F469857
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 619 | 376 | 567 | 163 |
Family's Representative Sequence
| Representative Sequence | 3300049570|Ga0501033_0002842|Ga0501033_0002842_42_584 |
| Length | 164 |
| Sequence | MAKKSSTGIDIGISAADRRKIADGLAHVLADAFTLYLKTHNFHWNITGAMFNSLHLMFEGQYTEQWNALDEIAERTRALGFNAPASYGEFIRLTSIKEEAGLTDTADWREMVRQLVAGNEAVCRTARKALKIADDAGDDPTTDLLTQRLNVHEKNAWMLRSLLQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 3 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 4 | 2511231003 | Herbaspirillum sp. CF444 | Isolate | Rhizosphere |
| 5 | 2511231026 | Herbaspirillum sp. YR522 | Isolate | Rhizosphere |
| 6 | 2513237082 | Paraburkholderia mimosarum STM3621 | Isolate | Nodule |
| 7 | 2513237083 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 8 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 9 | 2519103095 | Burkholderia sp. KJ006 | Isolate | Nodule |
| 10 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 11 | 2551306416 | Herbaspirillum seropedicae Os34 | Isolate | Unclassified |
| 12 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 13 | 2582581311 | Burkholderia sp. WP42 | Isolate | Rhizosphere |
| 14 | 2600255067 | Paraburkholderia kururiensis thiooxydans NBRC 107107 | Isolate | Unclassified |
| 15 | 2600255292 | Janthinobacterium lividum NFR18 | Isolate | Rhizoplane |
| 16 | 2617270889 | Nostoc punctiforme PCC 73102 | Isolate | Unclassified |
| 17 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 18 | 2721755763 | Pandoraea thiooxydans ATSB16 | Isolate | Rhizosphere |
| 19 | 2816332253 | Burkholderia vietnamiensis HI2297 | Isolate | Unclassified |
| 20 | 2816332256 | Burkholderia vietnamiensis MSMB608WGS | Isolate | Unclassified |
| 21 | 2816332286 | Burkholderia vietnamiensis HI2221 | Isolate | Rhizosphere |
| 22 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 23 | 2818991445 | Herbaspirillum hiltneri 3195 | Isolate | Unclassified |
| 24 | 2818991449 | Herbaspirillum huttiense 1147 | Isolate | Unclassified |
| 25 | 2848694841 | Nostoc sp. RF31YmG | Isolate | Unclassified |
| 26 | 2856287931 | Paraburkholderia bannensis BE22 | Isolate | Rhizosphere |
| 27 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 28 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 29 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 30 | 2900577576 | Ralstonia sp. TCR112 | Isolate | Rhizosphere |
| 31 | 2901300506 | Cupriavidus sp. UYMSc13B | Isolate | Unclassified |
| 32 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 33 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 34 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 35 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 36 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 37 | 2913844669 | Nostocales cyanobacterium LEGE 12452 | Isolate | Unclassified |
| 38 | 2913939268 | Nostoc sp. LEGE 12447 | Isolate | Unclassified |
| 39 | 2919046199 | Herbaspirillum frisingense 596 | Isolate | Unclassified |
| 40 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 41 | 2921643360 | Paraburkholderia steynii HC1.1ba | Isolate | Nodule |
| 42 | 2923510766 | Herbaspirillum rubrisubalbicans SLBN-127 | Isolate | Rhizosphere |
| 43 | 2928130867 | Herbaspirillum seropedicae 1977 | Isolate | Unclassified |
| 44 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 45 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 46 | 2932410948 | Janthinobacterium lividum 2829 | Isolate | Rhizosphere |
| 47 | 2932416698 | Janthinobacterium lividum 2830 | Isolate | Rhizosphere |
| 48 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 49 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 50 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 51 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 52 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 53 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 54 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 55 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 56 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 57 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 58 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 59 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 60 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 61 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 62 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 63 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 64 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 65 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 66 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 67 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 68 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 69 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 70 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 71 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 72 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 73 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 74 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 75 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 76 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 77 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 78 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 79 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 80 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 81 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 82 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 91 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 92 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 93 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 94 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 95 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 96 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 97 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 99 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 100 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 101 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 102 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 103 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 104 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 122 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 124 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 125 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 126 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 127 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 129 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 130 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 131 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 132 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 133 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 134 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 144 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 145 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 148 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 149 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 150 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 152 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 154 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 157 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 158 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 181 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 188 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 192 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 193 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 194 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 195 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 196 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 197 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 198 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 199 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 200 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 201 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 202 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 203 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 204 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 205 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 206 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 207 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 208 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 209 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 210 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 211 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 212 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 213 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 214 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 215 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 216 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 217 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 218 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 219 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 220 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 221 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 222 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 223 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 224 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 225 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 226 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 227 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 228 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 229 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 230 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 231 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 232 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 233 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 234 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 235 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 236 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 237 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 238 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 304 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 305 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 306 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 307 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 308 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 309 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 310 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 311 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 312 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 313 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 314 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 315 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 316 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 317 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 318 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 319 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 320 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 321 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 322 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 323 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 324 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 325 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 326 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 327 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 328 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 329 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 330 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 333 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 334 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 335 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 340 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 344 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 347 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 348 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 351 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 352 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 353 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 354 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 355 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 356 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 357 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 358 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 359 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 360 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 361 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 362 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 363 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 364 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 365 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 366 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 367 | 3300060245 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 6R_CD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 368 | 3300060246 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 22R_SD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 369 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 371 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 372 | 642555144 | Nostoc punctiforme PCC 73102 | Isolate | Unclassified |
| 373 | 8003955200 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 374 | 8020807995 | Burkholderia sp. B10 | Isolate | Rhizosphere |
| 375 | 8040167225 | Burkholderia vietnamiensis RS1 | Isolate | Unclassified |
| 376 | 8040173305 | Burkholderia vietnamiensis BE10 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.53 |
| Metatranscriptomes | 2.91 |
| Isolates | 8.56 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.86 |
| Nodule | 1.62 |
| Rhizoplane | 6.79 |
| Rhizosphere | 62.52 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.22 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_3111171 | 2162886007 | Bacteria | 33112 |
| 2 | JGI24740J21852_10035268 | 3300001979 | Bacteria | 1566 |
| 3 | JGI24739J22299_10092257 | 3300001989 | Bacteria | 921 |
| 4 | JGI24737J22298_10109286 | 3300001990 | Bacteria | 819 |
| 5 | JGI24735J21928_10001085 | 3300002067 | Bacteria | 9725 |
| 6 | JGI24735J21928_10134488 | 3300002067 | Bacteria | 713 |
| 7 | JGI25156J39149_1001646 | 3300002705 | Bacteria | 9062 |
| 8 | JGI25156J39149_1009851 | 3300002705 | Bacteria | 2291 |
| 9 | JGI25154J39366_1000620 | 3300002738 | Bacteria | 16876 |
| 10 | JGI25154J39366_1001336 | 3300002738 | Bacteria | 9062 |
| 11 | JGI25157J39369_1000960 | 3300002741 | Bacteria | 13491 |
| 12 | JGI25151J46595_10042717 | 3300003187 | Bacteria | 1630 |
| 13 | JGI25151J46595_10075877 | 3300003187 | Bacteria | 995 |
| 14 | JGI25165J46597_1000067 | 3300003214 | Bacteria | 196411 |
| 15 | rootL2_10145991 | 3300003322 | Bacteria | 1036 |
| 16 | rootL2_10189899 | 3300003322 | Bacteria | 1036 |
| 17 | rootL2_10329721 | 3300003322 | Bacteria | 3445 |
| 18 | rootH1_10039841 | 3300003316 | Bacteria | 6678 |
| 19 | rootH1_10039841 | 3300003323 | Bacteria | 86560 |
| 20 | JGI25160J50197_1000171 | 3300003354 | Bacteria | 55915 |
| 21 | Ga0055538_1000010 | 3300003751 | Bacteria | 376599 |
| 22 | Ga0055538_1000033 | 3300003751 | Bacteria | 195914 |
| 23 | Ga0055539_1000015 | 3300003752 | Bacteria | 376599 |
| 24 | Ga0055539_1000045 | 3300003752 | Bacteria | 195316 |
| 25 | Ga0055533_1000018 | 3300003756 | Bacteria | 376599 |
| 26 | Ga0055533_1000054 | 3300003756 | Bacteria | 195914 |
| 27 | Ga0055532_1000018 | 3300003758 | Bacteria | 305466 |
| 28 | Ga0055525_1000020 | 3300003759 | Bacteria | 376599 |
| 29 | Ga0055525_1000065 | 3300003759 | Bacteria | 195779 |
| 30 | Ga0055527_1000415 | 3300003760 | Bacteria | 17616 |
| 31 | Ga0055527_1002589 | 3300003760 | Bacteria | 2982 |
| 32 | Ga0055535_1001029 | 3300003761 | Bacteria | 17616 |
| 33 | Ga0055535_1003154 | 3300003761 | Bacteria | 4921 |
| 34 | Ga0055542_1001409 | 3300003762 | Bacteria | 12120 |
| 35 | Ga0055529_1004271 | 3300003763 | Bacteria | 2190 |
| 36 | Ga0055526_1007909 | 3300003771 | Bacteria | 5415 |
| 37 | Ga0055526_1018284 | 3300003771 | Bacteria | 2623 |
| 38 | Ga0055537_1015077 | 3300003773 | Bacteria | 1372 |
| 39 | Ga0055524_1000281 | 3300003775 | Bacteria | 50001 |
| 40 | Ga0055524_1028848 | 3300003775 | Bacteria | 1655 |
| 41 | Ga0055536_1000044 | 3300003781 | Bacteria | 123111 |
| 42 | Ga0055534_1000584 | 3300003784 | Bacteria | 19110 |
| 43 | Ga0055534_1005553 | 3300003784 | Bacteria | 3346 |
| 44 | Ga0055540_1074552 | 3300003792 | Bacteria | 658 |
| 45 | Ga0055531_10009435 | 3300003794 | Bacteria | 4984 |
| 46 | Ga0055541_1000011 | 3300003841 | Bacteria | 376599 |
| 47 | Ga0055541_1000031 | 3300003841 | Bacteria | 195914 |
| 48 | Ga0065165_1001400 | 3300005262 | Bacteria | 26315 |
| 49 | Ga0065704_10070139 | 3300005289 | Bacteria | 529843 |
| 50 | Ga0065707_10083069 | 3300005295 | Bacteria | 10627 |
| 51 | Ga0070666_10120429 | 3300005335 | Bacteria | 1820 |
| 52 | Ga0070666_10257873 | 3300005335 | Bacteria | 1236 |
| 53 | Ga0070666_10841099 | 3300005335 | Bacteria | 677 |
| 54 | Ga0070660_100000032 | 3300005339 | Bacteria | 85304 |
| 55 | Ga0070660_100006752 | 3300005339 | Bacteria | 7962 |
| 56 | Ga0070661_100091075 | 3300005344 | Bacteria | 2259 |
| 57 | Ga0070668_100217816 | 3300005347 | Bacteria | 1573 |
| 58 | Ga0070659_100000035 | 3300005366 | Bacteria | 115022 |
| 59 | Ga0070709_10187962 | 3300005434 | Bacteria | 1455 |
| 60 | Ga0070663_100000222 | 3300005455 | Bacteria | 28738 |
| 61 | Ga0070663_100088981 | 3300005455 | Bacteria | 2284 |
| 62 | Ga0070663_100113649 | 3300005455 | Bacteria | 2038 |
| 63 | Ga0070678_100184437 | 3300005456 | Bacteria | 1711 |
| 64 | Ga0070665_100311225 | 3300005548 | Bacteria | 1579 |
| 65 | Ga0068855_100000763 | 3300005563 | Bacteria | 39665 |
| 66 | Ga0068855_100031855 | 3300005563 | Bacteria | 6294 |
| 67 | Ga0068855_100097688 | 3300005563 | Bacteria | 3383 |
| 68 | Ga0068855_101196260 | 3300005563 | Bacteria | 790 |
| 69 | Ga0068857_100083556 | 3300005577 | Bacteria | 2852 |
| 70 | Ga0068854_100004210 | 3300005578 | Bacteria | 9060 |
| 71 | Ga0068856_100327497 | 3300005614 | Bacteria | 1549 |
| 72 | Ga0068852_100722091 | 3300005616 | Bacteria | 1007 |
| 73 | Ga0068851_10174315 | 3300005834 | Bacteria | 1188 |
| 74 | Ga0068851_10405205 | 3300005834 | Bacteria | 803 |
| 75 | Ga0068858_100397505 | 3300005842 | Bacteria | 1324 |
| 76 | Ga0070717_11348501 | 3300006028 | Bacteria | 648 |
| 77 | Ga0075364_10365262 | 3300006051 | Bacteria | 984 |
| 78 | Ga0070716_100050405 | 3300006173 | Bacteria | 2363 |
| 79 | Ga0075366_10001087 | 3300006195 | Bacteria | 13355 |
| 80 | Ga0075428_100010312 | 3300006844 | Bacteria | 10369 |
| 81 | Ga0079104_1003995 | 3300006946 | Bacteria | 6551 |
| 82 | Ga0099826_10000018 | 3300006948 | Bacteria | 198330 |
| 83 | Ga0105251_10161125 | 3300009011 | Bacteria | 1011 |
| 84 | Ga0105244_10031581 | 3300009036 | Bacteria | 2810 |
| 85 | Ga0105244_10070631 | 3300009036 | Bacteria | 1742 |
| 86 | Ga0105250_10000010 | 3300009092 | Bacteria | 298384 |
| 87 | Ga0105250_10004503 | 3300009092 | Bacteria | 6402 |
| 88 | Ga0105240_10017231 | 3300009093 | Bacteria | 9744 |
| 89 | Ga0105240_10030539 | 3300009093 | Bacteria | 7003 |
| 90 | Ga0105240_10043049 | 3300009093 | Bacteria | 5749 |
| 91 | Ga0105240_10062072 | 3300009093 | Bacteria | 4654 |
| 92 | Ga0105240_10984954 | 3300009093 | Bacteria | 902 |
| 93 | Ga0105245_10613889 | 3300009098 | Bacteria | 1115 |
| 94 | Ga0105241_11190003 | 3300009174 | Bacteria | 721 |
| 95 | Ga0105248_10500894 | 3300009177 | Bacteria | 1369 |
| 96 | Ga0105237_10023983 | 3300009545 | Bacteria | 6242 |
| 97 | Ga0105237_10093311 | 3300009545 | Bacteria | 2999 |
| 98 | Ga0105237_10122579 | 3300009545 | Bacteria | 2593 |
| 99 | Ga0105237_10439810 | 3300009545 | Bacteria | 1310 |
| 100 | Ga0105237_11057960 | 3300009545 | Bacteria | 818 |
| 101 | Ga0105238_10000004 | 3300009551 | Bacteria | 390514 |
| 102 | Ga0105238_10101063 | 3300009551 | Bacteria | 2867 |
| 103 | Ga0105238_10151743 | 3300009551 | Bacteria | 2292 |
| 104 | Ga0105239_10002820 | 3300010375 | Bacteria | 21739 |
| 105 | Ga0105239_10010789 | 3300010375 | Bacteria | 10206 |
| 106 | Ga0157371_10013404 | 3300013102 | Bacteria | 6226 |
| 107 | Ga0157370_10004029 | 3300013104 | Bacteria | 17072 |
| 108 | Ga0157370_10304339 | 3300013104 | Bacteria | 1471 |
| 109 | Ga0157369_10001942 | 3300013105 | Bacteria | 24889 |
| 110 | Ga0157374_10710152 | 3300013296 | Bacteria | 1019 |
| 111 | Ga0163162_10036635 | 3300013306 | Bacteria | 4892 |
| 112 | Ga0163162_12104359 | 3300013306 | Bacteria | 647 |
| 113 | Ga0157372_10323749 | 3300013307 | Bacteria | 1795 |
| 114 | Ga0157380_12949522 | 3300014326 | Bacteria | 542 |
| 115 | Ga0182008_10004241 | 3300014497 | Bacteria | 8406 |
| 116 | Ga0182008_10145724 | 3300014497 | Bacteria | 1186 |
| 117 | Ga0182008_10362177 | 3300014497 | Bacteria | 771 |
| 118 | Ga0157379_10000049 | 3300014968 | Bacteria | 74565 |
| 119 | Ga0182006_1000112 | 3300015261 | Bacteria | 87378 |
| 120 | Ga0182006_1050940 | 3300015261 | Bacteria | 1594 |
| 121 | Ga0182007_10000020 | 3300015262 | Bacteria | 194053 |
| 122 | Ga0182007_10017224 | 3300015262 | Bacteria | 2645 |
| 123 | Ga0182007_10024254 | 3300015262 | Bacteria | 2124 |
| 124 | Ga0182007_10032155 | 3300015262 | Bacteria | 1783 |
| 125 | Ga0182005_1000001 | 3300015265 | Bacteria | 1014869 |
| 126 | Ga0182005_1000118 | 3300015265 | Bacteria | 57357 |
| 127 | Ga0182005_1053401 | 3300015265 | Bacteria | 1100 |
| 128 | Ga0183361_10012 | 3300016635 | Bacteria | 203395 |
| 129 | Ga0163161_10039155 | 3300017792 | Bacteria | 3402 |
| 130 | Ga0206355_1360317 | 3300020076 | Bacteria | 604 |
| 131 | Ga0206350_10320270 | 3300020080 | Bacteria | 756 |
| 132 | Ga0206350_11216288 | 3300020080 | Bacteria | 722 |
| 133 | Ga0206354_10473152 | 3300020081 | Bacteria | 2096 |
| 134 | Ga0213872_10008589 | 3300021361 | Bacteria | 4939 |
| 135 | Ga0213872_10132756 | 3300021361 | Bacteria | 1096 |
| 136 | Ga0213872_10454948 | 3300021361 | Bacteria | 514 |
| 137 | Ga0224712_10137122 | 3300022467 | Bacteria | 1074 |
| 138 | Ga0209435_100007 | 3300025206 | Bacteria | 516857 |
| 139 | Ga0209435_100623 | 3300025206 | Bacteria | 6462 |
| 140 | Ga0209784_100025 | 3300025224 | Bacteria | 376681 |
| 141 | Ga0209784_100048 | 3300025224 | Bacteria | 198885 |
| 142 | Ga0209566_100025 | 3300025225 | Bacteria | 376681 |
| 143 | Ga0209566_100060 | 3300025225 | Bacteria | 198885 |
| 144 | Ga0209674_100042 | 3300025226 | Bacteria | 376681 |
| 145 | Ga0209674_100082 | 3300025226 | Bacteria | 198885 |
| 146 | Ga0209672_100038 | 3300025228 | Bacteria | 286731 |
| 147 | Ga0209672_100952 | 3300025228 | Bacteria | 12904 |
| 148 | Ga0209672_105499 | 3300025228 | Bacteria | 2164 |
| 149 | Ga0209147_100017 | 3300025229 | Bacteria | 516857 |
| 150 | Ga0209147_100259 | 3300025229 | Bacteria | 49184 |
| 151 | Ga0209563_100046 | 3300025230 | Bacteria | 376681 |
| 152 | Ga0209563_100082 | 3300025230 | Bacteria | 198750 |
| 153 | Ga0207427_100829 | 3300025231 | Bacteria | 13818 |
| 154 | Ga0209437_100125 | 3300025233 | Bacteria | 198146 |
| 155 | Ga0209258_100109 | 3300025242 | Bacteria | 203881 |
| 156 | Ga0209258_100215 | 3300025242 | Bacteria | 114444 |
| 157 | Ga0209646_1000044 | 3300025246 | Bacteria | 334596 |
| 158 | Ga0209646_1000133 | 3300025246 | Bacteria | 125401 |
| 159 | Ga0209026_1000774 | 3300025250 | Bacteria | 17883 |
| 160 | Ga0209026_1001042 | 3300025250 | Bacteria | 13542 |
| 161 | Ga0209677_100027 | 3300025253 | Bacteria | 376681 |
| 162 | Ga0209677_100046 | 3300025253 | Bacteria | 198287 |
| 163 | Ga0209148_1000844 | 3300025254 | Bacteria | 21726 |
| 164 | Ga0209148_1027150 | 3300025254 | Bacteria | 883 |
| 165 | Ga0209759_1000048 | 3300025256 | Bacteria | 224817 |
| 166 | Ga0209759_1000187 | 3300025256 | Bacteria | 100012 |
| 167 | Ga0209759_1005558 | 3300025256 | Bacteria | 4384 |
| 168 | Ga0209759_1015976 | 3300025256 | Bacteria | 1915 |
| 169 | Ga0209233_1000138 | 3300025261 | Bacteria | 198287 |
| 170 | Ga0209565_1000174 | 3300025263 | Bacteria | 82914 |
| 171 | Ga0209565_1002133 | 3300025263 | Bacteria | 7497 |
| 172 | Ga0209455_1004560 | 3300025272 | Bacteria | 4495 |
| 173 | Ga0209455_1005569 | 3300025272 | Bacteria | 3866 |
| 174 | Ga0209673_1015157 | 3300025273 | Bacteria | 2944 |
| 175 | Ga0209130_1007122 | 3300025284 | Bacteria | 3504 |
| 176 | Ga0209675_1000100 | 3300025291 | Bacteria | 128565 |
| 177 | Ga0209675_1001095 | 3300025291 | Bacteria | 16645 |
| 178 | Ga0209675_1004980 | 3300025291 | Bacteria | 5716 |
| 179 | Ga0209675_1005120 | 3300025291 | Bacteria | 5581 |
| 180 | Ga0209676_1000141 | 3300025292 | Bacteria | 175894 |
| 181 | Ga0209676_1066430 | 3300025292 | Bacteria | 874 |
| 182 | Ga0209025_1000390 | 3300025294 | Bacteria | 90952 |
| 183 | Ga0209025_1000755 | 3300025294 | Bacteria | 54059 |
| 184 | Ga0209025_1001457 | 3300025294 | Bacteria | 30940 |
| 185 | Ga0209025_1006408 | 3300025294 | Bacteria | 9148 |
| 186 | Ga0209025_1019891 | 3300025294 | Bacteria | 3706 |
| 187 | Ga0209564_1001462 | 3300025295 | Bacteria | 23992 |
| 188 | Ga0209564_1003294 | 3300025295 | Bacteria | 11224 |
| 189 | Ga0209564_1011309 | 3300025295 | Bacteria | 4011 |
| 190 | Ga0209256_1000434 | 3300025299 | Bacteria | 64801 |
| 191 | Ga0209256_1001596 | 3300025299 | Bacteria | 22189 |
| 192 | Ga0207426_1000037 | 3300025302 | Bacteria | 442735 |
| 193 | Ga0207426_1001791 | 3300025302 | Bacteria | 16051 |
| 194 | Ga0209051_1004798 | 3300025303 | Bacteria | 8153 |
| 195 | Ga0209051_1049645 | 3300025303 | Bacteria | 1412 |
| 196 | Ga0207656_10160428 | 3300025321 | Bacteria | 1070 |
| 197 | Ga0207696_1000133 | 3300025711 | Bacteria | 131987 |
| 198 | Ga0207696_1005177 | 3300025711 | Bacteria | 5458 |
| 199 | Ga0207655_1068552 | 3300025728 | Bacteria | 1330 |
| 200 | Ga0207713_1002908 | 3300025735 | Bacteria | 11990 |
| 201 | Ga0207680_10317563 | 3300025903 | Bacteria | 1089 |
| 202 | Ga0207680_11089891 | 3300025903 | Bacteria | 571 |
| 203 | Ga0207647_10000608 | 3300025904 | Bacteria | 27922 |
| 204 | Ga0207647_10003231 | 3300025904 | Bacteria | 12223 |
| 205 | Ga0207647_10022621 | 3300025904 | Bacteria | 4172 |
| 206 | Ga0207695_10001007 | 3300025913 | Bacteria | 49769 |
| 207 | Ga0207695_10110658 | 3300025913 | Bacteria | 2727 |
| 208 | Ga0207695_10128123 | 3300025913 | Bacteria | 2498 |
| 209 | Ga0207695_10366880 | 3300025913 | Bacteria | 1326 |
| 210 | Ga0207695_11313531 | 3300025913 | Bacteria | 604 |
| 211 | Ga0207671_10002362 | 3300025914 | Bacteria | 20313 |
| 212 | Ga0207671_10080640 | 3300025914 | Bacteria | 2440 |
| 213 | Ga0207671_10092086 | 3300025914 | Bacteria | 2285 |
| 214 | Ga0207671_10183593 | 3300025914 | Bacteria | 1629 |
| 215 | Ga0207671_10185055 | 3300025914 | Bacteria | 1622 |
| 216 | Ga0207657_10000051 | 3300025919 | Bacteria | 109129 |
| 217 | Ga0207657_10000131 | 3300025919 | Bacteria | 75479 |
| 218 | Ga0207649_10045441 | 3300025920 | Bacteria | 2693 |
| 219 | Ga0207694_10000021 | 3300025924 | Bacteria | 300246 |
| 220 | Ga0207694_10165073 | 3300025924 | Bacteria | 1790 |
| 221 | Ga0207690_10000034 | 3300025932 | Bacteria | 149574 |
| 222 | Ga0207706_10467047 | 3300025933 | Bacteria | 1091 |
| 223 | Ga0207709_10819038 | 3300025935 | Bacteria | 752 |
| 224 | Ga0207665_10080086 | 3300025939 | Bacteria | 2246 |
| 225 | Ga0207711_10047482 | 3300025941 | Bacteria | 3670 |
| 226 | Ga0207667_10000235 | 3300025949 | Bacteria | 77134 |
| 227 | Ga0207667_10037973 | 3300025949 | Bacteria | 5146 |
| 228 | Ga0207667_10039101 | 3300025949 | Bacteria | 5058 |
| 229 | Ga0207640_10009807 | 3300025981 | Bacteria | 5371 |
| 230 | Ga0207678_10001810 | 3300026067 | Bacteria | 19587 |
| 231 | Ga0207678_10069274 | 3300026067 | Bacteria | 3025 |
| 232 | Ga0207674_10099524 | 3300026116 | Bacteria | 2890 |
| 233 | Ga0209281_1003252 | 3300027111 | Bacteria | 5523 |
| 234 | Ga0209969_1002580 | 3300027360 | Bacteria | 2507 |
| 235 | Ga0209996_1011383 | 3300027395 | Bacteria | 1187 |
| 236 | Ga0209984_1001023 | 3300027424 | Bacteria | 2978 |
| 237 | Ga0209968_1011039 | 3300027526 | Bacteria | 1394 |
| 238 | Ga0209982_1000948 | 3300027552 | Bacteria | 3828 |
| 239 | Ga0209983_1002199 | 3300027665 | Bacteria | 4293 |
| 240 | Ga0209282_1000063 | 3300027666 | Bacteria | 93789 |
| 241 | Ga0209971_1001547 | 3300027682 | Bacteria | 5690 |
| 242 | Ga0209974_10005787 | 3300027876 | Bacteria | 4335 |
| 243 | Ga0268266_10083192 | 3300028379 | Bacteria | 2794 |
| 244 | Ga0268266_10408931 | 3300028379 | Bacteria | 1284 |
| 245 | Ga0265334_10000402 | 3300028573 | Bacteria | 22758 |
| 246 | Ga0265338_10000113 | 3300028800 | Bacteria | 150993 |
| 247 | Ga0265338_10119274 | 3300028800 | Bacteria | 2106 |
| 248 | Ga0265332_10000026 | 3300031238 | Bacteria | 193153 |
| 249 | Ga0307509_10000145 | 3300031507 | Bacteria | 107492 |
| 250 | Ga0307408_100016129 | 3300031548 | Bacteria | 4982 |
| 251 | Ga0307406_10001924 | 3300031901 | Bacteria | 11317 |
| 252 | Ga0307409_100001814 | 3300031995 | Bacteria | 10830 |
| 253 | Ga0307415_100254220 | 3300032126 | Bacteria | 1430 |
| 254 | Ga0316592_1096843 | 3300033524 | Bacteria | 677 |
| 255 | Ga0373946_0060798 | 3300035171 | Bacteria | 1607 |
| 256 | Ga0373937_0124447 | 3300036401 | Bacteria | 2404 |
| 257 | Ga0373937_0387695 | 3300036401 | Bacteria | 1325 |
| 258 | Ga0395899_0022113 | 3300037312 | Bacteria | 4822 |
| 259 | Ga0395899_0058642 | 3300037312 | Bacteria | 2839 |
| 260 | Ga0395899_0404001 | 3300037312 | Bacteria | 903 |
| 261 | Ga0395900_0002362 | 3300037418 | Bacteria | 20872 |
| 262 | Ga0395900_0065798 | 3300037418 | Bacteria | 3724 |
| 263 | Ga0395900_0206106 | 3300037418 | Bacteria | 1987 |
| 264 | Ga0395898_0000792 | 3300037466 | Bacteria | 53811 |
| 265 | Ga0395898_0006662 | 3300037466 | Bacteria | 12318 |
| 266 | Ga0395898_0020242 | 3300037466 | Bacteria | 6760 |
| 267 | Ga0395898_0232430 | 3300037466 | Bacteria | 1758 |
| 268 | Ga0395898_0570638 | 3300037466 | Bacteria | 1074 |
| 269 | Ga0395905_0000813 | 3300037471 | Bacteria | 40988 |
| 270 | Ga0395905_0005540 | 3300037471 | Bacteria | 12882 |
| 271 | Ga0395905_0899359 | 3300037471 | Bacteria | 788 |
| 272 | Ga0395905_1212326 | 3300037471 | Bacteria | 658 |
| 273 | Ga0395901_0000003 | 3300038443 | Bacteria | 701538 |
| 274 | Ga0395901_0000180 | 3300038443 | Bacteria | 81881 |
| 275 | Ga0395901_0000887 | 3300038443 | Bacteria | 32901 |
| 276 | Ga0395901_0088575 | 3300038443 | Bacteria | 3238 |
| 277 | Ga0395901_0518996 | 3300038443 | Bacteria | 1210 |
| 278 | Ga0237819_06728 | 3300038705 | Bacteria | 1705 |
| 279 | Ga0237819_12094 | 3300038705 | Bacteria | 1076 |
| 280 | Ga0436360_0491784 | 3300039438 | Bacteria | 1689 |
| 281 | Ga0436361_0266834 | 3300039447 | Bacteria | 548 |
| 282 | Ga0436361_0321406 | 3300039447 | Bacteria | 4407 |
| 283 | Ga0436361_0633092 | 3300039447 | Bacteria | 1422 |
| 284 | Ga0436361_1043697 | 3300039447 | Bacteria | 1110 |
| 285 | Ga0451789_1261723 | 3300041443 | Bacteria | 678 |
| 286 | Ga0451793_1378092 | 3300041452 | Bacteria | 890 |
| 287 | Ga0451798_0896809 | 3300041458 | Bacteria | 1233 |
| 288 | Ga0451807_2204438 | 3300041486 | Bacteria | 861 |
| 289 | Ga0451835_0930639 | 3300041492 | Bacteria | 796 |
| 290 | Ga0451839_1531924 | 3300041496 | Bacteria | 1258 |
| 291 | Ga0451841_1156474 | 3300041498 | Bacteria | 1414 |
| 292 | Ga0451843_1479918 | 3300041509 | Bacteria | 571 |
| 293 | Ga0451855_0537433 | 3300041511 | Bacteria | 1126 |
| 294 | Ga0439432_047114 | 3300042006 | Bacteria | 1353 |
| 295 | Ga0466969_0089520 | 3300044656 | Bacteria | 1460 |
| 296 | Ga0466972_0079611 | 3300044658 | Bacteria | 1560 |
| 297 | Ga0466972_0183867 | 3300044658 | Bacteria | 980 |
| 298 | Ga0466982_0098412 | 3300044672 | Bacteria | 1812 |
| 299 | Ga0453683_0112851 | 3300044673 | Bacteria | 1710 |
| 300 | Ga0466965_0006639 | 3300044683 | Bacteria | 5270 |
| 301 | Ga0466965_0189943 | 3300044683 | Bacteria | 1086 |
| 302 | Ga0466965_0472365 | 3300044683 | Bacteria | 700 |
| 303 | Ga0466966_0005778 | 3300044684 | Bacteria | 8151 |
| 304 | Ga0466966_0014130 | 3300044684 | Bacteria | 5283 |
| 305 | Ga0466961_0005254 | 3300044693 | Bacteria | 8150 |
| 306 | Ga0466961_0233516 | 3300044693 | Bacteria | 1131 |
| 307 | Ga0466963_0425991 | 3300044694 | Bacteria | 936 |
| 308 | Ga0466963_0638606 | 3300044694 | Bacteria | 751 |
| 309 | Ga0466964_0373505 | 3300044706 | Bacteria | 738 |
| 310 | Ga0453684_0000040 | 3300044712 | Bacteria | 690210 |
| 311 | Ga0466971_0015018 | 3300044719 | Bacteria | 3406 |
| 312 | Ga0466971_0018548 | 3300044719 | Bacteria | 3082 |
| 313 | Ga0466968_0006354 | 3300044735 | Bacteria | 4450 |
| 314 | Ga0466970_0025169 | 3300044765 | Bacteria | 3115 |
| 315 | Ga0466970_0210398 | 3300044765 | Bacteria | 1083 |
| 316 | Ga0466957_0020806 | 3300044842 | Bacteria | 3860 |
| 317 | Ga0466957_0144345 | 3300044842 | Bacteria | 1535 |
| 318 | Ga0466957_0615036 | 3300044842 | Bacteria | 761 |
| 319 | Ga0466960_0367037 | 3300044901 | Bacteria | 824 |
| 320 | Ga0466960_0495089 | 3300044901 | Bacteria | 715 |
| 321 | Ga0466959_0013608 | 3300045049 | Bacteria | 5900 |
| 322 | Ga0466959_0217894 | 3300045049 | Bacteria | 1324 |
| 323 | Ga0466959_0262441 | 3300045049 | Bacteria | 1189 |
| 324 | Ga0451576_0037303 | 3300045051 | Bacteria | 5149 |
| 325 | Ga0466958_0010813 | 3300045836 | Bacteria | 5123 |
| 326 | Ga0466958_0213495 | 3300045836 | Bacteria | 1230 |
| 327 | Ga0466958_0477196 | 3300045836 | Bacteria | 808 |
| 328 | Ga0495603_0004003 | 3300046455 | Bacteria | 8772 |
| 329 | Ga0495590_0043053 | 3300046457 | Bacteria | 1575 |
| 330 | Ga0495629_0001732 | 3300046459 | Bacteria | 17109 |
| 331 | Ga0495638_0097173 | 3300046460 | Bacteria | 1766 |
| 332 | Ga0495651_0030481 | 3300046462 | Bacteria | 4206 |
| 333 | Ga0495653_0019152 | 3300046463 | Bacteria | 5552 |
| 334 | Ga0495653_0118852 | 3300046463 | Bacteria | 1887 |
| 335 | Ga0495653_0287634 | 3300046463 | Bacteria | 1076 |
| 336 | Ga0495650_0002944 | 3300046471 | Bacteria | 12897 |
| 337 | Ga0495650_0256486 | 3300046471 | Bacteria | 593 |
| 338 | Ga0495580_0029510 | 3300046472 | Bacteria | 3980 |
| 339 | Ga0495605_0003621 | 3300046474 | Bacteria | 9166 |
| 340 | Ga0495605_0005538 | 3300046474 | Bacteria | 7347 |
| 341 | Ga0495605_0054550 | 3300046474 | Bacteria | 1935 |
| 342 | Ga0495639_0290183 | 3300046475 | Bacteria | 814 |
| 343 | Ga0495662_0060546 | 3300046476 | Bacteria | 1828 |
| 344 | Ga0495664_0049255 | 3300046477 | Bacteria | 2501 |
| 345 | Ga0495664_0110828 | 3300046477 | Bacteria | 1656 |
| 346 | Ga0495664_0128081 | 3300046477 | Bacteria | 1536 |
| 347 | Ga0495664_0263450 | 3300046477 | Bacteria | 1042 |
| 348 | Ga0495584_0079048 | 3300046491 | Bacteria | 1655 |
| 349 | Ga0495596_0000845 | 3300046500 | Bacteria | 18533 |
| 350 | Ga0495596_0073129 | 3300046500 | Bacteria | 1331 |
| 351 | Ga0495607_0016273 | 3300046501 | Bacteria | 4802 |
| 352 | Ga0495583_0023424 | 3300046506 | Bacteria | 3124 |
| 353 | Ga0495583_0038920 | 3300046506 | Bacteria | 2244 |
| 354 | Ga0495606_0004958 | 3300046507 | Bacteria | 12997 |
| 355 | Ga0495606_0131355 | 3300046507 | Bacteria | 1488 |
| 356 | Ga0495606_0419774 | 3300046507 | Bacteria | 692 |
| 357 | Ga0495608_0003969 | 3300046511 | Bacteria | 10626 |
| 358 | Ga0495608_0022983 | 3300046511 | Bacteria | 4275 |
| 359 | Ga0495608_0151115 | 3300046511 | Bacteria | 1480 |
| 360 | Ga0495610_0003098 | 3300046512 | Bacteria | 13264 |
| 361 | Ga0495616_0008782 | 3300046513 | Bacteria | 5950 |
| 362 | Ga0495616_0053497 | 3300046513 | Bacteria | 2006 |
| 363 | Ga0495628_0001866 | 3300046516 | Bacteria | 19122 |
| 364 | Ga0495628_0006103 | 3300046516 | Bacteria | 10537 |
| 365 | Ga0495628_0083791 | 3300046516 | Bacteria | 2475 |
| 366 | Ga0495628_0439791 | 3300046516 | Bacteria | 948 |
| 367 | Ga0495630_0457182 | 3300046517 | Bacteria | 978 |
| 368 | Ga0495644_0046337 | 3300046523 | Bacteria | 1634 |
| 369 | Ga0495648_0018991 | 3300046524 | Bacteria | 4849 |
| 370 | Ga0495648_0031046 | 3300046524 | Bacteria | 3524 |
| 371 | Ga0495666_0206526 | 3300046526 | Bacteria | 902 |
| 372 | Ga0495642_0052992 | 3300046528 | Bacteria | 1671 |
| 373 | Ga0495652_0006302 | 3300046529 | Bacteria | 11050 |
| 374 | Ga0495652_0047614 | 3300046529 | Bacteria | 3676 |
| 375 | Ga0495652_0144710 | 3300046529 | Bacteria | 1865 |
| 376 | Ga0495654_0145764 | 3300046530 | Bacteria | 1051 |
| 377 | Ga0495665_0109733 | 3300046531 | Bacteria | 1447 |
| 378 | Ga0495665_0119025 | 3300046531 | Bacteria | 1383 |
| 379 | Ga0495586_0130486 | 3300046535 | Bacteria | 1407 |
| 380 | Ga0495586_0243564 | 3300046535 | Bacteria | 1025 |
| 381 | Ga0495609_0007032 | 3300046538 | Bacteria | 5668 |
| 382 | Ga0495597_0084452 | 3300046542 | Bacteria | 1354 |
| 383 | Ga0495597_0348533 | 3300046542 | Bacteria | 568 |
| 384 | Ga0495645_0006241 | 3300046543 | Bacteria | 8257 |
| 385 | Ga0495645_0011392 | 3300046543 | Bacteria | 6256 |
| 386 | Ga0495645_0126632 | 3300046543 | Bacteria | 1794 |
| 387 | Ga0495667_0037279 | 3300046559 | Bacteria | 3241 |
| 388 | Ga0495656_0034494 | 3300046615 | Bacteria | 2072 |
| 389 | Ga0495656_0056546 | 3300046615 | Bacteria | 1696 |
| 390 | Ga0495668_0257076 | 3300046616 | Bacteria | 956 |
| 391 | Ga0495611_0105597 | 3300046648 | Bacteria | 1310 |
| 392 | Ga0495625_0295868 | 3300046660 | Bacteria | 1037 |
| 393 | Ga0495625_0534536 | 3300046660 | Bacteria | 712 |
| 394 | Ga0495661_0017791 | 3300046665 | Bacteria | 4685 |
| 395 | Ga0495661_0146552 | 3300046665 | Bacteria | 1279 |
| 396 | Ga0495657_0040791 | 3300046675 | Bacteria | 3181 |
| 397 | Ga0495599_0002151 | 3300046678 | Bacteria | 11458 |
| 398 | Ga0495623_0015772 | 3300046679 | Bacteria | 4884 |
| 399 | Ga0495623_0018230 | 3300046679 | Bacteria | 4533 |
| 400 | Ga0495623_0040897 | 3300046679 | Bacteria | 2958 |
| 401 | Ga0495646_0000331 | 3300046680 | Bacteria | 24355 |
| 402 | Ga0495646_0065842 | 3300046680 | Bacteria | 2144 |
| 403 | Ga0495646_0188776 | 3300046680 | Bacteria | 1127 |
| 404 | Ga0495658_0066530 | 3300046683 | Bacteria | 2082 |
| 405 | Ga0495669_0029127 | 3300046684 | Bacteria | 2420 |
| 406 | Ga0495669_0037002 | 3300046684 | Bacteria | 2159 |
| 407 | Ga0495669_0379476 | 3300046684 | Bacteria | 684 |
| 408 | Ga0495624_0031021 | 3300046690 | Bacteria | 3479 |
| 409 | Ga0495624_0084242 | 3300046690 | Bacteria | 1965 |
| 410 | Ga0495624_0140789 | 3300046690 | Bacteria | 1477 |
| 411 | Ga0495671_0002939 | 3300046692 | Bacteria | 10605 |
| 412 | Ga0495671_0355838 | 3300046692 | Bacteria | 702 |
| 413 | Ga0495649_0021267 | 3300046694 | Bacteria | 3635 |
| 414 | Ga0495649_0106031 | 3300046694 | Bacteria | 1492 |
| 415 | Ga0495649_0428173 | 3300046694 | Bacteria | 662 |
| 416 | Ga0495589_0016255 | 3300046794 | Bacteria | 3824 |
| 417 | Ga0495589_0066572 | 3300046794 | Bacteria | 1764 |
| 418 | Ga0495600_0013625 | 3300046809 | Bacteria | 5114 |
| 419 | Ga0495600_0246466 | 3300046809 | Bacteria | 1137 |
| 420 | Ga0495600_0324606 | 3300046809 | Bacteria | 968 |
| 421 | Ga0495660_0206382 | 3300046810 | Bacteria | 935 |
| 422 | Ga0495604_0011114 | 3300047317 | Bacteria | 7147 |
| 423 | Ga0495604_0169175 | 3300047317 | Bacteria | 1538 |
| 424 | Ga0495604_0439836 | 3300047317 | Bacteria | 853 |
| 425 | Ga0495636_0002527 | 3300047318 | Bacteria | 7020 |
| 426 | Ga0495636_0517716 | 3300047318 | Bacteria | 578 |
| 427 | Ga0495674_0029256 | 3300047319 | Bacteria | 5019 |
| 428 | Ga0495674_0197177 | 3300047319 | Bacteria | 1672 |
| 429 | Ga0495672_0002512 | 3300047320 | Bacteria | 16771 |
| 430 | Ga0495672_0082399 | 3300047320 | Bacteria | 1789 |
| 431 | Ga0495683_0027196 | 3300047323 | Bacteria | 2926 |
| 432 | Ga0495683_0265441 | 3300047323 | Bacteria | 748 |
| 433 | Ga0495687_112097 | 3300047443 | Bacteria | 1000 |
| 434 | Ga0495677_0051940 | 3300047445 | Bacteria | 1510 |
| 435 | Ga0495677_0285580 | 3300047445 | Bacteria | 648 |
| 436 | Ga0495679_015535 | 3300047446 | Bacteria | 2781 |
| 437 | Ga0495685_079015 | 3300047447 | Bacteria | 1096 |
| 438 | Ga0495673_0243281 | 3300047469 | Bacteria | 659 |
| 439 | Ga0495686_0000014 | 3300047472 | Bacteria | 474014 |
| 440 | Ga0495593_0110149 | 3300047673 | Bacteria | 1406 |
| 441 | Ga0495602_0017748 | 3300048088 | Bacteria | 7124 |
| 442 | Ga0495602_0107177 | 3300048088 | Bacteria | 2278 |
| 443 | Ga0495626_0098337 | 3300048091 | Bacteria | 1278 |
| 444 | Ga0496100_0008832 | 3300048903 | Bacteria | 5637 |
| 445 | Ga0496100_0016348 | 3300048903 | Bacteria | 4355 |
| 446 | Ga0496100_0084267 | 3300048903 | Bacteria | 2154 |
| 447 | Ga0496100_0222420 | 3300048903 | Bacteria | 1386 |
| 448 | Ga0496100_0671933 | 3300048903 | Bacteria | 807 |
| 449 | Ga0496100_0749940 | 3300048903 | Bacteria | 763 |
| 450 | Ga0496101_0031993 | 3300048904 | Bacteria | 3700 |
| 451 | Ga0496101_0111761 | 3300048904 | Bacteria | 2057 |
| 452 | Ga0496101_0165145 | 3300048904 | Bacteria | 1699 |
| 453 | Ga0496101_0238008 | 3300048904 | Bacteria | 1416 |
| 454 | Ga0496102_0000661 | 3300048905 | Bacteria | 34418 |
| 455 | Ga0496102_0079999 | 3300048905 | Bacteria | 3010 |
| 456 | Ga0496102_0142680 | 3300048905 | Bacteria | 2246 |
| 457 | Ga0496102_0444801 | 3300048905 | Bacteria | 1216 |
| 458 | Ga0496102_0901743 | 3300048905 | Bacteria | 806 |
| 459 | Ga0496103_0001616 | 3300048906 | Bacteria | 14787 |
| 460 | Ga0496103_0309620 | 3300048906 | Bacteria | 1016 |
| 461 | Ga0496104_0080317 | 3300048907 | Bacteria | 3109 |
| 462 | Ga0496104_0154788 | 3300048907 | Bacteria | 2200 |
| 463 | Ga0496104_0232015 | 3300048907 | Bacteria | 1757 |
| 464 | Ga0496104_0927386 | 3300048907 | Bacteria | 776 |
| 465 | Ga0496105_0035791 | 3300048908 | Bacteria | 4088 |
| 466 | Ga0496105_0272444 | 3300048908 | Bacteria | 1367 |
| 467 | Ga0496105_0314136 | 3300048908 | Bacteria | 1257 |
| 468 | Ga0496106_0358611 | 3300048909 | Bacteria | 1171 |
| 469 | Ga0496107_0010382 | 3300048910 | Bacteria | 6471 |
| 470 | Ga0496107_0565826 | 3300048910 | Bacteria | 841 |
| 471 | Ga0496108_0227400 | 3300048911 | Bacteria | 1622 |
| 472 | Ga0496109_0159185 | 3300048912 | Bacteria | 2115 |
| 473 | Ga0496110_0000055 | 3300048913 | Bacteria | 57895 |
| 474 | Ga0496111_0060848 | 3300048914 | Bacteria | 2737 |
| 475 | Ga0496111_0503059 | 3300048914 | Bacteria | 892 |
| 476 | Ga0496113_0038038 | 3300048916 | Bacteria | 3535 |
| 477 | Ga0496114_0005374 | 3300048917 | Bacteria | 10016 |
| 478 | Ga0496114_0332107 | 3300048917 | Bacteria | 1344 |
| 479 | Ga0496115_0257785 | 3300048918 | Bacteria | 1434 |
| 480 | Ga0496115_0886841 | 3300048918 | Bacteria | 689 |
| 481 | Ga0496116_0009836 | 3300048919 | Bacteria | 8099 |
| 482 | Ga0496116_0017083 | 3300048919 | Bacteria | 5650 |
| 483 | Ga0496116_0021038 | 3300048919 | Bacteria | 4932 |
| 484 | Ga0496117_0000094 | 3300048920 | Bacteria | 201853 |
| 485 | Ga0496117_0020755 | 3300048920 | Bacteria | 5346 |
| 486 | Ga0496117_0055517 | 3300048920 | Bacteria | 2767 |
| 487 | Ga0496117_0260800 | 3300048920 | Bacteria | 939 |
| 488 | Ga0496118_0000071 | 3300048921 | Bacteria | 201853 |
| 489 | Ga0496118_0002811 | 3300048921 | Bacteria | 22806 |
| 490 | Ga0496118_0118494 | 3300048921 | Bacteria | 1733 |
| 491 | Ga0496119_0075970 | 3300048922 | Bacteria | 1950 |
| 492 | Ga0496119_0307617 | 3300048922 | Bacteria | 779 |
| 493 | Ga0496119_0322061 | 3300048922 | Bacteria | 756 |
| 494 | Ga0496120_0240147 | 3300048923 | Bacteria | 855 |
| 495 | Ga0496121_0016109 | 3300048924 | Bacteria | 7745 |
| 496 | Ga0496121_0017999 | 3300048924 | Bacteria | 7159 |
| 497 | Ga0496121_0027352 | 3300048924 | Bacteria | 5338 |
| 498 | Ga0496121_0093918 | 3300048924 | Bacteria | 2334 |
| 499 | Ga0496121_0406748 | 3300048924 | Bacteria | 889 |
| 500 | Ga0496121_0610862 | 3300048924 | Bacteria | 671 |
| 501 | Ga0496122_0001303 | 3300048925 | Bacteria | 41143 |
| 502 | Ga0496122_0003123 | 3300048925 | Bacteria | 22187 |
| 503 | Ga0496122_0021375 | 3300048925 | Bacteria | 5795 |
| 504 | Ga0496122_0058759 | 3300048925 | Bacteria | 2844 |
| 505 | Ga0496122_0147471 | 3300048925 | Bacteria | 1459 |
| 506 | Ga0496123_0004461 | 3300048926 | Bacteria | 14692 |
| 507 | Ga0496123_0005043 | 3300048926 | Bacteria | 13508 |
| 508 | Ga0496123_0077630 | 3300048926 | Bacteria | 2039 |
| 509 | Ga0496123_0140910 | 3300048926 | Bacteria | 1318 |
| 510 | Ga0496124_0226582 | 3300048927 | Bacteria | 1401 |
| 511 | Ga0496124_0230176 | 3300048927 | Bacteria | 1386 |
| 512 | Ga0496125_0109846 | 3300048928 | Bacteria | 2001 |
| 513 | Ga0496125_0277511 | 3300048928 | Bacteria | 1040 |
| 514 | Ga0496126_0004283 | 3300048929 | Bacteria | 17159 |
| 515 | Ga0496126_0175701 | 3300048929 | Bacteria | 1822 |
| 516 | Ga0496126_0396279 | 3300048929 | Bacteria | 1121 |
| 517 | Ga0501305_045614 | 3300049161 | Bacteria | 724 |
| 518 | Ga0495678_092518 | 3300049459 | Bacteria | 1062 |
| 519 | Ga0495682_0003624 | 3300049460 | Bacteria | 6810 |
| 520 | Ga0501318_086593 | 3300049534 | Bacteria | 514 |
| 521 | Ga0501032_0439606 | 3300049569 | Bacteria | 836 |
| 522 | Ga0501033_0002842 | 3300049570 | Bacteria | 14508 |
| 523 | Ga0501034_0001676 | 3300049571 | Bacteria | 28558 |
| 524 | Ga0501034_0110212 | 3300049571 | Bacteria | 2744 |
| 525 | Ga0501034_0903086 | 3300049571 | Bacteria | 771 |
| 526 | Ga0501037_0322356 | 3300049573 | Bacteria | 1070 |
| 527 | Ga0501047_0004231 | 3300049581 | Bacteria | 13513 |
| 528 | Ga0501047_0055057 | 3300049581 | Bacteria | 3847 |
| 529 | Ga0501070_0568359 | 3300049586 | Bacteria | 906 |
| 530 | Ga0501074_0101267 | 3300049590 | Bacteria | 2062 |
| 531 | Ga0501079_0294698 | 3300049741 | Bacteria | 1269 |
| 532 | Ga0501080_0103747 | 3300049742 | Bacteria | 2637 |
| 533 | Ga0501080_1375150 | 3300049742 | Bacteria | 603 |
| 534 | Ga0501081_0050053 | 3300049743 | Bacteria | 2878 |
| 535 | Ga0501279_072708 | 3300049775 | Bacteria | 581 |
| 536 | Ga0501035_0040498 | 3300049822 | Bacteria | 4210 |
| 537 | Ga0501035_0318047 | 3300049822 | Bacteria | 1308 |
| 538 | Ga0501044_0014793 | 3300049823 | Bacteria | 8412 |
| 539 | Ga0501044_0279870 | 3300049823 | Bacteria | 1602 |
| 540 | nmdc:mga00v17_333412_c1 | 3300050491 | Bacteria | 986 |
| 541 | nmdc:mga0k408_18383_c1 | 3300050493 | Bacteria | 3902 |
| 542 | nmdc:mga0k408_1877_c1 | 3300050493 | Bacteria | 11265 |
| 543 | Ga0495601_0004204 | 3300053077 | Bacteria | 8304 |
| 544 | Ga0495601_0717882 | 3300053077 | Bacteria | 637 |
| 545 | Ga0495619_0336888 | 3300053085 | Bacteria | 1044 |
| 546 | Ga0500643_003797 | 3300053087 | Bacteria | 7061 |
| 547 | Ga0500595_005316 | 3300053119 | Bacteria | 5638 |
| 548 | Ga0500618_006459 | 3300053125 | Bacteria | 3437 |
| 549 | Ga0500574_000067 | 3300053141 | Bacteria | 11756 |
| 550 | Ga0500590_090625 | 3300053148 | Bacteria | 1485 |
| 551 | Ga0500616_0097314 | 3300053153 | Bacteria | 1445 |
| 552 | Ga0500619_007917 | 3300053154 | Bacteria | 2549 |
| 553 | Ga0590074_000395 | 3300059423 | Bacteria | 6237 |
| 554 | Ga0590075_002071 | 3300059424 | Bacteria | 4836 |
| 555 | Ga0590077_000266 | 3300059426 | Bacteria | 14827 |
| 556 | Ga0587077_043152 | 3300059493 | Bacteria | 913 |
| 557 | Ga0587086_011045 | 3300059507 | Bacteria | 1103 |
| 558 | Ga0587089_020444 | 3300059509 | Bacteria | 912 |
| 559 | Ga0587090_039129 | 3300059510 | Bacteria | 827 |
| 560 | Ga0587090_039280 | 3300059510 | Bacteria | 826 |
| 561 | Ga0587091_057690 | 3300059511 | Bacteria | 816 |
| 562 | Ga0587109_039592 | 3300059624 | Bacteria | 929 |
| 563 | Ga0587115_027978 | 3300059626 | Bacteria | 823 |
| 564 | Ga0587065_03325 | 3300060245 | Bacteria | 882 |
| 565 | Ga0587081_03844 | 3300060246 | Bacteria | 956 |
| 566 | Ga0501082_0416674 | 3300060353 | Bacteria | 1173 |
| 567 | Ga0466962_0029794 | 3300061719 | Bacteria | 2612 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300003322 | rootL2_10145991 | rootL2_101459913 | 154 |
| 2 | 3300003322 | rootL2_10189899 | rootL2_101898993 | 154 |
| 3 | 3300003322 | rootL2_10329721 | rootL2_103297213 | 154 |
| 4 | 3300003323 | rootH1_10039841 | rootH1_1003984157 | 154 |
| 5 | 3300005434 | Ga0070709_10187962 | Ga0070709_101879622 | 154 |
| 6 | 3300006173 | Ga0070716_100050405 | Ga0070716_1000504052 | 154 |
| 7 | 3300006195 | Ga0075366_10001087 | Ga0075366_100010872 | 154 |
| 8 | 3300014326 | Ga0157380_12949522 | Ga0157380_129495221 | 154 |
| 9 | 3300025939 | Ga0207665_10080086 | Ga0207665_100800862 | 154 |
| 10 | 3300027360 | Ga0209969_1002580 | Ga0209969_10025802 | 154 |
| 11 | 3300027395 | Ga0209996_1011383 | Ga0209996_10113831 | 154 |
| 12 | 3300027424 | Ga0209984_1001023 | Ga0209984_10010232 | 154 |
| 13 | 3300027526 | Ga0209968_1011039 | Ga0209968_10110392 | 154 |
| 14 | 3300027552 | Ga0209982_1000948 | Ga0209982_10009483 | 154 |
| 15 | 3300027665 | Ga0209983_1002199 | Ga0209983_10021993 | 154 |
| 16 | 3300027682 | Ga0209971_1001547 | Ga0209971_10015472 | 154 |
| 17 | 3300027876 | Ga0209974_10005787 | Ga0209974_100057872 | 154 |
| 18 | 3300031548 | Ga0307408_100016129 | Ga0307408_1000161294 | 154 |
| 19 | 3300031901 | Ga0307406_10001924 | Ga0307406_1000192410 | 154 |
| 20 | 3300041452 | Ga0451793_1378092 | Ga0451793_1378092_43_510 | 154 |
| 21 | 3300041458 | Ga0451798_0896809 | Ga0451798_0896809_339_809 | 154 |
| 22 | 3300048914 | Ga0496111_0503059 | Ga0496111_0503059_91_558 | 154 |
| 23 | 3300048917 | Ga0496114_0332107 | Ga0496114_0332107_39_509 | 154 |
| 24 | 3300049161 | Ga0501305_045614 | Ga0501305_045614_114_581 | 154 |
| 25 | 3300049571 | Ga0501034_0110212 | Ga0501034_0110212_83_613 | 154 |
| 26 | 3300049581 | Ga0501047_0055057 | Ga0501047_0055057_3069_3599 | 154 |
| 27 | 3300049586 | Ga0501070_0568359 | Ga0501070_0568359_45_575 | 154 |
| 28 | 3300049775 | Ga0501279_072708 | Ga0501279_072708_84_554 | 154 |
| 29 | 3300050493 | nmdc:mga0k408_1877_c1 | nmdc:mga0k408_1877_c1_896_1366 | 154 |
| 30 | 3300006844 | Ga0075428_100010312 | Ga0075428_1000103128 | 155 |
| 31 | 3300025935 | Ga0207709_10819038 | Ga0207709_108190382 | 155 |
| 32 | 3300049741 | Ga0501079_0294698 | Ga0501079_0294698_133_606 | 155 |
| 33 | 3300049743 | Ga0501081_0050053 | Ga0501081_0050053_1459_1932 | 155 |
| 34 | 3300060353 | Ga0501082_0416674 | Ga0501082_0416674_249_722 | 155 |
| 35 | 3300005295 | Ga0065707_10083069 | Ga0065707_100830693 | 156 |
| 36 | 3300025291 | Ga0209675_1001095 | Ga0209675_100109510 | 156 |
| 37 | 3300025292 | Ga0209676_1066430 | Ga0209676_10664301 | 156 |
| 38 | 3300025711 | Ga0207696_1000133 | Ga0207696_1000133113 | 156 |
| 39 | 3300031238 | Ga0265332_10000026 | Ga0265332_1000002677 | 156 |
| 40 | 3300031507 | Ga0307509_10000145 | Ga0307509_1000014516 | 156 |
| 41 | 3300031995 | Ga0307409_100001814 | Ga0307409_1000018149 | 156 |
| 42 | 3300032126 | Ga0307415_100254220 | Ga0307415_1002542201 | 156 |
| 43 | 3300033524 | Ga0316592_1096843 | Ga0316592_10968431 | 156 |
| 44 | 3300041486 | Ga0451807_2204438 | Ga0451807_2204438_361_837 | 156 |
| 45 | 3300041492 | Ga0451835_0930639 | Ga0451835_0930639_154_630 | 156 |
| 46 | 3300041496 | Ga0451839_1531924 | Ga0451839_1531924_125_601 | 156 |
| 47 | 3300041498 | Ga0451841_1156474 | Ga0451841_1156474_116_592 | 156 |
| 48 | 3300041509 | Ga0451843_1479918 | Ga0451843_1479918_48_521 | 156 |
| 49 | 3300041511 | Ga0451855_0537433 | Ga0451855_0537433_509_985 | 156 |
| 50 | 3300044673 | Ga0453683_0112851 | Ga0453683_0112851_62_532 | 156 |
| 51 | 3300045051 | Ga0451576_0037303 | Ga0451576_0037303_2030_2500 | 156 |
| 52 | 3300053087 | Ga0500643_003797 | Ga0500643_003797_6180_6656 | 156 |
| 53 | 3300053153 | Ga0500616_0097314 | Ga0500616_0097314_588_1070 | 156 |
| 54 | 3300059510 | Ga0587090_039280 | Ga0587090_039280_12_488 | 156 |
| 55 | iso_pu_bacteria | 2511231003 | 2511251429 | 156 |
| 56 | iso_pu_bacteria | 2818991436 | 2819544657 | 156 |
| 57 | iso_pu_bacteria | 2818991445 | 2819593875 | 156 |
| 58 | 3300021361 | Ga0213872_10454948 | Ga0213872_104549481 | 157 |
| 59 | 3300028573 | Ga0265334_10000402 | Ga0265334_100004028 | 157 |
| 60 | 3300039447 | Ga0436361_0266834 | Ga0436361_0266834_27_503 | 157 |
| 61 | 3300049534 | Ga0501318_086593 | Ga0501318_086593_14_490 | 157 |
| 62 | 3300049570 | Ga0501033_0002842 | Ga0501033_0002842_42_584 | 157 |
| 63 | 3300049823 | Ga0501044_0279870 | Ga0501044_0279870_246_722 | 157 |
| 64 | iso_pu_bacteria | 2501025502 | 2501078880 | 157 |
| 65 | iso_pu_bacteria | 2510917013 | 2511089518 | 157 |
| 66 | iso_pu_bacteria | 2513237082 | 2513551551 | 157 |
| 67 | iso_pu_bacteria | 2513237083 | 2513560202 | 157 |
| 68 | iso_pu_bacteria | 2513237166 | 2514046265 | 157 |
| 69 | iso_pu_bacteria | 2519103095 | 2519457870 | 157 |
| 70 | iso_pu_bacteria | 2562617112 | 2563061881 | 157 |
| 71 | iso_pu_bacteria | 2582581311 | 2585295174 | 157 |
| 72 | iso_pu_bacteria | 2600255067 | 2600814643 | 157 |
| 73 | iso_pu_bacteria | 2617270889 | 2617917244 | 157 |
| 74 | iso_pu_bacteria | 2711768613 | 2713478283 | 157 |
| 75 | iso_pu_bacteria | 2721755763 | 2723879439 | 157 |
| 76 | iso_pu_bacteria | 2816332253 | 2817260052 | 157 |
| 77 | iso_pu_bacteria | 2816332256 | 2817277716 | 157 |
| 78 | iso_pu_bacteria | 2816332286 | 2817456871 | 157 |
| 79 | iso_pu_bacteria | 2848694841 | 2848700633 | 157 |
| 80 | iso_pu_bacteria | 2856287931 | 2856289182 | 157 |
| 81 | iso_pu_bacteria | 2857357740 | 2857363447 | 157 |
| 82 | iso_pu_bacteria | 2883087390 | 2883094713 | 157 |
| 83 | iso_pu_bacteria | 2901300506 | 2901312458 | 157 |
| 84 | iso_pu_bacteria | 2913844669 | 2913848627 | 157 |
| 85 | iso_pu_bacteria | 2913939268 | 2913941667 | 157 |
| 86 | iso_pu_bacteria | 2921643360 | 2921643750 | 157 |
| 87 | iso_pu_bacteria | 2928157003 | 2928159876 | 157 |
| 88 | iso_pu_bacteria | 2928163908 | 2928164083 | 157 |
| 89 | iso_pu_bacteria | 2981990288 | 2981994313 | 157 |
| 90 | iso_pu_bacteria | 641736154 | 642419227 | 157 |
| 91 | iso_pu_bacteria | 642555144 | 642602710 | 157 |
| 92 | iso_pu_bacteria | 8003955200 | 8003957469 | 157 |
| 93 | iso_pu_bacteria | 8020807995 | 8020812271 | 157 |
| 94 | iso_pu_bacteria | 8040167225 | 8040172274 | 157 |
| 95 | iso_pu_bacteria | 8040173305 | 8040175775 | 157 |
| 96 | 3300013306 | Ga0163162_12104359 | Ga0163162_121043592 | 158 |
| 97 | 3300036401 | Ga0373937_0387695 | Ga0373937_0387695_747_1223 | 158 |
| 98 | 3300037466 | Ga0395898_0570638 | Ga0395898_0570638_221_703 | 158 |
| 99 | 3300037471 | Ga0395905_0000813 | Ga0395905_0000813_16162_16644 | 158 |
| 100 | 3300037471 | Ga0395905_1212326 | Ga0395905_1212326_68_550 | 158 |
| 101 | 3300038443 | Ga0395901_0088575 | Ga0395901_0088575_1547_2029 | 158 |
| 102 | 3300044712 | Ga0453684_0000040 | Ga0453684_0000040_386821_387303 | 158 |
| 103 | iso_pu_bacteria | 2511231026 | 2511386573 | 158 |
| 104 | iso_pu_bacteria | 2521172590 | 2521561162 | 158 |
| 105 | iso_pu_bacteria | 2551306416 | 2553005962 | 158 |
| 106 | iso_pu_bacteria | 2818991449 | 2819617540 | 158 |
| 107 | iso_pu_bacteria | 2904439833 | 2904442198 | 158 |
| 108 | iso_pu_bacteria | 2904530477 | 2904533487 | 158 |
| 109 | iso_pu_bacteria | 2904584206 | 2904586439 | 158 |
| 110 | iso_pu_bacteria | 2904589729 | 2904591748 | 158 |
| 111 | iso_pu_bacteria | 2904601388 | 2904602093 | 158 |
| 112 | iso_pu_bacteria | 2919046199 | 2919051236 | 158 |
| 113 | iso_pu_bacteria | 2919079590 | 2919083563 | 158 |
| 114 | iso_pu_bacteria | 2923510766 | 2923515001 | 158 |
| 115 | iso_pu_bacteria | 2928130867 | 2928133508 | 158 |
| 116 | 3300006051 | Ga0075364_10365262 | Ga0075364_103652621 | 159 |
| 117 | 3300009092 | Ga0105250_10000010 | Ga0105250_1000001010 | 159 |
| 118 | 3300014968 | Ga0157379_10000049 | Ga0157379_1000004911 | 159 |
| 119 | 3300050491 | nmdc:mga00v17_333412_c1 | nmdc:mga00v17_333412_c1_79_564 | 159 |
| 120 | iso_pu_bacteria | 2600255292 | 2601669110 | 159 |
| 121 | iso_pu_bacteria | 2900577576 | 2900581049 | 159 |
| 122 | iso_pu_bacteria | 2932410948 | 2932416414 | 159 |
| 123 | iso_pu_bacteria | 2932416698 | 2932417185 | 159 |
| 124 | 3300002705 | JGI25156J39149_1001646 | JGI25156J39149_10016463 | 160 |
| 125 | 3300002705 | JGI25156J39149_1009851 | JGI25156J39149_10098512 | 160 |
| 126 | 3300002738 | JGI25154J39366_1000620 | JGI25154J39366_10006203 | 160 |
| 127 | 3300002738 | JGI25154J39366_1001336 | JGI25154J39366_10013366 | 160 |
| 128 | 3300002741 | JGI25157J39369_1000960 | JGI25157J39369_100096010 | 160 |
| 129 | 3300003214 | JGI25165J46597_1000067 | JGI25165J46597_100006715 | 160 |
| 130 | 3300003751 | Ga0055538_1000033 | Ga0055538_100003315 | 160 |
| 131 | 3300003752 | Ga0055539_1000045 | Ga0055539_100004514 | 160 |
| 132 | 3300003756 | Ga0055533_1000054 | Ga0055533_100005415 | 160 |
| 133 | 3300003758 | Ga0055532_1000018 | Ga0055532_10000183 | 160 |
| 134 | 3300003759 | Ga0055525_1000065 | Ga0055525_100006515 | 160 |
| 135 | 3300003761 | Ga0055535_1003154 | Ga0055535_10031543 | 160 |
| 136 | 3300003794 | Ga0055531_10009435 | Ga0055531_100094353 | 160 |
| 137 | 3300003841 | Ga0055541_1000031 | Ga0055541_100003115 | 160 |
| 138 | 3300015262 | Ga0182007_10017224 | Ga0182007_100172243 | 160 |
| 139 | 3300015262 | Ga0182007_10032155 | Ga0182007_100321551 | 160 |
| 140 | 3300015265 | Ga0182005_1000118 | Ga0182005_100011843 | 160 |
| 141 | 3300025206 | Ga0209435_100007 | Ga0209435_100007196 | 160 |
| 142 | 3300025206 | Ga0209435_100623 | Ga0209435_1006233 | 160 |
| 143 | 3300025224 | Ga0209784_100048 | Ga0209784_10004814 | 160 |
| 144 | 3300025225 | Ga0209566_100060 | Ga0209566_10006014 | 160 |
| 145 | 3300025226 | Ga0209674_100082 | Ga0209674_10008214 | 160 |
| 146 | 3300025228 | Ga0209672_105499 | Ga0209672_1054992 | 160 |
| 147 | 3300025229 | Ga0209147_100017 | Ga0209147_100017276 | 160 |
| 148 | 3300025230 | Ga0209563_100082 | Ga0209563_10008214 | 160 |
| 149 | 3300025231 | Ga0207427_100829 | Ga0207427_10082911 | 160 |
| 150 | 3300025233 | Ga0209437_100125 | Ga0209437_10012513 | 160 |
| 151 | 3300025242 | Ga0209258_100215 | Ga0209258_100215108 | 160 |
| 152 | 3300025246 | Ga0209646_1000044 | Ga0209646_1000044117 | 160 |
| 153 | 3300025246 | Ga0209646_1000133 | Ga0209646_100013394 | 160 |
| 154 | 3300025250 | Ga0209026_1000774 | Ga0209026_100077413 | 160 |
| 155 | 3300025250 | Ga0209026_1001042 | Ga0209026_100104210 | 160 |
| 156 | 3300025253 | Ga0209677_100046 | Ga0209677_10004613 | 160 |
| 157 | 3300025254 | Ga0209148_1027150 | Ga0209148_10271502 | 160 |
| 158 | 3300025256 | Ga0209759_1000048 | Ga0209759_1000048196 | 160 |
| 159 | 3300025256 | Ga0209759_1000187 | Ga0209759_100018717 | 160 |
| 160 | 3300025261 | Ga0209233_1000138 | Ga0209233_100013813 | 160 |
| 161 | 3300025272 | Ga0209455_1005569 | Ga0209455_10055692 | 160 |
| 162 | 3300025294 | Ga0209025_1006408 | Ga0209025_10064085 | 160 |
| 163 | 3300046462 | Ga0495651_0030481 | Ga0495651_0030481_283_771 | 160 |
| 164 | 3300046463 | Ga0495653_0019152 | Ga0495653_0019152_1325_1813 | 160 |
| 165 | 3300046511 | Ga0495608_0003969 | Ga0495608_0003969_6903_7391 | 160 |
| 166 | 3300046511 | Ga0495608_0022983 | Ga0495608_0022983_1698_2186 | 160 |
| 167 | 3300046516 | Ga0495628_0001866 | Ga0495628_0001866_15490_15978 | 160 |
| 168 | 3300046516 | Ga0495628_0006103 | Ga0495628_0006103_6939_7427 | 160 |
| 169 | 3300046529 | Ga0495652_0006302 | Ga0495652_0006302_3527_4015 | 160 |
| 170 | 3300046529 | Ga0495652_0047614 | Ga0495652_0047614_2419_2907 | 160 |
| 171 | 3300046543 | Ga0495645_0126632 | Ga0495645_0126632_324_812 | 160 |
| 172 | 3300046648 | Ga0495611_0105597 | Ga0495611_0105597_439_927 | 160 |
| 173 | 3300046675 | Ga0495657_0040791 | Ga0495657_0040791_1514_2002 | 160 |
| 174 | 3300046678 | Ga0495599_0002151 | Ga0495599_0002151_7607_8095 | 160 |
| 175 | 3300046679 | Ga0495623_0018230 | Ga0495623_0018230_3648_4136 | 160 |
| 176 | 3300046679 | Ga0495623_0040897 | Ga0495623_0040897_1671_2159 | 160 |
| 177 | 3300046680 | Ga0495646_0000331 | Ga0495646_0000331_3792_4280 | 160 |
| 178 | 3300046680 | Ga0495646_0065842 | Ga0495646_0065842_1642_2130 | 160 |
| 179 | 3300046683 | Ga0495658_0066530 | Ga0495658_0066530_18_506 | 160 |
| 180 | 3300046690 | Ga0495624_0031021 | Ga0495624_0031021_1555_2043 | 160 |
| 181 | 3300046690 | Ga0495624_0140789 | Ga0495624_0140789_670_1158 | 160 |
| 182 | 3300046809 | Ga0495600_0013625 | Ga0495600_0013625_1239_1727 | 160 |
| 183 | 3300047317 | Ga0495604_0011114 | Ga0495604_0011114_2922_3410 | 160 |
| 184 | 3300048088 | Ga0495602_0017748 | Ga0495602_0017748_3651_4139 | 160 |
| 185 | 3300050493 | nmdc:mga0k408_18383_c1 | nmdc:mga0k408_18383_c1_18_506 | 160 |
| 186 | 3300053077 | Ga0495601_0004204 | Ga0495601_0004204_3157_3645 | 160 |
| 187 | 3300053077 | Ga0495601_0717882 | Ga0495601_0717882_118_606 | 160 |
| 188 | 3300053085 | Ga0495619_0336888 | Ga0495619_0336888_428_916 | 160 |
| 189 | 3300053119 | Ga0500595_005316 | Ga0500595_005316_1949_2437 | 160 |
| 190 | 3300053141 | Ga0500574_000067 | Ga0500574_000067_10973_11461 | 160 |
| 191 | 3300053154 | Ga0500619_007917 | Ga0500619_007917_1804_2292 | 160 |
| 192 | iso_pu_bacteria | 2885270888 | 2885277322 | 160 |
| 193 | 3300001979 | JGI24740J21852_10035268 | JGI24740J21852_100352682 | 161 |
| 194 | 3300001989 | JGI24739J22299_10092257 | JGI24739J22299_100922572 | 161 |
| 195 | 3300001990 | JGI24737J22298_10109286 | JGI24737J22298_101092861 | 161 |
| 196 | 3300002067 | JGI24735J21928_10001085 | JGI24735J21928_100010851 | 161 |
| 197 | 3300002067 | JGI24735J21928_10134488 | JGI24735J21928_101344881 | 161 |
| 198 | 3300003187 | JGI25151J46595_10042717 | JGI25151J46595_100427172 | 161 |
| 199 | 3300003187 | JGI25151J46595_10075877 | JGI25151J46595_100758772 | 161 |
| 200 | 3300003354 | JGI25160J50197_1000171 | JGI25160J50197_100017137 | 161 |
| 201 | 3300003760 | Ga0055527_1000415 | Ga0055527_100041510 | 161 |
| 202 | 3300003760 | Ga0055527_1002589 | Ga0055527_10025894 | 161 |
| 203 | 3300003761 | Ga0055535_1001029 | Ga0055535_100102910 | 161 |
| 204 | 3300003762 | Ga0055542_1001409 | Ga0055542_10014093 | 161 |
| 205 | 3300003763 | Ga0055529_1004271 | Ga0055529_10042713 | 161 |
| 206 | 3300003771 | Ga0055526_1007909 | Ga0055526_10079095 | 161 |
| 207 | 3300003771 | Ga0055526_1018284 | Ga0055526_10182843 | 161 |
| 208 | 3300003773 | Ga0055537_1015077 | Ga0055537_10150772 | 161 |
| 209 | 3300003775 | Ga0055524_1000281 | Ga0055524_10002813 | 161 |
| 210 | 3300003775 | Ga0055524_1028848 | Ga0055524_10288482 | 161 |
| 211 | 3300003781 | Ga0055536_1000044 | Ga0055536_1000044120 | 161 |
| 212 | 3300003784 | Ga0055534_1000584 | Ga0055534_10005842 | 161 |
| 213 | 3300003784 | Ga0055534_1005553 | Ga0055534_10055531 | 161 |
| 214 | 3300003792 | Ga0055540_1074552 | Ga0055540_10745521 | 161 |
| 215 | 3300005262 | Ga0065165_1001400 | Ga0065165_100140013 | 161 |
| 216 | 3300005335 | Ga0070666_10120429 | Ga0070666_101204292 | 161 |
| 217 | 3300005335 | Ga0070666_10257873 | Ga0070666_102578732 | 161 |
| 218 | 3300005335 | Ga0070666_10841099 | Ga0070666_108410991 | 161 |
| 219 | 3300005339 | Ga0070660_100000032 | Ga0070660_10000003251 | 161 |
| 220 | 3300005339 | Ga0070660_100006752 | Ga0070660_1000067522 | 161 |
| 221 | 3300005344 | Ga0070661_100091075 | Ga0070661_1000910753 | 161 |
| 222 | 3300005347 | Ga0070668_100217816 | Ga0070668_1002178162 | 161 |
| 223 | 3300005366 | Ga0070659_100000035 | Ga0070659_10000003584 | 161 |
| 224 | 3300005455 | Ga0070663_100000222 | Ga0070663_10000022216 | 161 |
| 225 | 3300005455 | Ga0070663_100088981 | Ga0070663_1000889813 | 161 |
| 226 | 3300005455 | Ga0070663_100113649 | Ga0070663_1001136493 | 161 |
| 227 | 3300005456 | Ga0070678_100184437 | Ga0070678_1001844372 | 161 |
| 228 | 3300005548 | Ga0070665_100311225 | Ga0070665_1003112252 | 161 |
| 229 | 3300005563 | Ga0068855_100031855 | Ga0068855_1000318553 | 161 |
| 230 | 3300005563 | Ga0068855_100097688 | Ga0068855_1000976883 | 161 |
| 231 | 3300005616 | Ga0068852_100722091 | Ga0068852_1007220912 | 161 |
| 232 | 3300005834 | Ga0068851_10405205 | Ga0068851_104052051 | 161 |
| 233 | 3300005842 | Ga0068858_100397505 | Ga0068858_1003975052 | 161 |
| 234 | 3300006028 | Ga0070717_11348501 | Ga0070717_113485011 | 161 |
| 235 | 3300006948 | Ga0099826_10000018 | Ga0099826_10000018139 | 161 |
| 236 | 3300009011 | Ga0105251_10161125 | Ga0105251_101611252 | 161 |
| 237 | 3300009036 | Ga0105244_10070631 | Ga0105244_100706312 | 161 |
| 238 | 3300009092 | Ga0105250_10004503 | Ga0105250_100045035 | 161 |
| 239 | 3300009093 | Ga0105240_10017231 | Ga0105240_100172319 | 161 |
| 240 | 3300009093 | Ga0105240_10043049 | Ga0105240_100430496 | 161 |
| 241 | 3300009098 | Ga0105245_10613889 | Ga0105245_106138892 | 161 |
| 242 | 3300009174 | Ga0105241_11190003 | Ga0105241_111900031 | 161 |
| 243 | 3300009177 | Ga0105248_10500894 | Ga0105248_105008942 | 161 |
| 244 | 3300009545 | Ga0105237_10122579 | Ga0105237_101225792 | 161 |
| 245 | 3300009545 | Ga0105237_11057960 | Ga0105237_110579601 | 161 |
| 246 | 3300009551 | Ga0105238_10101063 | Ga0105238_101010633 | 161 |
| 247 | 3300009551 | Ga0105238_10151743 | Ga0105238_101517432 | 161 |
| 248 | 3300010375 | Ga0105239_10010789 | Ga0105239_100107895 | 161 |
| 249 | 3300013102 | Ga0157371_10013404 | Ga0157371_100134044 | 161 |
| 250 | 3300013104 | Ga0157370_10304339 | Ga0157370_103043392 | 161 |
| 251 | 3300013105 | Ga0157369_10001942 | Ga0157369_100019425 | 161 |
| 252 | 3300013296 | Ga0157374_10710152 | Ga0157374_107101521 | 161 |
| 253 | 3300013306 | Ga0163162_10036635 | Ga0163162_100366356 | 161 |
| 254 | 3300013307 | Ga0157372_10323749 | Ga0157372_103237492 | 161 |
| 255 | 3300014497 | Ga0182008_10004241 | Ga0182008_100042411 | 161 |
| 256 | 3300014497 | Ga0182008_10145724 | Ga0182008_101457242 | 161 |
| 257 | 3300014497 | Ga0182008_10362177 | Ga0182008_103621771 | 161 |
| 258 | 3300015261 | Ga0182006_1000112 | Ga0182006_100011224 | 161 |
| 259 | 3300015261 | Ga0182006_1050940 | Ga0182006_10509403 | 161 |
| 260 | 3300015262 | Ga0182007_10000020 | Ga0182007_1000002082 | 161 |
| 261 | 3300015262 | Ga0182007_10024254 | Ga0182007_100242542 | 161 |
| 262 | 3300015265 | Ga0182005_1000001 | Ga0182005_100000183 | 161 |
| 263 | 3300015265 | Ga0182005_1053401 | Ga0182005_10534011 | 161 |
| 264 | 3300016635 | Ga0183361_10012 | Ga0183361_1001238 | 161 |
| 265 | 3300017792 | Ga0163161_10039155 | Ga0163161_100391552 | 161 |
| 266 | 3300020076 | Ga0206355_1360317 | Ga0206355_13603171 | 161 |
| 267 | 3300020080 | Ga0206350_10320270 | Ga0206350_103202701 | 161 |
| 268 | 3300020080 | Ga0206350_11216288 | Ga0206350_112162881 | 161 |
| 269 | 3300020081 | Ga0206354_10473152 | Ga0206354_104731522 | 161 |
| 270 | 3300022467 | Ga0224712_10137122 | Ga0224712_101371222 | 161 |
| 271 | 3300025228 | Ga0209672_100038 | Ga0209672_100038167 | 161 |
| 272 | 3300025228 | Ga0209672_100952 | Ga0209672_1009526 | 161 |
| 273 | 3300025229 | Ga0209147_100259 | Ga0209147_10025911 | 161 |
| 274 | 3300025242 | Ga0209258_100109 | Ga0209258_1001099 | 161 |
| 275 | 3300025254 | Ga0209148_1000844 | Ga0209148_10008449 | 161 |
| 276 | 3300025256 | Ga0209759_1005558 | Ga0209759_10055584 | 161 |
| 277 | 3300025256 | Ga0209759_1015976 | Ga0209759_10159762 | 161 |
| 278 | 3300025263 | Ga0209565_1000174 | Ga0209565_10001746 | 161 |
| 279 | 3300025263 | Ga0209565_1002133 | Ga0209565_10021335 | 161 |
| 280 | 3300025272 | Ga0209455_1004560 | Ga0209455_10045603 | 161 |
| 281 | 3300025273 | Ga0209673_1015157 | Ga0209673_10151574 | 161 |
| 282 | 3300025284 | Ga0209130_1007122 | Ga0209130_10071223 | 161 |
| 283 | 3300025291 | Ga0209675_1000100 | Ga0209675_100010047 | 161 |
| 284 | 3300025291 | Ga0209675_1004980 | Ga0209675_10049805 | 161 |
| 285 | 3300025291 | Ga0209675_1005120 | Ga0209675_10051205 | 161 |
| 286 | 3300025292 | Ga0209676_1000141 | Ga0209676_100014112 | 161 |
| 287 | 3300025294 | Ga0209025_1000390 | Ga0209025_10003909 | 161 |
| 288 | 3300025294 | Ga0209025_1000755 | Ga0209025_100075512 | 161 |
| 289 | 3300025294 | Ga0209025_1001457 | Ga0209025_100145710 | 161 |
| 290 | 3300025294 | Ga0209025_1019891 | Ga0209025_10198912 | 161 |
| 291 | 3300025295 | Ga0209564_1001462 | Ga0209564_10014626 | 161 |
| 292 | 3300025295 | Ga0209564_1003294 | Ga0209564_10032946 | 161 |
| 293 | 3300025295 | Ga0209564_1011309 | Ga0209564_10113095 | 161 |
| 294 | 3300025299 | Ga0209256_1000434 | Ga0209256_100043417 | 161 |
| 295 | 3300025299 | Ga0209256_1001596 | Ga0209256_100159612 | 161 |
| 296 | 3300025302 | Ga0207426_1000037 | Ga0207426_1000037173 | 161 |
| 297 | 3300025302 | Ga0207426_1001791 | Ga0207426_100179115 | 161 |
| 298 | 3300025303 | Ga0209051_1004798 | Ga0209051_10047983 | 161 |
| 299 | 3300025303 | Ga0209051_1049645 | Ga0209051_10496452 | 161 |
| 300 | 3300025711 | Ga0207696_1005177 | Ga0207696_10051772 | 161 |
| 301 | 3300025728 | Ga0207655_1068552 | Ga0207655_10685522 | 161 |
| 302 | 3300025735 | Ga0207713_1002908 | Ga0207713_10029089 | 161 |
| 303 | 3300025903 | Ga0207680_10317563 | Ga0207680_103175632 | 161 |
| 304 | 3300025903 | Ga0207680_11089891 | Ga0207680_110898911 | 161 |
| 305 | 3300025904 | Ga0207647_10000608 | Ga0207647_1000060821 | 161 |
| 306 | 3300025904 | Ga0207647_10003231 | Ga0207647_100032318 | 161 |
| 307 | 3300025904 | Ga0207647_10022621 | Ga0207647_100226215 | 161 |
| 308 | 3300025913 | Ga0207695_10110658 | Ga0207695_101106583 | 161 |
| 309 | 3300025913 | Ga0207695_10128123 | Ga0207695_101281231 | 161 |
| 310 | 3300025913 | Ga0207695_10366880 | Ga0207695_103668801 | 161 |
| 311 | 3300025913 | Ga0207695_11313531 | Ga0207695_113135311 | 161 |
| 312 | 3300025914 | Ga0207671_10080640 | Ga0207671_100806402 | 161 |
| 313 | 3300025914 | Ga0207671_10183593 | Ga0207671_101835931 | 161 |
| 314 | 3300025914 | Ga0207671_10185055 | Ga0207671_101850553 | 161 |
| 315 | 3300025919 | Ga0207657_10000051 | Ga0207657_1000005148 | 161 |
| 316 | 3300025919 | Ga0207657_10000131 | Ga0207657_100001312 | 161 |
| 317 | 3300025920 | Ga0207649_10045441 | Ga0207649_100454413 | 161 |
| 318 | 3300025924 | Ga0207694_10165073 | Ga0207694_101650732 | 161 |
| 319 | 3300025932 | Ga0207690_10000034 | Ga0207690_1000003483 | 161 |
| 320 | 3300025933 | Ga0207706_10467047 | Ga0207706_104670471 | 161 |
| 321 | 3300025941 | Ga0207711_10047482 | Ga0207711_100474822 | 161 |
| 322 | 3300025949 | Ga0207667_10037973 | Ga0207667_100379731 | 161 |
| 323 | 3300025949 | Ga0207667_10039101 | Ga0207667_100391014 | 161 |
| 324 | 3300026067 | Ga0207678_10001810 | Ga0207678_100018106 | 161 |
| 325 | 3300026067 | Ga0207678_10069274 | Ga0207678_100692741 | 161 |
| 326 | 3300027666 | Ga0209282_1000063 | Ga0209282_100006351 | 161 |
| 327 | 3300028379 | Ga0268266_10083192 | Ga0268266_100831922 | 161 |
| 328 | 3300028379 | Ga0268266_10408931 | Ga0268266_104089312 | 161 |
| 329 | 3300028800 | Ga0265338_10000113 | Ga0265338_1000011364 | 161 |
| 330 | 3300035171 | Ga0373946_0060798 | Ga0373946_0060798_1020_1511 | 161 |
| 331 | 3300036401 | Ga0373937_0124447 | Ga0373937_0124447_1849_2340 | 161 |
| 332 | 3300037312 | Ga0395899_0058642 | Ga0395899_0058642_10_498 | 161 |
| 333 | 3300037312 | Ga0395899_0404001 | Ga0395899_0404001_361_849 | 161 |
| 334 | 3300037418 | Ga0395900_0002362 | Ga0395900_0002362_8105_8593 | 161 |
| 335 | 3300037418 | Ga0395900_0065798 | Ga0395900_0065798_2531_3019 | 161 |
| 336 | 3300037418 | Ga0395900_0206106 | Ga0395900_0206106_975_1463 | 161 |
| 337 | 3300037466 | Ga0395898_0000792 | Ga0395898_0000792_50311_50799 | 161 |
| 338 | 3300037466 | Ga0395898_0006662 | Ga0395898_0006662_1182_1670 | 161 |
| 339 | 3300037466 | Ga0395898_0020242 | Ga0395898_0020242_782_1270 | 161 |
| 340 | 3300037466 | Ga0395898_0232430 | Ga0395898_0232430_507_995 | 161 |
| 341 | 3300037471 | Ga0395905_0005540 | Ga0395905_0005540_928_1416 | 161 |
| 342 | 3300037471 | Ga0395905_0899359 | Ga0395905_0899359_278_763 | 161 |
| 343 | 3300038443 | Ga0395901_0000003 | Ga0395901_0000003_514940_515428 | 161 |
| 344 | 3300038443 | Ga0395901_0000180 | Ga0395901_0000180_57202_57690 | 161 |
| 345 | 3300038443 | Ga0395901_0000887 | Ga0395901_0000887_24162_24650 | 161 |
| 346 | 3300038443 | Ga0395901_0518996 | Ga0395901_0518996_245_733 | 161 |
| 347 | 3300038705 | Ga0237819_06728 | Ga0237819_06728_63_554 | 161 |
| 348 | 3300038705 | Ga0237819_12094 | Ga0237819_12094_504_995 | 161 |
| 349 | 3300039438 | Ga0436360_0491784 | Ga0436360_0491784_280_768 | 161 |
| 350 | 3300039447 | Ga0436361_1043697 | Ga0436361_1043697_315_803 | 161 |
| 351 | 3300041443 | Ga0451789_1261723 | Ga0451789_1261723_82_579 | 161 |
| 352 | 3300044656 | Ga0466969_0089520 | Ga0466969_0089520_298_786 | 161 |
| 353 | 3300044658 | Ga0466972_0079611 | Ga0466972_0079611_175_663 | 161 |
| 354 | 3300044658 | Ga0466972_0183867 | Ga0466972_0183867_255_743 | 161 |
| 355 | 3300044672 | Ga0466982_0098412 | Ga0466982_0098412_1017_1505 | 161 |
| 356 | 3300044683 | Ga0466965_0006639 | Ga0466965_0006639_4722_5210 | 161 |
| 357 | 3300044683 | Ga0466965_0472365 | Ga0466965_0472365_82_570 | 161 |
| 358 | 3300044684 | Ga0466966_0005778 | Ga0466966_0005778_5081_5569 | 161 |
| 359 | 3300044684 | Ga0466966_0014130 | Ga0466966_0014130_2763_3251 | 161 |
| 360 | 3300044693 | Ga0466961_0005254 | Ga0466961_0005254_6374_6862 | 161 |
| 361 | 3300044693 | Ga0466961_0233516 | Ga0466961_0233516_388_876 | 161 |
| 362 | 3300044694 | Ga0466963_0425991 | Ga0466963_0425991_77_565 | 161 |
| 363 | 3300044694 | Ga0466963_0638606 | Ga0466963_0638606_192_680 | 161 |
| 364 | 3300044706 | Ga0466964_0373505 | Ga0466964_0373505_188_676 | 161 |
| 365 | 3300044719 | Ga0466971_0015018 | Ga0466971_0015018_1517_2005 | 161 |
| 366 | 3300044719 | Ga0466971_0018548 | Ga0466971_0018548_50_538 | 161 |
| 367 | 3300044735 | Ga0466968_0006354 | Ga0466968_0006354_2436_2924 | 161 |
| 368 | 3300044765 | Ga0466970_0025169 | Ga0466970_0025169_2471_2959 | 161 |
| 369 | 3300044765 | Ga0466970_0210398 | Ga0466970_0210398_245_733 | 161 |
| 370 | 3300044842 | Ga0466957_0020806 | Ga0466957_0020806_3294_3782 | 161 |
| 371 | 3300044842 | Ga0466957_0144345 | Ga0466957_0144345_654_1142 | 161 |
| 372 | 3300044842 | Ga0466957_0615036 | Ga0466957_0615036_209_697 | 161 |
| 373 | 3300044901 | Ga0466960_0495089 | Ga0466960_0495089_70_558 | 161 |
| 374 | 3300045049 | Ga0466959_0013608 | Ga0466959_0013608_4165_4653 | 161 |
| 375 | 3300045049 | Ga0466959_0217894 | Ga0466959_0217894_446_934 | 161 |
| 376 | 3300045049 | Ga0466959_0262441 | Ga0466959_0262441_374_862 | 161 |
| 377 | 3300045836 | Ga0466958_0010813 | Ga0466958_0010813_451_939 | 161 |
| 378 | 3300045836 | Ga0466958_0213495 | Ga0466958_0213495_334_822 | 161 |
| 379 | 3300045836 | Ga0466958_0477196 | Ga0466958_0477196_138_626 | 161 |
| 380 | 3300046455 | Ga0495603_0004003 | Ga0495603_0004003_2028_2516 | 161 |
| 381 | 3300046457 | Ga0495590_0043053 | Ga0495590_0043053_400_888 | 161 |
| 382 | 3300046459 | Ga0495629_0001732 | Ga0495629_0001732_11878_12366 | 161 |
| 383 | 3300046460 | Ga0495638_0097173 | Ga0495638_0097173_901_1389 | 161 |
| 384 | 3300046463 | Ga0495653_0287634 | Ga0495653_0287634_151_639 | 161 |
| 385 | 3300046471 | Ga0495650_0002944 | Ga0495650_0002944_6233_6721 | 161 |
| 386 | 3300046471 | Ga0495650_0256486 | Ga0495650_0256486_21_512 | 161 |
| 387 | 3300046472 | Ga0495580_0029510 | Ga0495580_0029510_1855_2343 | 161 |
| 388 | 3300046474 | Ga0495605_0003621 | Ga0495605_0003621_8084_8569 | 161 |
| 389 | 3300046474 | Ga0495605_0005538 | Ga0495605_0005538_1503_1991 | 161 |
| 390 | 3300046474 | Ga0495605_0054550 | Ga0495605_0054550_490_978 | 161 |
| 391 | 3300046475 | Ga0495639_0290183 | Ga0495639_0290183_201_689 | 161 |
| 392 | 3300046476 | Ga0495662_0060546 | Ga0495662_0060546_1095_1583 | 161 |
| 393 | 3300046477 | Ga0495664_0049255 | Ga0495664_0049255_1949_2440 | 161 |
| 394 | 3300046477 | Ga0495664_0128081 | Ga0495664_0128081_35_523 | 161 |
| 395 | 3300046477 | Ga0495664_0263450 | Ga0495664_0263450_28_516 | 161 |
| 396 | 3300046491 | Ga0495584_0079048 | Ga0495584_0079048_1120_1608 | 161 |
| 397 | 3300046500 | Ga0495596_0000845 | Ga0495596_0000845_16982_17467 | 161 |
| 398 | 3300046500 | Ga0495596_0073129 | Ga0495596_0073129_406_894 | 161 |
| 399 | 3300046501 | Ga0495607_0016273 | Ga0495607_0016273_883_1368 | 161 |
| 400 | 3300046506 | Ga0495583_0023424 | Ga0495583_0023424_1759_2247 | 161 |
| 401 | 3300046506 | Ga0495583_0038920 | Ga0495583_0038920_1339_1827 | 161 |
| 402 | 3300046511 | Ga0495608_0151115 | Ga0495608_0151115_182_670 | 161 |
| 403 | 3300046512 | Ga0495610_0003098 | Ga0495610_0003098_9054_9539 | 161 |
| 404 | 3300046513 | Ga0495616_0008782 | Ga0495616_0008782_2136_2621 | 161 |
| 405 | 3300046513 | Ga0495616_0053497 | Ga0495616_0053497_193_681 | 161 |
| 406 | 3300046516 | Ga0495628_0439791 | Ga0495628_0439791_350_841 | 161 |
| 407 | 3300046517 | Ga0495630_0457182 | Ga0495630_0457182_228_716 | 161 |
| 408 | 3300046523 | Ga0495644_0046337 | Ga0495644_0046337_485_973 | 161 |
| 409 | 3300046524 | Ga0495648_0018991 | Ga0495648_0018991_3401_3889 | 161 |
| 410 | 3300046524 | Ga0495648_0031046 | Ga0495648_0031046_2088_2573 | 161 |
| 411 | 3300046526 | Ga0495666_0206526 | Ga0495666_0206526_136_624 | 161 |
| 412 | 3300046528 | Ga0495642_0052992 | Ga0495642_0052992_1019_1507 | 161 |
| 413 | 3300046529 | Ga0495652_0144710 | Ga0495652_0144710_1363_1851 | 161 |
| 414 | 3300046530 | Ga0495654_0145764 | Ga0495654_0145764_103_591 | 161 |
| 415 | 3300046531 | Ga0495665_0109733 | Ga0495665_0109733_852_1340 | 161 |
| 416 | 3300046535 | Ga0495586_0130486 | Ga0495586_0130486_366_854 | 161 |
| 417 | 3300046538 | Ga0495609_0007032 | Ga0495609_0007032_4249_4734 | 161 |
| 418 | 3300046542 | Ga0495597_0084452 | Ga0495597_0084452_172_657 | 161 |
| 419 | 3300046542 | Ga0495597_0348533 | Ga0495597_0348533_36_524 | 161 |
| 420 | 3300046543 | Ga0495645_0006241 | Ga0495645_0006241_7211_7699 | 161 |
| 421 | 3300046543 | Ga0495645_0011392 | Ga0495645_0011392_2037_2525 | 161 |
| 422 | 3300046559 | Ga0495667_0037279 | Ga0495667_0037279_451_939 | 161 |
| 423 | 3300046615 | Ga0495656_0056546 | Ga0495656_0056546_624_1112 | 161 |
| 424 | 3300046616 | Ga0495668_0257076 | Ga0495668_0257076_389_877 | 161 |
| 425 | 3300046660 | Ga0495625_0295868 | Ga0495625_0295868_243_731 | 161 |
| 426 | 3300046660 | Ga0495625_0534536 | Ga0495625_0534536_159_647 | 161 |
| 427 | 3300046665 | Ga0495661_0017791 | Ga0495661_0017791_2966_3451 | 161 |
| 428 | 3300046665 | Ga0495661_0146552 | Ga0495661_0146552_694_1182 | 161 |
| 429 | 3300046684 | Ga0495669_0029127 | Ga0495669_0029127_1463_1951 | 161 |
| 430 | 3300046684 | Ga0495669_0037002 | Ga0495669_0037002_1544_2032 | 161 |
| 431 | 3300046684 | Ga0495669_0379476 | Ga0495669_0379476_14_502 | 161 |
| 432 | 3300046692 | Ga0495671_0002939 | Ga0495671_0002939_6888_7373 | 161 |
| 433 | 3300046694 | Ga0495649_0106031 | Ga0495649_0106031_561_1049 | 161 |
| 434 | 3300046694 | Ga0495649_0428173 | Ga0495649_0428173_104_592 | 161 |
| 435 | 3300046794 | Ga0495589_0016255 | Ga0495589_0016255_2778_3266 | 161 |
| 436 | 3300046809 | Ga0495600_0324606 | Ga0495600_0324606_259_747 | 161 |
| 437 | 3300046810 | Ga0495660_0206382 | Ga0495660_0206382_362_850 | 161 |
| 438 | 3300047317 | Ga0495604_0169175 | Ga0495604_0169175_891_1376 | 161 |
| 439 | 3300047319 | Ga0495674_0029256 | Ga0495674_0029256_858_1349 | 161 |
| 440 | 3300047320 | Ga0495672_0002512 | Ga0495672_0002512_14140_14631 | 161 |
| 441 | 3300047320 | Ga0495672_0082399 | Ga0495672_0082399_854_1339 | 161 |
| 442 | 3300047323 | Ga0495683_0265441 | Ga0495683_0265441_161_649 | 161 |
| 443 | 3300047443 | Ga0495687_112097 | Ga0495687_112097_212_700 | 161 |
| 444 | 3300047445 | Ga0495677_0051940 | Ga0495677_0051940_65_553 | 161 |
| 445 | 3300047445 | Ga0495677_0285580 | Ga0495677_0285580_43_531 | 161 |
| 446 | 3300047446 | Ga0495679_015535 | Ga0495679_015535_302_790 | 161 |
| 447 | 3300047447 | Ga0495685_079015 | Ga0495685_079015_445_930 | 161 |
| 448 | 3300047469 | Ga0495673_0243281 | Ga0495673_0243281_37_528 | 161 |
| 449 | 3300047472 | Ga0495686_0000014 | Ga0495686_0000014_298698_299189 | 161 |
| 450 | 3300048091 | Ga0495626_0098337 | Ga0495626_0098337_450_938 | 161 |
| 451 | 3300048903 | Ga0496100_0008832 | Ga0496100_0008832_306_794 | 161 |
| 452 | 3300048903 | Ga0496100_0016348 | Ga0496100_0016348_1922_2410 | 161 |
| 453 | 3300048903 | Ga0496100_0084267 | Ga0496100_0084267_482_970 | 161 |
| 454 | 3300048903 | Ga0496100_0222420 | Ga0496100_0222420_357_845 | 161 |
| 455 | 3300048903 | Ga0496100_0671933 | Ga0496100_0671933_206_694 | 161 |
| 456 | 3300048904 | Ga0496101_0031993 | Ga0496101_0031993_1902_2390 | 161 |
| 457 | 3300048904 | Ga0496101_0165145 | Ga0496101_0165145_335_823 | 161 |
| 458 | 3300048904 | Ga0496101_0238008 | Ga0496101_0238008_858_1346 | 161 |
| 459 | 3300048905 | Ga0496102_0000661 | Ga0496102_0000661_23668_24156 | 161 |
| 460 | 3300048905 | Ga0496102_0444801 | Ga0496102_0444801_385_873 | 161 |
| 461 | 3300048905 | Ga0496102_0901743 | Ga0496102_0901743_286_774 | 161 |
| 462 | 3300048906 | Ga0496103_0001616 | Ga0496103_0001616_1141_1629 | 161 |
| 463 | 3300048906 | Ga0496103_0309620 | Ga0496103_0309620_518_1006 | 161 |
| 464 | 3300048907 | Ga0496104_0080317 | Ga0496104_0080317_430_918 | 161 |
| 465 | 3300048907 | Ga0496104_0154788 | Ga0496104_0154788_1169_1657 | 161 |
| 466 | 3300048907 | Ga0496104_0232015 | Ga0496104_0232015_917_1405 | 161 |
| 467 | 3300048907 | Ga0496104_0927386 | Ga0496104_0927386_269_757 | 161 |
| 468 | 3300048908 | Ga0496105_0035791 | Ga0496105_0035791_1468_1956 | 161 |
| 469 | 3300048908 | Ga0496105_0314136 | Ga0496105_0314136_645_1133 | 161 |
| 470 | 3300048909 | Ga0496106_0358611 | Ga0496106_0358611_25_513 | 161 |
| 471 | 3300048910 | Ga0496107_0010382 | Ga0496107_0010382_1171_1659 | 161 |
| 472 | 3300048910 | Ga0496107_0565826 | Ga0496107_0565826_138_626 | 161 |
| 473 | 3300048911 | Ga0496108_0227400 | Ga0496108_0227400_896_1384 | 161 |
| 474 | 3300048912 | Ga0496109_0159185 | Ga0496109_0159185_1591_2079 | 161 |
| 475 | 3300048914 | Ga0496111_0060848 | Ga0496111_0060848_1740_2237 | 161 |
| 476 | 3300048916 | Ga0496113_0038038 | Ga0496113_0038038_466_954 | 161 |
| 477 | 3300048917 | Ga0496114_0005374 | Ga0496114_0005374_7046_7534 | 161 |
| 478 | 3300048918 | Ga0496115_0257785 | Ga0496115_0257785_822_1310 | 161 |
| 479 | 3300048918 | Ga0496115_0886841 | Ga0496115_0886841_159_647 | 161 |
| 480 | 3300048919 | Ga0496116_0009836 | Ga0496116_0009836_7130_7627 | 161 |
| 481 | 3300048919 | Ga0496116_0017083 | Ga0496116_0017083_907_1392 | 161 |
| 482 | 3300048919 | Ga0496116_0021038 | Ga0496116_0021038_4038_4523 | 161 |
| 483 | 3300048920 | Ga0496117_0000094 | Ga0496117_0000094_162785_163282 | 161 |
| 484 | 3300048920 | Ga0496117_0020755 | Ga0496117_0020755_4813_5301 | 161 |
| 485 | 3300048920 | Ga0496117_0055517 | Ga0496117_0055517_1755_2243 | 161 |
| 486 | 3300048920 | Ga0496117_0260800 | Ga0496117_0260800_411_899 | 161 |
| 487 | 3300048921 | Ga0496118_0000071 | Ga0496118_0000071_162785_163282 | 161 |
| 488 | 3300048921 | Ga0496118_0002811 | Ga0496118_0002811_22126_22614 | 161 |
| 489 | 3300048921 | Ga0496118_0118494 | Ga0496118_0118494_624_1112 | 161 |
| 490 | 3300048922 | Ga0496119_0075970 | Ga0496119_0075970_1168_1656 | 161 |
| 491 | 3300048922 | Ga0496119_0307617 | Ga0496119_0307617_66_563 | 161 |
| 492 | 3300048922 | Ga0496119_0322061 | Ga0496119_0322061_228_716 | 161 |
| 493 | 3300048923 | Ga0496120_0240147 | Ga0496120_0240147_326_814 | 161 |
| 494 | 3300048924 | Ga0496121_0016109 | Ga0496121_0016109_3331_3828 | 161 |
| 495 | 3300048924 | Ga0496121_0017999 | Ga0496121_0017999_1796_2284 | 161 |
| 496 | 3300048924 | Ga0496121_0027352 | Ga0496121_0027352_1030_1515 | 161 |
| 497 | 3300048924 | Ga0496121_0093918 | Ga0496121_0093918_1796_2284 | 161 |
| 498 | 3300048924 | Ga0496121_0406748 | Ga0496121_0406748_358_846 | 161 |
| 499 | 3300048924 | Ga0496121_0610862 | Ga0496121_0610862_34_522 | 161 |
| 500 | 3300048925 | Ga0496122_0003123 | Ga0496122_0003123_1975_2472 | 161 |
| 501 | 3300048925 | Ga0496122_0021375 | Ga0496122_0021375_4464_4949 | 161 |
| 502 | 3300048925 | Ga0496122_0058759 | Ga0496122_0058759_178_666 | 161 |
| 503 | 3300048925 | Ga0496122_0147471 | Ga0496122_0147471_301_789 | 161 |
| 504 | 3300048926 | Ga0496123_0004461 | Ga0496123_0004461_9087_9584 | 161 |
| 505 | 3300048926 | Ga0496123_0005043 | Ga0496123_0005043_903_1388 | 161 |
| 506 | 3300048926 | Ga0496123_0077630 | Ga0496123_0077630_133_621 | 161 |
| 507 | 3300048926 | Ga0496123_0140910 | Ga0496123_0140910_211_699 | 161 |
| 508 | 3300048927 | Ga0496124_0226582 | Ga0496124_0226582_287_775 | 161 |
| 509 | 3300048927 | Ga0496124_0230176 | Ga0496124_0230176_620_1117 | 161 |
| 510 | 3300048928 | Ga0496125_0109846 | Ga0496125_0109846_451_948 | 161 |
| 511 | 3300048928 | Ga0496125_0277511 | Ga0496125_0277511_221_709 | 161 |
| 512 | 3300048929 | Ga0496126_0004283 | Ga0496126_0004283_4707_5195 | 161 |
| 513 | 3300048929 | Ga0496126_0175701 | Ga0496126_0175701_214_702 | 161 |
| 514 | 3300048929 | Ga0496126_0396279 | Ga0496126_0396279_120_617 | 161 |
| 515 | 3300049459 | Ga0495678_092518 | Ga0495678_092518_290_778 | 161 |
| 516 | 3300049460 | Ga0495682_0003624 | Ga0495682_0003624_534_1022 | 161 |
| 517 | 3300049571 | Ga0501034_0001676 | Ga0501034_0001676_22608_23093 | 161 |
| 518 | 3300049571 | Ga0501034_0903086 | Ga0501034_0903086_11_514 | 161 |
| 519 | 3300049573 | Ga0501037_0322356 | Ga0501037_0322356_52_555 | 161 |
| 520 | 3300049742 | Ga0501080_1375150 | Ga0501080_1375150_22_525 | 161 |
| 521 | 3300049822 | Ga0501035_0318047 | Ga0501035_0318047_628_1131 | 161 |
| 522 | 3300061719 | Ga0466962_0029794 | Ga0466962_0029794_490_978 | 161 |
| 523 | 3300003751 | Ga0055538_1000010 | Ga0055538_100001073 | 162 |
| 524 | 3300003752 | Ga0055539_1000015 | Ga0055539_100001573 | 162 |
| 525 | 3300003756 | Ga0055533_1000018 | Ga0055533_100001873 | 162 |
| 526 | 3300003759 | Ga0055525_1000020 | Ga0055525_100002073 | 162 |
| 527 | 3300003841 | Ga0055541_1000011 | Ga0055541_100001173 | 162 |
| 528 | 3300005563 | Ga0068855_100000763 | Ga0068855_10000076315 | 162 |
| 529 | 3300005563 | Ga0068855_101196260 | Ga0068855_1011962601 | 162 |
| 530 | 3300005577 | Ga0068857_100083556 | Ga0068857_1000835563 | 162 |
| 531 | 3300005578 | Ga0068854_100004210 | Ga0068854_1000042103 | 162 |
| 532 | 3300005614 | Ga0068856_100327497 | Ga0068856_1003274972 | 162 |
| 533 | 3300005834 | Ga0068851_10174315 | Ga0068851_101743151 | 162 |
| 534 | 3300006946 | Ga0079104_1003995 | Ga0079104_10039956 | 162 |
| 535 | 3300009036 | Ga0105244_10031581 | Ga0105244_100315814 | 162 |
| 536 | 3300009093 | Ga0105240_10062072 | Ga0105240_100620721 | 162 |
| 537 | 3300009093 | Ga0105240_10984954 | Ga0105240_109849542 | 162 |
| 538 | 3300009545 | Ga0105237_10023983 | Ga0105237_100239836 | 162 |
| 539 | 3300009545 | Ga0105237_10093311 | Ga0105237_100933113 | 162 |
| 540 | 3300009551 | Ga0105238_10000004 | Ga0105238_10000004144 | 162 |
| 541 | 3300010375 | Ga0105239_10002820 | Ga0105239_1000282015 | 162 |
| 542 | 3300021361 | Ga0213872_10008589 | Ga0213872_100085892 | 162 |
| 543 | 3300021361 | Ga0213872_10132756 | Ga0213872_101327562 | 162 |
| 544 | 3300025224 | Ga0209784_100025 | Ga0209784_10002573 | 162 |
| 545 | 3300025225 | Ga0209566_100025 | Ga0209566_10002573 | 162 |
| 546 | 3300025226 | Ga0209674_100042 | Ga0209674_10004273 | 162 |
| 547 | 3300025230 | Ga0209563_100046 | Ga0209563_10004673 | 162 |
| 548 | 3300025253 | Ga0209677_100027 | Ga0209677_10002773 | 162 |
| 549 | 3300025321 | Ga0207656_10160428 | Ga0207656_101604281 | 162 |
| 550 | 3300025913 | Ga0207695_10001007 | Ga0207695_1000100724 | 162 |
| 551 | 3300025914 | Ga0207671_10002362 | Ga0207671_100023622 | 162 |
| 552 | 3300025914 | Ga0207671_10092086 | Ga0207671_100920862 | 162 |
| 553 | 3300025924 | Ga0207694_10000021 | Ga0207694_1000002162 | 162 |
| 554 | 3300025949 | Ga0207667_10000235 | Ga0207667_1000023544 | 162 |
| 555 | 3300025981 | Ga0207640_10009807 | Ga0207640_100098071 | 162 |
| 556 | 3300026116 | Ga0207674_10099524 | Ga0207674_100995243 | 162 |
| 557 | 3300027111 | Ga0209281_1003252 | Ga0209281_10032524 | 162 |
| 558 | 3300028800 | Ga0265338_10119274 | Ga0265338_101192742 | 162 |
| 559 | 3300037312 | Ga0395899_0022113 | Ga0395899_0022113_102_593 | 162 |
| 560 | 3300039447 | Ga0436361_0321406 | Ga0436361_0321406_3845_4339 | 162 |
| 561 | 3300039447 | Ga0436361_0633092 | Ga0436361_0633092_433_933 | 162 |
| 562 | 3300042006 | Ga0439432_047114 | Ga0439432_047114_703_1293 | 162 |
| 563 | 3300047318 | Ga0495636_0517716 | Ga0495636_0517716_79_567 | 162 |
| 564 | 3300048925 | Ga0496122_0001303 | Ga0496122_0001303_22076_22624 | 162 |
| 565 | 3300049569 | Ga0501032_0439606 | Ga0501032_0439606_312_824 | 162 |
| 566 | 3300049581 | Ga0501047_0004231 | Ga0501047_0004231_7810_8322 | 162 |
| 567 | 3300049590 | Ga0501074_0101267 | Ga0501074_0101267_1462_1974 | 162 |
| 568 | 3300049742 | Ga0501080_0103747 | Ga0501080_0103747_1683_2195 | 162 |
| 569 | 3300049822 | Ga0501035_0040498 | Ga0501035_0040498_2352_2864 | 162 |
| 570 | 3300049823 | Ga0501044_0014793 | Ga0501044_0014793_4313_4825 | 162 |
| 571 | 3300053125 | Ga0500618_006459 | Ga0500618_006459_1107_1601 | 162 |
| 572 | 3300053148 | Ga0500590_090625 | Ga0500590_090625_788_1297 | 162 |
| 573 | 3300059423 | Ga0590074_000395 | Ga0590074_000395_3517_4011 | 162 |
| 574 | 3300059424 | Ga0590075_002071 | Ga0590075_002071_2989_3483 | 162 |
| 575 | 3300059426 | Ga0590077_000266 | Ga0590077_000266_2778_3272 | 162 |
| 576 | 3300048913 | Ga0496110_0000055 | Ga0496110_0000055_9158_9655 | 165 |
| 577 | 3300046615 | Ga0495656_0034494 | Ga0495656_0034494_1270_1770 | 166 |
| 578 | 3300047318 | Ga0495636_0002527 | Ga0495636_0002527_4499_4999 | 166 |
| 579 | 3300059493 | Ga0587077_043152 | Ga0587077_043152_281_799 | 170 |
| 580 | 3300059507 | Ga0587086_011045 | Ga0587086_011045_281_799 | 170 |
| 581 | 3300059509 | Ga0587089_020444 | Ga0587089_020444_281_799 | 170 |
| 582 | 3300059510 | Ga0587090_039129 | Ga0587090_039129_281_799 | 170 |
| 583 | 3300059511 | Ga0587091_057690 | Ga0587091_057690_27_545 | 170 |
| 584 | 3300059624 | Ga0587109_039592 | Ga0587109_039592_131_649 | 170 |
| 585 | 3300059626 | Ga0587115_027978 | Ga0587115_027978_27_545 | 170 |
| 586 | 3300060245 | Ga0587065_03325 | Ga0587065_03325_281_799 | 170 |
| 587 | 3300060246 | Ga0587081_03844 | Ga0587081_03844_281_799 | 170 |
| 588 | 3300009093 | Ga0105240_10030539 | Ga0105240_100305392 | 176 |
| 589 | 3300009545 | Ga0105237_10439810 | Ga0105237_104398101 | 176 |
| 590 | 3300013104 | Ga0157370_10004029 | Ga0157370_1000402911 | 176 |
| 591 | 3300044683 | Ga0466965_0189943 | Ga0466965_0189943_215_754 | 176 |
| 592 | 3300044901 | Ga0466960_0367037 | Ga0466960_0367037_220_759 | 176 |
| 593 | 3300046463 | Ga0495653_0118852 | Ga0495653_0118852_1038_1574 | 176 |
| 594 | 3300046477 | Ga0495664_0110828 | Ga0495664_0110828_956_1492 | 176 |
| 595 | 3300046507 | Ga0495606_0004958 | Ga0495606_0004958_5871_6410 | 176 |
| 596 | 3300046507 | Ga0495606_0131355 | Ga0495606_0131355_550_1086 | 176 |
| 597 | 3300046507 | Ga0495606_0419774 | Ga0495606_0419774_137_673 | 176 |
| 598 | 3300046516 | Ga0495628_0083791 | Ga0495628_0083791_319_855 | 176 |
| 599 | 3300046531 | Ga0495665_0119025 | Ga0495665_0119025_301_837 | 176 |
| 600 | 3300046535 | Ga0495586_0243564 | Ga0495586_0243564_157_693 | 176 |
| 601 | 3300046679 | Ga0495623_0015772 | Ga0495623_0015772_3044_3580 | 176 |
| 602 | 3300046680 | Ga0495646_0188776 | Ga0495646_0188776_177_713 | 176 |
| 603 | 3300046690 | Ga0495624_0084242 | Ga0495624_0084242_923_1459 | 176 |
| 604 | 3300046692 | Ga0495671_0355838 | Ga0495671_0355838_25_564 | 176 |
| 605 | 3300046694 | Ga0495649_0021267 | Ga0495649_0021267_206_745 | 176 |
| 606 | 3300046794 | Ga0495589_0066572 | Ga0495589_0066572_739_1278 | 176 |
| 607 | 3300046809 | Ga0495600_0246466 | Ga0495600_0246466_483_1019 | 176 |
| 608 | 3300047317 | Ga0495604_0439836 | Ga0495604_0439836_150_686 | 176 |
| 609 | 3300047319 | Ga0495674_0197177 | Ga0495674_0197177_995_1531 | 176 |
| 610 | 3300047323 | Ga0495683_0027196 | Ga0495683_0027196_1383_1922 | 176 |
| 611 | 3300047673 | Ga0495593_0110149 | Ga0495593_0110149_818_1354 | 176 |
| 612 | 3300048088 | Ga0495602_0107177 | Ga0495602_0107177_429_965 | 176 |
| 613 | 3300048903 | Ga0496100_0749940 | Ga0496100_0749940_140_676 | 176 |
| 614 | 3300048904 | Ga0496101_0111761 | Ga0496101_0111761_365_901 | 176 |
| 615 | 3300048905 | Ga0496102_0079999 | Ga0496102_0079999_1328_1864 | 176 |
| 616 | 3300048905 | Ga0496102_0142680 | Ga0496102_0142680_1328_1864 | 176 |
| 617 | 3300048908 | Ga0496105_0272444 | Ga0496105_0272444_699_1235 | 176 |
| 618 | 3300005289 | Ga0065704_10070139 | Ga0065704_10070139102 | 187 |
| 619 | 2162886007 | SwRhRL2b_contig_3111171 | SwRhRL2b_0976.00001320 | 193 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8ff9-assembly1.cif.gz_B | crystal structure of apo dps protein (pa0962) from pseudomonas aeruginosa (orthorhombic form) | 0.9878 | 39 | 193 |
| 8ff9-assembly1.cif.gz_B | crystal structure of apo dps protein (pa0962) from pseudomonas aeruginosa (orthorhombic form) | 0.9753 | 39 | 193 |
| 1jig-assembly1.cif.gz_A | dlp-2 from bacillus anthracis | 0.9625 | 50 | 193 |
| 2d5k-assembly1.cif.gz_B | crystal structure of dps from staphylococcus aureus | 0.961 | 51 | 193 |
| 6lkp-assembly1.cif.gz_F-2 | crystal structure of dps1 from the thermophilic non-heterocystous filamentous cyanobacterium thermoleptolyngbya sp. o-77 | 0.959 | 41 | 193 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2d5kD00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.9601 | 49 | 193 | 1.20.1260.10 |
| 1ji5D00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.9582 | 53 | 193 | 1.20.1260.10 |
| 4cybA00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.9576 | 39 | 193 | 1.20.1260.10 |
| 2xgwA00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.9557 | 49 | 191 | 1.20.1260.10 |
| 1n1qA00 | Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle | 0.9528 | 45 | 193 | 1.20.1260.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0S8F4Y2-F1-model_v4 | Ferritin | 0.9976 | 39 | 193 |
GO:0008199
GO:0016722 |
| AF-A0A329P5B3-F1-model_v4 | deleted | 0.9964 | 39 | 178 |
|
| AF-A0A6M0AMB4-F1-model_v4 | DNA starvation/stationary phase protection protein | 0.9961 | 45 | 163 |
GO:0008199
GO:0016722 |
| AF-M6KP73-F1-model_v4 | Ferritin-like protein | 0.9946 | 58 | 193 |
GO:0008199
GO:0016722 |
| AF-A0A0S8B9K7-F1-model_v4 | Ferritin | 0.9945 | 41 | 193 |
GO:0008199
GO:0016722 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar