F470442

General Info

Members Datasets Scaffolds Average Seq Length
626 336 594 121

Family's Representative Sequence

Representative Sequence 3300005539|Ga0068853_100636316|Ga0068853_1006363161
Length 144
Sequence MGGPDKPGHDGSQNFGPQLREIAMRFTKDHEWVEVDGDVATVGITAYAAEQLGDVVFVETPEVGKTVKAGDGFAVVESVKAASDVYAPISGEVVEANGILGNSPETVNAAPEAAGWFAKVKLANPAEVEALMDRPAYEAFLQTL

Samples

Sample ID Description Type Environment
1 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
2 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
3 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
4 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
5 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
6 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
7 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
8 2643221584 Caulobacter sp. Root656 Isolate Unclassified
9 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
10 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
11 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
12 2643221640 Caulobacter sp. Root342 Isolate Unclassified
13 2643221642 Caulobacter sp. Root343 Isolate Unclassified
14 2643221649 Leifsonia sp. Root4 Isolate Unclassified
15 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
16 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
17 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
18 2818991435 Caulobacter henricii 536 Isolate Unclassified
19 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
20 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
21 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
22 2849560528 Caulobacter zeae 410 Isolate Unclassified
23 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
24 2851153111 Caulobacter radicis 736 Isolate Unclassified
25 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
26 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
27 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
28 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
29 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
30 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
31 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
32 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
33 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
34 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
35 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
36 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
37 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
38 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
39 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
40 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
41 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
42 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
43 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
44 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
45 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
46 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
47 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
48 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
49 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
50 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
51 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
52 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
53 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
54 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
55 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
56 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
57 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
58 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
59 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
60 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
61 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
62 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
63 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
64 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
65 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
66 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
67 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
68 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
69 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
70 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
71 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
72 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
73 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
74 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
75 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
76 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
77 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
78 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
79 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
80 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
81 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
82 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
83 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
84 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
85 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
86 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
89 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
93 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
94 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
96 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
118 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
119 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
120 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
123 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
124 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
126 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
127 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
129 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
172 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
173 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
174 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
175 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
176 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
177 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
178 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
179 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
180 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
181 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
182 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
183 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
184 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
185 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
186 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
187 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
188 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
189 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
190 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
191 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
192 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
193 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
194 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
195 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
196 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
197 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
198 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
199 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
200 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
201 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
202 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
203 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
204 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
205 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
206 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
207 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
208 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
209 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
210 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
211 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
212 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
213 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
214 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
215 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
216 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
217 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
218 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
219 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
220 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
221 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
222 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
223 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
224 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
225 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
226 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
227 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
228 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
229 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
230 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
231 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
232 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
233 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
234 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
235 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
236 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
237 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
238 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
239 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
240 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
241 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
242 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
243 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
244 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
245 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
246 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
247 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
248 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
249 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
250 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
251 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
252 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
253 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
254 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
255 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
256 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
257 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
258 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
259 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
260 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
261 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
262 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
263 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
264 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
265 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
266 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
267 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
268 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
269 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
270 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
271 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
272 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
273 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
274 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
275 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
276 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
277 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
278 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
279 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
280 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
281 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
282 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
283 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
284 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
292 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
293 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
294 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
295 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
296 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
297 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
298 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
299 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
300 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
301 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
303 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
304 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
305 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
306 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
307 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
308 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
309 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
310 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
311 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
312 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
313 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
314 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
315 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
316 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
317 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
318 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
319 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
320 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
321 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
322 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
323 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
324 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
325 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
326 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
327 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
328 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
329 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
330 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
331 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
332 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
333 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
334 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
335 8046352972 Agromyces mangrovi NBRC 112812 Isolate Rhizosphere
336 8054002106 Azospirillum lipoferum 59b Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.89
Metatranscriptomes 0
Isolates 5.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.09
Nodule 0
Rhizoplane 4.47
Rhizosphere 70.45
Stem 0
Stem Tuber 0
Unclassified 7.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARcpr5oldR_c009756 3300000041 Bacteria 815
2 ARcpr5yngRDRAFT_c009901 3300000043 Bacteria 812
3 JGI25150J39212_1025331 3300002774 Bacteria 867
4 JGI25153J46596_10019850 3300003215 Bacteria 2559
5 JGI25153J46596_10038049 3300003215 Bacteria 1522
6 JGI25153J46596_10086712 3300003215 Bacteria 766
7 Ga0055526_1013317 3300003771 Bacteria 3490
8 Ga0055526_1063969 3300003771 Bacteria 772
9 Ga0055537_1001374 3300003773 Bacteria 9739
10 Ga0055537_1008763 3300003773 Bacteria 2297
11 Ga0055524_1001543 3300003775 Bacteria 13030
12 Ga0055524_1005141 3300003775 Bacteria 5908
13 Ga0055524_1026703 3300003775 Bacteria 1776
14 Ga0055524_1055908 3300003775 Bacteria 853
15 Ga0055536_1000905 3300003781 Bacteria 19181
16 Ga0055536_1000910 3300003781 Bacteria 19125
17 Ga0055528_1009105 3300003790 Bacteria 4185
18 Ga0055528_1096392 3300003790 Bacteria 503
19 Ga0055530_10000596 3300003791 Bacteria 31254
20 Ga0055530_10009556 3300003791 Bacteria 3710
21 Ga0055530_10035865 3300003791 Bacteria 1253
22 Ga0055531_10000012 3300003794 Bacteria 191187
23 Ga0055531_10001326 3300003794 Bacteria 18512
24 Ga0055531_10001529 3300003794 Bacteria 16949
25 Ga0055531_10003074 3300003794 Bacteria 10794
26 Ga0065165_1003707 3300005262 Bacteria 10348
27 Ga0065165_1113718 3300005262 Bacteria 663
28 Ga0065707_10939732 3300005295 Bacteria 555
29 Ga0070658_10242366 3300005327 Bacteria 1528
30 Ga0070658_10276590 3300005327 Bacteria 1428
31 Ga0070658_10400212 3300005327 Bacteria 1179
32 Ga0070683_101085838 3300005329 Bacteria 769
33 Ga0070683_102057462 3300005329 Bacteria 548
34 Ga0070670_100000032 3300005331 Bacteria 158514
35 Ga0070670_100518115 3300005331 Bacteria 1062
36 Ga0070677_10482366 3300005333 Bacteria 669
37 Ga0070666_10032870 3300005335 Bacteria 3429
38 Ga0070666_10268620 3300005335 Bacteria 1210
39 Ga0070666_10539802 3300005335 Bacteria 848
40 Ga0070680_100029974 3300005336 Bacteria 4368
41 Ga0068868_100138306 3300005338 Bacteria 1998
42 Ga0070660_100902960 3300005339 Bacteria 745
43 Ga0070689_101398716 3300005340 Bacteria 632
44 Ga0070691_10012155 3300005341 Bacteria 3942
45 Ga0070661_100125835 3300005344 Bacteria 1923
46 Ga0070668_100000702 3300005347 Bacteria 22873
47 Ga0070668_100005927 3300005347 Bacteria 9057
48 Ga0070668_100008316 3300005347 Bacteria 7703
49 Ga0070668_100111636 3300005347 Bacteria 2176
50 Ga0070668_100326803 3300005347 Bacteria 1292
51 Ga0070671_100078320 3300005355 Bacteria 2763
52 Ga0070671_100158098 3300005355 Bacteria 1915
53 Ga0070671_100517686 3300005355 Bacteria 1027
54 Ga0070673_100147028 3300005364 Bacteria 1993
55 Ga0070659_100001930 3300005366 Bacteria 14815
56 Ga0070659_100004321 3300005366 Bacteria 10146
57 Ga0070667_100000387 3300005367 Bacteria 47707
58 Ga0070667_100817494 3300005367 Bacteria 865
59 Ga0070667_100833523 3300005367 Bacteria 857
60 Ga0070667_101327588 3300005367 Bacteria 674
61 Ga0070705_100470954 3300005440 Bacteria 947
62 Ga0070705_101811799 3300005440 Bacteria 518
63 Ga0070678_100132952 3300005456 Bacteria 1980
64 Ga0070662_100230211 3300005457 Bacteria 1482
65 Ga0070662_100302017 3300005457 Bacteria 1301
66 Ga0070681_10563906 3300005458 Bacteria 1052
67 Ga0068867_101138848 3300005459 Bacteria 714
68 Ga0070685_10957329 3300005466 Bacteria 640
69 Ga0070679_100040495 3300005530 Bacteria 4635
70 Ga0070679_101528034 3300005530 Bacteria 615
71 Ga0068853_100003476 3300005539 Bacteria 12049
72 Ga0068853_100393618 3300005539 Bacteria 1296
73 Ga0068853_100496449 3300005539 Bacteria 1152
74 Ga0068853_100636316 3300005539 Bacteria 1014
75 Ga0070686_100346285 3300005544 Bacteria 1115
76 Ga0070696_100570328 3300005546 Bacteria 909
77 Ga0070696_100913029 3300005546 Bacteria 729
78 Ga0070693_100718873 3300005547 Bacteria 733
79 Ga0070665_100000136 3300005548 Bacteria 138094
80 Ga0070665_100001151 3300005548 Bacteria 32520
81 Ga0070665_101372920 3300005548 Bacteria 716
82 Ga0070704_100638592 3300005549 Bacteria 939
83 Ga0070704_101631454 3300005549 Bacteria 595
84 Ga0068855_100097020 3300005563 Bacteria 3395
85 Ga0068855_100147645 3300005563 Bacteria 2675
86 Ga0068855_100327833 3300005563 Bacteria 1691
87 Ga0068855_100820023 3300005563 Bacteria 988
88 Ga0070664_100932410 3300005564 Bacteria 815
89 Ga0068857_100298544 3300005577 Bacteria 1485
90 Ga0068857_102251207 3300005577 Bacteria 535
91 Ga0068854_101752688 3300005578 Bacteria 569
92 Ga0068856_100351334 3300005614 Bacteria 1493
93 Ga0068856_101743438 3300005614 Bacteria 635
94 Ga0068859_100042143 3300005617 Bacteria 4585
95 Ga0068859_100128836 3300005617 Bacteria 2601
96 Ga0068859_101422116 3300005617 Bacteria 765
97 Ga0068864_100000491 3300005618 Bacteria 34223
98 Ga0068864_100001848 3300005618 Bacteria 17418
99 Ga0068864_100065251 3300005618 Bacteria 3158
100 Ga0068864_100443278 3300005618 Bacteria 1241
101 Ga0068864_101359056 3300005618 Bacteria 712
102 Ga0068861_100406812 3300005719 Bacteria 1209
103 Ga0068861_101378140 3300005719 Bacteria 688
104 Ga0068863_100004096 3300005841 Bacteria 14401
105 Ga0068863_100005840 3300005841 Bacteria 12058
106 Ga0068863_100560702 3300005841 Bacteria 1128
107 Ga0068863_101378577 3300005841 Bacteria 713
108 Ga0068863_102520841 3300005841 Bacteria 523
109 Ga0068858_100012067 3300005842 Bacteria 8142
110 Ga0068858_100044239 3300005842 Bacteria 4128
111 Ga0068858_100469579 3300005842 Bacteria 1214
112 Ga0068858_101451656 3300005842 Bacteria 676
113 Ga0068860_100000100 3300005843 Bacteria 144580
114 Ga0068860_100000167 3300005843 Bacteria 108234
115 Ga0068862_100117199 3300005844 Bacteria 2343
116 Ga0068862_100230870 3300005844 Bacteria 1679
117 Ga0068862_100341966 3300005844 Bacteria 1386
118 Ga0068862_100347893 3300005844 Bacteria 1374
119 Ga0075369_10001997 3300006186 Bacteria 7178
120 Ga0075366_10014506 3300006195 Bacteria 4500
121 Ga0075366_10169386 3300006195 Bacteria 1325
122 Ga0097621_101822345 3300006237 Bacteria 580
123 Ga0075370_10141327 3300006353 Bacteria 1407
124 Ga0075370_10153795 3300006353 Bacteria 1348
125 Ga0068871_100819917 3300006358 Bacteria 859
126 Ga0068865_100000195 3300006881 Bacteria 33732
127 Ga0097620_100042143 3300006931 Bacteria 4585
128 Ga0097620_100128817 3300006931 Bacteria 2601
129 Ga0097620_101422433 3300006931 Bacteria 765
130 Ga0105250_10010734 3300009092 Bacteria 3811
131 Ga0105240_10000581 3300009093 Bacteria 67884
132 Ga0105240_10008814 3300009093 Bacteria 14369
133 Ga0105240_10038728 3300009093 Bacteria 6112
134 Ga0105240_10449085 3300009093 Bacteria 1443
135 Ga0105240_11370457 3300009093 Bacteria 744
136 Ga0105240_12070353 3300009093 Bacteria 591
137 Ga0105240_12618992 3300009093 Bacteria 521
138 Ga0111539_11574640 3300009094 Bacteria 762
139 Ga0105245_10213735 3300009098 Bacteria 1857
140 Ga0105247_10198741 3300009101 Bacteria 1346
141 Ga0105241_12283228 3300009174 Bacteria 538
142 Ga0105242_12517972 3300009176 Bacteria 563
143 Ga0105248_10003790 3300009177 Bacteria 16748
144 Ga0105248_10286267 3300009177 Bacteria 1855
145 Ga0105248_11091965 3300009177 Bacteria 902
146 Ga0105248_11227002 3300009177 Bacteria 848
147 Ga0105248_11334453 3300009177 Bacteria 811
148 Ga0105248_11605552 3300009177 Bacteria 737
149 Ga0105248_11873537 3300009177 Bacteria 680
150 Ga0105237_10527250 3300009545 Bacteria 1188
151 Ga0105238_10007249 3300009551 Bacteria 11101
152 Ga0105238_10700955 3300009551 Bacteria 1024
153 Ga0105238_10748753 3300009551 Bacteria 991
154 Ga0105238_11984477 3300009551 Bacteria 615
155 Ga0105238_12366078 3300009551 Bacteria 567
156 Ga0105249_10001354 3300009553 Bacteria 21412
157 Ga0105249_10215538 3300009553 Bacteria 1887
158 Ga0105032_101996 3300009979 Bacteria 1845
159 Ga0105239_10496336 3300010375 Bacteria 1388
160 Ga0105239_12162199 3300010375 Bacteria 647
161 Ga0105239_12670659 3300010375 Bacteria 583
162 Ga0157373_10003677 3300013100 Bacteria 11602
163 Ga0157373_10037336 3300013100 Bacteria 3483
164 Ga0157370_10355448 3300013104 Bacteria 1350
165 Ga0157369_10328289 3300013105 Bacteria 1590
166 Ga0157369_11514069 3300013105 Bacteria 682
167 Ga0163162_10060119 3300013306 Bacteria 3834
168 Ga0163162_10214864 3300013306 Bacteria 2053
169 Ga0163162_11304738 3300013306 Bacteria 825
170 Ga0157372_11479643 3300013307 Bacteria 782
171 Ga0157375_10224663 3300013308 Bacteria 2037
172 Ga0157375_11116199 3300013308 Bacteria 923
173 Ga0163163_10045475 3300014325 Bacteria 4309
174 Ga0163163_10120681 3300014325 Bacteria 2655
175 Ga0163163_10122100 3300014325 Bacteria 2639
176 Ga0163163_10371871 3300014325 Bacteria 1486
177 Ga0163163_10542448 3300014325 Bacteria 1225
178 Ga0157380_11801877 3300014326 Bacteria 671
179 Ga0182008_10255553 3300014497 Bacteria 905
180 Ga0157379_10149251 3300014968 Bacteria 2109
181 Ga0157376_10405847 3300014969 Bacteria 1319
182 Ga0163161_10207934 3300017792 Bacteria 1511
183 Ga0163161_11082300 3300017792 Bacteria 688
184 Ga0163161_11737738 3300017792 Bacteria 553
185 Ga0213876_10015657 3300021384 Bacteria 4014
186 Ga0213875_10100446 3300021388 Bacteria 1350
187 Ga0207425_1009019 3300025245 Bacteria 2509
188 Ga0209148_1030050 3300025254 Bacteria 817
189 Ga0209565_1000030 3300025263 Bacteria 325058
190 Ga0209565_1000552 3300025263 Bacteria 26049
191 Ga0209673_1000768 3300025273 Bacteria 43336
192 Ga0209673_1036209 3300025273 Bacteria 1468
193 Ga0209675_1002582 3300025291 Bacteria 9191
194 Ga0209675_1043525 3300025291 Bacteria 966
195 Ga0209676_1000043 3300025292 Bacteria 418680
196 Ga0209676_1000392 3300025292 Bacteria 79950
197 Ga0209564_1003574 3300025295 Bacteria 10395
198 Ga0209564_1022562 3300025295 Bacteria 2219
199 Ga0209564_1028726 3300025295 Bacteria 1768
200 Ga0209758_1004179 3300025297 Bacteria 12271
201 Ga0209758_1006159 3300025297 Bacteria 8785
202 Ga0209758_1023081 3300025297 Bacteria 2826
203 Ga0209050_1000039 3300025298 Bacteria 410069
204 Ga0209050_1001794 3300025298 Bacteria 21075
205 Ga0209050_1001959 3300025298 Bacteria 19483
206 Ga0209050_1023621 3300025298 Bacteria 2156
207 Ga0209050_1026711 3300025298 Bacteria 1924
208 Ga0209256_1000046 3300025299 Bacteria 325040
209 Ga0209256_1001825 3300025299 Bacteria 19903
210 Ga0209256_1004214 3300025299 Bacteria 9233
211 Ga0209256_1009352 3300025299 Bacteria 4318
212 Ga0209051_1002664 3300025303 Bacteria 12491
213 Ga0209257_1000051 3300025304 Bacteria 434166
214 Ga0209257_1000186 3300025304 Bacteria 154365
215 Ga0209257_1000533 3300025304 Bacteria 66037
216 Ga0209257_1000616 3300025304 Bacteria 57900
217 Ga0209257_1009235 3300025304 Bacteria 5344
218 Ga0207696_1070448 3300025711 Bacteria 972
219 Ga0207680_10481387 3300025903 Bacteria 883
220 Ga0207645_10488724 3300025907 Bacteria 833
221 Ga0207705_10016114 3300025909 Bacteria 5362
222 Ga0207705_10158546 3300025909 Bacteria 1699
223 Ga0207705_10586000 3300025909 Bacteria 867
224 Ga0207707_10153412 3300025912 Bacteria 2014
225 Ga0207695_10000595 3300025913 Bacteria 72573
226 Ga0207695_10001322 3300025913 Bacteria 42020
227 Ga0207695_10004246 3300025913 Bacteria 19682
228 Ga0207695_10027094 3300025913 Bacteria 6384
229 Ga0207695_10140957 3300025913 Bacteria 2359
230 Ga0207671_10061666 3300025914 Bacteria 2783
231 Ga0207671_10720305 3300025914 Bacteria 793
232 Ga0207660_10002459 3300025917 Bacteria 12167
233 Ga0207657_10001400 3300025919 Bacteria 25701
234 Ga0207657_10630268 3300025919 Bacteria 835
235 Ga0207649_10163310 3300025920 Bacteria 1545
236 Ga0207649_10739020 3300025920 Bacteria 765
237 Ga0207652_10006051 3300025921 Bacteria 9792
238 Ga0207652_10435873 3300025921 Bacteria 1182
239 Ga0207681_10196104 3300025923 Bacteria 1548
240 Ga0207681_10232733 3300025923 Bacteria 1431
241 Ga0207681_10954435 3300025923 Bacteria 719
242 Ga0207694_10086016 3300025924 Bacteria 2475
243 Ga0207694_10112362 3300025924 Bacteria 2168
244 Ga0207694_10218073 3300025924 Bacteria 1555
245 Ga0207694_10918490 3300025924 Bacteria 740
246 Ga0207694_11302121 3300025924 Bacteria 615
247 Ga0207694_11871296 3300025924 Bacteria 504
248 Ga0207650_10000074 3300025925 Bacteria 134837
249 Ga0207650_10116804 3300025925 Bacteria 2072
250 Ga0207650_10209839 3300025925 Bacteria 1564
251 Ga0207650_10266150 3300025925 Bacteria 1392
252 Ga0207650_10987671 3300025925 Bacteria 716
253 Ga0207687_10259178 3300025927 Bacteria 1385
254 Ga0207644_10389609 3300025931 Bacteria 1137
255 Ga0207690_10144289 3300025932 Bacteria 1758
256 Ga0207690_10867813 3300025932 Bacteria 748
257 Ga0207706_10029362 3300025933 Bacteria 4909
258 Ga0207686_11388843 3300025934 Bacteria 578
259 Ga0207704_10016516 3300025938 Bacteria 3795
260 Ga0207711_10001500 3300025941 Bacteria 21752
261 Ga0207711_10324816 3300025941 Bacteria 1422
262 Ga0207711_10436626 3300025941 Bacteria 1218
263 Ga0207711_10838868 3300025941 Bacteria 855
264 Ga0207711_10921967 3300025941 Bacteria 812
265 Ga0207711_11953526 3300025941 Bacteria 530
266 Ga0207679_10019722 3300025945 Bacteria 4538
267 Ga0207679_10439140 3300025945 Bacteria 1155
268 Ga0207667_10054152 3300025949 Bacteria 4220
269 Ga0207667_10061067 3300025949 Bacteria 3944
270 Ga0207667_10429810 3300025949 Bacteria 1343
271 Ga0207667_10588797 3300025949 Bacteria 1122
272 Ga0207667_10827552 3300025949 Bacteria 921
273 Ga0207651_10185558 3300025960 Bacteria 1654
274 Ga0207712_10011454 3300025961 Bacteria 5648
275 Ga0207712_10138362 3300025961 Bacteria 1865
276 Ga0207668_10000093 3300025972 Bacteria 64280
277 Ga0207668_10002915 3300025972 Bacteria 10040
278 Ga0207668_10015103 3300025972 Bacteria 4793
279 Ga0207668_10407039 3300025972 Bacteria 1151
280 Ga0207668_10471148 3300025972 Bacteria 1075
281 Ga0207640_10263297 3300025981 Bacteria 1345
282 Ga0207640_10535988 3300025981 Bacteria 981
283 Ga0207658_10000266 3300025986 Bacteria 55102
284 Ga0207658_10020936 3300025986 Bacteria 4533
285 Ga0207658_10603174 3300025986 Bacteria 986
286 Ga0207658_11189273 3300025986 Bacteria 697
287 Ga0207658_12115324 3300025986 Bacteria 511
288 Ga0207703_10001734 3300026035 Bacteria 19606
289 Ga0207703_10005822 3300026035 Bacteria 9873
290 Ga0207703_10157248 3300026035 Bacteria 1988
291 Ga0207703_10523962 3300026035 Bacteria 1115
292 Ga0207639_10008239 3300026041 Bacteria 7138
293 Ga0207639_10383425 3300026041 Bacteria 1263
294 Ga0207639_10605062 3300026041 Bacteria 1011
295 Ga0207702_10570866 3300026078 Bacteria 1108
296 Ga0207702_10725094 3300026078 Bacteria 980
297 Ga0207702_10789418 3300026078 Bacteria 938
298 Ga0207641_10004778 3300026088 Bacteria 11683
299 Ga0207641_10008000 3300026088 Bacteria 8763
300 Ga0207641_10550218 3300026088 Bacteria 1125
301 Ga0207641_10897052 3300026088 Bacteria 880
302 Ga0207641_11405232 3300026088 Bacteria 699
303 Ga0207676_10003303 3300026095 Bacteria 11450
304 Ga0207676_10003513 3300026095 Bacteria 11090
305 Ga0207676_10003975 3300026095 Bacteria 10431
306 Ga0207674_10091603 3300026116 Bacteria 3030
307 Ga0207675_100311305 3300026118 Bacteria 1536
308 Ga0207675_100671105 3300026118 Bacteria 1044
309 Ga0207675_101316988 3300026118 Bacteria 743
310 Ga0207683_10175967 3300026121 Bacteria 1939
311 Ga0207683_10282675 3300026121 Bacteria 1516
312 Ga0207698_11023948 3300026142 Bacteria 837
313 Ga0268266_10000003 3300028379 Bacteria 1701703
314 Ga0268266_10006422 3300028379 Bacteria 10768
315 Ga0268266_11153308 3300028379 Bacteria 750
316 Ga0268266_11171129 3300028379 Bacteria 743
317 Ga0268265_10000648 3300028380 Bacteria 34549
318 Ga0268265_10003084 3300028380 Bacteria 12164
319 Ga0268265_10130801 3300028380 Bacteria 2085
320 Ga0268265_10148036 3300028380 Bacteria 1976
321 Ga0268264_10000002 3300028381 Bacteria 1153045
322 Ga0268264_10000068 3300028381 Bacteria 275708
323 Ga0265319_1001009 3300028563 Bacteria 17574
324 Ga0265334_10093185 3300028573 Bacteria 1097
325 Ga0265318_10042001 3300028577 Bacteria 1736
326 Ga0265318_10136114 3300028577 Bacteria 903
327 Ga0265318_10139953 3300028577 Bacteria 889
328 Ga0265323_10188927 3300028653 Bacteria 650
329 Ga0265336_10033290 3300028666 Bacteria 1596
330 Ga0265336_10090801 3300028666 Bacteria 910
331 Ga0307517_10023613 3300028786 Bacteria 7632
332 Ga0307517_10102272 3300028786 Bacteria 2248
333 Ga0307515_10088331 3300028794 Bacteria 3919
334 Ga0307515_10148947 3300028794 Bacteria 2459
335 Ga0265338_10035691 3300028800 Bacteria 4771
336 Ga0265338_10064888 3300028800 Bacteria 3172
337 Ga0265338_10119548 3300028800 Bacteria 2103
338 Ga0265338_10172613 3300028800 Bacteria 1656
339 Ga0265330_10339093 3300031235 Bacteria 635
340 Ga0265332_10092820 3300031238 Bacteria 1276
341 Ga0265320_10027367 3300031240 Bacteria 2973
342 Ga0265320_10066321 3300031240 Bacteria 1711
343 Ga0265340_10022802 3300031247 Bacteria 3197
344 Ga0265339_10188401 3300031249 Bacteria 1024
345 Ga0265331_10013895 3300031250 Bacteria 4307
346 Ga0265327_10005457 3300031251 Bacteria 10606
347 Ga0265316_10588434 3300031344 Bacteria 790
348 Ga0265316_10931542 3300031344 Bacteria 606
349 Ga0307513_10001689 3300031456 Bacteria 31587
350 Ga0307513_10012006 3300031456 Bacteria 10723
351 Ga0307513_10019458 3300031456 Bacteria 8083
352 Ga0307408_100172102 3300031548 Bacteria 1730
353 Ga0307508_10587866 3300031616 Bacteria 714
354 Ga0265342_10181535 3300031712 Bacteria 1152
355 Ga0307516_10002970 3300031730 Bacteria 22191
356 Ga0307405_11935990 3300031731 Bacteria 526
357 Ga0307413_11582712 3300031824 Bacteria 581
358 Ga0307406_10165441 3300031901 Bacteria 1595
359 Ga0307406_10893511 3300031901 Bacteria 756
360 Ga0307406_11245889 3300031901 Bacteria 647
361 Ga0307412_10720252 3300031911 Bacteria 858
362 Ga0307412_11178837 3300031911 Bacteria 685
363 Ga0307409_102041013 3300031995 Bacteria 603
364 Ga0307416_100346055 3300032002 Bacteria 1502
365 Ga0307414_11861759 3300032004 Bacteria 561
366 Ga0307510_10091868 3300033180 Bacteria 2875
367 Ga0307510_10605315 3300033180 Bacteria 548
368 Ga0373944_0047566 3300035089 Bacteria 1344
369 Ga0373932_0309369 3300035112 Bacteria 592
370 Ga0373936_0012346 3300035113 Bacteria 3249
371 Ga0373935_0840883 3300035692 Bacteria 679
372 Ga0373935_0871416 3300035692 Bacteria 666
373 Ga0373935_1095332 3300035692 Bacteria 593
374 Ga0373927_0000886 3300035695 Bacteria 22786
375 Ga0373925_0000160 3300037068 Bacteria 72172
376 Ga0395899_0000260 3300037312 Bacteria 69458
377 Ga0395899_0065302 3300037312 Bacteria 2674
378 Ga0395899_0172126 3300037312 Bacteria 1524
379 Ga0395900_0000008 3300037418 Bacteria 480459
380 Ga0395900_0045875 3300037418 Bacteria 4501
381 Ga0395900_0185225 3300037418 Bacteria 2113
382 Ga0395900_0375054 3300037418 Bacteria 1392
383 Ga0395900_1322695 3300037418 Bacteria 634
384 Ga0395898_0243013 3300037466 Bacteria 1717
385 Ga0395898_0664133 3300037466 Bacteria 984
386 Ga0395905_0002508 3300037471 Bacteria 20281
387 Ga0395905_0011635 3300037471 Bacteria 8499
388 Ga0436364_1032418 3300037853 Bacteria 1770
389 Ga0395901_0000008 3300038443 Bacteria 495962
390 Ga0395901_0547882 3300038443 Bacteria 1173
391 Ga0395901_0785420 3300038443 Bacteria 942
392 Ga0436365_0658056 3300039437 Bacteria 4484
393 Ga0436365_1349197 3300039437 Bacteria 670
394 Ga0436361_0314376 3300039447 Bacteria 17837
395 Ga0436363_0351388 3300039450 Bacteria 1034
396 Ga0436363_0665676 3300039450 Bacteria 532
397 Ga0451789_0317317 3300041443 Bacteria 537
398 Ga0451807_0397995 3300041486 Bacteria 898
399 Ga0451835_0347279 3300041492 Bacteria 627
400 Ga0451847_0643662 3300041503 Bacteria 817
401 Ga0451853_1525706 3300041512 Bacteria 576
402 Ga0439441_018014 3300042001 Bacteria 1274
403 Ga0439435_0002352 3300042436 Bacteria 3737
404 Ga0439444_0039228 3300042437 Bacteria 923
405 Ga0439459_0002303 3300042438 Bacteria 2931
406 Ga0451577_0900684 3300042876 Unclassified 796
407 Ga0466957_1034745 3300044842 Bacteria 591
408 Ga0466958_0658897 3300045836 Bacteria 682
409 Ga0466958_0819632 3300045836 Bacteria 607
410 Ga0495590_0001696 3300046457 Bacteria 9363
411 Ga0495629_1011557 3300046459 Bacteria 541
412 Ga0495638_0001383 3300046460 Bacteria 22119
413 Ga0495638_0002620 3300046460 Bacteria 14480
414 Ga0495638_0016210 3300046460 Bacteria 4995
415 Ga0495650_0000024 3300046471 Bacteria 496674
416 Ga0495585_0083463 3300046492 Bacteria 1729
417 Ga0495607_0050793 3300046501 Bacteria 2412
418 Ga0495583_0246547 3300046506 Bacteria 717
419 Ga0495606_0004488 3300046507 Bacteria 13913
420 Ga0495606_0229571 3300046507 Bacteria 1041
421 Ga0495610_0012692 3300046512 Bacteria 5050
422 Ga0495610_0098285 3300046512 Bacteria 1315
423 Ga0495616_0007196 3300046513 Bacteria 6670
424 Ga0495616_0072190 3300046513 Bacteria 1667
425 Ga0495616_0146747 3300046513 Bacteria 1070
426 Ga0495620_0021961 3300046515 Bacteria 3086
427 Ga0495631_0000540 3300046518 Bacteria 25409
428 Ga0495632_0003150 3300046519 Bacteria 11925
429 Ga0495648_0000029 3300046524 Bacteria 223499
430 Ga0495648_0094859 3300046524 Bacteria 1661
431 Ga0495648_0380805 3300046524 Bacteria 636
432 Ga0495648_0399852 3300046524 Bacteria 614
433 Ga0495648_0509897 3300046524 Bacteria 514
434 Ga0495663_0074096 3300046525 Bacteria 1088
435 Ga0495642_0016600 3300046528 Bacteria 2872
436 Ga0495654_0000226 3300046530 Bacteria 52630
437 Ga0495654_0072563 3300046530 Bacteria 1629
438 Ga0495665_0193677 3300046531 Bacteria 1055
439 Ga0495587_0577130 3300046536 Bacteria 620
440 Ga0495609_0193888 3300046538 Bacteria 851
441 Ga0495597_0109881 3300046542 Bacteria 1156
442 Ga0495597_0264264 3300046542 Bacteria 673
443 Ga0495633_0117835 3300046558 Bacteria 1230
444 Ga0495668_0000141 3300046616 Bacteria 108840
445 Ga0495668_0011679 3300046616 Bacteria 5247
446 Ga0495668_0037370 3300046616 Bacteria 2716
447 Ga0495668_0047260 3300046616 Bacteria 2390
448 Ga0495668_0084968 3300046616 Bacteria 1735
449 Ga0495668_0112566 3300046616 Bacteria 1489
450 Ga0495625_0085870 3300046660 Bacteria 2183
451 Ga0495625_0087855 3300046660 Bacteria 2154
452 Ga0495625_0090268 3300046660 Bacteria 2120
453 Ga0495625_0099813 3300046660 Bacteria 1995
454 Ga0495625_0204179 3300046660 Bacteria 1302
455 Ga0495659_0226385 3300046664 Bacteria 773
456 Ga0495659_0513534 3300046664 Bacteria 526
457 Ga0495588_0048257 3300046674 Bacteria 2187
458 Ga0495588_0265893 3300046674 Bacteria 904
459 Ga0495599_0195290 3300046678 Bacteria 1244
460 Ga0495658_0605069 3300046683 Bacteria 702
461 Ga0495669_0000012 3300046684 Bacteria 157373
462 Ga0495669_0000109 3300046684 Bacteria 53382
463 Ga0495669_0454219 3300046684 Bacteria 622
464 Ga0495671_0073107 3300046692 Bacteria 1683
465 Ga0495671_0146413 3300046692 Bacteria 1150
466 Ga0495660_0073886 3300046810 Bacteria 1802
467 Ga0495660_0148135 3300046810 Bacteria 1161
468 Ga0495674_0118732 3300047319 Bacteria 2236
469 Ga0495672_0509623 3300047320 Bacteria 533
470 Ga0495683_0222124 3300047323 Bacteria 842
471 Ga0495673_0000342 3300047469 Bacteria 58945
472 Ga0495681_0071183 3300047470 Bacteria 1575
473 Ga0495681_0085939 3300047470 Bacteria 1396
474 Ga0495686_0094683 3300047472 Bacteria 1809
475 Ga0495614_0531047 3300048089 Bacteria 562
476 Ga0496101_0334584 3300048904 Bacteria 1189
477 Ga0496101_0346961 3300048904 Bacteria 1166
478 Ga0496102_0081137 3300048905 Bacteria 2990
479 Ga0496103_0026473 3300048906 Bacteria 3511
480 Ga0496103_0141771 3300048906 Bacteria 1537
481 Ga0496105_0601488 3300048908 Bacteria 853
482 Ga0496106_0025542 3300048909 Bacteria 4397
483 Ga0496106_0123528 3300048909 Bacteria 2025
484 Ga0496107_0001980 3300048910 Bacteria 13038
485 Ga0496108_0018886 3300048911 Bacteria 5653
486 Ga0496109_0017572 3300048912 Bacteria 6272
487 Ga0496109_1685243 3300048912 Bacteria 568
488 Ga0496110_0383193 3300048913 Bacteria 1281
489 Ga0496111_0194131 3300048914 Bacteria 1509
490 Ga0496112_0067842 3300048915 Bacteria 3521
491 Ga0496112_0226006 3300048915 Bacteria 1827
492 Ga0496112_0283548 3300048915 Bacteria 1603
493 Ga0496112_0821215 3300048915 Unclassified 854
494 Ga0496113_0274602 3300048916 Bacteria 1347
495 Ga0496113_0308891 3300048916 Bacteria 1267
496 Ga0496114_0665695 3300048917 Bacteria 915
497 Ga0496115_0000210 3300048918 Bacteria 54070
498 Ga0496115_0000966 3300048918 Bacteria 20875
499 Ga0496115_0105062 3300048918 Bacteria 2318
500 Ga0496115_0169209 3300048918 Bacteria 1807
501 Ga0496115_0191049 3300048918 Bacteria 1692
502 Ga0496121_0004298 3300048924 Bacteria 19307
503 Ga0496121_0670804 3300048924 Bacteria 628
504 Ga0496122_0092958 3300048925 Bacteria 2048
505 Ga0496124_0003907 3300048927 Bacteria 17812
506 Ga0496124_0075119 3300048927 Bacteria 2792
507 Ga0496124_0283675 3300048927 Bacteria 1206
508 Ga0496125_0029780 3300048928 Bacteria 4898
509 Ga0496125_0258106 3300048928 Bacteria 1094
510 Ga0496125_0351534 3300048928 Bacteria 880
511 Ga0496126_0005086 3300048929 Bacteria 15258
512 Ga0501034_0061114 3300049571 Bacteria 3784
513 Ga0501034_1516920 3300049571 Bacteria 544
514 Ga0501037_0129883 3300049573 Bacteria 1807
515 Ga0501037_0778136 3300049573 Bacteria 633
516 Ga0501038_0412811 3300049574 Bacteria 1043
517 Ga0501038_1393957 3300049574 Bacteria 504
518 Ga0501039_0943344 3300049575 Bacteria 671
519 Ga0501043_0173124 3300049579 Bacteria 1684
520 Ga0501047_0004111 3300049581 Bacteria 13694
521 Ga0501047_0017073 3300049581 Bacteria 6941
522 Ga0501047_0234554 3300049581 Bacteria 1687
523 Ga0501047_0239769 3300049581 Bacteria 1664
524 Ga0501047_0515206 3300049581 Bacteria 1022
525 Ga0501047_0678304 3300049581 Bacteria 849
526 Ga0501047_1079148 3300049581 Bacteria 616
527 Ga0501048_0197256 3300049582 Bacteria 1427
528 Ga0501048_0517230 3300049582 Bacteria 856
529 Ga0501067_0290646 3300049583 Bacteria 910
530 Ga0501068_0158025 3300049584 Bacteria 1428
531 Ga0501068_0297201 3300049584 Bacteria 1033
532 Ga0501069_0244745 3300049585 Bacteria 1045
533 Ga0501070_0116431 3300049586 Bacteria 2207
534 Ga0501071_0062133 3300049587 Bacteria 2706
535 Ga0501073_0239131 3300049589 Bacteria 1254
536 Ga0501073_0273568 3300049589 Bacteria 1165
537 Ga0501074_0109812 3300049590 Bacteria 1973
538 Ga0501257_036880 3300049686 Bacteria 1192
539 Ga0501080_1528039 3300049742 Bacteria 567
540 Ga0501083_0314043 3300049744 Bacteria 1019
541 Ga0501035_1005701 3300049822 Bacteria 655
542 Ga0501044_0111380 3300049823 Bacteria 2745
543 Ga0501044_0524381 3300049823 Bacteria 1084
544 Ga0501044_0667420 3300049823 Bacteria 927
545 Ga0501044_1195855 3300049823 Bacteria 628
546 nmdc:mga0k408_118551_c1 3300050493 Bacteria 1567
547 nmdc:mga0k408_798038_c1 3300050493 Bacteria 550
548 nmdc:mga07m45_652561_c1 3300050496 Bacteria 606
549 nmdc:mga07m45_95083_c1 3300050496 Bacteria 1709
550 nmdc:mga08y16_1661854_c1 3300050511 Bacteria 595
551 nmdc:mga0sz30_49421_c1 3300050516 Bacteria 1782
552 Ga0495601_0208504 3300053077 Bacteria 1277
553 Ga0500635_0000045 3300053080 Bacteria 87314
554 Ga0500635_0121275 3300053080 Bacteria 979
555 Ga0500578_0000102 3300053086 Bacteria 99108
556 Ga0500643_057687 3300053087 Bacteria 1095
557 Ga0500643_095746 3300053087 Bacteria 807
558 Ga0500644_0000290 3300053088 Bacteria 27182
559 Ga0500644_0154529 3300053088 Bacteria 922
560 Ga0500644_0502137 3300053088 Bacteria 534
561 Ga0500646_0178841 3300053090 Bacteria 718
562 Ga0500566_0175010 3300053094 Bacteria 1106
563 Ga0500641_0126629 3300053096 Bacteria 1102
564 Ga0500641_0173532 3300053096 Bacteria 927
565 Ga0500555_000770 3300053103 Bacteria 11786
566 Ga0500556_0002007 3300053104 Bacteria 7135
567 Ga0500556_0130848 3300053104 Bacteria 983
568 Ga0500562_002145 3300053108 Bacteria 4933
569 Ga0500562_002785 3300053108 Bacteria 4352
570 Ga0500562_053104 3300053108 Bacteria 1085
571 Ga0500594_0000540 3300053118 Bacteria 8211
572 Ga0500595_106751 3300053119 Bacteria 799
573 Ga0500607_253162 3300053121 Bacteria 698
574 Ga0500608_000037 3300053122 Bacteria 60499
575 Ga0500642_0207288 3300053130 Bacteria 911
576 Ga0500559_0000023 3300053136 Bacteria 127993
577 Ga0500559_0001365 3300053136 Bacteria 13991
578 Ga0500559_0248354 3300053136 Bacteria 838
579 Ga0500559_0300320 3300053136 Bacteria 754
580 Ga0500564_000289 3300053138 Bacteria 13960
581 Ga0500590_142998 3300053148 Bacteria 1090
582 Ga0500616_0001152 3300053153 Bacteria 27030
583 Ga0500616_0224846 3300053153 Bacteria 816
584 Ga0500622_0000674 3300053156 Bacteria 30184
585 Ga0500622_0029320 3300053156 Bacteria 2894
586 Ga0500622_0069190 3300053156 Bacteria 1788
587 Ga0500627_0005522 3300053158 Bacteria 4207
588 Ga0500639_115535 3300053163 Bacteria 1298
589 Ga0500636_0012697 3300053177 Bacteria 4938
590 Ga0500636_0059283 3300053177 Bacteria 2237
591 Ga0500637_0037054 3300053178 Bacteria 2739
592 Ga0500645_004788 3300053730 Bacteria 5120
593 Ga0500609_004649 3300053731 Bacteria 1892
594 Ga0590077_094482 3300059426 Bacteria 696

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005295 Ga0065707_10939732 Ga0065707_109397321 100
2 3300005544 Ga0070686_100346285 Ga0070686_1003462852 100
3 3300005549 Ga0070704_100638592 Ga0070704_1006385922 100
4 3300005546 Ga0070696_100913029 Ga0070696_1009130291 109
5 iso_pu_bacteria 2582581279 2585148927 117
6 iso_pu_bacteria 2582581280 2585154006 117
7 iso_pu_bacteria 2582581293 2585194999 117
8 iso_pu_bacteria 2585428106 2587919000 117
9 iso_pu_bacteria 2643221552 2643780751 117
10 iso_pu_bacteria 2643221584 2643930043 117
11 iso_pu_bacteria 2643221598 2643998352 117
12 iso_pu_bacteria 2643221614 2644086790 117
13 iso_pu_bacteria 2643221640 2644227586 117
14 iso_pu_bacteria 2643221642 2644236896 117
15 iso_pu_bacteria 2643221661 2644341744 117
16 iso_pu_bacteria 2643221666 2644368031 117
17 iso_pu_bacteria 2791355048 2792461466 117
18 iso_pu_bacteria 2818991435 2819536114 117
19 iso_pu_bacteria 2818991454 2819644507 117
20 iso_pu_bacteria 2843744320 2843746171 117
21 iso_pu_bacteria 2849560528 2849561577 117
22 iso_pu_bacteria 2849573788 2849576425 117
23 iso_pu_bacteria 2851153111 2851153916 117
24 iso_pu_bacteria 2884960567 2884961380 117
25 iso_pu_bacteria 2898329390 2898332103 117
26 iso_pu_bacteria 2928531327 2928531699 117
27 3300053153 Ga0500616_0001152 Ga0500616_0001152_25833_26207 118
28 iso_pu_bacteria 2585428094 2587864415 118
29 iso_pu_bacteria 2643221622 2644128375 118
30 iso_pu_bacteria 2643221649 2644280387 118
31 iso_pu_bacteria 8046352972 8046353359 118
32 iso_pu_bacteria 2511231221 2512033114 119
33 iso_pu_bacteria 2818991466 2819714072 119
34 iso_pu_bacteria 2879163058 2879165035 119
35 iso_pu_bacteria 8054002106 8054005019 119
36 3300005335 Ga0070666_10268620 Ga0070666_102686202 120
37 3300005548 Ga0070665_101372920 Ga0070665_1013729202 120
38 3300005842 Ga0068858_101451656 Ga0068858_1014516562 120
39 3300009093 Ga0105240_10000581 Ga0105240_100005814 120
40 3300009093 Ga0105240_12618992 Ga0105240_126189921 120
41 3300009177 Ga0105248_11227002 Ga0105248_112270022 120
42 3300009551 Ga0105238_10748753 Ga0105238_107487532 120
43 3300010375 Ga0105239_12162199 Ga0105239_121621991 120
44 3300025903 Ga0207680_10481387 Ga0207680_104813872 120
45 3300025913 Ga0207695_10004246 Ga0207695_100042465 120
46 3300025924 Ga0207694_10086016 Ga0207694_100860162 120
47 3300025941 Ga0207711_10838868 Ga0207711_108388682 120
48 iso_pu_bacteria 2891395885 2891404593 120
49 iso_pu_bacteria 2891554331 2891561741 120
50 3300003215 JGI25153J46596_10019850 JGI25153J46596_100198502 121
51 3300003215 JGI25153J46596_10086712 JGI25153J46596_100867121 121
52 3300003771 Ga0055526_1013317 Ga0055526_10133173 121
53 3300003771 Ga0055526_1063969 Ga0055526_10639692 121
54 3300003773 Ga0055537_1008763 Ga0055537_10087632 121
55 3300003775 Ga0055524_1005141 Ga0055524_10051412 121
56 3300003775 Ga0055524_1026703 Ga0055524_10267032 121
57 3300003775 Ga0055524_1055908 Ga0055524_10559082 121
58 3300003781 Ga0055536_1000905 Ga0055536_10009052 121
59 3300003781 Ga0055536_1000910 Ga0055536_100091020 121
60 3300003790 Ga0055528_1009105 Ga0055528_10091052 121
61 3300003790 Ga0055528_1096392 Ga0055528_10963921 121
62 3300003791 Ga0055530_10009556 Ga0055530_100095563 121
63 3300003794 Ga0055531_10001529 Ga0055531_100015293 121
64 3300003794 Ga0055531_10003074 Ga0055531_1000307410 121
65 3300005262 Ga0065165_1003707 Ga0065165_10037076 121
66 3300005327 Ga0070658_10242366 Ga0070658_102423662 121
67 3300005327 Ga0070658_10276590 Ga0070658_102765902 121
68 3300005327 Ga0070658_10400212 Ga0070658_104002121 121
69 3300005329 Ga0070683_102057462 Ga0070683_1020574621 121
70 3300005331 Ga0070670_100000032 Ga0070670_10000003215 121
71 3300005331 Ga0070670_100518115 Ga0070670_1005181152 121
72 3300005333 Ga0070677_10482366 Ga0070677_104823662 121
73 3300005335 Ga0070666_10032870 Ga0070666_100328704 121
74 3300005335 Ga0070666_10539802 Ga0070666_105398022 121
75 3300005336 Ga0070680_100029974 Ga0070680_1000299741 121
76 3300005338 Ga0068868_100138306 Ga0068868_1001383062 121
77 3300005339 Ga0070660_100902960 Ga0070660_1009029602 121
78 3300005341 Ga0070691_10012155 Ga0070691_100121553 121
79 3300005344 Ga0070661_100125835 Ga0070661_1001258352 121
80 3300005347 Ga0070668_100000702 Ga0070668_10000070216 121
81 3300005347 Ga0070668_100005927 Ga0070668_10000592710 121
82 3300005347 Ga0070668_100008316 Ga0070668_1000083163 121
83 3300005347 Ga0070668_100111636 Ga0070668_1001116362 121
84 3300005347 Ga0070668_100326803 Ga0070668_1003268032 121
85 3300005355 Ga0070671_100078320 Ga0070671_1000783202 121
86 3300005355 Ga0070671_100158098 Ga0070671_1001580982 121
87 3300005355 Ga0070671_100517686 Ga0070671_1005176862 121
88 3300005364 Ga0070673_100147028 Ga0070673_1001470282 121
89 3300005366 Ga0070659_100001930 Ga0070659_1000019308 121
90 3300005366 Ga0070659_100004321 Ga0070659_1000043217 121
91 3300005367 Ga0070667_100000387 Ga0070667_1000003876 121
92 3300005367 Ga0070667_100817494 Ga0070667_1008174941 121
93 3300005367 Ga0070667_100833523 Ga0070667_1008335232 121
94 3300005367 Ga0070667_101327588 Ga0070667_1013275881 121
95 3300005440 Ga0070705_101811799 Ga0070705_1018117991 121
96 3300005456 Ga0070678_100132952 Ga0070678_1001329521 121
97 3300005457 Ga0070662_100230211 Ga0070662_1002302113 121
98 3300005457 Ga0070662_100302017 Ga0070662_1003020171 121
99 3300005458 Ga0070681_10563906 Ga0070681_105639062 121
100 3300005459 Ga0068867_101138848 Ga0068867_1011388482 121
101 3300005466 Ga0070685_10957329 Ga0070685_109573291 121
102 3300005530 Ga0070679_100040495 Ga0070679_1000404952 121
103 3300005530 Ga0070679_101528034 Ga0070679_1015280341 121
104 3300005539 Ga0068853_100003476 Ga0068853_1000034761 121
105 3300005539 Ga0068853_100393618 Ga0068853_1003936181 121
106 3300005539 Ga0068853_100496449 Ga0068853_1004964491 121
107 3300005546 Ga0070696_100570328 Ga0070696_1005703282 121
108 3300005547 Ga0070693_100718873 Ga0070693_1007188731 121
109 3300005548 Ga0070665_100000136 Ga0070665_10000013663 121
110 3300005548 Ga0070665_100001151 Ga0070665_10000115133 121
111 3300005563 Ga0068855_100097020 Ga0068855_1000970202 121
112 3300005563 Ga0068855_100147645 Ga0068855_1001476453 121
113 3300005563 Ga0068855_100327833 Ga0068855_1003278332 121
114 3300005563 Ga0068855_100820023 Ga0068855_1008200232 121
115 3300005564 Ga0070664_100932410 Ga0070664_1009324102 121
116 3300005577 Ga0068857_100298544 Ga0068857_1002985442 121
117 3300005577 Ga0068857_102251207 Ga0068857_1022512072 121
118 3300005578 Ga0068854_101752688 Ga0068854_1017526881 121
119 3300005614 Ga0068856_100351334 Ga0068856_1003513342 121
120 3300005614 Ga0068856_101743438 Ga0068856_1017434381 121
121 3300005617 Ga0068859_100042143 Ga0068859_1000421433 121
122 3300005617 Ga0068859_100128836 Ga0068859_1001288363 121
123 3300005617 Ga0068859_101422116 Ga0068859_1014221161 121
124 3300005618 Ga0068864_100000491 Ga0068864_10000049117 121
125 3300005618 Ga0068864_100001848 Ga0068864_1000018488 121
126 3300005618 Ga0068864_100065251 Ga0068864_1000652512 121
127 3300005618 Ga0068864_100443278 Ga0068864_1004432782 121
128 3300005618 Ga0068864_101359056 Ga0068864_1013590562 121
129 3300005719 Ga0068861_100406812 Ga0068861_1004068122 121
130 3300005719 Ga0068861_101378140 Ga0068861_1013781402 121
131 3300005841 Ga0068863_100004096 Ga0068863_10000409611 121
132 3300005841 Ga0068863_100005840 Ga0068863_1000058406 121
133 3300005841 Ga0068863_100560702 Ga0068863_1005607021 121
134 3300005841 Ga0068863_101378577 Ga0068863_1013785772 121
135 3300005841 Ga0068863_102520841 Ga0068863_1025208412 121
136 3300005842 Ga0068858_100012067 Ga0068858_1000120673 121
137 3300005842 Ga0068858_100044239 Ga0068858_1000442392 121
138 3300005842 Ga0068858_100469579 Ga0068858_1004695792 121
139 3300005843 Ga0068860_100000100 Ga0068860_100000100146 121
140 3300005843 Ga0068860_100000167 Ga0068860_10000016764 121
141 3300005844 Ga0068862_100117199 Ga0068862_1001171992 121
142 3300005844 Ga0068862_100230870 Ga0068862_1002308701 121
143 3300005844 Ga0068862_100341966 Ga0068862_1003419662 121
144 3300005844 Ga0068862_100347893 Ga0068862_1003478932 121
145 3300006186 Ga0075369_10001997 Ga0075369_100019976 121
146 3300006195 Ga0075366_10014506 Ga0075366_100145065 121
147 3300006195 Ga0075366_10169386 Ga0075366_101693863 121
148 3300006237 Ga0097621_101822345 Ga0097621_1018223452 121
149 3300006353 Ga0075370_10141327 Ga0075370_101413271 121
150 3300006353 Ga0075370_10153795 Ga0075370_101537952 121
151 3300006358 Ga0068871_100819917 Ga0068871_1008199172 121
152 3300006881 Ga0068865_100000195 Ga0068865_10000019518 121
153 3300006931 Ga0097620_100042143 Ga0097620_1000421435 121
154 3300006931 Ga0097620_100128817 Ga0097620_1001288173 121
155 3300006931 Ga0097620_101422433 Ga0097620_1014224331 121
156 3300009092 Ga0105250_10010734 Ga0105250_100107342 121
157 3300009093 Ga0105240_10008814 Ga0105240_1000881414 121
158 3300009093 Ga0105240_10038728 Ga0105240_100387288 121
159 3300009093 Ga0105240_10449085 Ga0105240_104490852 121
160 3300009093 Ga0105240_12070353 Ga0105240_120703531 121
161 3300009098 Ga0105245_10213735 Ga0105245_102137352 121
162 3300009101 Ga0105247_10198741 Ga0105247_101987412 121
163 3300009174 Ga0105241_12283228 Ga0105241_122832281 121
164 3300009176 Ga0105242_12517972 Ga0105242_125179722 121
165 3300009177 Ga0105248_10003790 Ga0105248_1000379015 121
166 3300009177 Ga0105248_10286267 Ga0105248_102862672 121
167 3300009177 Ga0105248_11091965 Ga0105248_110919652 121
168 3300009177 Ga0105248_11334453 Ga0105248_113344532 121
169 3300009177 Ga0105248_11873537 Ga0105248_118735371 121
170 3300009545 Ga0105237_10527250 Ga0105237_105272502 121
171 3300009551 Ga0105238_10007249 Ga0105238_100072499 121
172 3300009551 Ga0105238_10700955 Ga0105238_107009552 121
173 3300009551 Ga0105238_11984477 Ga0105238_119844772 121
174 3300009551 Ga0105238_12366078 Ga0105238_123660781 121
175 3300009553 Ga0105249_10001354 Ga0105249_1000135426 121
176 3300009553 Ga0105249_10215538 Ga0105249_102155382 121
177 3300009979 Ga0105032_101996 Ga0105032_1019961 121
178 3300010375 Ga0105239_10496336 Ga0105239_104963362 121
179 3300010375 Ga0105239_12670659 Ga0105239_126706591 121
180 3300013100 Ga0157373_10003677 Ga0157373_1000367711 121
181 3300013100 Ga0157373_10037336 Ga0157373_100373364 121
182 3300013104 Ga0157370_10355448 Ga0157370_103554482 121
183 3300013105 Ga0157369_10328289 Ga0157369_103282892 121
184 3300013306 Ga0163162_10060119 Ga0163162_100601193 121
185 3300013306 Ga0163162_10214864 Ga0163162_102148642 121
186 3300013306 Ga0163162_11304738 Ga0163162_113047382 121
187 3300013307 Ga0157372_11479643 Ga0157372_114796432 121
188 3300013308 Ga0157375_10224663 Ga0157375_102246632 121
189 3300013308 Ga0157375_11116199 Ga0157375_111161991 121
190 3300014325 Ga0163163_10045475 Ga0163163_100454753 121
191 3300014325 Ga0163163_10122100 Ga0163163_101221002 121
192 3300014325 Ga0163163_10371871 Ga0163163_103718712 121
193 3300014325 Ga0163163_10542448 Ga0163163_105424482 121
194 3300014497 Ga0182008_10255553 Ga0182008_102555532 121
195 3300014968 Ga0157379_10149251 Ga0157379_101492512 121
196 3300014969 Ga0157376_10405847 Ga0157376_104058472 121
197 3300017792 Ga0163161_10207934 Ga0163161_102079342 121
198 3300017792 Ga0163161_11082300 Ga0163161_110823001 121
199 3300017792 Ga0163161_11737738 Ga0163161_117377381 121
200 3300021384 Ga0213876_10015657 Ga0213876_100156572 121
201 3300025254 Ga0209148_1030050 Ga0209148_10300501 121
202 3300025263 Ga0209565_1000552 Ga0209565_100055216 121
203 3300025273 Ga0209673_1036209 Ga0209673_10362092 121
204 3300025291 Ga0209675_1002582 Ga0209675_10025825 121
205 3300025292 Ga0209676_1000043 Ga0209676_1000043335 121
206 3300025292 Ga0209676_1000392 Ga0209676_100039284 121
207 3300025295 Ga0209564_1003574 Ga0209564_10035748 121
208 3300025295 Ga0209564_1022562 Ga0209564_10225622 121
209 3300025295 Ga0209564_1028726 Ga0209564_10287262 121
210 3300025297 Ga0209758_1004179 Ga0209758_10041793 121
211 3300025297 Ga0209758_1006159 Ga0209758_10061599 121
212 3300025298 Ga0209050_1001794 Ga0209050_100179422 121
213 3300025298 Ga0209050_1001959 Ga0209050_10019592 121
214 3300025298 Ga0209050_1023621 Ga0209050_10236212 121
215 3300025299 Ga0209256_1001825 Ga0209256_100182518 121
216 3300025299 Ga0209256_1004214 Ga0209256_100421410 121
217 3300025299 Ga0209256_1009352 Ga0209256_10093525 121
218 3300025303 Ga0209051_1002664 Ga0209051_10026642 121
219 3300025304 Ga0209257_1000186 Ga0209257_100018683 121
220 3300025304 Ga0209257_1000616 Ga0209257_100061620 121
221 3300025304 Ga0209257_1009235 Ga0209257_10092354 121
222 3300025711 Ga0207696_1070448 Ga0207696_10704482 121
223 3300025907 Ga0207645_10488724 Ga0207645_104887242 121
224 3300025909 Ga0207705_10016114 Ga0207705_100161145 121
225 3300025909 Ga0207705_10158546 Ga0207705_101585462 121
226 3300025909 Ga0207705_10586000 Ga0207705_105860002 121
227 3300025912 Ga0207707_10153412 Ga0207707_101534122 121
228 3300025913 Ga0207695_10000595 Ga0207695_1000059570 121
229 3300025913 Ga0207695_10001322 Ga0207695_1000132222 121
230 3300025913 Ga0207695_10027094 Ga0207695_100270948 121
231 3300025913 Ga0207695_10140957 Ga0207695_101409572 121
232 3300025914 Ga0207671_10720305 Ga0207671_107203051 121
233 3300025917 Ga0207660_10002459 Ga0207660_100024593 121
234 3300025919 Ga0207657_10001400 Ga0207657_1000140027 121
235 3300025919 Ga0207657_10630268 Ga0207657_106302682 121
236 3300025920 Ga0207649_10163310 Ga0207649_101633102 121
237 3300025920 Ga0207649_10739020 Ga0207649_107390202 121
238 3300025921 Ga0207652_10006051 Ga0207652_100060515 121
239 3300025921 Ga0207652_10435873 Ga0207652_104358732 121
240 3300025923 Ga0207681_10196104 Ga0207681_101961042 121
241 3300025923 Ga0207681_10232733 Ga0207681_102327331 121
242 3300025923 Ga0207681_10954435 Ga0207681_109544351 121
243 3300025924 Ga0207694_10112362 Ga0207694_101123622 121
244 3300025924 Ga0207694_10218073 Ga0207694_102180732 121
245 3300025924 Ga0207694_10918490 Ga0207694_109184901 121
246 3300025924 Ga0207694_11302121 Ga0207694_113021211 121
247 3300025924 Ga0207694_11871296 Ga0207694_118712961 121
248 3300025925 Ga0207650_10000074 Ga0207650_1000007465 121
249 3300025925 Ga0207650_10116804 Ga0207650_101168042 121
250 3300025925 Ga0207650_10209839 Ga0207650_102098392 121
251 3300025925 Ga0207650_10266150 Ga0207650_102661502 121
252 3300025925 Ga0207650_10987671 Ga0207650_109876712 121
253 3300025927 Ga0207687_10259178 Ga0207687_102591782 121
254 3300025931 Ga0207644_10389609 Ga0207644_103896092 121
255 3300025932 Ga0207690_10144289 Ga0207690_101442892 121
256 3300025933 Ga0207706_10029362 Ga0207706_100293622 121
257 3300025934 Ga0207686_11388843 Ga0207686_113888431 121
258 3300025938 Ga0207704_10016516 Ga0207704_100165162 121
259 3300025941 Ga0207711_10001500 Ga0207711_1000150014 121
260 3300025941 Ga0207711_10324816 Ga0207711_103248161 121
261 3300025941 Ga0207711_10436626 Ga0207711_104366262 121
262 3300025941 Ga0207711_10921967 Ga0207711_109219672 121
263 3300025945 Ga0207679_10019722 Ga0207679_100197225 121
264 3300025945 Ga0207679_10439140 Ga0207679_104391402 121
265 3300025949 Ga0207667_10054152 Ga0207667_100541525 121
266 3300025949 Ga0207667_10061067 Ga0207667_100610673 121
267 3300025949 Ga0207667_10429810 Ga0207667_104298102 121
268 3300025949 Ga0207667_10588797 Ga0207667_105887972 121
269 3300025949 Ga0207667_10827552 Ga0207667_108275521 121
270 3300025960 Ga0207651_10185558 Ga0207651_101855582 121
271 3300025961 Ga0207712_10011454 Ga0207712_100114546 121
272 3300025961 Ga0207712_10138362 Ga0207712_101383622 121
273 3300025972 Ga0207668_10000093 Ga0207668_1000009363 121
274 3300025972 Ga0207668_10002915 Ga0207668_100029155 121
275 3300025972 Ga0207668_10015103 Ga0207668_100151034 121
276 3300025972 Ga0207668_10407039 Ga0207668_104070392 121
277 3300025972 Ga0207668_10471148 Ga0207668_104711482 121
278 3300025981 Ga0207640_10535988 Ga0207640_105359882 121
279 3300025986 Ga0207658_10000266 Ga0207658_1000026651 121
280 3300025986 Ga0207658_10020936 Ga0207658_100209361 121
281 3300025986 Ga0207658_10603174 Ga0207658_106031742 121
282 3300025986 Ga0207658_11189273 Ga0207658_111892732 121
283 3300025986 Ga0207658_12115324 Ga0207658_121153241 121
284 3300026035 Ga0207703_10001734 Ga0207703_1000173412 121
285 3300026035 Ga0207703_10005822 Ga0207703_100058222 121
286 3300026035 Ga0207703_10157248 Ga0207703_101572482 121
287 3300026035 Ga0207703_10523962 Ga0207703_105239622 121
288 3300026041 Ga0207639_10008239 Ga0207639_100082397 121
289 3300026041 Ga0207639_10383425 Ga0207639_103834252 121
290 3300026041 Ga0207639_10605062 Ga0207639_106050621 121
291 3300026078 Ga0207702_10570866 Ga0207702_105708662 121
292 3300026078 Ga0207702_10725094 Ga0207702_107250941 121
293 3300026078 Ga0207702_10789418 Ga0207702_107894182 121
294 3300026088 Ga0207641_10004778 Ga0207641_100047786 121
295 3300026088 Ga0207641_10008000 Ga0207641_100080008 121
296 3300026088 Ga0207641_10550218 Ga0207641_105502182 121
297 3300026088 Ga0207641_10897052 Ga0207641_108970522 121
298 3300026088 Ga0207641_11405232 Ga0207641_114052321 121
299 3300026095 Ga0207676_10003303 Ga0207676_100033033 121
300 3300026095 Ga0207676_10003513 Ga0207676_100035136 121
301 3300026095 Ga0207676_10003975 Ga0207676_1000397511 121
302 3300026116 Ga0207674_10091603 Ga0207674_100916032 121
303 3300026118 Ga0207675_100311305 Ga0207675_1003113052 121
304 3300026118 Ga0207675_100671105 Ga0207675_1006711052 121
305 3300026118 Ga0207675_101316988 Ga0207675_1013169882 121
306 3300026121 Ga0207683_10175967 Ga0207683_101759672 121
307 3300026121 Ga0207683_10282675 Ga0207683_102826752 121
308 3300026142 Ga0207698_11023948 Ga0207698_110239482 121
309 3300028379 Ga0268266_10000003 Ga0268266_10000003665 121
310 3300028379 Ga0268266_10006422 Ga0268266_100064227 121
311 3300028379 Ga0268266_11171129 Ga0268266_111711291 121
312 3300028380 Ga0268265_10000648 Ga0268265_1000064839 121
313 3300028380 Ga0268265_10003084 Ga0268265_1000308410 121
314 3300028380 Ga0268265_10130801 Ga0268265_101308012 121
315 3300028380 Ga0268265_10148036 Ga0268265_101480362 121
316 3300028381 Ga0268264_10000002 Ga0268264_10000002692 121
317 3300028381 Ga0268264_10000068 Ga0268264_1000006863 121
318 3300028786 Ga0307517_10023613 Ga0307517_100236136 121
319 3300028786 Ga0307517_10102272 Ga0307517_101022722 121
320 3300028794 Ga0307515_10088331 Ga0307515_100883312 121
321 3300028794 Ga0307515_10148947 Ga0307515_101489472 121
322 3300028800 Ga0265338_10064888 Ga0265338_100648882 121
323 3300028800 Ga0265338_10119548 Ga0265338_101195482 121
324 3300031251 Ga0265327_10005457 Ga0265327_100054572 121
325 3300031456 Ga0307513_10001689 Ga0307513_1000168910 121
326 3300031456 Ga0307513_10012006 Ga0307513_100120062 121
327 3300031456 Ga0307513_10019458 Ga0307513_100194588 121
328 3300031548 Ga0307408_100172102 Ga0307408_1001721022 121
329 3300031616 Ga0307508_10587866 Ga0307508_105878661 121
330 3300031730 Ga0307516_10002970 Ga0307516_100029704 121
331 3300031731 Ga0307405_11935990 Ga0307405_119359902 121
332 3300031824 Ga0307413_11582712 Ga0307413_115827122 121
333 3300031901 Ga0307406_10165441 Ga0307406_101654412 121
334 3300031901 Ga0307406_10893511 Ga0307406_108935112 121
335 3300031901 Ga0307406_11245889 Ga0307406_112458892 121
336 3300031911 Ga0307412_11178837 Ga0307412_111788372 121
337 3300031995 Ga0307409_102041013 Ga0307409_1020410132 121
338 3300032002 Ga0307416_100346055 Ga0307416_1003460552 121
339 3300032004 Ga0307414_11861759 Ga0307414_118617592 121
340 3300033180 Ga0307510_10091868 Ga0307510_100918682 121
341 3300033180 Ga0307510_10605315 Ga0307510_106053151 121
342 3300035089 Ga0373944_0047566 Ga0373944_0047566_42_407 121
343 3300035112 Ga0373932_0309369 Ga0373932_0309369_18_383 121
344 3300035113 Ga0373936_0012346 Ga0373936_0012346_1115_1480 121
345 3300035692 Ga0373935_0840883 Ga0373935_0840883_12_377 121
346 3300035692 Ga0373935_0871416 Ga0373935_0871416_240_605 121
347 3300035692 Ga0373935_1095332 Ga0373935_1095332_135_500 121
348 3300035695 Ga0373927_0000886 Ga0373927_0000886_10445_10810 121
349 3300037068 Ga0373925_0000160 Ga0373925_0000160_19524_19889 121
350 3300037312 Ga0395899_0000260 Ga0395899_0000260_54865_55230 121
351 3300037312 Ga0395899_0065302 Ga0395899_0065302_2067_2432 121
352 3300037312 Ga0395899_0172126 Ga0395899_0172126_349_714 121
353 3300037418 Ga0395900_0000008 Ga0395900_0000008_302818_303183 121
354 3300037418 Ga0395900_0045875 Ga0395900_0045875_628_993 121
355 3300037418 Ga0395900_0185225 Ga0395900_0185225_359_724 121
356 3300037418 Ga0395900_0375054 Ga0395900_0375054_1011_1376 121
357 3300037418 Ga0395900_1322695 Ga0395900_1322695_102_467 121
358 3300037466 Ga0395898_0243013 Ga0395898_0243013_1112_1477 121
359 3300037466 Ga0395898_0664133 Ga0395898_0664133_420_785 121
360 3300037471 Ga0395905_0002508 Ga0395905_0002508_11108_11473 121
361 3300037471 Ga0395905_0011635 Ga0395905_0011635_3356_3721 121
362 3300038443 Ga0395901_0000008 Ga0395901_0000008_177279_177644 121
363 3300038443 Ga0395901_0547882 Ga0395901_0547882_753_1118 121
364 3300038443 Ga0395901_0785420 Ga0395901_0785420_372_737 121
365 3300039437 Ga0436365_0658056 Ga0436365_0658056_3392_3757 121
366 3300039437 Ga0436365_1349197 Ga0436365_1349197_41_406 121
367 3300039447 Ga0436361_0314376 Ga0436361_0314376_10147_10512 121
368 3300039450 Ga0436363_0665676 Ga0436363_0665676_149_514 121
369 3300041443 Ga0451789_0317317 Ga0451789_0317317_43_408 121
370 3300041492 Ga0451835_0347279 Ga0451835_0347279_192_557 121
371 3300041503 Ga0451847_0643662 Ga0451847_0643662_96_461 121
372 3300041512 Ga0451853_1525706 Ga0451853_1525706_94_459 121
373 3300042001 Ga0439441_018014 Ga0439441_018014_811_1176 121
374 3300042438 Ga0439459_0002303 Ga0439459_0002303_54_419 121
375 3300044842 Ga0466957_1034745 Ga0466957_1034745_47_412 121
376 3300045836 Ga0466958_0658897 Ga0466958_0658897_17_382 121
377 3300045836 Ga0466958_0819632 Ga0466958_0819632_155_520 121
378 3300046457 Ga0495590_0001696 Ga0495590_0001696_2817_3182 121
379 3300046459 Ga0495629_1011557 Ga0495629_1011557_143_508 121
380 3300046460 Ga0495638_0001383 Ga0495638_0001383_4809_5174 121
381 3300046460 Ga0495638_0002620 Ga0495638_0002620_5476_5841 121
382 3300046460 Ga0495638_0016210 Ga0495638_0016210_590_955 121
383 3300046471 Ga0495650_0000024 Ga0495650_0000024_259928_260293 121
384 3300046492 Ga0495585_0083463 Ga0495585_0083463_1121_1486 121
385 3300046501 Ga0495607_0050793 Ga0495607_0050793_514_879 121
386 3300046506 Ga0495583_0246547 Ga0495583_0246547_65_430 121
387 3300046507 Ga0495606_0004488 Ga0495606_0004488_12612_12977 121
388 3300046507 Ga0495606_0229571 Ga0495606_0229571_591_956 121
389 3300046512 Ga0495610_0012692 Ga0495610_0012692_86_451 121
390 3300046512 Ga0495610_0098285 Ga0495610_0098285_75_440 121
391 3300046513 Ga0495616_0007196 Ga0495616_0007196_4800_5165 121
392 3300046513 Ga0495616_0072190 Ga0495616_0072190_725_1090 121
393 3300046513 Ga0495616_0146747 Ga0495616_0146747_417_782 121
394 3300046515 Ga0495620_0021961 Ga0495620_0021961_1378_1743 121
395 3300046518 Ga0495631_0000540 Ga0495631_0000540_1991_2356 121
396 3300046519 Ga0495632_0003150 Ga0495632_0003150_4259_4624 121
397 3300046524 Ga0495648_0000029 Ga0495648_0000029_219044_219409 121
398 3300046524 Ga0495648_0094859 Ga0495648_0094859_368_733 121
399 3300046524 Ga0495648_0380805 Ga0495648_0380805_223_588 121
400 3300046524 Ga0495648_0399852 Ga0495648_0399852_120_485 121
401 3300046524 Ga0495648_0509897 Ga0495648_0509897_64_429 121
402 3300046525 Ga0495663_0074096 Ga0495663_0074096_163_528 121
403 3300046528 Ga0495642_0016600 Ga0495642_0016600_1009_1374 121
404 3300046530 Ga0495654_0000226 Ga0495654_0000226_27668_28033 121
405 3300046530 Ga0495654_0072563 Ga0495654_0072563_454_819 121
406 3300046531 Ga0495665_0193677 Ga0495665_0193677_103_468 121
407 3300046536 Ga0495587_0577130 Ga0495587_0577130_200_565 121
408 3300046538 Ga0495609_0193888 Ga0495609_0193888_287_652 121
409 3300046542 Ga0495597_0109881 Ga0495597_0109881_314_679 121
410 3300046542 Ga0495597_0264264 Ga0495597_0264264_228_593 121
411 3300046558 Ga0495633_0117835 Ga0495633_0117835_19_384 121
412 3300046616 Ga0495668_0000141 Ga0495668_0000141_6697_7062 121
413 3300046616 Ga0495668_0011679 Ga0495668_0011679_1660_2025 121
414 3300046616 Ga0495668_0037370 Ga0495668_0037370_2191_2556 121
415 3300046616 Ga0495668_0047260 Ga0495668_0047260_1869_2234 121
416 3300046616 Ga0495668_0084968 Ga0495668_0084968_1308_1673 121
417 3300046616 Ga0495668_0112566 Ga0495668_0112566_556_921 121
418 3300046660 Ga0495625_0085870 Ga0495625_0085870_947_1312 121
419 3300046660 Ga0495625_0087855 Ga0495625_0087855_1044_1409 121
420 3300046660 Ga0495625_0099813 Ga0495625_0099813_976_1341 121
421 3300046660 Ga0495625_0204179 Ga0495625_0204179_299_664 121
422 3300046664 Ga0495659_0226385 Ga0495659_0226385_108_473 121
423 3300046664 Ga0495659_0513534 Ga0495659_0513534_81_446 121
424 3300046674 Ga0495588_0048257 Ga0495588_0048257_843_1208 121
425 3300046674 Ga0495588_0265893 Ga0495588_0265893_434_799 121
426 3300046678 Ga0495599_0195290 Ga0495599_0195290_778_1143 121
427 3300046683 Ga0495658_0605069 Ga0495658_0605069_192_557 121
428 3300046684 Ga0495669_0000012 Ga0495669_0000012_110854_111219 121
429 3300046684 Ga0495669_0000109 Ga0495669_0000109_38398_38763 121
430 3300046684 Ga0495669_0454219 Ga0495669_0454219_85_450 121
431 3300046692 Ga0495671_0073107 Ga0495671_0073107_1209_1574 121
432 3300046692 Ga0495671_0146413 Ga0495671_0146413_256_621 121
433 3300046810 Ga0495660_0073886 Ga0495660_0073886_1076_1441 121
434 3300046810 Ga0495660_0148135 Ga0495660_0148135_295_660 121
435 3300047319 Ga0495674_0118732 Ga0495674_0118732_1717_2082 121
436 3300047320 Ga0495672_0509623 Ga0495672_0509623_130_495 121
437 3300047323 Ga0495683_0222124 Ga0495683_0222124_413_778 121
438 3300047469 Ga0495673_0000342 Ga0495673_0000342_17341_17706 121
439 3300047470 Ga0495681_0071183 Ga0495681_0071183_450_815 121
440 3300047470 Ga0495681_0085939 Ga0495681_0085939_646_1011 121
441 3300047472 Ga0495686_0094683 Ga0495686_0094683_1315_1680 121
442 3300048089 Ga0495614_0531047 Ga0495614_0531047_158_523 121
443 3300048904 Ga0496101_0334584 Ga0496101_0334584_13_378 121
444 3300048904 Ga0496101_0346961 Ga0496101_0346961_396_761 121
445 3300048905 Ga0496102_0081137 Ga0496102_0081137_1847_2212 121
446 3300048906 Ga0496103_0026473 Ga0496103_0026473_1127_1492 121
447 3300048906 Ga0496103_0141771 Ga0496103_0141771_249_614 121
448 3300048908 Ga0496105_0601488 Ga0496105_0601488_409_774 121
449 3300048909 Ga0496106_0025542 Ga0496106_0025542_2635_3000 121
450 3300048909 Ga0496106_0123528 Ga0496106_0123528_252_617 121
451 3300048910 Ga0496107_0001980 Ga0496107_0001980_3474_3839 121
452 3300048911 Ga0496108_0018886 Ga0496108_0018886_1192_1557 121
453 3300048912 Ga0496109_0017572 Ga0496109_0017572_4832_5197 121
454 3300048912 Ga0496109_1685243 Ga0496109_1685243_37_402 121
455 3300048913 Ga0496110_0383193 Ga0496110_0383193_619_984 121
456 3300048914 Ga0496111_0194131 Ga0496111_0194131_330_695 121
457 3300048915 Ga0496112_0067842 Ga0496112_0067842_1827_2192 121
458 3300048915 Ga0496112_0226006 Ga0496112_0226006_1164_1532 121
459 3300048915 Ga0496112_0283548 Ga0496112_0283548_930_1295 121
460 3300048916 Ga0496113_0274602 Ga0496113_0274602_482_847 121
461 3300048916 Ga0496113_0308891 Ga0496113_0308891_660_1025 121
462 3300048917 Ga0496114_0665695 Ga0496114_0665695_510_875 121
463 3300048918 Ga0496115_0000210 Ga0496115_0000210_40405_40770 121
464 3300048918 Ga0496115_0000966 Ga0496115_0000966_17751_18116 121
465 3300048918 Ga0496115_0105062 Ga0496115_0105062_243_608 121
466 3300048918 Ga0496115_0169209 Ga0496115_0169209_590_955 121
467 3300048918 Ga0496115_0191049 Ga0496115_0191049_504_869 121
468 3300048924 Ga0496121_0004298 Ga0496121_0004298_14300_14665 121
469 3300048924 Ga0496121_0670804 Ga0496121_0670804_123_488 121
470 3300048927 Ga0496124_0075119 Ga0496124_0075119_2327_2692 121
471 3300048927 Ga0496124_0283675 Ga0496124_0283675_228_593 121
472 3300048928 Ga0496125_0029780 Ga0496125_0029780_2208_2573 121
473 3300048928 Ga0496125_0258106 Ga0496125_0258106_170_535 121
474 3300048929 Ga0496126_0005086 Ga0496126_0005086_1867_2232 121
475 3300049571 Ga0501034_1516920 Ga0501034_1516920_133_498 121
476 3300049573 Ga0501037_0778136 Ga0501037_0778136_200_565 121
477 3300049574 Ga0501038_1393957 Ga0501038_1393957_15_380 121
478 3300049581 Ga0501047_0004111 Ga0501047_0004111_11213_11578 121
479 3300049581 Ga0501047_0017073 Ga0501047_0017073_2933_3298 121
480 3300049581 Ga0501047_0234554 Ga0501047_0234554_1292_1657 121
481 3300049581 Ga0501047_0515206 Ga0501047_0515206_375_740 121
482 3300049581 Ga0501047_0678304 Ga0501047_0678304_174_539 121
483 3300049581 Ga0501047_1079148 Ga0501047_1079148_234_599 121
484 3300049582 Ga0501048_0197256 Ga0501048_0197256_253_618 121
485 3300049686 Ga0501257_036880 Ga0501257_036880_784_1149 121
486 3300049823 Ga0501044_0111380 Ga0501044_0111380_826_1191 121
487 3300049823 Ga0501044_0524381 Ga0501044_0524381_528_893 121
488 3300049823 Ga0501044_1195855 Ga0501044_1195855_97_462 121
489 3300050493 nmdc:mga0k408_118551_c1 nmdc:mga0k408_118551_c1_452_817 121
490 3300050493 nmdc:mga0k408_798038_c1 nmdc:mga0k408_798038_c1_134_499 121
491 3300050496 nmdc:mga07m45_652561_c1 nmdc:mga07m45_652561_c1_186_551 121
492 3300050496 nmdc:mga07m45_95083_c1 nmdc:mga07m45_95083_c1_906_1271 121
493 3300050516 nmdc:mga0sz30_49421_c1 nmdc:mga0sz30_49421_c1_717_1082 121
494 3300053077 Ga0495601_0208504 Ga0495601_0208504_228_593 121
495 3300053080 Ga0500635_0000045 Ga0500635_0000045_17047_17412 121
496 3300053080 Ga0500635_0121275 Ga0500635_0121275_243_608 121
497 3300053086 Ga0500578_0000102 Ga0500578_0000102_59906_60271 121
498 3300053087 Ga0500643_057687 Ga0500643_057687_38_403 121
499 3300053087 Ga0500643_095746 Ga0500643_095746_203_568 121
500 3300053088 Ga0500644_0000290 Ga0500644_0000290_26296_26661 121
501 3300053088 Ga0500644_0154529 Ga0500644_0154529_82_447 121
502 3300053088 Ga0500644_0502137 Ga0500644_0502137_25_390 121
503 3300053090 Ga0500646_0178841 Ga0500646_0178841_206_571 121
504 3300053094 Ga0500566_0175010 Ga0500566_0175010_708_1073 121
505 3300053096 Ga0500641_0126629 Ga0500641_0126629_242_607 121
506 3300053096 Ga0500641_0173532 Ga0500641_0173532_542_907 121
507 3300053103 Ga0500555_000770 Ga0500555_000770_10669_11034 121
508 3300053104 Ga0500556_0002007 Ga0500556_0002007_1060_1425 121
509 3300053104 Ga0500556_0130848 Ga0500556_0130848_279_644 121
510 3300053108 Ga0500562_002145 Ga0500562_002145_3870_4235 121
511 3300053108 Ga0500562_002785 Ga0500562_002785_3955_4320 121
512 3300053108 Ga0500562_053104 Ga0500562_053104_422_787 121
513 3300053118 Ga0500594_0000540 Ga0500594_0000540_106_471 121
514 3300053119 Ga0500595_106751 Ga0500595_106751_177_542 121
515 3300053121 Ga0500607_253162 Ga0500607_253162_17_382 121
516 3300053122 Ga0500608_000037 Ga0500608_000037_41448_41813 121
517 3300053130 Ga0500642_0207288 Ga0500642_0207288_38_403 121
518 3300053136 Ga0500559_0000023 Ga0500559_0000023_14491_14856 121
519 3300053136 Ga0500559_0001365 Ga0500559_0001365_6212_6577 121
520 3300053136 Ga0500559_0248354 Ga0500559_0248354_163_528 121
521 3300053136 Ga0500559_0300320 Ga0500559_0300320_267_632 121
522 3300053138 Ga0500564_000289 Ga0500564_000289_4159_4524 121
523 3300053148 Ga0500590_142998 Ga0500590_142998_496_861 121
524 3300053153 Ga0500616_0224846 Ga0500616_0224846_16_381 121
525 3300053156 Ga0500622_0000674 Ga0500622_0000674_6562_6927 121
526 3300053156 Ga0500622_0029320 Ga0500622_0029320_42_407 121
527 3300053156 Ga0500622_0069190 Ga0500622_0069190_1346_1711 121
528 3300053158 Ga0500627_0005522 Ga0500627_0005522_1447_1812 121
529 3300053163 Ga0500639_115535 Ga0500639_115535_671_1036 121
530 3300053177 Ga0500636_0012697 Ga0500636_0012697_4424_4789 121
531 3300053177 Ga0500636_0059283 Ga0500636_0059283_1003_1368 121
532 3300053178 Ga0500637_0037054 Ga0500637_0037054_85_450 121
533 3300053730 Ga0500645_004788 Ga0500645_004788_3299_3664 121
534 3300053731 Ga0500609_004649 Ga0500609_004649_1356_1721 121
535 3300000041 ARcpr5oldR_c009756 ARcpr5oldR_0097562 122
536 3300000043 ARcpr5yngRDRAFT_c009901 ARcpr5yngRDRAFT_0099012 122
537 3300002774 JGI25150J39212_1025331 JGI25150J39212_10253311 122
538 3300003215 JGI25153J46596_10038049 JGI25153J46596_100380492 122
539 3300003773 Ga0055537_1001374 Ga0055537_10013747 122
540 3300003775 Ga0055524_1001543 Ga0055524_100154311 122
541 3300003791 Ga0055530_10000596 Ga0055530_1000059616 122
542 3300003791 Ga0055530_10035865 Ga0055530_100358652 122
543 3300003794 Ga0055531_10000012 Ga0055531_1000001261 122
544 3300003794 Ga0055531_10001326 Ga0055531_1000132611 122
545 3300005262 Ga0065165_1113718 Ga0065165_11137181 122
546 3300005329 Ga0070683_101085838 Ga0070683_1010858382 122
547 3300005340 Ga0070689_101398716 Ga0070689_1013987161 122
548 3300005440 Ga0070705_100470954 Ga0070705_1004709541 122
549 3300005539 Ga0068853_100636316 Ga0068853_1006363161 122
550 3300005549 Ga0070704_101631454 Ga0070704_1016314541 122
551 3300009093 Ga0105240_11370457 Ga0105240_113704571 122
552 3300009094 Ga0111539_11574640 Ga0111539_115746402 122
553 3300009177 Ga0105248_11605552 Ga0105248_116055522 122
554 3300013105 Ga0157369_11514069 Ga0157369_115140691 122
555 3300014325 Ga0163163_10120681 Ga0163163_101206812 122
556 3300014326 Ga0157380_11801877 Ga0157380_118018772 122
557 3300021388 Ga0213875_10100446 Ga0213875_101004462 122
558 3300025245 Ga0207425_1009019 Ga0207425_10090192 122
559 3300025263 Ga0209565_1000030 Ga0209565_1000030175 122
560 3300025273 Ga0209673_1000768 Ga0209673_10007685 122
561 3300025291 Ga0209675_1043525 Ga0209675_10435251 122
562 3300025297 Ga0209758_1023081 Ga0209758_10230813 122
563 3300025298 Ga0209050_1000039 Ga0209050_1000039261 122
564 3300025298 Ga0209050_1026711 Ga0209050_10267112 122
565 3300025299 Ga0209256_1000046 Ga0209256_1000046110 122
566 3300025304 Ga0209257_1000051 Ga0209257_1000051261 122
567 3300025304 Ga0209257_1000533 Ga0209257_100053348 122
568 3300025914 Ga0207671_10061666 Ga0207671_100616662 122
569 3300025932 Ga0207690_10867813 Ga0207690_108678132 122
570 3300025941 Ga0207711_11953526 Ga0207711_119535261 122
571 3300025981 Ga0207640_10263297 Ga0207640_102632972 122
572 3300028379 Ga0268266_11153308 Ga0268266_111533082 122
573 3300028563 Ga0265319_1001009 Ga0265319_10010096 122
574 3300028573 Ga0265334_10093185 Ga0265334_100931852 122
575 3300028577 Ga0265318_10042001 Ga0265318_100420012 122
576 3300028577 Ga0265318_10136114 Ga0265318_101361142 122
577 3300028577 Ga0265318_10139953 Ga0265318_101399531 122
578 3300028653 Ga0265323_10188927 Ga0265323_101889271 122
579 3300028666 Ga0265336_10033290 Ga0265336_100332902 122
580 3300028666 Ga0265336_10090801 Ga0265336_100908012 122
581 3300028800 Ga0265338_10035691 Ga0265338_100356912 122
582 3300028800 Ga0265338_10172613 Ga0265338_101726131 122
583 3300031235 Ga0265330_10339093 Ga0265330_103390932 122
584 3300031238 Ga0265332_10092820 Ga0265332_100928202 122
585 3300031240 Ga0265320_10027367 Ga0265320_100273672 122
586 3300031240 Ga0265320_10066321 Ga0265320_100663212 122
587 3300031247 Ga0265340_10022802 Ga0265340_100228022 122
588 3300031249 Ga0265339_10188401 Ga0265339_101884012 122
589 3300031250 Ga0265331_10013895 Ga0265331_100138955 122
590 3300031344 Ga0265316_10588434 Ga0265316_105884341 122
591 3300031344 Ga0265316_10931542 Ga0265316_109315421 122
592 3300031712 Ga0265342_10181535 Ga0265342_101815352 122
593 3300031911 Ga0307412_10720252 Ga0307412_107202522 122
594 3300037853 Ga0436364_1032418 Ga0436364_1032418_390_758 122
595 3300039450 Ga0436363_0351388 Ga0436363_0351388_637_1008 122
596 3300041486 Ga0451807_0397995 Ga0451807_0397995_502_882 122
597 3300042436 Ga0439435_0002352 Ga0439435_0002352_829_1200 122
598 3300042437 Ga0439444_0039228 Ga0439444_0039228_133_504 122
599 3300042876 Ga0451577_0900684 Ga0451577_0900684_357_728 122
600 3300046660 Ga0495625_0090268 Ga0495625_0090268_1629_2003 122
601 3300048915 Ga0496112_0821215 Ga0496112_0821215_206_607 122
602 3300048925 Ga0496122_0092958 Ga0496122_0092958_1556_1930 122
603 3300048927 Ga0496124_0003907 Ga0496124_0003907_16404_16796 122
604 3300048928 Ga0496125_0351534 Ga0496125_0351534_13_405 122
605 3300049571 Ga0501034_0061114 Ga0501034_0061114_421_795 122
606 3300049573 Ga0501037_0129883 Ga0501037_0129883_244_618 122
607 3300049574 Ga0501038_0412811 Ga0501038_0412811_514_888 122
608 3300049575 Ga0501039_0943344 Ga0501039_0943344_174_548 122
609 3300049579 Ga0501043_0173124 Ga0501043_0173124_829_1203 122
610 3300049581 Ga0501047_0239769 Ga0501047_0239769_732_1106 122
611 3300049582 Ga0501048_0517230 Ga0501048_0517230_423_797 122
612 3300049583 Ga0501067_0290646 Ga0501067_0290646_360_734 122
613 3300049584 Ga0501068_0158025 Ga0501068_0158025_54_434 122
614 3300049584 Ga0501068_0297201 Ga0501068_0297201_475_849 122
615 3300049585 Ga0501069_0244745 Ga0501069_0244745_127_501 122
616 3300049586 Ga0501070_0116431 Ga0501070_0116431_872_1246 122
617 3300049587 Ga0501071_0062133 Ga0501071_0062133_1726_2100 122
618 3300049589 Ga0501073_0239131 Ga0501073_0239131_39_410 122
619 3300049589 Ga0501073_0273568 Ga0501073_0273568_531_905 122
620 3300049590 Ga0501074_0109812 Ga0501074_0109812_451_825 122
621 3300049742 Ga0501080_1528039 Ga0501080_1528039_134_508 122
622 3300049744 Ga0501083_0314043 Ga0501083_0314043_273_647 122
623 3300049822 Ga0501035_1005701 Ga0501035_1005701_145_519 122
624 3300049823 Ga0501044_0667420 Ga0501044_0667420_233_607 122
625 3300050511 nmdc:mga08y16_1661854_c1 nmdc:mga08y16_1661854_c1_177_566 122
626 3300059426 Ga0590077_094482 Ga0590077_094482_141_515 122

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01597

GCV_H

Glycine cleavage H-protein

24

144

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zko-assembly1.cif.gz_A crystal structure of glycine cleavage system h protein (tm0212) from thermotoga maritima at 1.65 a resolution 0.9947 1 120
3wdn-assembly1.cif.gz_A high-resolution x-ray crystal structure of bovine h-protein using a high-pressure cryocooling method 0.9894 1 121
1htp-assembly1.cif.gz_A refined structures at 2 angstroms and 2.2 angstroms of the two forms of the h-protein, a lipoamide-containing protein of the glycine decarboxylase complex 0.9875 2 121
1onl-assembly3.cif.gz_C crystal structure of thermus thermophilus hb8 h-protein of the glycine cleavage system 0.9818 2 121
3wdn-assembly1.cif.gz_A high-resolution x-ray crystal structure of bovine h-protein using a high-pressure cryocooling method 0.9734 1 121
ID Description Score Start End Superfamily
af_Q20634_6_139_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9939 2 118 2.40.50.100
3wdnA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9893 1 121 2.40.50.100
af_Q9U616_24_160_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9834 2 119 2.40.50.100
af_Q54JV8_6_144_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9806 2 119 2.40.50.100
af_Q54JU3_2_142_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.977 2 119 2.40.50.100
ID Description Score Start End GO Terms
AF-A0A853FS71-F1-model_v4 Glycine cleavage system H protein 1.002 2 122 GO:0005829
GO:0005960
GO:0019464
AF-A0A432VJA8-F1-model_v4 Glycine cleavage system H protein 1.002 2 122 GO:0005737
GO:0005960
GO:0019464
AF-A0A0Q6L2U3-F1-model_v4 Glycine cleavage system H protein 1.002 1 122 GO:0005829
GO:0005960
GO:0019464
AF-A0A501PQ64-F1-model_v4 Glycine cleavage system H protein 1.002 2 121 GO:0005829
GO:0005960
GO:0019464
AF-A0A6I4UL61-F1-model_v4 Glycine cleavage system H protein 1.001 1 122 GO:0005829
GO:0005960
GO:0019464

Feature Viewer

pLDDT pTM Quality
97.91 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map