F470442
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 626 | 336 | 594 | 121 |
Family's Representative Sequence
| Representative Sequence | 3300005539|Ga0068853_100636316|Ga0068853_1006363161 |
| Length | 144 |
| Sequence | MGGPDKPGHDGSQNFGPQLREIAMRFTKDHEWVEVDGDVATVGITAYAAEQLGDVVFVETPEVGKTVKAGDGFAVVESVKAASDVYAPISGEVVEANGILGNSPETVNAAPEAAGWFAKVKLANPAEVEALMDRPAYEAFLQTL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231221 | Azospirillum lipoferum 4B | Isolate | Rhizosphere |
| 2 | 2582581279 | Caulobacter henricii OK261 | Isolate | Rhizosphere |
| 3 | 2582581280 | Caulobacter henricii CF287 | Isolate | Rhizosphere |
| 4 | 2582581293 | Caulobacter henricii YR570 | Isolate | Rhizosphere |
| 5 | 2585428094 | Herbiconiux sp. YR403 | Isolate | Rhizosphere |
| 6 | 2585428106 | Caulobacter sp. OV484 | Isolate | Rhizosphere |
| 7 | 2643221552 | Caulobacter sp. Root1472 | Isolate | Unclassified |
| 8 | 2643221584 | Caulobacter sp. Root656 | Isolate | Unclassified |
| 9 | 2643221598 | Phenylobacterium sp. Root700 | Isolate | Unclassified |
| 10 | 2643221614 | Phenylobacterium sp. Root77 | Isolate | Unclassified |
| 11 | 2643221622 | Sphingomonas sp. Root241 | Isolate | Unclassified |
| 12 | 2643221640 | Caulobacter sp. Root342 | Isolate | Unclassified |
| 13 | 2643221642 | Caulobacter sp. Root343 | Isolate | Unclassified |
| 14 | 2643221649 | Leifsonia sp. Root4 | Isolate | Unclassified |
| 15 | 2643221661 | Phenylobacterium sp. Root1277 | Isolate | Unclassified |
| 16 | 2643221666 | Phenylobacterium sp. Root1290 | Isolate | Unclassified |
| 17 | 2791355048 | Caulobacter flavus CGMCC1 15093 | Isolate | Rhizosphere |
| 18 | 2818991435 | Caulobacter henricii 536 | Isolate | Unclassified |
| 19 | 2818991454 | Caulobacter rhizosphaerae 3260 | Isolate | Rhizosphere |
| 20 | 2818991466 | Sphingomonas trueperi 1152a | Isolate | Unclassified |
| 21 | 2843744320 | Caulobacter flavus RHGG3 | Isolate | Unclassified |
| 22 | 2849560528 | Caulobacter zeae 410 | Isolate | Unclassified |
| 23 | 2849573788 | Caulobacter endophyticus 774 | Isolate | Unclassified |
| 24 | 2851153111 | Caulobacter radicis 736 | Isolate | Unclassified |
| 25 | 2879163058 | Sphingomonas pokkalii L3B27 | Isolate | Rhizosphere |
| 26 | 2884960567 | Caulobacter sp. 602-1 | Isolate | Rhizosphere |
| 27 | 2891395885 | Microbispora catharanthi CR1-09 | Isolate | Unclassified |
| 28 | 2891554331 | Microbispora sp. CL1-1 | Isolate | Unclassified |
| 29 | 2898329390 | Caulobacter sp. 602-2 | Isolate | Rhizosphere |
| 30 | 2928531327 | Caulobacter sp. 1776 | Isolate | Rhizosphere |
| 31 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 32 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 33 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 34 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 35 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 36 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 37 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 38 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 39 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 40 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 41 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 42 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 43 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 44 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 51 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 53 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 64 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 65 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 67 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 68 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 74 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 76 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 77 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 78 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 79 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 80 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 81 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 82 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 83 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 84 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 85 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 86 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 87 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 89 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 90 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 91 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009979 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG | Metagenome | Rhizosphere |
| 104 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 114 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 118 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 119 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 120 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 122 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 123 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 124 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 126 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 127 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 129 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 172 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 173 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 174 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 175 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 176 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 177 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 178 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 179 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 180 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 181 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 182 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 183 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 184 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 185 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 186 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 187 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 188 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 189 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 190 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 191 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 192 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 193 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 194 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 195 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 196 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 197 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 198 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 199 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 200 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 201 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 202 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 203 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 204 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 205 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 206 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 207 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 208 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 209 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 210 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 211 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 212 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 213 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 214 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 215 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 216 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 217 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 218 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 219 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 220 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 221 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 222 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 223 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 224 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 225 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 226 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 227 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 266 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 267 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 268 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 269 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 270 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 271 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 272 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 273 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 274 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 275 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 276 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 277 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 278 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 279 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 280 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 281 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 282 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 283 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 284 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 299 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 304 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 305 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 307 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 309 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 310 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 311 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 312 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 313 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 314 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 315 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 316 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 317 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 318 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 319 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 320 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 321 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 322 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 323 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 324 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 325 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 326 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 327 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 328 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 329 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 330 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 331 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 332 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 333 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 334 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 335 | 8046352972 | Agromyces mangrovi NBRC 112812 | Isolate | Rhizosphere |
| 336 | 8054002106 | Azospirillum lipoferum 59b | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.89 |
| Metatranscriptomes | 0 |
| Isolates | 5.11 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 17.09 |
| Nodule | 0 |
| Rhizoplane | 4.47 |
| Rhizosphere | 70.45 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.99 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | ARcpr5oldR_c009756 | 3300000041 | Bacteria | 815 |
| 2 | ARcpr5yngRDRAFT_c009901 | 3300000043 | Bacteria | 812 |
| 3 | JGI25150J39212_1025331 | 3300002774 | Bacteria | 867 |
| 4 | JGI25153J46596_10019850 | 3300003215 | Bacteria | 2559 |
| 5 | JGI25153J46596_10038049 | 3300003215 | Bacteria | 1522 |
| 6 | JGI25153J46596_10086712 | 3300003215 | Bacteria | 766 |
| 7 | Ga0055526_1013317 | 3300003771 | Bacteria | 3490 |
| 8 | Ga0055526_1063969 | 3300003771 | Bacteria | 772 |
| 9 | Ga0055537_1001374 | 3300003773 | Bacteria | 9739 |
| 10 | Ga0055537_1008763 | 3300003773 | Bacteria | 2297 |
| 11 | Ga0055524_1001543 | 3300003775 | Bacteria | 13030 |
| 12 | Ga0055524_1005141 | 3300003775 | Bacteria | 5908 |
| 13 | Ga0055524_1026703 | 3300003775 | Bacteria | 1776 |
| 14 | Ga0055524_1055908 | 3300003775 | Bacteria | 853 |
| 15 | Ga0055536_1000905 | 3300003781 | Bacteria | 19181 |
| 16 | Ga0055536_1000910 | 3300003781 | Bacteria | 19125 |
| 17 | Ga0055528_1009105 | 3300003790 | Bacteria | 4185 |
| 18 | Ga0055528_1096392 | 3300003790 | Bacteria | 503 |
| 19 | Ga0055530_10000596 | 3300003791 | Bacteria | 31254 |
| 20 | Ga0055530_10009556 | 3300003791 | Bacteria | 3710 |
| 21 | Ga0055530_10035865 | 3300003791 | Bacteria | 1253 |
| 22 | Ga0055531_10000012 | 3300003794 | Bacteria | 191187 |
| 23 | Ga0055531_10001326 | 3300003794 | Bacteria | 18512 |
| 24 | Ga0055531_10001529 | 3300003794 | Bacteria | 16949 |
| 25 | Ga0055531_10003074 | 3300003794 | Bacteria | 10794 |
| 26 | Ga0065165_1003707 | 3300005262 | Bacteria | 10348 |
| 27 | Ga0065165_1113718 | 3300005262 | Bacteria | 663 |
| 28 | Ga0065707_10939732 | 3300005295 | Bacteria | 555 |
| 29 | Ga0070658_10242366 | 3300005327 | Bacteria | 1528 |
| 30 | Ga0070658_10276590 | 3300005327 | Bacteria | 1428 |
| 31 | Ga0070658_10400212 | 3300005327 | Bacteria | 1179 |
| 32 | Ga0070683_101085838 | 3300005329 | Bacteria | 769 |
| 33 | Ga0070683_102057462 | 3300005329 | Bacteria | 548 |
| 34 | Ga0070670_100000032 | 3300005331 | Bacteria | 158514 |
| 35 | Ga0070670_100518115 | 3300005331 | Bacteria | 1062 |
| 36 | Ga0070677_10482366 | 3300005333 | Bacteria | 669 |
| 37 | Ga0070666_10032870 | 3300005335 | Bacteria | 3429 |
| 38 | Ga0070666_10268620 | 3300005335 | Bacteria | 1210 |
| 39 | Ga0070666_10539802 | 3300005335 | Bacteria | 848 |
| 40 | Ga0070680_100029974 | 3300005336 | Bacteria | 4368 |
| 41 | Ga0068868_100138306 | 3300005338 | Bacteria | 1998 |
| 42 | Ga0070660_100902960 | 3300005339 | Bacteria | 745 |
| 43 | Ga0070689_101398716 | 3300005340 | Bacteria | 632 |
| 44 | Ga0070691_10012155 | 3300005341 | Bacteria | 3942 |
| 45 | Ga0070661_100125835 | 3300005344 | Bacteria | 1923 |
| 46 | Ga0070668_100000702 | 3300005347 | Bacteria | 22873 |
| 47 | Ga0070668_100005927 | 3300005347 | Bacteria | 9057 |
| 48 | Ga0070668_100008316 | 3300005347 | Bacteria | 7703 |
| 49 | Ga0070668_100111636 | 3300005347 | Bacteria | 2176 |
| 50 | Ga0070668_100326803 | 3300005347 | Bacteria | 1292 |
| 51 | Ga0070671_100078320 | 3300005355 | Bacteria | 2763 |
| 52 | Ga0070671_100158098 | 3300005355 | Bacteria | 1915 |
| 53 | Ga0070671_100517686 | 3300005355 | Bacteria | 1027 |
| 54 | Ga0070673_100147028 | 3300005364 | Bacteria | 1993 |
| 55 | Ga0070659_100001930 | 3300005366 | Bacteria | 14815 |
| 56 | Ga0070659_100004321 | 3300005366 | Bacteria | 10146 |
| 57 | Ga0070667_100000387 | 3300005367 | Bacteria | 47707 |
| 58 | Ga0070667_100817494 | 3300005367 | Bacteria | 865 |
| 59 | Ga0070667_100833523 | 3300005367 | Bacteria | 857 |
| 60 | Ga0070667_101327588 | 3300005367 | Bacteria | 674 |
| 61 | Ga0070705_100470954 | 3300005440 | Bacteria | 947 |
| 62 | Ga0070705_101811799 | 3300005440 | Bacteria | 518 |
| 63 | Ga0070678_100132952 | 3300005456 | Bacteria | 1980 |
| 64 | Ga0070662_100230211 | 3300005457 | Bacteria | 1482 |
| 65 | Ga0070662_100302017 | 3300005457 | Bacteria | 1301 |
| 66 | Ga0070681_10563906 | 3300005458 | Bacteria | 1052 |
| 67 | Ga0068867_101138848 | 3300005459 | Bacteria | 714 |
| 68 | Ga0070685_10957329 | 3300005466 | Bacteria | 640 |
| 69 | Ga0070679_100040495 | 3300005530 | Bacteria | 4635 |
| 70 | Ga0070679_101528034 | 3300005530 | Bacteria | 615 |
| 71 | Ga0068853_100003476 | 3300005539 | Bacteria | 12049 |
| 72 | Ga0068853_100393618 | 3300005539 | Bacteria | 1296 |
| 73 | Ga0068853_100496449 | 3300005539 | Bacteria | 1152 |
| 74 | Ga0068853_100636316 | 3300005539 | Bacteria | 1014 |
| 75 | Ga0070686_100346285 | 3300005544 | Bacteria | 1115 |
| 76 | Ga0070696_100570328 | 3300005546 | Bacteria | 909 |
| 77 | Ga0070696_100913029 | 3300005546 | Bacteria | 729 |
| 78 | Ga0070693_100718873 | 3300005547 | Bacteria | 733 |
| 79 | Ga0070665_100000136 | 3300005548 | Bacteria | 138094 |
| 80 | Ga0070665_100001151 | 3300005548 | Bacteria | 32520 |
| 81 | Ga0070665_101372920 | 3300005548 | Bacteria | 716 |
| 82 | Ga0070704_100638592 | 3300005549 | Bacteria | 939 |
| 83 | Ga0070704_101631454 | 3300005549 | Bacteria | 595 |
| 84 | Ga0068855_100097020 | 3300005563 | Bacteria | 3395 |
| 85 | Ga0068855_100147645 | 3300005563 | Bacteria | 2675 |
| 86 | Ga0068855_100327833 | 3300005563 | Bacteria | 1691 |
| 87 | Ga0068855_100820023 | 3300005563 | Bacteria | 988 |
| 88 | Ga0070664_100932410 | 3300005564 | Bacteria | 815 |
| 89 | Ga0068857_100298544 | 3300005577 | Bacteria | 1485 |
| 90 | Ga0068857_102251207 | 3300005577 | Bacteria | 535 |
| 91 | Ga0068854_101752688 | 3300005578 | Bacteria | 569 |
| 92 | Ga0068856_100351334 | 3300005614 | Bacteria | 1493 |
| 93 | Ga0068856_101743438 | 3300005614 | Bacteria | 635 |
| 94 | Ga0068859_100042143 | 3300005617 | Bacteria | 4585 |
| 95 | Ga0068859_100128836 | 3300005617 | Bacteria | 2601 |
| 96 | Ga0068859_101422116 | 3300005617 | Bacteria | 765 |
| 97 | Ga0068864_100000491 | 3300005618 | Bacteria | 34223 |
| 98 | Ga0068864_100001848 | 3300005618 | Bacteria | 17418 |
| 99 | Ga0068864_100065251 | 3300005618 | Bacteria | 3158 |
| 100 | Ga0068864_100443278 | 3300005618 | Bacteria | 1241 |
| 101 | Ga0068864_101359056 | 3300005618 | Bacteria | 712 |
| 102 | Ga0068861_100406812 | 3300005719 | Bacteria | 1209 |
| 103 | Ga0068861_101378140 | 3300005719 | Bacteria | 688 |
| 104 | Ga0068863_100004096 | 3300005841 | Bacteria | 14401 |
| 105 | Ga0068863_100005840 | 3300005841 | Bacteria | 12058 |
| 106 | Ga0068863_100560702 | 3300005841 | Bacteria | 1128 |
| 107 | Ga0068863_101378577 | 3300005841 | Bacteria | 713 |
| 108 | Ga0068863_102520841 | 3300005841 | Bacteria | 523 |
| 109 | Ga0068858_100012067 | 3300005842 | Bacteria | 8142 |
| 110 | Ga0068858_100044239 | 3300005842 | Bacteria | 4128 |
| 111 | Ga0068858_100469579 | 3300005842 | Bacteria | 1214 |
| 112 | Ga0068858_101451656 | 3300005842 | Bacteria | 676 |
| 113 | Ga0068860_100000100 | 3300005843 | Bacteria | 144580 |
| 114 | Ga0068860_100000167 | 3300005843 | Bacteria | 108234 |
| 115 | Ga0068862_100117199 | 3300005844 | Bacteria | 2343 |
| 116 | Ga0068862_100230870 | 3300005844 | Bacteria | 1679 |
| 117 | Ga0068862_100341966 | 3300005844 | Bacteria | 1386 |
| 118 | Ga0068862_100347893 | 3300005844 | Bacteria | 1374 |
| 119 | Ga0075369_10001997 | 3300006186 | Bacteria | 7178 |
| 120 | Ga0075366_10014506 | 3300006195 | Bacteria | 4500 |
| 121 | Ga0075366_10169386 | 3300006195 | Bacteria | 1325 |
| 122 | Ga0097621_101822345 | 3300006237 | Bacteria | 580 |
| 123 | Ga0075370_10141327 | 3300006353 | Bacteria | 1407 |
| 124 | Ga0075370_10153795 | 3300006353 | Bacteria | 1348 |
| 125 | Ga0068871_100819917 | 3300006358 | Bacteria | 859 |
| 126 | Ga0068865_100000195 | 3300006881 | Bacteria | 33732 |
| 127 | Ga0097620_100042143 | 3300006931 | Bacteria | 4585 |
| 128 | Ga0097620_100128817 | 3300006931 | Bacteria | 2601 |
| 129 | Ga0097620_101422433 | 3300006931 | Bacteria | 765 |
| 130 | Ga0105250_10010734 | 3300009092 | Bacteria | 3811 |
| 131 | Ga0105240_10000581 | 3300009093 | Bacteria | 67884 |
| 132 | Ga0105240_10008814 | 3300009093 | Bacteria | 14369 |
| 133 | Ga0105240_10038728 | 3300009093 | Bacteria | 6112 |
| 134 | Ga0105240_10449085 | 3300009093 | Bacteria | 1443 |
| 135 | Ga0105240_11370457 | 3300009093 | Bacteria | 744 |
| 136 | Ga0105240_12070353 | 3300009093 | Bacteria | 591 |
| 137 | Ga0105240_12618992 | 3300009093 | Bacteria | 521 |
| 138 | Ga0111539_11574640 | 3300009094 | Bacteria | 762 |
| 139 | Ga0105245_10213735 | 3300009098 | Bacteria | 1857 |
| 140 | Ga0105247_10198741 | 3300009101 | Bacteria | 1346 |
| 141 | Ga0105241_12283228 | 3300009174 | Bacteria | 538 |
| 142 | Ga0105242_12517972 | 3300009176 | Bacteria | 563 |
| 143 | Ga0105248_10003790 | 3300009177 | Bacteria | 16748 |
| 144 | Ga0105248_10286267 | 3300009177 | Bacteria | 1855 |
| 145 | Ga0105248_11091965 | 3300009177 | Bacteria | 902 |
| 146 | Ga0105248_11227002 | 3300009177 | Bacteria | 848 |
| 147 | Ga0105248_11334453 | 3300009177 | Bacteria | 811 |
| 148 | Ga0105248_11605552 | 3300009177 | Bacteria | 737 |
| 149 | Ga0105248_11873537 | 3300009177 | Bacteria | 680 |
| 150 | Ga0105237_10527250 | 3300009545 | Bacteria | 1188 |
| 151 | Ga0105238_10007249 | 3300009551 | Bacteria | 11101 |
| 152 | Ga0105238_10700955 | 3300009551 | Bacteria | 1024 |
| 153 | Ga0105238_10748753 | 3300009551 | Bacteria | 991 |
| 154 | Ga0105238_11984477 | 3300009551 | Bacteria | 615 |
| 155 | Ga0105238_12366078 | 3300009551 | Bacteria | 567 |
| 156 | Ga0105249_10001354 | 3300009553 | Bacteria | 21412 |
| 157 | Ga0105249_10215538 | 3300009553 | Bacteria | 1887 |
| 158 | Ga0105032_101996 | 3300009979 | Bacteria | 1845 |
| 159 | Ga0105239_10496336 | 3300010375 | Bacteria | 1388 |
| 160 | Ga0105239_12162199 | 3300010375 | Bacteria | 647 |
| 161 | Ga0105239_12670659 | 3300010375 | Bacteria | 583 |
| 162 | Ga0157373_10003677 | 3300013100 | Bacteria | 11602 |
| 163 | Ga0157373_10037336 | 3300013100 | Bacteria | 3483 |
| 164 | Ga0157370_10355448 | 3300013104 | Bacteria | 1350 |
| 165 | Ga0157369_10328289 | 3300013105 | Bacteria | 1590 |
| 166 | Ga0157369_11514069 | 3300013105 | Bacteria | 682 |
| 167 | Ga0163162_10060119 | 3300013306 | Bacteria | 3834 |
| 168 | Ga0163162_10214864 | 3300013306 | Bacteria | 2053 |
| 169 | Ga0163162_11304738 | 3300013306 | Bacteria | 825 |
| 170 | Ga0157372_11479643 | 3300013307 | Bacteria | 782 |
| 171 | Ga0157375_10224663 | 3300013308 | Bacteria | 2037 |
| 172 | Ga0157375_11116199 | 3300013308 | Bacteria | 923 |
| 173 | Ga0163163_10045475 | 3300014325 | Bacteria | 4309 |
| 174 | Ga0163163_10120681 | 3300014325 | Bacteria | 2655 |
| 175 | Ga0163163_10122100 | 3300014325 | Bacteria | 2639 |
| 176 | Ga0163163_10371871 | 3300014325 | Bacteria | 1486 |
| 177 | Ga0163163_10542448 | 3300014325 | Bacteria | 1225 |
| 178 | Ga0157380_11801877 | 3300014326 | Bacteria | 671 |
| 179 | Ga0182008_10255553 | 3300014497 | Bacteria | 905 |
| 180 | Ga0157379_10149251 | 3300014968 | Bacteria | 2109 |
| 181 | Ga0157376_10405847 | 3300014969 | Bacteria | 1319 |
| 182 | Ga0163161_10207934 | 3300017792 | Bacteria | 1511 |
| 183 | Ga0163161_11082300 | 3300017792 | Bacteria | 688 |
| 184 | Ga0163161_11737738 | 3300017792 | Bacteria | 553 |
| 185 | Ga0213876_10015657 | 3300021384 | Bacteria | 4014 |
| 186 | Ga0213875_10100446 | 3300021388 | Bacteria | 1350 |
| 187 | Ga0207425_1009019 | 3300025245 | Bacteria | 2509 |
| 188 | Ga0209148_1030050 | 3300025254 | Bacteria | 817 |
| 189 | Ga0209565_1000030 | 3300025263 | Bacteria | 325058 |
| 190 | Ga0209565_1000552 | 3300025263 | Bacteria | 26049 |
| 191 | Ga0209673_1000768 | 3300025273 | Bacteria | 43336 |
| 192 | Ga0209673_1036209 | 3300025273 | Bacteria | 1468 |
| 193 | Ga0209675_1002582 | 3300025291 | Bacteria | 9191 |
| 194 | Ga0209675_1043525 | 3300025291 | Bacteria | 966 |
| 195 | Ga0209676_1000043 | 3300025292 | Bacteria | 418680 |
| 196 | Ga0209676_1000392 | 3300025292 | Bacteria | 79950 |
| 197 | Ga0209564_1003574 | 3300025295 | Bacteria | 10395 |
| 198 | Ga0209564_1022562 | 3300025295 | Bacteria | 2219 |
| 199 | Ga0209564_1028726 | 3300025295 | Bacteria | 1768 |
| 200 | Ga0209758_1004179 | 3300025297 | Bacteria | 12271 |
| 201 | Ga0209758_1006159 | 3300025297 | Bacteria | 8785 |
| 202 | Ga0209758_1023081 | 3300025297 | Bacteria | 2826 |
| 203 | Ga0209050_1000039 | 3300025298 | Bacteria | 410069 |
| 204 | Ga0209050_1001794 | 3300025298 | Bacteria | 21075 |
| 205 | Ga0209050_1001959 | 3300025298 | Bacteria | 19483 |
| 206 | Ga0209050_1023621 | 3300025298 | Bacteria | 2156 |
| 207 | Ga0209050_1026711 | 3300025298 | Bacteria | 1924 |
| 208 | Ga0209256_1000046 | 3300025299 | Bacteria | 325040 |
| 209 | Ga0209256_1001825 | 3300025299 | Bacteria | 19903 |
| 210 | Ga0209256_1004214 | 3300025299 | Bacteria | 9233 |
| 211 | Ga0209256_1009352 | 3300025299 | Bacteria | 4318 |
| 212 | Ga0209051_1002664 | 3300025303 | Bacteria | 12491 |
| 213 | Ga0209257_1000051 | 3300025304 | Bacteria | 434166 |
| 214 | Ga0209257_1000186 | 3300025304 | Bacteria | 154365 |
| 215 | Ga0209257_1000533 | 3300025304 | Bacteria | 66037 |
| 216 | Ga0209257_1000616 | 3300025304 | Bacteria | 57900 |
| 217 | Ga0209257_1009235 | 3300025304 | Bacteria | 5344 |
| 218 | Ga0207696_1070448 | 3300025711 | Bacteria | 972 |
| 219 | Ga0207680_10481387 | 3300025903 | Bacteria | 883 |
| 220 | Ga0207645_10488724 | 3300025907 | Bacteria | 833 |
| 221 | Ga0207705_10016114 | 3300025909 | Bacteria | 5362 |
| 222 | Ga0207705_10158546 | 3300025909 | Bacteria | 1699 |
| 223 | Ga0207705_10586000 | 3300025909 | Bacteria | 867 |
| 224 | Ga0207707_10153412 | 3300025912 | Bacteria | 2014 |
| 225 | Ga0207695_10000595 | 3300025913 | Bacteria | 72573 |
| 226 | Ga0207695_10001322 | 3300025913 | Bacteria | 42020 |
| 227 | Ga0207695_10004246 | 3300025913 | Bacteria | 19682 |
| 228 | Ga0207695_10027094 | 3300025913 | Bacteria | 6384 |
| 229 | Ga0207695_10140957 | 3300025913 | Bacteria | 2359 |
| 230 | Ga0207671_10061666 | 3300025914 | Bacteria | 2783 |
| 231 | Ga0207671_10720305 | 3300025914 | Bacteria | 793 |
| 232 | Ga0207660_10002459 | 3300025917 | Bacteria | 12167 |
| 233 | Ga0207657_10001400 | 3300025919 | Bacteria | 25701 |
| 234 | Ga0207657_10630268 | 3300025919 | Bacteria | 835 |
| 235 | Ga0207649_10163310 | 3300025920 | Bacteria | 1545 |
| 236 | Ga0207649_10739020 | 3300025920 | Bacteria | 765 |
| 237 | Ga0207652_10006051 | 3300025921 | Bacteria | 9792 |
| 238 | Ga0207652_10435873 | 3300025921 | Bacteria | 1182 |
| 239 | Ga0207681_10196104 | 3300025923 | Bacteria | 1548 |
| 240 | Ga0207681_10232733 | 3300025923 | Bacteria | 1431 |
| 241 | Ga0207681_10954435 | 3300025923 | Bacteria | 719 |
| 242 | Ga0207694_10086016 | 3300025924 | Bacteria | 2475 |
| 243 | Ga0207694_10112362 | 3300025924 | Bacteria | 2168 |
| 244 | Ga0207694_10218073 | 3300025924 | Bacteria | 1555 |
| 245 | Ga0207694_10918490 | 3300025924 | Bacteria | 740 |
| 246 | Ga0207694_11302121 | 3300025924 | Bacteria | 615 |
| 247 | Ga0207694_11871296 | 3300025924 | Bacteria | 504 |
| 248 | Ga0207650_10000074 | 3300025925 | Bacteria | 134837 |
| 249 | Ga0207650_10116804 | 3300025925 | Bacteria | 2072 |
| 250 | Ga0207650_10209839 | 3300025925 | Bacteria | 1564 |
| 251 | Ga0207650_10266150 | 3300025925 | Bacteria | 1392 |
| 252 | Ga0207650_10987671 | 3300025925 | Bacteria | 716 |
| 253 | Ga0207687_10259178 | 3300025927 | Bacteria | 1385 |
| 254 | Ga0207644_10389609 | 3300025931 | Bacteria | 1137 |
| 255 | Ga0207690_10144289 | 3300025932 | Bacteria | 1758 |
| 256 | Ga0207690_10867813 | 3300025932 | Bacteria | 748 |
| 257 | Ga0207706_10029362 | 3300025933 | Bacteria | 4909 |
| 258 | Ga0207686_11388843 | 3300025934 | Bacteria | 578 |
| 259 | Ga0207704_10016516 | 3300025938 | Bacteria | 3795 |
| 260 | Ga0207711_10001500 | 3300025941 | Bacteria | 21752 |
| 261 | Ga0207711_10324816 | 3300025941 | Bacteria | 1422 |
| 262 | Ga0207711_10436626 | 3300025941 | Bacteria | 1218 |
| 263 | Ga0207711_10838868 | 3300025941 | Bacteria | 855 |
| 264 | Ga0207711_10921967 | 3300025941 | Bacteria | 812 |
| 265 | Ga0207711_11953526 | 3300025941 | Bacteria | 530 |
| 266 | Ga0207679_10019722 | 3300025945 | Bacteria | 4538 |
| 267 | Ga0207679_10439140 | 3300025945 | Bacteria | 1155 |
| 268 | Ga0207667_10054152 | 3300025949 | Bacteria | 4220 |
| 269 | Ga0207667_10061067 | 3300025949 | Bacteria | 3944 |
| 270 | Ga0207667_10429810 | 3300025949 | Bacteria | 1343 |
| 271 | Ga0207667_10588797 | 3300025949 | Bacteria | 1122 |
| 272 | Ga0207667_10827552 | 3300025949 | Bacteria | 921 |
| 273 | Ga0207651_10185558 | 3300025960 | Bacteria | 1654 |
| 274 | Ga0207712_10011454 | 3300025961 | Bacteria | 5648 |
| 275 | Ga0207712_10138362 | 3300025961 | Bacteria | 1865 |
| 276 | Ga0207668_10000093 | 3300025972 | Bacteria | 64280 |
| 277 | Ga0207668_10002915 | 3300025972 | Bacteria | 10040 |
| 278 | Ga0207668_10015103 | 3300025972 | Bacteria | 4793 |
| 279 | Ga0207668_10407039 | 3300025972 | Bacteria | 1151 |
| 280 | Ga0207668_10471148 | 3300025972 | Bacteria | 1075 |
| 281 | Ga0207640_10263297 | 3300025981 | Bacteria | 1345 |
| 282 | Ga0207640_10535988 | 3300025981 | Bacteria | 981 |
| 283 | Ga0207658_10000266 | 3300025986 | Bacteria | 55102 |
| 284 | Ga0207658_10020936 | 3300025986 | Bacteria | 4533 |
| 285 | Ga0207658_10603174 | 3300025986 | Bacteria | 986 |
| 286 | Ga0207658_11189273 | 3300025986 | Bacteria | 697 |
| 287 | Ga0207658_12115324 | 3300025986 | Bacteria | 511 |
| 288 | Ga0207703_10001734 | 3300026035 | Bacteria | 19606 |
| 289 | Ga0207703_10005822 | 3300026035 | Bacteria | 9873 |
| 290 | Ga0207703_10157248 | 3300026035 | Bacteria | 1988 |
| 291 | Ga0207703_10523962 | 3300026035 | Bacteria | 1115 |
| 292 | Ga0207639_10008239 | 3300026041 | Bacteria | 7138 |
| 293 | Ga0207639_10383425 | 3300026041 | Bacteria | 1263 |
| 294 | Ga0207639_10605062 | 3300026041 | Bacteria | 1011 |
| 295 | Ga0207702_10570866 | 3300026078 | Bacteria | 1108 |
| 296 | Ga0207702_10725094 | 3300026078 | Bacteria | 980 |
| 297 | Ga0207702_10789418 | 3300026078 | Bacteria | 938 |
| 298 | Ga0207641_10004778 | 3300026088 | Bacteria | 11683 |
| 299 | Ga0207641_10008000 | 3300026088 | Bacteria | 8763 |
| 300 | Ga0207641_10550218 | 3300026088 | Bacteria | 1125 |
| 301 | Ga0207641_10897052 | 3300026088 | Bacteria | 880 |
| 302 | Ga0207641_11405232 | 3300026088 | Bacteria | 699 |
| 303 | Ga0207676_10003303 | 3300026095 | Bacteria | 11450 |
| 304 | Ga0207676_10003513 | 3300026095 | Bacteria | 11090 |
| 305 | Ga0207676_10003975 | 3300026095 | Bacteria | 10431 |
| 306 | Ga0207674_10091603 | 3300026116 | Bacteria | 3030 |
| 307 | Ga0207675_100311305 | 3300026118 | Bacteria | 1536 |
| 308 | Ga0207675_100671105 | 3300026118 | Bacteria | 1044 |
| 309 | Ga0207675_101316988 | 3300026118 | Bacteria | 743 |
| 310 | Ga0207683_10175967 | 3300026121 | Bacteria | 1939 |
| 311 | Ga0207683_10282675 | 3300026121 | Bacteria | 1516 |
| 312 | Ga0207698_11023948 | 3300026142 | Bacteria | 837 |
| 313 | Ga0268266_10000003 | 3300028379 | Bacteria | 1701703 |
| 314 | Ga0268266_10006422 | 3300028379 | Bacteria | 10768 |
| 315 | Ga0268266_11153308 | 3300028379 | Bacteria | 750 |
| 316 | Ga0268266_11171129 | 3300028379 | Bacteria | 743 |
| 317 | Ga0268265_10000648 | 3300028380 | Bacteria | 34549 |
| 318 | Ga0268265_10003084 | 3300028380 | Bacteria | 12164 |
| 319 | Ga0268265_10130801 | 3300028380 | Bacteria | 2085 |
| 320 | Ga0268265_10148036 | 3300028380 | Bacteria | 1976 |
| 321 | Ga0268264_10000002 | 3300028381 | Bacteria | 1153045 |
| 322 | Ga0268264_10000068 | 3300028381 | Bacteria | 275708 |
| 323 | Ga0265319_1001009 | 3300028563 | Bacteria | 17574 |
| 324 | Ga0265334_10093185 | 3300028573 | Bacteria | 1097 |
| 325 | Ga0265318_10042001 | 3300028577 | Bacteria | 1736 |
| 326 | Ga0265318_10136114 | 3300028577 | Bacteria | 903 |
| 327 | Ga0265318_10139953 | 3300028577 | Bacteria | 889 |
| 328 | Ga0265323_10188927 | 3300028653 | Bacteria | 650 |
| 329 | Ga0265336_10033290 | 3300028666 | Bacteria | 1596 |
| 330 | Ga0265336_10090801 | 3300028666 | Bacteria | 910 |
| 331 | Ga0307517_10023613 | 3300028786 | Bacteria | 7632 |
| 332 | Ga0307517_10102272 | 3300028786 | Bacteria | 2248 |
| 333 | Ga0307515_10088331 | 3300028794 | Bacteria | 3919 |
| 334 | Ga0307515_10148947 | 3300028794 | Bacteria | 2459 |
| 335 | Ga0265338_10035691 | 3300028800 | Bacteria | 4771 |
| 336 | Ga0265338_10064888 | 3300028800 | Bacteria | 3172 |
| 337 | Ga0265338_10119548 | 3300028800 | Bacteria | 2103 |
| 338 | Ga0265338_10172613 | 3300028800 | Bacteria | 1656 |
| 339 | Ga0265330_10339093 | 3300031235 | Bacteria | 635 |
| 340 | Ga0265332_10092820 | 3300031238 | Bacteria | 1276 |
| 341 | Ga0265320_10027367 | 3300031240 | Bacteria | 2973 |
| 342 | Ga0265320_10066321 | 3300031240 | Bacteria | 1711 |
| 343 | Ga0265340_10022802 | 3300031247 | Bacteria | 3197 |
| 344 | Ga0265339_10188401 | 3300031249 | Bacteria | 1024 |
| 345 | Ga0265331_10013895 | 3300031250 | Bacteria | 4307 |
| 346 | Ga0265327_10005457 | 3300031251 | Bacteria | 10606 |
| 347 | Ga0265316_10588434 | 3300031344 | Bacteria | 790 |
| 348 | Ga0265316_10931542 | 3300031344 | Bacteria | 606 |
| 349 | Ga0307513_10001689 | 3300031456 | Bacteria | 31587 |
| 350 | Ga0307513_10012006 | 3300031456 | Bacteria | 10723 |
| 351 | Ga0307513_10019458 | 3300031456 | Bacteria | 8083 |
| 352 | Ga0307408_100172102 | 3300031548 | Bacteria | 1730 |
| 353 | Ga0307508_10587866 | 3300031616 | Bacteria | 714 |
| 354 | Ga0265342_10181535 | 3300031712 | Bacteria | 1152 |
| 355 | Ga0307516_10002970 | 3300031730 | Bacteria | 22191 |
| 356 | Ga0307405_11935990 | 3300031731 | Bacteria | 526 |
| 357 | Ga0307413_11582712 | 3300031824 | Bacteria | 581 |
| 358 | Ga0307406_10165441 | 3300031901 | Bacteria | 1595 |
| 359 | Ga0307406_10893511 | 3300031901 | Bacteria | 756 |
| 360 | Ga0307406_11245889 | 3300031901 | Bacteria | 647 |
| 361 | Ga0307412_10720252 | 3300031911 | Bacteria | 858 |
| 362 | Ga0307412_11178837 | 3300031911 | Bacteria | 685 |
| 363 | Ga0307409_102041013 | 3300031995 | Bacteria | 603 |
| 364 | Ga0307416_100346055 | 3300032002 | Bacteria | 1502 |
| 365 | Ga0307414_11861759 | 3300032004 | Bacteria | 561 |
| 366 | Ga0307510_10091868 | 3300033180 | Bacteria | 2875 |
| 367 | Ga0307510_10605315 | 3300033180 | Bacteria | 548 |
| 368 | Ga0373944_0047566 | 3300035089 | Bacteria | 1344 |
| 369 | Ga0373932_0309369 | 3300035112 | Bacteria | 592 |
| 370 | Ga0373936_0012346 | 3300035113 | Bacteria | 3249 |
| 371 | Ga0373935_0840883 | 3300035692 | Bacteria | 679 |
| 372 | Ga0373935_0871416 | 3300035692 | Bacteria | 666 |
| 373 | Ga0373935_1095332 | 3300035692 | Bacteria | 593 |
| 374 | Ga0373927_0000886 | 3300035695 | Bacteria | 22786 |
| 375 | Ga0373925_0000160 | 3300037068 | Bacteria | 72172 |
| 376 | Ga0395899_0000260 | 3300037312 | Bacteria | 69458 |
| 377 | Ga0395899_0065302 | 3300037312 | Bacteria | 2674 |
| 378 | Ga0395899_0172126 | 3300037312 | Bacteria | 1524 |
| 379 | Ga0395900_0000008 | 3300037418 | Bacteria | 480459 |
| 380 | Ga0395900_0045875 | 3300037418 | Bacteria | 4501 |
| 381 | Ga0395900_0185225 | 3300037418 | Bacteria | 2113 |
| 382 | Ga0395900_0375054 | 3300037418 | Bacteria | 1392 |
| 383 | Ga0395900_1322695 | 3300037418 | Bacteria | 634 |
| 384 | Ga0395898_0243013 | 3300037466 | Bacteria | 1717 |
| 385 | Ga0395898_0664133 | 3300037466 | Bacteria | 984 |
| 386 | Ga0395905_0002508 | 3300037471 | Bacteria | 20281 |
| 387 | Ga0395905_0011635 | 3300037471 | Bacteria | 8499 |
| 388 | Ga0436364_1032418 | 3300037853 | Bacteria | 1770 |
| 389 | Ga0395901_0000008 | 3300038443 | Bacteria | 495962 |
| 390 | Ga0395901_0547882 | 3300038443 | Bacteria | 1173 |
| 391 | Ga0395901_0785420 | 3300038443 | Bacteria | 942 |
| 392 | Ga0436365_0658056 | 3300039437 | Bacteria | 4484 |
| 393 | Ga0436365_1349197 | 3300039437 | Bacteria | 670 |
| 394 | Ga0436361_0314376 | 3300039447 | Bacteria | 17837 |
| 395 | Ga0436363_0351388 | 3300039450 | Bacteria | 1034 |
| 396 | Ga0436363_0665676 | 3300039450 | Bacteria | 532 |
| 397 | Ga0451789_0317317 | 3300041443 | Bacteria | 537 |
| 398 | Ga0451807_0397995 | 3300041486 | Bacteria | 898 |
| 399 | Ga0451835_0347279 | 3300041492 | Bacteria | 627 |
| 400 | Ga0451847_0643662 | 3300041503 | Bacteria | 817 |
| 401 | Ga0451853_1525706 | 3300041512 | Bacteria | 576 |
| 402 | Ga0439441_018014 | 3300042001 | Bacteria | 1274 |
| 403 | Ga0439435_0002352 | 3300042436 | Bacteria | 3737 |
| 404 | Ga0439444_0039228 | 3300042437 | Bacteria | 923 |
| 405 | Ga0439459_0002303 | 3300042438 | Bacteria | 2931 |
| 406 | Ga0451577_0900684 | 3300042876 | Unclassified | 796 |
| 407 | Ga0466957_1034745 | 3300044842 | Bacteria | 591 |
| 408 | Ga0466958_0658897 | 3300045836 | Bacteria | 682 |
| 409 | Ga0466958_0819632 | 3300045836 | Bacteria | 607 |
| 410 | Ga0495590_0001696 | 3300046457 | Bacteria | 9363 |
| 411 | Ga0495629_1011557 | 3300046459 | Bacteria | 541 |
| 412 | Ga0495638_0001383 | 3300046460 | Bacteria | 22119 |
| 413 | Ga0495638_0002620 | 3300046460 | Bacteria | 14480 |
| 414 | Ga0495638_0016210 | 3300046460 | Bacteria | 4995 |
| 415 | Ga0495650_0000024 | 3300046471 | Bacteria | 496674 |
| 416 | Ga0495585_0083463 | 3300046492 | Bacteria | 1729 |
| 417 | Ga0495607_0050793 | 3300046501 | Bacteria | 2412 |
| 418 | Ga0495583_0246547 | 3300046506 | Bacteria | 717 |
| 419 | Ga0495606_0004488 | 3300046507 | Bacteria | 13913 |
| 420 | Ga0495606_0229571 | 3300046507 | Bacteria | 1041 |
| 421 | Ga0495610_0012692 | 3300046512 | Bacteria | 5050 |
| 422 | Ga0495610_0098285 | 3300046512 | Bacteria | 1315 |
| 423 | Ga0495616_0007196 | 3300046513 | Bacteria | 6670 |
| 424 | Ga0495616_0072190 | 3300046513 | Bacteria | 1667 |
| 425 | Ga0495616_0146747 | 3300046513 | Bacteria | 1070 |
| 426 | Ga0495620_0021961 | 3300046515 | Bacteria | 3086 |
| 427 | Ga0495631_0000540 | 3300046518 | Bacteria | 25409 |
| 428 | Ga0495632_0003150 | 3300046519 | Bacteria | 11925 |
| 429 | Ga0495648_0000029 | 3300046524 | Bacteria | 223499 |
| 430 | Ga0495648_0094859 | 3300046524 | Bacteria | 1661 |
| 431 | Ga0495648_0380805 | 3300046524 | Bacteria | 636 |
| 432 | Ga0495648_0399852 | 3300046524 | Bacteria | 614 |
| 433 | Ga0495648_0509897 | 3300046524 | Bacteria | 514 |
| 434 | Ga0495663_0074096 | 3300046525 | Bacteria | 1088 |
| 435 | Ga0495642_0016600 | 3300046528 | Bacteria | 2872 |
| 436 | Ga0495654_0000226 | 3300046530 | Bacteria | 52630 |
| 437 | Ga0495654_0072563 | 3300046530 | Bacteria | 1629 |
| 438 | Ga0495665_0193677 | 3300046531 | Bacteria | 1055 |
| 439 | Ga0495587_0577130 | 3300046536 | Bacteria | 620 |
| 440 | Ga0495609_0193888 | 3300046538 | Bacteria | 851 |
| 441 | Ga0495597_0109881 | 3300046542 | Bacteria | 1156 |
| 442 | Ga0495597_0264264 | 3300046542 | Bacteria | 673 |
| 443 | Ga0495633_0117835 | 3300046558 | Bacteria | 1230 |
| 444 | Ga0495668_0000141 | 3300046616 | Bacteria | 108840 |
| 445 | Ga0495668_0011679 | 3300046616 | Bacteria | 5247 |
| 446 | Ga0495668_0037370 | 3300046616 | Bacteria | 2716 |
| 447 | Ga0495668_0047260 | 3300046616 | Bacteria | 2390 |
| 448 | Ga0495668_0084968 | 3300046616 | Bacteria | 1735 |
| 449 | Ga0495668_0112566 | 3300046616 | Bacteria | 1489 |
| 450 | Ga0495625_0085870 | 3300046660 | Bacteria | 2183 |
| 451 | Ga0495625_0087855 | 3300046660 | Bacteria | 2154 |
| 452 | Ga0495625_0090268 | 3300046660 | Bacteria | 2120 |
| 453 | Ga0495625_0099813 | 3300046660 | Bacteria | 1995 |
| 454 | Ga0495625_0204179 | 3300046660 | Bacteria | 1302 |
| 455 | Ga0495659_0226385 | 3300046664 | Bacteria | 773 |
| 456 | Ga0495659_0513534 | 3300046664 | Bacteria | 526 |
| 457 | Ga0495588_0048257 | 3300046674 | Bacteria | 2187 |
| 458 | Ga0495588_0265893 | 3300046674 | Bacteria | 904 |
| 459 | Ga0495599_0195290 | 3300046678 | Bacteria | 1244 |
| 460 | Ga0495658_0605069 | 3300046683 | Bacteria | 702 |
| 461 | Ga0495669_0000012 | 3300046684 | Bacteria | 157373 |
| 462 | Ga0495669_0000109 | 3300046684 | Bacteria | 53382 |
| 463 | Ga0495669_0454219 | 3300046684 | Bacteria | 622 |
| 464 | Ga0495671_0073107 | 3300046692 | Bacteria | 1683 |
| 465 | Ga0495671_0146413 | 3300046692 | Bacteria | 1150 |
| 466 | Ga0495660_0073886 | 3300046810 | Bacteria | 1802 |
| 467 | Ga0495660_0148135 | 3300046810 | Bacteria | 1161 |
| 468 | Ga0495674_0118732 | 3300047319 | Bacteria | 2236 |
| 469 | Ga0495672_0509623 | 3300047320 | Bacteria | 533 |
| 470 | Ga0495683_0222124 | 3300047323 | Bacteria | 842 |
| 471 | Ga0495673_0000342 | 3300047469 | Bacteria | 58945 |
| 472 | Ga0495681_0071183 | 3300047470 | Bacteria | 1575 |
| 473 | Ga0495681_0085939 | 3300047470 | Bacteria | 1396 |
| 474 | Ga0495686_0094683 | 3300047472 | Bacteria | 1809 |
| 475 | Ga0495614_0531047 | 3300048089 | Bacteria | 562 |
| 476 | Ga0496101_0334584 | 3300048904 | Bacteria | 1189 |
| 477 | Ga0496101_0346961 | 3300048904 | Bacteria | 1166 |
| 478 | Ga0496102_0081137 | 3300048905 | Bacteria | 2990 |
| 479 | Ga0496103_0026473 | 3300048906 | Bacteria | 3511 |
| 480 | Ga0496103_0141771 | 3300048906 | Bacteria | 1537 |
| 481 | Ga0496105_0601488 | 3300048908 | Bacteria | 853 |
| 482 | Ga0496106_0025542 | 3300048909 | Bacteria | 4397 |
| 483 | Ga0496106_0123528 | 3300048909 | Bacteria | 2025 |
| 484 | Ga0496107_0001980 | 3300048910 | Bacteria | 13038 |
| 485 | Ga0496108_0018886 | 3300048911 | Bacteria | 5653 |
| 486 | Ga0496109_0017572 | 3300048912 | Bacteria | 6272 |
| 487 | Ga0496109_1685243 | 3300048912 | Bacteria | 568 |
| 488 | Ga0496110_0383193 | 3300048913 | Bacteria | 1281 |
| 489 | Ga0496111_0194131 | 3300048914 | Bacteria | 1509 |
| 490 | Ga0496112_0067842 | 3300048915 | Bacteria | 3521 |
| 491 | Ga0496112_0226006 | 3300048915 | Bacteria | 1827 |
| 492 | Ga0496112_0283548 | 3300048915 | Bacteria | 1603 |
| 493 | Ga0496112_0821215 | 3300048915 | Unclassified | 854 |
| 494 | Ga0496113_0274602 | 3300048916 | Bacteria | 1347 |
| 495 | Ga0496113_0308891 | 3300048916 | Bacteria | 1267 |
| 496 | Ga0496114_0665695 | 3300048917 | Bacteria | 915 |
| 497 | Ga0496115_0000210 | 3300048918 | Bacteria | 54070 |
| 498 | Ga0496115_0000966 | 3300048918 | Bacteria | 20875 |
| 499 | Ga0496115_0105062 | 3300048918 | Bacteria | 2318 |
| 500 | Ga0496115_0169209 | 3300048918 | Bacteria | 1807 |
| 501 | Ga0496115_0191049 | 3300048918 | Bacteria | 1692 |
| 502 | Ga0496121_0004298 | 3300048924 | Bacteria | 19307 |
| 503 | Ga0496121_0670804 | 3300048924 | Bacteria | 628 |
| 504 | Ga0496122_0092958 | 3300048925 | Bacteria | 2048 |
| 505 | Ga0496124_0003907 | 3300048927 | Bacteria | 17812 |
| 506 | Ga0496124_0075119 | 3300048927 | Bacteria | 2792 |
| 507 | Ga0496124_0283675 | 3300048927 | Bacteria | 1206 |
| 508 | Ga0496125_0029780 | 3300048928 | Bacteria | 4898 |
| 509 | Ga0496125_0258106 | 3300048928 | Bacteria | 1094 |
| 510 | Ga0496125_0351534 | 3300048928 | Bacteria | 880 |
| 511 | Ga0496126_0005086 | 3300048929 | Bacteria | 15258 |
| 512 | Ga0501034_0061114 | 3300049571 | Bacteria | 3784 |
| 513 | Ga0501034_1516920 | 3300049571 | Bacteria | 544 |
| 514 | Ga0501037_0129883 | 3300049573 | Bacteria | 1807 |
| 515 | Ga0501037_0778136 | 3300049573 | Bacteria | 633 |
| 516 | Ga0501038_0412811 | 3300049574 | Bacteria | 1043 |
| 517 | Ga0501038_1393957 | 3300049574 | Bacteria | 504 |
| 518 | Ga0501039_0943344 | 3300049575 | Bacteria | 671 |
| 519 | Ga0501043_0173124 | 3300049579 | Bacteria | 1684 |
| 520 | Ga0501047_0004111 | 3300049581 | Bacteria | 13694 |
| 521 | Ga0501047_0017073 | 3300049581 | Bacteria | 6941 |
| 522 | Ga0501047_0234554 | 3300049581 | Bacteria | 1687 |
| 523 | Ga0501047_0239769 | 3300049581 | Bacteria | 1664 |
| 524 | Ga0501047_0515206 | 3300049581 | Bacteria | 1022 |
| 525 | Ga0501047_0678304 | 3300049581 | Bacteria | 849 |
| 526 | Ga0501047_1079148 | 3300049581 | Bacteria | 616 |
| 527 | Ga0501048_0197256 | 3300049582 | Bacteria | 1427 |
| 528 | Ga0501048_0517230 | 3300049582 | Bacteria | 856 |
| 529 | Ga0501067_0290646 | 3300049583 | Bacteria | 910 |
| 530 | Ga0501068_0158025 | 3300049584 | Bacteria | 1428 |
| 531 | Ga0501068_0297201 | 3300049584 | Bacteria | 1033 |
| 532 | Ga0501069_0244745 | 3300049585 | Bacteria | 1045 |
| 533 | Ga0501070_0116431 | 3300049586 | Bacteria | 2207 |
| 534 | Ga0501071_0062133 | 3300049587 | Bacteria | 2706 |
| 535 | Ga0501073_0239131 | 3300049589 | Bacteria | 1254 |
| 536 | Ga0501073_0273568 | 3300049589 | Bacteria | 1165 |
| 537 | Ga0501074_0109812 | 3300049590 | Bacteria | 1973 |
| 538 | Ga0501257_036880 | 3300049686 | Bacteria | 1192 |
| 539 | Ga0501080_1528039 | 3300049742 | Bacteria | 567 |
| 540 | Ga0501083_0314043 | 3300049744 | Bacteria | 1019 |
| 541 | Ga0501035_1005701 | 3300049822 | Bacteria | 655 |
| 542 | Ga0501044_0111380 | 3300049823 | Bacteria | 2745 |
| 543 | Ga0501044_0524381 | 3300049823 | Bacteria | 1084 |
| 544 | Ga0501044_0667420 | 3300049823 | Bacteria | 927 |
| 545 | Ga0501044_1195855 | 3300049823 | Bacteria | 628 |
| 546 | nmdc:mga0k408_118551_c1 | 3300050493 | Bacteria | 1567 |
| 547 | nmdc:mga0k408_798038_c1 | 3300050493 | Bacteria | 550 |
| 548 | nmdc:mga07m45_652561_c1 | 3300050496 | Bacteria | 606 |
| 549 | nmdc:mga07m45_95083_c1 | 3300050496 | Bacteria | 1709 |
| 550 | nmdc:mga08y16_1661854_c1 | 3300050511 | Bacteria | 595 |
| 551 | nmdc:mga0sz30_49421_c1 | 3300050516 | Bacteria | 1782 |
| 552 | Ga0495601_0208504 | 3300053077 | Bacteria | 1277 |
| 553 | Ga0500635_0000045 | 3300053080 | Bacteria | 87314 |
| 554 | Ga0500635_0121275 | 3300053080 | Bacteria | 979 |
| 555 | Ga0500578_0000102 | 3300053086 | Bacteria | 99108 |
| 556 | Ga0500643_057687 | 3300053087 | Bacteria | 1095 |
| 557 | Ga0500643_095746 | 3300053087 | Bacteria | 807 |
| 558 | Ga0500644_0000290 | 3300053088 | Bacteria | 27182 |
| 559 | Ga0500644_0154529 | 3300053088 | Bacteria | 922 |
| 560 | Ga0500644_0502137 | 3300053088 | Bacteria | 534 |
| 561 | Ga0500646_0178841 | 3300053090 | Bacteria | 718 |
| 562 | Ga0500566_0175010 | 3300053094 | Bacteria | 1106 |
| 563 | Ga0500641_0126629 | 3300053096 | Bacteria | 1102 |
| 564 | Ga0500641_0173532 | 3300053096 | Bacteria | 927 |
| 565 | Ga0500555_000770 | 3300053103 | Bacteria | 11786 |
| 566 | Ga0500556_0002007 | 3300053104 | Bacteria | 7135 |
| 567 | Ga0500556_0130848 | 3300053104 | Bacteria | 983 |
| 568 | Ga0500562_002145 | 3300053108 | Bacteria | 4933 |
| 569 | Ga0500562_002785 | 3300053108 | Bacteria | 4352 |
| 570 | Ga0500562_053104 | 3300053108 | Bacteria | 1085 |
| 571 | Ga0500594_0000540 | 3300053118 | Bacteria | 8211 |
| 572 | Ga0500595_106751 | 3300053119 | Bacteria | 799 |
| 573 | Ga0500607_253162 | 3300053121 | Bacteria | 698 |
| 574 | Ga0500608_000037 | 3300053122 | Bacteria | 60499 |
| 575 | Ga0500642_0207288 | 3300053130 | Bacteria | 911 |
| 576 | Ga0500559_0000023 | 3300053136 | Bacteria | 127993 |
| 577 | Ga0500559_0001365 | 3300053136 | Bacteria | 13991 |
| 578 | Ga0500559_0248354 | 3300053136 | Bacteria | 838 |
| 579 | Ga0500559_0300320 | 3300053136 | Bacteria | 754 |
| 580 | Ga0500564_000289 | 3300053138 | Bacteria | 13960 |
| 581 | Ga0500590_142998 | 3300053148 | Bacteria | 1090 |
| 582 | Ga0500616_0001152 | 3300053153 | Bacteria | 27030 |
| 583 | Ga0500616_0224846 | 3300053153 | Bacteria | 816 |
| 584 | Ga0500622_0000674 | 3300053156 | Bacteria | 30184 |
| 585 | Ga0500622_0029320 | 3300053156 | Bacteria | 2894 |
| 586 | Ga0500622_0069190 | 3300053156 | Bacteria | 1788 |
| 587 | Ga0500627_0005522 | 3300053158 | Bacteria | 4207 |
| 588 | Ga0500639_115535 | 3300053163 | Bacteria | 1298 |
| 589 | Ga0500636_0012697 | 3300053177 | Bacteria | 4938 |
| 590 | Ga0500636_0059283 | 3300053177 | Bacteria | 2237 |
| 591 | Ga0500637_0037054 | 3300053178 | Bacteria | 2739 |
| 592 | Ga0500645_004788 | 3300053730 | Bacteria | 5120 |
| 593 | Ga0500609_004649 | 3300053731 | Bacteria | 1892 |
| 594 | Ga0590077_094482 | 3300059426 | Bacteria | 696 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005295 | Ga0065707_10939732 | Ga0065707_109397321 | 100 |
| 2 | 3300005544 | Ga0070686_100346285 | Ga0070686_1003462852 | 100 |
| 3 | 3300005549 | Ga0070704_100638592 | Ga0070704_1006385922 | 100 |
| 4 | 3300005546 | Ga0070696_100913029 | Ga0070696_1009130291 | 109 |
| 5 | iso_pu_bacteria | 2582581279 | 2585148927 | 117 |
| 6 | iso_pu_bacteria | 2582581280 | 2585154006 | 117 |
| 7 | iso_pu_bacteria | 2582581293 | 2585194999 | 117 |
| 8 | iso_pu_bacteria | 2585428106 | 2587919000 | 117 |
| 9 | iso_pu_bacteria | 2643221552 | 2643780751 | 117 |
| 10 | iso_pu_bacteria | 2643221584 | 2643930043 | 117 |
| 11 | iso_pu_bacteria | 2643221598 | 2643998352 | 117 |
| 12 | iso_pu_bacteria | 2643221614 | 2644086790 | 117 |
| 13 | iso_pu_bacteria | 2643221640 | 2644227586 | 117 |
| 14 | iso_pu_bacteria | 2643221642 | 2644236896 | 117 |
| 15 | iso_pu_bacteria | 2643221661 | 2644341744 | 117 |
| 16 | iso_pu_bacteria | 2643221666 | 2644368031 | 117 |
| 17 | iso_pu_bacteria | 2791355048 | 2792461466 | 117 |
| 18 | iso_pu_bacteria | 2818991435 | 2819536114 | 117 |
| 19 | iso_pu_bacteria | 2818991454 | 2819644507 | 117 |
| 20 | iso_pu_bacteria | 2843744320 | 2843746171 | 117 |
| 21 | iso_pu_bacteria | 2849560528 | 2849561577 | 117 |
| 22 | iso_pu_bacteria | 2849573788 | 2849576425 | 117 |
| 23 | iso_pu_bacteria | 2851153111 | 2851153916 | 117 |
| 24 | iso_pu_bacteria | 2884960567 | 2884961380 | 117 |
| 25 | iso_pu_bacteria | 2898329390 | 2898332103 | 117 |
| 26 | iso_pu_bacteria | 2928531327 | 2928531699 | 117 |
| 27 | 3300053153 | Ga0500616_0001152 | Ga0500616_0001152_25833_26207 | 118 |
| 28 | iso_pu_bacteria | 2585428094 | 2587864415 | 118 |
| 29 | iso_pu_bacteria | 2643221622 | 2644128375 | 118 |
| 30 | iso_pu_bacteria | 2643221649 | 2644280387 | 118 |
| 31 | iso_pu_bacteria | 8046352972 | 8046353359 | 118 |
| 32 | iso_pu_bacteria | 2511231221 | 2512033114 | 119 |
| 33 | iso_pu_bacteria | 2818991466 | 2819714072 | 119 |
| 34 | iso_pu_bacteria | 2879163058 | 2879165035 | 119 |
| 35 | iso_pu_bacteria | 8054002106 | 8054005019 | 119 |
| 36 | 3300005335 | Ga0070666_10268620 | Ga0070666_102686202 | 120 |
| 37 | 3300005548 | Ga0070665_101372920 | Ga0070665_1013729202 | 120 |
| 38 | 3300005842 | Ga0068858_101451656 | Ga0068858_1014516562 | 120 |
| 39 | 3300009093 | Ga0105240_10000581 | Ga0105240_100005814 | 120 |
| 40 | 3300009093 | Ga0105240_12618992 | Ga0105240_126189921 | 120 |
| 41 | 3300009177 | Ga0105248_11227002 | Ga0105248_112270022 | 120 |
| 42 | 3300009551 | Ga0105238_10748753 | Ga0105238_107487532 | 120 |
| 43 | 3300010375 | Ga0105239_12162199 | Ga0105239_121621991 | 120 |
| 44 | 3300025903 | Ga0207680_10481387 | Ga0207680_104813872 | 120 |
| 45 | 3300025913 | Ga0207695_10004246 | Ga0207695_100042465 | 120 |
| 46 | 3300025924 | Ga0207694_10086016 | Ga0207694_100860162 | 120 |
| 47 | 3300025941 | Ga0207711_10838868 | Ga0207711_108388682 | 120 |
| 48 | iso_pu_bacteria | 2891395885 | 2891404593 | 120 |
| 49 | iso_pu_bacteria | 2891554331 | 2891561741 | 120 |
| 50 | 3300003215 | JGI25153J46596_10019850 | JGI25153J46596_100198502 | 121 |
| 51 | 3300003215 | JGI25153J46596_10086712 | JGI25153J46596_100867121 | 121 |
| 52 | 3300003771 | Ga0055526_1013317 | Ga0055526_10133173 | 121 |
| 53 | 3300003771 | Ga0055526_1063969 | Ga0055526_10639692 | 121 |
| 54 | 3300003773 | Ga0055537_1008763 | Ga0055537_10087632 | 121 |
| 55 | 3300003775 | Ga0055524_1005141 | Ga0055524_10051412 | 121 |
| 56 | 3300003775 | Ga0055524_1026703 | Ga0055524_10267032 | 121 |
| 57 | 3300003775 | Ga0055524_1055908 | Ga0055524_10559082 | 121 |
| 58 | 3300003781 | Ga0055536_1000905 | Ga0055536_10009052 | 121 |
| 59 | 3300003781 | Ga0055536_1000910 | Ga0055536_100091020 | 121 |
| 60 | 3300003790 | Ga0055528_1009105 | Ga0055528_10091052 | 121 |
| 61 | 3300003790 | Ga0055528_1096392 | Ga0055528_10963921 | 121 |
| 62 | 3300003791 | Ga0055530_10009556 | Ga0055530_100095563 | 121 |
| 63 | 3300003794 | Ga0055531_10001529 | Ga0055531_100015293 | 121 |
| 64 | 3300003794 | Ga0055531_10003074 | Ga0055531_1000307410 | 121 |
| 65 | 3300005262 | Ga0065165_1003707 | Ga0065165_10037076 | 121 |
| 66 | 3300005327 | Ga0070658_10242366 | Ga0070658_102423662 | 121 |
| 67 | 3300005327 | Ga0070658_10276590 | Ga0070658_102765902 | 121 |
| 68 | 3300005327 | Ga0070658_10400212 | Ga0070658_104002121 | 121 |
| 69 | 3300005329 | Ga0070683_102057462 | Ga0070683_1020574621 | 121 |
| 70 | 3300005331 | Ga0070670_100000032 | Ga0070670_10000003215 | 121 |
| 71 | 3300005331 | Ga0070670_100518115 | Ga0070670_1005181152 | 121 |
| 72 | 3300005333 | Ga0070677_10482366 | Ga0070677_104823662 | 121 |
| 73 | 3300005335 | Ga0070666_10032870 | Ga0070666_100328704 | 121 |
| 74 | 3300005335 | Ga0070666_10539802 | Ga0070666_105398022 | 121 |
| 75 | 3300005336 | Ga0070680_100029974 | Ga0070680_1000299741 | 121 |
| 76 | 3300005338 | Ga0068868_100138306 | Ga0068868_1001383062 | 121 |
| 77 | 3300005339 | Ga0070660_100902960 | Ga0070660_1009029602 | 121 |
| 78 | 3300005341 | Ga0070691_10012155 | Ga0070691_100121553 | 121 |
| 79 | 3300005344 | Ga0070661_100125835 | Ga0070661_1001258352 | 121 |
| 80 | 3300005347 | Ga0070668_100000702 | Ga0070668_10000070216 | 121 |
| 81 | 3300005347 | Ga0070668_100005927 | Ga0070668_10000592710 | 121 |
| 82 | 3300005347 | Ga0070668_100008316 | Ga0070668_1000083163 | 121 |
| 83 | 3300005347 | Ga0070668_100111636 | Ga0070668_1001116362 | 121 |
| 84 | 3300005347 | Ga0070668_100326803 | Ga0070668_1003268032 | 121 |
| 85 | 3300005355 | Ga0070671_100078320 | Ga0070671_1000783202 | 121 |
| 86 | 3300005355 | Ga0070671_100158098 | Ga0070671_1001580982 | 121 |
| 87 | 3300005355 | Ga0070671_100517686 | Ga0070671_1005176862 | 121 |
| 88 | 3300005364 | Ga0070673_100147028 | Ga0070673_1001470282 | 121 |
| 89 | 3300005366 | Ga0070659_100001930 | Ga0070659_1000019308 | 121 |
| 90 | 3300005366 | Ga0070659_100004321 | Ga0070659_1000043217 | 121 |
| 91 | 3300005367 | Ga0070667_100000387 | Ga0070667_1000003876 | 121 |
| 92 | 3300005367 | Ga0070667_100817494 | Ga0070667_1008174941 | 121 |
| 93 | 3300005367 | Ga0070667_100833523 | Ga0070667_1008335232 | 121 |
| 94 | 3300005367 | Ga0070667_101327588 | Ga0070667_1013275881 | 121 |
| 95 | 3300005440 | Ga0070705_101811799 | Ga0070705_1018117991 | 121 |
| 96 | 3300005456 | Ga0070678_100132952 | Ga0070678_1001329521 | 121 |
| 97 | 3300005457 | Ga0070662_100230211 | Ga0070662_1002302113 | 121 |
| 98 | 3300005457 | Ga0070662_100302017 | Ga0070662_1003020171 | 121 |
| 99 | 3300005458 | Ga0070681_10563906 | Ga0070681_105639062 | 121 |
| 100 | 3300005459 | Ga0068867_101138848 | Ga0068867_1011388482 | 121 |
| 101 | 3300005466 | Ga0070685_10957329 | Ga0070685_109573291 | 121 |
| 102 | 3300005530 | Ga0070679_100040495 | Ga0070679_1000404952 | 121 |
| 103 | 3300005530 | Ga0070679_101528034 | Ga0070679_1015280341 | 121 |
| 104 | 3300005539 | Ga0068853_100003476 | Ga0068853_1000034761 | 121 |
| 105 | 3300005539 | Ga0068853_100393618 | Ga0068853_1003936181 | 121 |
| 106 | 3300005539 | Ga0068853_100496449 | Ga0068853_1004964491 | 121 |
| 107 | 3300005546 | Ga0070696_100570328 | Ga0070696_1005703282 | 121 |
| 108 | 3300005547 | Ga0070693_100718873 | Ga0070693_1007188731 | 121 |
| 109 | 3300005548 | Ga0070665_100000136 | Ga0070665_10000013663 | 121 |
| 110 | 3300005548 | Ga0070665_100001151 | Ga0070665_10000115133 | 121 |
| 111 | 3300005563 | Ga0068855_100097020 | Ga0068855_1000970202 | 121 |
| 112 | 3300005563 | Ga0068855_100147645 | Ga0068855_1001476453 | 121 |
| 113 | 3300005563 | Ga0068855_100327833 | Ga0068855_1003278332 | 121 |
| 114 | 3300005563 | Ga0068855_100820023 | Ga0068855_1008200232 | 121 |
| 115 | 3300005564 | Ga0070664_100932410 | Ga0070664_1009324102 | 121 |
| 116 | 3300005577 | Ga0068857_100298544 | Ga0068857_1002985442 | 121 |
| 117 | 3300005577 | Ga0068857_102251207 | Ga0068857_1022512072 | 121 |
| 118 | 3300005578 | Ga0068854_101752688 | Ga0068854_1017526881 | 121 |
| 119 | 3300005614 | Ga0068856_100351334 | Ga0068856_1003513342 | 121 |
| 120 | 3300005614 | Ga0068856_101743438 | Ga0068856_1017434381 | 121 |
| 121 | 3300005617 | Ga0068859_100042143 | Ga0068859_1000421433 | 121 |
| 122 | 3300005617 | Ga0068859_100128836 | Ga0068859_1001288363 | 121 |
| 123 | 3300005617 | Ga0068859_101422116 | Ga0068859_1014221161 | 121 |
| 124 | 3300005618 | Ga0068864_100000491 | Ga0068864_10000049117 | 121 |
| 125 | 3300005618 | Ga0068864_100001848 | Ga0068864_1000018488 | 121 |
| 126 | 3300005618 | Ga0068864_100065251 | Ga0068864_1000652512 | 121 |
| 127 | 3300005618 | Ga0068864_100443278 | Ga0068864_1004432782 | 121 |
| 128 | 3300005618 | Ga0068864_101359056 | Ga0068864_1013590562 | 121 |
| 129 | 3300005719 | Ga0068861_100406812 | Ga0068861_1004068122 | 121 |
| 130 | 3300005719 | Ga0068861_101378140 | Ga0068861_1013781402 | 121 |
| 131 | 3300005841 | Ga0068863_100004096 | Ga0068863_10000409611 | 121 |
| 132 | 3300005841 | Ga0068863_100005840 | Ga0068863_1000058406 | 121 |
| 133 | 3300005841 | Ga0068863_100560702 | Ga0068863_1005607021 | 121 |
| 134 | 3300005841 | Ga0068863_101378577 | Ga0068863_1013785772 | 121 |
| 135 | 3300005841 | Ga0068863_102520841 | Ga0068863_1025208412 | 121 |
| 136 | 3300005842 | Ga0068858_100012067 | Ga0068858_1000120673 | 121 |
| 137 | 3300005842 | Ga0068858_100044239 | Ga0068858_1000442392 | 121 |
| 138 | 3300005842 | Ga0068858_100469579 | Ga0068858_1004695792 | 121 |
| 139 | 3300005843 | Ga0068860_100000100 | Ga0068860_100000100146 | 121 |
| 140 | 3300005843 | Ga0068860_100000167 | Ga0068860_10000016764 | 121 |
| 141 | 3300005844 | Ga0068862_100117199 | Ga0068862_1001171992 | 121 |
| 142 | 3300005844 | Ga0068862_100230870 | Ga0068862_1002308701 | 121 |
| 143 | 3300005844 | Ga0068862_100341966 | Ga0068862_1003419662 | 121 |
| 144 | 3300005844 | Ga0068862_100347893 | Ga0068862_1003478932 | 121 |
| 145 | 3300006186 | Ga0075369_10001997 | Ga0075369_100019976 | 121 |
| 146 | 3300006195 | Ga0075366_10014506 | Ga0075366_100145065 | 121 |
| 147 | 3300006195 | Ga0075366_10169386 | Ga0075366_101693863 | 121 |
| 148 | 3300006237 | Ga0097621_101822345 | Ga0097621_1018223452 | 121 |
| 149 | 3300006353 | Ga0075370_10141327 | Ga0075370_101413271 | 121 |
| 150 | 3300006353 | Ga0075370_10153795 | Ga0075370_101537952 | 121 |
| 151 | 3300006358 | Ga0068871_100819917 | Ga0068871_1008199172 | 121 |
| 152 | 3300006881 | Ga0068865_100000195 | Ga0068865_10000019518 | 121 |
| 153 | 3300006931 | Ga0097620_100042143 | Ga0097620_1000421435 | 121 |
| 154 | 3300006931 | Ga0097620_100128817 | Ga0097620_1001288173 | 121 |
| 155 | 3300006931 | Ga0097620_101422433 | Ga0097620_1014224331 | 121 |
| 156 | 3300009092 | Ga0105250_10010734 | Ga0105250_100107342 | 121 |
| 157 | 3300009093 | Ga0105240_10008814 | Ga0105240_1000881414 | 121 |
| 158 | 3300009093 | Ga0105240_10038728 | Ga0105240_100387288 | 121 |
| 159 | 3300009093 | Ga0105240_10449085 | Ga0105240_104490852 | 121 |
| 160 | 3300009093 | Ga0105240_12070353 | Ga0105240_120703531 | 121 |
| 161 | 3300009098 | Ga0105245_10213735 | Ga0105245_102137352 | 121 |
| 162 | 3300009101 | Ga0105247_10198741 | Ga0105247_101987412 | 121 |
| 163 | 3300009174 | Ga0105241_12283228 | Ga0105241_122832281 | 121 |
| 164 | 3300009176 | Ga0105242_12517972 | Ga0105242_125179722 | 121 |
| 165 | 3300009177 | Ga0105248_10003790 | Ga0105248_1000379015 | 121 |
| 166 | 3300009177 | Ga0105248_10286267 | Ga0105248_102862672 | 121 |
| 167 | 3300009177 | Ga0105248_11091965 | Ga0105248_110919652 | 121 |
| 168 | 3300009177 | Ga0105248_11334453 | Ga0105248_113344532 | 121 |
| 169 | 3300009177 | Ga0105248_11873537 | Ga0105248_118735371 | 121 |
| 170 | 3300009545 | Ga0105237_10527250 | Ga0105237_105272502 | 121 |
| 171 | 3300009551 | Ga0105238_10007249 | Ga0105238_100072499 | 121 |
| 172 | 3300009551 | Ga0105238_10700955 | Ga0105238_107009552 | 121 |
| 173 | 3300009551 | Ga0105238_11984477 | Ga0105238_119844772 | 121 |
| 174 | 3300009551 | Ga0105238_12366078 | Ga0105238_123660781 | 121 |
| 175 | 3300009553 | Ga0105249_10001354 | Ga0105249_1000135426 | 121 |
| 176 | 3300009553 | Ga0105249_10215538 | Ga0105249_102155382 | 121 |
| 177 | 3300009979 | Ga0105032_101996 | Ga0105032_1019961 | 121 |
| 178 | 3300010375 | Ga0105239_10496336 | Ga0105239_104963362 | 121 |
| 179 | 3300010375 | Ga0105239_12670659 | Ga0105239_126706591 | 121 |
| 180 | 3300013100 | Ga0157373_10003677 | Ga0157373_1000367711 | 121 |
| 181 | 3300013100 | Ga0157373_10037336 | Ga0157373_100373364 | 121 |
| 182 | 3300013104 | Ga0157370_10355448 | Ga0157370_103554482 | 121 |
| 183 | 3300013105 | Ga0157369_10328289 | Ga0157369_103282892 | 121 |
| 184 | 3300013306 | Ga0163162_10060119 | Ga0163162_100601193 | 121 |
| 185 | 3300013306 | Ga0163162_10214864 | Ga0163162_102148642 | 121 |
| 186 | 3300013306 | Ga0163162_11304738 | Ga0163162_113047382 | 121 |
| 187 | 3300013307 | Ga0157372_11479643 | Ga0157372_114796432 | 121 |
| 188 | 3300013308 | Ga0157375_10224663 | Ga0157375_102246632 | 121 |
| 189 | 3300013308 | Ga0157375_11116199 | Ga0157375_111161991 | 121 |
| 190 | 3300014325 | Ga0163163_10045475 | Ga0163163_100454753 | 121 |
| 191 | 3300014325 | Ga0163163_10122100 | Ga0163163_101221002 | 121 |
| 192 | 3300014325 | Ga0163163_10371871 | Ga0163163_103718712 | 121 |
| 193 | 3300014325 | Ga0163163_10542448 | Ga0163163_105424482 | 121 |
| 194 | 3300014497 | Ga0182008_10255553 | Ga0182008_102555532 | 121 |
| 195 | 3300014968 | Ga0157379_10149251 | Ga0157379_101492512 | 121 |
| 196 | 3300014969 | Ga0157376_10405847 | Ga0157376_104058472 | 121 |
| 197 | 3300017792 | Ga0163161_10207934 | Ga0163161_102079342 | 121 |
| 198 | 3300017792 | Ga0163161_11082300 | Ga0163161_110823001 | 121 |
| 199 | 3300017792 | Ga0163161_11737738 | Ga0163161_117377381 | 121 |
| 200 | 3300021384 | Ga0213876_10015657 | Ga0213876_100156572 | 121 |
| 201 | 3300025254 | Ga0209148_1030050 | Ga0209148_10300501 | 121 |
| 202 | 3300025263 | Ga0209565_1000552 | Ga0209565_100055216 | 121 |
| 203 | 3300025273 | Ga0209673_1036209 | Ga0209673_10362092 | 121 |
| 204 | 3300025291 | Ga0209675_1002582 | Ga0209675_10025825 | 121 |
| 205 | 3300025292 | Ga0209676_1000043 | Ga0209676_1000043335 | 121 |
| 206 | 3300025292 | Ga0209676_1000392 | Ga0209676_100039284 | 121 |
| 207 | 3300025295 | Ga0209564_1003574 | Ga0209564_10035748 | 121 |
| 208 | 3300025295 | Ga0209564_1022562 | Ga0209564_10225622 | 121 |
| 209 | 3300025295 | Ga0209564_1028726 | Ga0209564_10287262 | 121 |
| 210 | 3300025297 | Ga0209758_1004179 | Ga0209758_10041793 | 121 |
| 211 | 3300025297 | Ga0209758_1006159 | Ga0209758_10061599 | 121 |
| 212 | 3300025298 | Ga0209050_1001794 | Ga0209050_100179422 | 121 |
| 213 | 3300025298 | Ga0209050_1001959 | Ga0209050_10019592 | 121 |
| 214 | 3300025298 | Ga0209050_1023621 | Ga0209050_10236212 | 121 |
| 215 | 3300025299 | Ga0209256_1001825 | Ga0209256_100182518 | 121 |
| 216 | 3300025299 | Ga0209256_1004214 | Ga0209256_100421410 | 121 |
| 217 | 3300025299 | Ga0209256_1009352 | Ga0209256_10093525 | 121 |
| 218 | 3300025303 | Ga0209051_1002664 | Ga0209051_10026642 | 121 |
| 219 | 3300025304 | Ga0209257_1000186 | Ga0209257_100018683 | 121 |
| 220 | 3300025304 | Ga0209257_1000616 | Ga0209257_100061620 | 121 |
| 221 | 3300025304 | Ga0209257_1009235 | Ga0209257_10092354 | 121 |
| 222 | 3300025711 | Ga0207696_1070448 | Ga0207696_10704482 | 121 |
| 223 | 3300025907 | Ga0207645_10488724 | Ga0207645_104887242 | 121 |
| 224 | 3300025909 | Ga0207705_10016114 | Ga0207705_100161145 | 121 |
| 225 | 3300025909 | Ga0207705_10158546 | Ga0207705_101585462 | 121 |
| 226 | 3300025909 | Ga0207705_10586000 | Ga0207705_105860002 | 121 |
| 227 | 3300025912 | Ga0207707_10153412 | Ga0207707_101534122 | 121 |
| 228 | 3300025913 | Ga0207695_10000595 | Ga0207695_1000059570 | 121 |
| 229 | 3300025913 | Ga0207695_10001322 | Ga0207695_1000132222 | 121 |
| 230 | 3300025913 | Ga0207695_10027094 | Ga0207695_100270948 | 121 |
| 231 | 3300025913 | Ga0207695_10140957 | Ga0207695_101409572 | 121 |
| 232 | 3300025914 | Ga0207671_10720305 | Ga0207671_107203051 | 121 |
| 233 | 3300025917 | Ga0207660_10002459 | Ga0207660_100024593 | 121 |
| 234 | 3300025919 | Ga0207657_10001400 | Ga0207657_1000140027 | 121 |
| 235 | 3300025919 | Ga0207657_10630268 | Ga0207657_106302682 | 121 |
| 236 | 3300025920 | Ga0207649_10163310 | Ga0207649_101633102 | 121 |
| 237 | 3300025920 | Ga0207649_10739020 | Ga0207649_107390202 | 121 |
| 238 | 3300025921 | Ga0207652_10006051 | Ga0207652_100060515 | 121 |
| 239 | 3300025921 | Ga0207652_10435873 | Ga0207652_104358732 | 121 |
| 240 | 3300025923 | Ga0207681_10196104 | Ga0207681_101961042 | 121 |
| 241 | 3300025923 | Ga0207681_10232733 | Ga0207681_102327331 | 121 |
| 242 | 3300025923 | Ga0207681_10954435 | Ga0207681_109544351 | 121 |
| 243 | 3300025924 | Ga0207694_10112362 | Ga0207694_101123622 | 121 |
| 244 | 3300025924 | Ga0207694_10218073 | Ga0207694_102180732 | 121 |
| 245 | 3300025924 | Ga0207694_10918490 | Ga0207694_109184901 | 121 |
| 246 | 3300025924 | Ga0207694_11302121 | Ga0207694_113021211 | 121 |
| 247 | 3300025924 | Ga0207694_11871296 | Ga0207694_118712961 | 121 |
| 248 | 3300025925 | Ga0207650_10000074 | Ga0207650_1000007465 | 121 |
| 249 | 3300025925 | Ga0207650_10116804 | Ga0207650_101168042 | 121 |
| 250 | 3300025925 | Ga0207650_10209839 | Ga0207650_102098392 | 121 |
| 251 | 3300025925 | Ga0207650_10266150 | Ga0207650_102661502 | 121 |
| 252 | 3300025925 | Ga0207650_10987671 | Ga0207650_109876712 | 121 |
| 253 | 3300025927 | Ga0207687_10259178 | Ga0207687_102591782 | 121 |
| 254 | 3300025931 | Ga0207644_10389609 | Ga0207644_103896092 | 121 |
| 255 | 3300025932 | Ga0207690_10144289 | Ga0207690_101442892 | 121 |
| 256 | 3300025933 | Ga0207706_10029362 | Ga0207706_100293622 | 121 |
| 257 | 3300025934 | Ga0207686_11388843 | Ga0207686_113888431 | 121 |
| 258 | 3300025938 | Ga0207704_10016516 | Ga0207704_100165162 | 121 |
| 259 | 3300025941 | Ga0207711_10001500 | Ga0207711_1000150014 | 121 |
| 260 | 3300025941 | Ga0207711_10324816 | Ga0207711_103248161 | 121 |
| 261 | 3300025941 | Ga0207711_10436626 | Ga0207711_104366262 | 121 |
| 262 | 3300025941 | Ga0207711_10921967 | Ga0207711_109219672 | 121 |
| 263 | 3300025945 | Ga0207679_10019722 | Ga0207679_100197225 | 121 |
| 264 | 3300025945 | Ga0207679_10439140 | Ga0207679_104391402 | 121 |
| 265 | 3300025949 | Ga0207667_10054152 | Ga0207667_100541525 | 121 |
| 266 | 3300025949 | Ga0207667_10061067 | Ga0207667_100610673 | 121 |
| 267 | 3300025949 | Ga0207667_10429810 | Ga0207667_104298102 | 121 |
| 268 | 3300025949 | Ga0207667_10588797 | Ga0207667_105887972 | 121 |
| 269 | 3300025949 | Ga0207667_10827552 | Ga0207667_108275521 | 121 |
| 270 | 3300025960 | Ga0207651_10185558 | Ga0207651_101855582 | 121 |
| 271 | 3300025961 | Ga0207712_10011454 | Ga0207712_100114546 | 121 |
| 272 | 3300025961 | Ga0207712_10138362 | Ga0207712_101383622 | 121 |
| 273 | 3300025972 | Ga0207668_10000093 | Ga0207668_1000009363 | 121 |
| 274 | 3300025972 | Ga0207668_10002915 | Ga0207668_100029155 | 121 |
| 275 | 3300025972 | Ga0207668_10015103 | Ga0207668_100151034 | 121 |
| 276 | 3300025972 | Ga0207668_10407039 | Ga0207668_104070392 | 121 |
| 277 | 3300025972 | Ga0207668_10471148 | Ga0207668_104711482 | 121 |
| 278 | 3300025981 | Ga0207640_10535988 | Ga0207640_105359882 | 121 |
| 279 | 3300025986 | Ga0207658_10000266 | Ga0207658_1000026651 | 121 |
| 280 | 3300025986 | Ga0207658_10020936 | Ga0207658_100209361 | 121 |
| 281 | 3300025986 | Ga0207658_10603174 | Ga0207658_106031742 | 121 |
| 282 | 3300025986 | Ga0207658_11189273 | Ga0207658_111892732 | 121 |
| 283 | 3300025986 | Ga0207658_12115324 | Ga0207658_121153241 | 121 |
| 284 | 3300026035 | Ga0207703_10001734 | Ga0207703_1000173412 | 121 |
| 285 | 3300026035 | Ga0207703_10005822 | Ga0207703_100058222 | 121 |
| 286 | 3300026035 | Ga0207703_10157248 | Ga0207703_101572482 | 121 |
| 287 | 3300026035 | Ga0207703_10523962 | Ga0207703_105239622 | 121 |
| 288 | 3300026041 | Ga0207639_10008239 | Ga0207639_100082397 | 121 |
| 289 | 3300026041 | Ga0207639_10383425 | Ga0207639_103834252 | 121 |
| 290 | 3300026041 | Ga0207639_10605062 | Ga0207639_106050621 | 121 |
| 291 | 3300026078 | Ga0207702_10570866 | Ga0207702_105708662 | 121 |
| 292 | 3300026078 | Ga0207702_10725094 | Ga0207702_107250941 | 121 |
| 293 | 3300026078 | Ga0207702_10789418 | Ga0207702_107894182 | 121 |
| 294 | 3300026088 | Ga0207641_10004778 | Ga0207641_100047786 | 121 |
| 295 | 3300026088 | Ga0207641_10008000 | Ga0207641_100080008 | 121 |
| 296 | 3300026088 | Ga0207641_10550218 | Ga0207641_105502182 | 121 |
| 297 | 3300026088 | Ga0207641_10897052 | Ga0207641_108970522 | 121 |
| 298 | 3300026088 | Ga0207641_11405232 | Ga0207641_114052321 | 121 |
| 299 | 3300026095 | Ga0207676_10003303 | Ga0207676_100033033 | 121 |
| 300 | 3300026095 | Ga0207676_10003513 | Ga0207676_100035136 | 121 |
| 301 | 3300026095 | Ga0207676_10003975 | Ga0207676_1000397511 | 121 |
| 302 | 3300026116 | Ga0207674_10091603 | Ga0207674_100916032 | 121 |
| 303 | 3300026118 | Ga0207675_100311305 | Ga0207675_1003113052 | 121 |
| 304 | 3300026118 | Ga0207675_100671105 | Ga0207675_1006711052 | 121 |
| 305 | 3300026118 | Ga0207675_101316988 | Ga0207675_1013169882 | 121 |
| 306 | 3300026121 | Ga0207683_10175967 | Ga0207683_101759672 | 121 |
| 307 | 3300026121 | Ga0207683_10282675 | Ga0207683_102826752 | 121 |
| 308 | 3300026142 | Ga0207698_11023948 | Ga0207698_110239482 | 121 |
| 309 | 3300028379 | Ga0268266_10000003 | Ga0268266_10000003665 | 121 |
| 310 | 3300028379 | Ga0268266_10006422 | Ga0268266_100064227 | 121 |
| 311 | 3300028379 | Ga0268266_11171129 | Ga0268266_111711291 | 121 |
| 312 | 3300028380 | Ga0268265_10000648 | Ga0268265_1000064839 | 121 |
| 313 | 3300028380 | Ga0268265_10003084 | Ga0268265_1000308410 | 121 |
| 314 | 3300028380 | Ga0268265_10130801 | Ga0268265_101308012 | 121 |
| 315 | 3300028380 | Ga0268265_10148036 | Ga0268265_101480362 | 121 |
| 316 | 3300028381 | Ga0268264_10000002 | Ga0268264_10000002692 | 121 |
| 317 | 3300028381 | Ga0268264_10000068 | Ga0268264_1000006863 | 121 |
| 318 | 3300028786 | Ga0307517_10023613 | Ga0307517_100236136 | 121 |
| 319 | 3300028786 | Ga0307517_10102272 | Ga0307517_101022722 | 121 |
| 320 | 3300028794 | Ga0307515_10088331 | Ga0307515_100883312 | 121 |
| 321 | 3300028794 | Ga0307515_10148947 | Ga0307515_101489472 | 121 |
| 322 | 3300028800 | Ga0265338_10064888 | Ga0265338_100648882 | 121 |
| 323 | 3300028800 | Ga0265338_10119548 | Ga0265338_101195482 | 121 |
| 324 | 3300031251 | Ga0265327_10005457 | Ga0265327_100054572 | 121 |
| 325 | 3300031456 | Ga0307513_10001689 | Ga0307513_1000168910 | 121 |
| 326 | 3300031456 | Ga0307513_10012006 | Ga0307513_100120062 | 121 |
| 327 | 3300031456 | Ga0307513_10019458 | Ga0307513_100194588 | 121 |
| 328 | 3300031548 | Ga0307408_100172102 | Ga0307408_1001721022 | 121 |
| 329 | 3300031616 | Ga0307508_10587866 | Ga0307508_105878661 | 121 |
| 330 | 3300031730 | Ga0307516_10002970 | Ga0307516_100029704 | 121 |
| 331 | 3300031731 | Ga0307405_11935990 | Ga0307405_119359902 | 121 |
| 332 | 3300031824 | Ga0307413_11582712 | Ga0307413_115827122 | 121 |
| 333 | 3300031901 | Ga0307406_10165441 | Ga0307406_101654412 | 121 |
| 334 | 3300031901 | Ga0307406_10893511 | Ga0307406_108935112 | 121 |
| 335 | 3300031901 | Ga0307406_11245889 | Ga0307406_112458892 | 121 |
| 336 | 3300031911 | Ga0307412_11178837 | Ga0307412_111788372 | 121 |
| 337 | 3300031995 | Ga0307409_102041013 | Ga0307409_1020410132 | 121 |
| 338 | 3300032002 | Ga0307416_100346055 | Ga0307416_1003460552 | 121 |
| 339 | 3300032004 | Ga0307414_11861759 | Ga0307414_118617592 | 121 |
| 340 | 3300033180 | Ga0307510_10091868 | Ga0307510_100918682 | 121 |
| 341 | 3300033180 | Ga0307510_10605315 | Ga0307510_106053151 | 121 |
| 342 | 3300035089 | Ga0373944_0047566 | Ga0373944_0047566_42_407 | 121 |
| 343 | 3300035112 | Ga0373932_0309369 | Ga0373932_0309369_18_383 | 121 |
| 344 | 3300035113 | Ga0373936_0012346 | Ga0373936_0012346_1115_1480 | 121 |
| 345 | 3300035692 | Ga0373935_0840883 | Ga0373935_0840883_12_377 | 121 |
| 346 | 3300035692 | Ga0373935_0871416 | Ga0373935_0871416_240_605 | 121 |
| 347 | 3300035692 | Ga0373935_1095332 | Ga0373935_1095332_135_500 | 121 |
| 348 | 3300035695 | Ga0373927_0000886 | Ga0373927_0000886_10445_10810 | 121 |
| 349 | 3300037068 | Ga0373925_0000160 | Ga0373925_0000160_19524_19889 | 121 |
| 350 | 3300037312 | Ga0395899_0000260 | Ga0395899_0000260_54865_55230 | 121 |
| 351 | 3300037312 | Ga0395899_0065302 | Ga0395899_0065302_2067_2432 | 121 |
| 352 | 3300037312 | Ga0395899_0172126 | Ga0395899_0172126_349_714 | 121 |
| 353 | 3300037418 | Ga0395900_0000008 | Ga0395900_0000008_302818_303183 | 121 |
| 354 | 3300037418 | Ga0395900_0045875 | Ga0395900_0045875_628_993 | 121 |
| 355 | 3300037418 | Ga0395900_0185225 | Ga0395900_0185225_359_724 | 121 |
| 356 | 3300037418 | Ga0395900_0375054 | Ga0395900_0375054_1011_1376 | 121 |
| 357 | 3300037418 | Ga0395900_1322695 | Ga0395900_1322695_102_467 | 121 |
| 358 | 3300037466 | Ga0395898_0243013 | Ga0395898_0243013_1112_1477 | 121 |
| 359 | 3300037466 | Ga0395898_0664133 | Ga0395898_0664133_420_785 | 121 |
| 360 | 3300037471 | Ga0395905_0002508 | Ga0395905_0002508_11108_11473 | 121 |
| 361 | 3300037471 | Ga0395905_0011635 | Ga0395905_0011635_3356_3721 | 121 |
| 362 | 3300038443 | Ga0395901_0000008 | Ga0395901_0000008_177279_177644 | 121 |
| 363 | 3300038443 | Ga0395901_0547882 | Ga0395901_0547882_753_1118 | 121 |
| 364 | 3300038443 | Ga0395901_0785420 | Ga0395901_0785420_372_737 | 121 |
| 365 | 3300039437 | Ga0436365_0658056 | Ga0436365_0658056_3392_3757 | 121 |
| 366 | 3300039437 | Ga0436365_1349197 | Ga0436365_1349197_41_406 | 121 |
| 367 | 3300039447 | Ga0436361_0314376 | Ga0436361_0314376_10147_10512 | 121 |
| 368 | 3300039450 | Ga0436363_0665676 | Ga0436363_0665676_149_514 | 121 |
| 369 | 3300041443 | Ga0451789_0317317 | Ga0451789_0317317_43_408 | 121 |
| 370 | 3300041492 | Ga0451835_0347279 | Ga0451835_0347279_192_557 | 121 |
| 371 | 3300041503 | Ga0451847_0643662 | Ga0451847_0643662_96_461 | 121 |
| 372 | 3300041512 | Ga0451853_1525706 | Ga0451853_1525706_94_459 | 121 |
| 373 | 3300042001 | Ga0439441_018014 | Ga0439441_018014_811_1176 | 121 |
| 374 | 3300042438 | Ga0439459_0002303 | Ga0439459_0002303_54_419 | 121 |
| 375 | 3300044842 | Ga0466957_1034745 | Ga0466957_1034745_47_412 | 121 |
| 376 | 3300045836 | Ga0466958_0658897 | Ga0466958_0658897_17_382 | 121 |
| 377 | 3300045836 | Ga0466958_0819632 | Ga0466958_0819632_155_520 | 121 |
| 378 | 3300046457 | Ga0495590_0001696 | Ga0495590_0001696_2817_3182 | 121 |
| 379 | 3300046459 | Ga0495629_1011557 | Ga0495629_1011557_143_508 | 121 |
| 380 | 3300046460 | Ga0495638_0001383 | Ga0495638_0001383_4809_5174 | 121 |
| 381 | 3300046460 | Ga0495638_0002620 | Ga0495638_0002620_5476_5841 | 121 |
| 382 | 3300046460 | Ga0495638_0016210 | Ga0495638_0016210_590_955 | 121 |
| 383 | 3300046471 | Ga0495650_0000024 | Ga0495650_0000024_259928_260293 | 121 |
| 384 | 3300046492 | Ga0495585_0083463 | Ga0495585_0083463_1121_1486 | 121 |
| 385 | 3300046501 | Ga0495607_0050793 | Ga0495607_0050793_514_879 | 121 |
| 386 | 3300046506 | Ga0495583_0246547 | Ga0495583_0246547_65_430 | 121 |
| 387 | 3300046507 | Ga0495606_0004488 | Ga0495606_0004488_12612_12977 | 121 |
| 388 | 3300046507 | Ga0495606_0229571 | Ga0495606_0229571_591_956 | 121 |
| 389 | 3300046512 | Ga0495610_0012692 | Ga0495610_0012692_86_451 | 121 |
| 390 | 3300046512 | Ga0495610_0098285 | Ga0495610_0098285_75_440 | 121 |
| 391 | 3300046513 | Ga0495616_0007196 | Ga0495616_0007196_4800_5165 | 121 |
| 392 | 3300046513 | Ga0495616_0072190 | Ga0495616_0072190_725_1090 | 121 |
| 393 | 3300046513 | Ga0495616_0146747 | Ga0495616_0146747_417_782 | 121 |
| 394 | 3300046515 | Ga0495620_0021961 | Ga0495620_0021961_1378_1743 | 121 |
| 395 | 3300046518 | Ga0495631_0000540 | Ga0495631_0000540_1991_2356 | 121 |
| 396 | 3300046519 | Ga0495632_0003150 | Ga0495632_0003150_4259_4624 | 121 |
| 397 | 3300046524 | Ga0495648_0000029 | Ga0495648_0000029_219044_219409 | 121 |
| 398 | 3300046524 | Ga0495648_0094859 | Ga0495648_0094859_368_733 | 121 |
| 399 | 3300046524 | Ga0495648_0380805 | Ga0495648_0380805_223_588 | 121 |
| 400 | 3300046524 | Ga0495648_0399852 | Ga0495648_0399852_120_485 | 121 |
| 401 | 3300046524 | Ga0495648_0509897 | Ga0495648_0509897_64_429 | 121 |
| 402 | 3300046525 | Ga0495663_0074096 | Ga0495663_0074096_163_528 | 121 |
| 403 | 3300046528 | Ga0495642_0016600 | Ga0495642_0016600_1009_1374 | 121 |
| 404 | 3300046530 | Ga0495654_0000226 | Ga0495654_0000226_27668_28033 | 121 |
| 405 | 3300046530 | Ga0495654_0072563 | Ga0495654_0072563_454_819 | 121 |
| 406 | 3300046531 | Ga0495665_0193677 | Ga0495665_0193677_103_468 | 121 |
| 407 | 3300046536 | Ga0495587_0577130 | Ga0495587_0577130_200_565 | 121 |
| 408 | 3300046538 | Ga0495609_0193888 | Ga0495609_0193888_287_652 | 121 |
| 409 | 3300046542 | Ga0495597_0109881 | Ga0495597_0109881_314_679 | 121 |
| 410 | 3300046542 | Ga0495597_0264264 | Ga0495597_0264264_228_593 | 121 |
| 411 | 3300046558 | Ga0495633_0117835 | Ga0495633_0117835_19_384 | 121 |
| 412 | 3300046616 | Ga0495668_0000141 | Ga0495668_0000141_6697_7062 | 121 |
| 413 | 3300046616 | Ga0495668_0011679 | Ga0495668_0011679_1660_2025 | 121 |
| 414 | 3300046616 | Ga0495668_0037370 | Ga0495668_0037370_2191_2556 | 121 |
| 415 | 3300046616 | Ga0495668_0047260 | Ga0495668_0047260_1869_2234 | 121 |
| 416 | 3300046616 | Ga0495668_0084968 | Ga0495668_0084968_1308_1673 | 121 |
| 417 | 3300046616 | Ga0495668_0112566 | Ga0495668_0112566_556_921 | 121 |
| 418 | 3300046660 | Ga0495625_0085870 | Ga0495625_0085870_947_1312 | 121 |
| 419 | 3300046660 | Ga0495625_0087855 | Ga0495625_0087855_1044_1409 | 121 |
| 420 | 3300046660 | Ga0495625_0099813 | Ga0495625_0099813_976_1341 | 121 |
| 421 | 3300046660 | Ga0495625_0204179 | Ga0495625_0204179_299_664 | 121 |
| 422 | 3300046664 | Ga0495659_0226385 | Ga0495659_0226385_108_473 | 121 |
| 423 | 3300046664 | Ga0495659_0513534 | Ga0495659_0513534_81_446 | 121 |
| 424 | 3300046674 | Ga0495588_0048257 | Ga0495588_0048257_843_1208 | 121 |
| 425 | 3300046674 | Ga0495588_0265893 | Ga0495588_0265893_434_799 | 121 |
| 426 | 3300046678 | Ga0495599_0195290 | Ga0495599_0195290_778_1143 | 121 |
| 427 | 3300046683 | Ga0495658_0605069 | Ga0495658_0605069_192_557 | 121 |
| 428 | 3300046684 | Ga0495669_0000012 | Ga0495669_0000012_110854_111219 | 121 |
| 429 | 3300046684 | Ga0495669_0000109 | Ga0495669_0000109_38398_38763 | 121 |
| 430 | 3300046684 | Ga0495669_0454219 | Ga0495669_0454219_85_450 | 121 |
| 431 | 3300046692 | Ga0495671_0073107 | Ga0495671_0073107_1209_1574 | 121 |
| 432 | 3300046692 | Ga0495671_0146413 | Ga0495671_0146413_256_621 | 121 |
| 433 | 3300046810 | Ga0495660_0073886 | Ga0495660_0073886_1076_1441 | 121 |
| 434 | 3300046810 | Ga0495660_0148135 | Ga0495660_0148135_295_660 | 121 |
| 435 | 3300047319 | Ga0495674_0118732 | Ga0495674_0118732_1717_2082 | 121 |
| 436 | 3300047320 | Ga0495672_0509623 | Ga0495672_0509623_130_495 | 121 |
| 437 | 3300047323 | Ga0495683_0222124 | Ga0495683_0222124_413_778 | 121 |
| 438 | 3300047469 | Ga0495673_0000342 | Ga0495673_0000342_17341_17706 | 121 |
| 439 | 3300047470 | Ga0495681_0071183 | Ga0495681_0071183_450_815 | 121 |
| 440 | 3300047470 | Ga0495681_0085939 | Ga0495681_0085939_646_1011 | 121 |
| 441 | 3300047472 | Ga0495686_0094683 | Ga0495686_0094683_1315_1680 | 121 |
| 442 | 3300048089 | Ga0495614_0531047 | Ga0495614_0531047_158_523 | 121 |
| 443 | 3300048904 | Ga0496101_0334584 | Ga0496101_0334584_13_378 | 121 |
| 444 | 3300048904 | Ga0496101_0346961 | Ga0496101_0346961_396_761 | 121 |
| 445 | 3300048905 | Ga0496102_0081137 | Ga0496102_0081137_1847_2212 | 121 |
| 446 | 3300048906 | Ga0496103_0026473 | Ga0496103_0026473_1127_1492 | 121 |
| 447 | 3300048906 | Ga0496103_0141771 | Ga0496103_0141771_249_614 | 121 |
| 448 | 3300048908 | Ga0496105_0601488 | Ga0496105_0601488_409_774 | 121 |
| 449 | 3300048909 | Ga0496106_0025542 | Ga0496106_0025542_2635_3000 | 121 |
| 450 | 3300048909 | Ga0496106_0123528 | Ga0496106_0123528_252_617 | 121 |
| 451 | 3300048910 | Ga0496107_0001980 | Ga0496107_0001980_3474_3839 | 121 |
| 452 | 3300048911 | Ga0496108_0018886 | Ga0496108_0018886_1192_1557 | 121 |
| 453 | 3300048912 | Ga0496109_0017572 | Ga0496109_0017572_4832_5197 | 121 |
| 454 | 3300048912 | Ga0496109_1685243 | Ga0496109_1685243_37_402 | 121 |
| 455 | 3300048913 | Ga0496110_0383193 | Ga0496110_0383193_619_984 | 121 |
| 456 | 3300048914 | Ga0496111_0194131 | Ga0496111_0194131_330_695 | 121 |
| 457 | 3300048915 | Ga0496112_0067842 | Ga0496112_0067842_1827_2192 | 121 |
| 458 | 3300048915 | Ga0496112_0226006 | Ga0496112_0226006_1164_1532 | 121 |
| 459 | 3300048915 | Ga0496112_0283548 | Ga0496112_0283548_930_1295 | 121 |
| 460 | 3300048916 | Ga0496113_0274602 | Ga0496113_0274602_482_847 | 121 |
| 461 | 3300048916 | Ga0496113_0308891 | Ga0496113_0308891_660_1025 | 121 |
| 462 | 3300048917 | Ga0496114_0665695 | Ga0496114_0665695_510_875 | 121 |
| 463 | 3300048918 | Ga0496115_0000210 | Ga0496115_0000210_40405_40770 | 121 |
| 464 | 3300048918 | Ga0496115_0000966 | Ga0496115_0000966_17751_18116 | 121 |
| 465 | 3300048918 | Ga0496115_0105062 | Ga0496115_0105062_243_608 | 121 |
| 466 | 3300048918 | Ga0496115_0169209 | Ga0496115_0169209_590_955 | 121 |
| 467 | 3300048918 | Ga0496115_0191049 | Ga0496115_0191049_504_869 | 121 |
| 468 | 3300048924 | Ga0496121_0004298 | Ga0496121_0004298_14300_14665 | 121 |
| 469 | 3300048924 | Ga0496121_0670804 | Ga0496121_0670804_123_488 | 121 |
| 470 | 3300048927 | Ga0496124_0075119 | Ga0496124_0075119_2327_2692 | 121 |
| 471 | 3300048927 | Ga0496124_0283675 | Ga0496124_0283675_228_593 | 121 |
| 472 | 3300048928 | Ga0496125_0029780 | Ga0496125_0029780_2208_2573 | 121 |
| 473 | 3300048928 | Ga0496125_0258106 | Ga0496125_0258106_170_535 | 121 |
| 474 | 3300048929 | Ga0496126_0005086 | Ga0496126_0005086_1867_2232 | 121 |
| 475 | 3300049571 | Ga0501034_1516920 | Ga0501034_1516920_133_498 | 121 |
| 476 | 3300049573 | Ga0501037_0778136 | Ga0501037_0778136_200_565 | 121 |
| 477 | 3300049574 | Ga0501038_1393957 | Ga0501038_1393957_15_380 | 121 |
| 478 | 3300049581 | Ga0501047_0004111 | Ga0501047_0004111_11213_11578 | 121 |
| 479 | 3300049581 | Ga0501047_0017073 | Ga0501047_0017073_2933_3298 | 121 |
| 480 | 3300049581 | Ga0501047_0234554 | Ga0501047_0234554_1292_1657 | 121 |
| 481 | 3300049581 | Ga0501047_0515206 | Ga0501047_0515206_375_740 | 121 |
| 482 | 3300049581 | Ga0501047_0678304 | Ga0501047_0678304_174_539 | 121 |
| 483 | 3300049581 | Ga0501047_1079148 | Ga0501047_1079148_234_599 | 121 |
| 484 | 3300049582 | Ga0501048_0197256 | Ga0501048_0197256_253_618 | 121 |
| 485 | 3300049686 | Ga0501257_036880 | Ga0501257_036880_784_1149 | 121 |
| 486 | 3300049823 | Ga0501044_0111380 | Ga0501044_0111380_826_1191 | 121 |
| 487 | 3300049823 | Ga0501044_0524381 | Ga0501044_0524381_528_893 | 121 |
| 488 | 3300049823 | Ga0501044_1195855 | Ga0501044_1195855_97_462 | 121 |
| 489 | 3300050493 | nmdc:mga0k408_118551_c1 | nmdc:mga0k408_118551_c1_452_817 | 121 |
| 490 | 3300050493 | nmdc:mga0k408_798038_c1 | nmdc:mga0k408_798038_c1_134_499 | 121 |
| 491 | 3300050496 | nmdc:mga07m45_652561_c1 | nmdc:mga07m45_652561_c1_186_551 | 121 |
| 492 | 3300050496 | nmdc:mga07m45_95083_c1 | nmdc:mga07m45_95083_c1_906_1271 | 121 |
| 493 | 3300050516 | nmdc:mga0sz30_49421_c1 | nmdc:mga0sz30_49421_c1_717_1082 | 121 |
| 494 | 3300053077 | Ga0495601_0208504 | Ga0495601_0208504_228_593 | 121 |
| 495 | 3300053080 | Ga0500635_0000045 | Ga0500635_0000045_17047_17412 | 121 |
| 496 | 3300053080 | Ga0500635_0121275 | Ga0500635_0121275_243_608 | 121 |
| 497 | 3300053086 | Ga0500578_0000102 | Ga0500578_0000102_59906_60271 | 121 |
| 498 | 3300053087 | Ga0500643_057687 | Ga0500643_057687_38_403 | 121 |
| 499 | 3300053087 | Ga0500643_095746 | Ga0500643_095746_203_568 | 121 |
| 500 | 3300053088 | Ga0500644_0000290 | Ga0500644_0000290_26296_26661 | 121 |
| 501 | 3300053088 | Ga0500644_0154529 | Ga0500644_0154529_82_447 | 121 |
| 502 | 3300053088 | Ga0500644_0502137 | Ga0500644_0502137_25_390 | 121 |
| 503 | 3300053090 | Ga0500646_0178841 | Ga0500646_0178841_206_571 | 121 |
| 504 | 3300053094 | Ga0500566_0175010 | Ga0500566_0175010_708_1073 | 121 |
| 505 | 3300053096 | Ga0500641_0126629 | Ga0500641_0126629_242_607 | 121 |
| 506 | 3300053096 | Ga0500641_0173532 | Ga0500641_0173532_542_907 | 121 |
| 507 | 3300053103 | Ga0500555_000770 | Ga0500555_000770_10669_11034 | 121 |
| 508 | 3300053104 | Ga0500556_0002007 | Ga0500556_0002007_1060_1425 | 121 |
| 509 | 3300053104 | Ga0500556_0130848 | Ga0500556_0130848_279_644 | 121 |
| 510 | 3300053108 | Ga0500562_002145 | Ga0500562_002145_3870_4235 | 121 |
| 511 | 3300053108 | Ga0500562_002785 | Ga0500562_002785_3955_4320 | 121 |
| 512 | 3300053108 | Ga0500562_053104 | Ga0500562_053104_422_787 | 121 |
| 513 | 3300053118 | Ga0500594_0000540 | Ga0500594_0000540_106_471 | 121 |
| 514 | 3300053119 | Ga0500595_106751 | Ga0500595_106751_177_542 | 121 |
| 515 | 3300053121 | Ga0500607_253162 | Ga0500607_253162_17_382 | 121 |
| 516 | 3300053122 | Ga0500608_000037 | Ga0500608_000037_41448_41813 | 121 |
| 517 | 3300053130 | Ga0500642_0207288 | Ga0500642_0207288_38_403 | 121 |
| 518 | 3300053136 | Ga0500559_0000023 | Ga0500559_0000023_14491_14856 | 121 |
| 519 | 3300053136 | Ga0500559_0001365 | Ga0500559_0001365_6212_6577 | 121 |
| 520 | 3300053136 | Ga0500559_0248354 | Ga0500559_0248354_163_528 | 121 |
| 521 | 3300053136 | Ga0500559_0300320 | Ga0500559_0300320_267_632 | 121 |
| 522 | 3300053138 | Ga0500564_000289 | Ga0500564_000289_4159_4524 | 121 |
| 523 | 3300053148 | Ga0500590_142998 | Ga0500590_142998_496_861 | 121 |
| 524 | 3300053153 | Ga0500616_0224846 | Ga0500616_0224846_16_381 | 121 |
| 525 | 3300053156 | Ga0500622_0000674 | Ga0500622_0000674_6562_6927 | 121 |
| 526 | 3300053156 | Ga0500622_0029320 | Ga0500622_0029320_42_407 | 121 |
| 527 | 3300053156 | Ga0500622_0069190 | Ga0500622_0069190_1346_1711 | 121 |
| 528 | 3300053158 | Ga0500627_0005522 | Ga0500627_0005522_1447_1812 | 121 |
| 529 | 3300053163 | Ga0500639_115535 | Ga0500639_115535_671_1036 | 121 |
| 530 | 3300053177 | Ga0500636_0012697 | Ga0500636_0012697_4424_4789 | 121 |
| 531 | 3300053177 | Ga0500636_0059283 | Ga0500636_0059283_1003_1368 | 121 |
| 532 | 3300053178 | Ga0500637_0037054 | Ga0500637_0037054_85_450 | 121 |
| 533 | 3300053730 | Ga0500645_004788 | Ga0500645_004788_3299_3664 | 121 |
| 534 | 3300053731 | Ga0500609_004649 | Ga0500609_004649_1356_1721 | 121 |
| 535 | 3300000041 | ARcpr5oldR_c009756 | ARcpr5oldR_0097562 | 122 |
| 536 | 3300000043 | ARcpr5yngRDRAFT_c009901 | ARcpr5yngRDRAFT_0099012 | 122 |
| 537 | 3300002774 | JGI25150J39212_1025331 | JGI25150J39212_10253311 | 122 |
| 538 | 3300003215 | JGI25153J46596_10038049 | JGI25153J46596_100380492 | 122 |
| 539 | 3300003773 | Ga0055537_1001374 | Ga0055537_10013747 | 122 |
| 540 | 3300003775 | Ga0055524_1001543 | Ga0055524_100154311 | 122 |
| 541 | 3300003791 | Ga0055530_10000596 | Ga0055530_1000059616 | 122 |
| 542 | 3300003791 | Ga0055530_10035865 | Ga0055530_100358652 | 122 |
| 543 | 3300003794 | Ga0055531_10000012 | Ga0055531_1000001261 | 122 |
| 544 | 3300003794 | Ga0055531_10001326 | Ga0055531_1000132611 | 122 |
| 545 | 3300005262 | Ga0065165_1113718 | Ga0065165_11137181 | 122 |
| 546 | 3300005329 | Ga0070683_101085838 | Ga0070683_1010858382 | 122 |
| 547 | 3300005340 | Ga0070689_101398716 | Ga0070689_1013987161 | 122 |
| 548 | 3300005440 | Ga0070705_100470954 | Ga0070705_1004709541 | 122 |
| 549 | 3300005539 | Ga0068853_100636316 | Ga0068853_1006363161 | 122 |
| 550 | 3300005549 | Ga0070704_101631454 | Ga0070704_1016314541 | 122 |
| 551 | 3300009093 | Ga0105240_11370457 | Ga0105240_113704571 | 122 |
| 552 | 3300009094 | Ga0111539_11574640 | Ga0111539_115746402 | 122 |
| 553 | 3300009177 | Ga0105248_11605552 | Ga0105248_116055522 | 122 |
| 554 | 3300013105 | Ga0157369_11514069 | Ga0157369_115140691 | 122 |
| 555 | 3300014325 | Ga0163163_10120681 | Ga0163163_101206812 | 122 |
| 556 | 3300014326 | Ga0157380_11801877 | Ga0157380_118018772 | 122 |
| 557 | 3300021388 | Ga0213875_10100446 | Ga0213875_101004462 | 122 |
| 558 | 3300025245 | Ga0207425_1009019 | Ga0207425_10090192 | 122 |
| 559 | 3300025263 | Ga0209565_1000030 | Ga0209565_1000030175 | 122 |
| 560 | 3300025273 | Ga0209673_1000768 | Ga0209673_10007685 | 122 |
| 561 | 3300025291 | Ga0209675_1043525 | Ga0209675_10435251 | 122 |
| 562 | 3300025297 | Ga0209758_1023081 | Ga0209758_10230813 | 122 |
| 563 | 3300025298 | Ga0209050_1000039 | Ga0209050_1000039261 | 122 |
| 564 | 3300025298 | Ga0209050_1026711 | Ga0209050_10267112 | 122 |
| 565 | 3300025299 | Ga0209256_1000046 | Ga0209256_1000046110 | 122 |
| 566 | 3300025304 | Ga0209257_1000051 | Ga0209257_1000051261 | 122 |
| 567 | 3300025304 | Ga0209257_1000533 | Ga0209257_100053348 | 122 |
| 568 | 3300025914 | Ga0207671_10061666 | Ga0207671_100616662 | 122 |
| 569 | 3300025932 | Ga0207690_10867813 | Ga0207690_108678132 | 122 |
| 570 | 3300025941 | Ga0207711_11953526 | Ga0207711_119535261 | 122 |
| 571 | 3300025981 | Ga0207640_10263297 | Ga0207640_102632972 | 122 |
| 572 | 3300028379 | Ga0268266_11153308 | Ga0268266_111533082 | 122 |
| 573 | 3300028563 | Ga0265319_1001009 | Ga0265319_10010096 | 122 |
| 574 | 3300028573 | Ga0265334_10093185 | Ga0265334_100931852 | 122 |
| 575 | 3300028577 | Ga0265318_10042001 | Ga0265318_100420012 | 122 |
| 576 | 3300028577 | Ga0265318_10136114 | Ga0265318_101361142 | 122 |
| 577 | 3300028577 | Ga0265318_10139953 | Ga0265318_101399531 | 122 |
| 578 | 3300028653 | Ga0265323_10188927 | Ga0265323_101889271 | 122 |
| 579 | 3300028666 | Ga0265336_10033290 | Ga0265336_100332902 | 122 |
| 580 | 3300028666 | Ga0265336_10090801 | Ga0265336_100908012 | 122 |
| 581 | 3300028800 | Ga0265338_10035691 | Ga0265338_100356912 | 122 |
| 582 | 3300028800 | Ga0265338_10172613 | Ga0265338_101726131 | 122 |
| 583 | 3300031235 | Ga0265330_10339093 | Ga0265330_103390932 | 122 |
| 584 | 3300031238 | Ga0265332_10092820 | Ga0265332_100928202 | 122 |
| 585 | 3300031240 | Ga0265320_10027367 | Ga0265320_100273672 | 122 |
| 586 | 3300031240 | Ga0265320_10066321 | Ga0265320_100663212 | 122 |
| 587 | 3300031247 | Ga0265340_10022802 | Ga0265340_100228022 | 122 |
| 588 | 3300031249 | Ga0265339_10188401 | Ga0265339_101884012 | 122 |
| 589 | 3300031250 | Ga0265331_10013895 | Ga0265331_100138955 | 122 |
| 590 | 3300031344 | Ga0265316_10588434 | Ga0265316_105884341 | 122 |
| 591 | 3300031344 | Ga0265316_10931542 | Ga0265316_109315421 | 122 |
| 592 | 3300031712 | Ga0265342_10181535 | Ga0265342_101815352 | 122 |
| 593 | 3300031911 | Ga0307412_10720252 | Ga0307412_107202522 | 122 |
| 594 | 3300037853 | Ga0436364_1032418 | Ga0436364_1032418_390_758 | 122 |
| 595 | 3300039450 | Ga0436363_0351388 | Ga0436363_0351388_637_1008 | 122 |
| 596 | 3300041486 | Ga0451807_0397995 | Ga0451807_0397995_502_882 | 122 |
| 597 | 3300042436 | Ga0439435_0002352 | Ga0439435_0002352_829_1200 | 122 |
| 598 | 3300042437 | Ga0439444_0039228 | Ga0439444_0039228_133_504 | 122 |
| 599 | 3300042876 | Ga0451577_0900684 | Ga0451577_0900684_357_728 | 122 |
| 600 | 3300046660 | Ga0495625_0090268 | Ga0495625_0090268_1629_2003 | 122 |
| 601 | 3300048915 | Ga0496112_0821215 | Ga0496112_0821215_206_607 | 122 |
| 602 | 3300048925 | Ga0496122_0092958 | Ga0496122_0092958_1556_1930 | 122 |
| 603 | 3300048927 | Ga0496124_0003907 | Ga0496124_0003907_16404_16796 | 122 |
| 604 | 3300048928 | Ga0496125_0351534 | Ga0496125_0351534_13_405 | 122 |
| 605 | 3300049571 | Ga0501034_0061114 | Ga0501034_0061114_421_795 | 122 |
| 606 | 3300049573 | Ga0501037_0129883 | Ga0501037_0129883_244_618 | 122 |
| 607 | 3300049574 | Ga0501038_0412811 | Ga0501038_0412811_514_888 | 122 |
| 608 | 3300049575 | Ga0501039_0943344 | Ga0501039_0943344_174_548 | 122 |
| 609 | 3300049579 | Ga0501043_0173124 | Ga0501043_0173124_829_1203 | 122 |
| 610 | 3300049581 | Ga0501047_0239769 | Ga0501047_0239769_732_1106 | 122 |
| 611 | 3300049582 | Ga0501048_0517230 | Ga0501048_0517230_423_797 | 122 |
| 612 | 3300049583 | Ga0501067_0290646 | Ga0501067_0290646_360_734 | 122 |
| 613 | 3300049584 | Ga0501068_0158025 | Ga0501068_0158025_54_434 | 122 |
| 614 | 3300049584 | Ga0501068_0297201 | Ga0501068_0297201_475_849 | 122 |
| 615 | 3300049585 | Ga0501069_0244745 | Ga0501069_0244745_127_501 | 122 |
| 616 | 3300049586 | Ga0501070_0116431 | Ga0501070_0116431_872_1246 | 122 |
| 617 | 3300049587 | Ga0501071_0062133 | Ga0501071_0062133_1726_2100 | 122 |
| 618 | 3300049589 | Ga0501073_0239131 | Ga0501073_0239131_39_410 | 122 |
| 619 | 3300049589 | Ga0501073_0273568 | Ga0501073_0273568_531_905 | 122 |
| 620 | 3300049590 | Ga0501074_0109812 | Ga0501074_0109812_451_825 | 122 |
| 621 | 3300049742 | Ga0501080_1528039 | Ga0501080_1528039_134_508 | 122 |
| 622 | 3300049744 | Ga0501083_0314043 | Ga0501083_0314043_273_647 | 122 |
| 623 | 3300049822 | Ga0501035_1005701 | Ga0501035_1005701_145_519 | 122 |
| 624 | 3300049823 | Ga0501044_0667420 | Ga0501044_0667420_233_607 | 122 |
| 625 | 3300050511 | nmdc:mga08y16_1661854_c1 | nmdc:mga08y16_1661854_c1_177_566 | 122 |
| 626 | 3300059426 | Ga0590077_094482 | Ga0590077_094482_141_515 | 122 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1zko-assembly1.cif.gz_A | crystal structure of glycine cleavage system h protein (tm0212) from thermotoga maritima at 1.65 a resolution | 0.9947 | 1 | 120 |
| 3wdn-assembly1.cif.gz_A | high-resolution x-ray crystal structure of bovine h-protein using a high-pressure cryocooling method | 0.9894 | 1 | 121 |
| 1htp-assembly1.cif.gz_A | refined structures at 2 angstroms and 2.2 angstroms of the two forms of the h-protein, a lipoamide-containing protein of the glycine decarboxylase complex | 0.9875 | 2 | 121 |
| 1onl-assembly3.cif.gz_C | crystal structure of thermus thermophilus hb8 h-protein of the glycine cleavage system | 0.9818 | 2 | 121 |
| 3wdn-assembly1.cif.gz_A | high-resolution x-ray crystal structure of bovine h-protein using a high-pressure cryocooling method | 0.9734 | 1 | 121 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q20634_6_139_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9939 | 2 | 118 | 2.40.50.100 |
| 3wdnA00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9893 | 1 | 121 | 2.40.50.100 |
| af_Q9U616_24_160_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9834 | 2 | 119 | 2.40.50.100 |
| af_Q54JV8_6_144_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9806 | 2 | 119 | 2.40.50.100 |
| af_Q54JU3_2_142_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.977 | 2 | 119 | 2.40.50.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A853FS71-F1-model_v4 | Glycine cleavage system H protein | 1.002 | 2 | 122 |
GO:0005829
GO:0005960 GO:0019464 |
| AF-A0A432VJA8-F1-model_v4 | Glycine cleavage system H protein | 1.002 | 2 | 122 |
GO:0005737
GO:0005960 GO:0019464 |
| AF-A0A0Q6L2U3-F1-model_v4 | Glycine cleavage system H protein | 1.002 | 1 | 122 |
GO:0005829
GO:0005960 GO:0019464 |
| AF-A0A501PQ64-F1-model_v4 | Glycine cleavage system H protein | 1.002 | 2 | 121 |
GO:0005829
GO:0005960 GO:0019464 |
| AF-A0A6I4UL61-F1-model_v4 | Glycine cleavage system H protein | 1.001 | 1 | 122 |
GO:0005829
GO:0005960 GO:0019464 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar