F469857

General Info

Members Datasets Scaffolds Average Seq Length
619 376 567 163

Family's Representative Sequence

Representative Sequence 3300049570|Ga0501033_0002842|Ga0501033_0002842_42_584
Length 164
Sequence MAKKSSTGIDIGISAADRRKIADGLAHVLADAFTLYLKTHNFHWNITGAMFNSLHLMFEGQYTEQWNALDEIAERTRALGFNAPASYGEFIRLTSIKEEAGLTDTADWREMVRQLVAGNEAVCRTARKALKIADDAGDDPTTDLLTQRLNVHEKNAWMLRSLLQ

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
3 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
4 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
5 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
6 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
7 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
8 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
9 2519103095 Burkholderia sp. KJ006 Isolate Nodule
10 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
11 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
12 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
13 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
14 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
15 2600255292 Janthinobacterium lividum NFR18 Isolate Rhizoplane
16 2617270889 Nostoc punctiforme PCC 73102 Isolate Unclassified
17 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
18 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
19 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
20 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
21 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
22 2818991436 Collimonas arenae 515 Isolate Unclassified
23 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
24 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
25 2848694841 Nostoc sp. RF31YmG Isolate Unclassified
26 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
27 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
28 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
29 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
30 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
31 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
32 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
33 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
34 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
35 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
36 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
37 2913844669 Nostocales cyanobacterium LEGE 12452 Isolate Unclassified
38 2913939268 Nostoc sp. LEGE 12447 Isolate Unclassified
39 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
40 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
41 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
42 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
43 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
44 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
45 2928163908 Burkholderia sp. 567 Isolate Unclassified
46 2932410948 Janthinobacterium lividum 2829 Isolate Rhizosphere
47 2932416698 Janthinobacterium lividum 2830 Isolate Rhizosphere
48 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
49 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
50 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
51 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
52 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
53 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
54 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
55 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
56 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
57 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
58 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
59 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
60 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
61 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
62 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
63 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
64 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
65 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
66 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
67 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
68 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
69 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
70 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
71 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
72 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
73 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
74 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
75 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
76 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
77 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
78 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
79 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
80 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
81 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
82 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
83 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
84 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
85 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
86 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
87 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
88 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
89 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
90 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
91 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
92 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
93 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
94 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
95 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
96 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
97 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
98 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
99 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
100 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
101 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
102 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
103 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
104 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
105 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
106 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
107 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
108 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
109 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
110 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
111 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
112 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
113 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
114 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
115 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
116 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
117 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
118 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
119 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
120 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
121 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
122 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
123 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
124 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
125 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
126 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
127 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
128 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
129 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
132 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
134 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
141 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
142 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
144 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
145 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
148 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
149 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
150 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
151 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
152 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
153 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
154 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
156 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
157 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
158 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
159 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
181 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
188 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
192 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
193 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
194 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
195 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
196 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
197 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
198 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
199 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
201 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
202 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
203 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
204 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
205 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
206 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
207 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
208 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
209 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
210 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
211 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
212 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
213 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
214 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
215 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
216 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
217 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
218 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
219 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
220 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
221 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
222 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
223 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
224 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
225 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
226 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
227 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
228 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
229 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
230 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
231 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
232 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
233 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
234 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
235 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
236 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
237 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
238 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
239 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
240 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
241 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
242 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
243 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
244 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
245 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
246 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
247 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
248 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
249 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
250 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
251 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
252 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
253 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
254 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
255 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
256 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
257 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
258 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
259 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
260 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
261 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
262 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
263 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
264 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
265 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
266 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
267 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
268 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
269 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
270 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
271 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
272 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
273 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
274 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
275 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
276 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
277 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
278 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
279 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
280 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
281 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
282 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
283 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
284 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
285 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
286 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
287 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
288 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
289 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
290 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
291 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
292 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
293 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
294 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
295 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
296 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
297 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
298 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
299 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
300 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
301 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
302 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
303 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
304 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
305 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
306 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
307 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
308 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
309 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
310 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
311 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
312 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
313 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
314 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
315 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
316 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
317 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
318 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
319 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
320 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
321 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
322 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
323 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
324 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
325 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
326 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
327 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
328 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
329 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
330 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
331 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
332 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
333 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
334 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
335 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
337 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
339 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
340 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
341 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
342 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
343 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
344 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
346 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
347 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
348 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
349 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
350 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
351 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
352 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
353 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
354 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
355 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
356 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
357 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
358 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
359 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
360 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
361 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
362 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
363 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
364 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
365 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
366 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
367 3300060245 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 6R_CD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
368 3300060246 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 22R_SD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
369 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
370 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
371 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
372 642555144 Nostoc punctiforme PCC 73102 Isolate Unclassified
373 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
374 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
375 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
376 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.53
Metatranscriptomes 2.91
Isolates 8.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.86
Nodule 1.62
Rhizoplane 6.79
Rhizosphere 62.52
Stem 0
Stem Tuber 0
Unclassified 14.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3111171 2162886007 Bacteria 33112
2 JGI24740J21852_10035268 3300001979 Bacteria 1566
3 JGI24739J22299_10092257 3300001989 Bacteria 921
4 JGI24737J22298_10109286 3300001990 Bacteria 819
5 JGI24735J21928_10001085 3300002067 Bacteria 9725
6 JGI24735J21928_10134488 3300002067 Bacteria 713
7 JGI25156J39149_1001646 3300002705 Bacteria 9062
8 JGI25156J39149_1009851 3300002705 Bacteria 2291
9 JGI25154J39366_1000620 3300002738 Bacteria 16876
10 JGI25154J39366_1001336 3300002738 Bacteria 9062
11 JGI25157J39369_1000960 3300002741 Bacteria 13491
12 JGI25151J46595_10042717 3300003187 Bacteria 1630
13 JGI25151J46595_10075877 3300003187 Bacteria 995
14 JGI25165J46597_1000067 3300003214 Bacteria 196411
15 rootL2_10145991 3300003322 Bacteria 1036
16 rootL2_10189899 3300003322 Bacteria 1036
17 rootL2_10329721 3300003322 Bacteria 3445
18 rootH1_10039841 3300003316 Bacteria 6678
19 rootH1_10039841 3300003323 Bacteria 86560
20 JGI25160J50197_1000171 3300003354 Bacteria 55915
21 Ga0055538_1000010 3300003751 Bacteria 376599
22 Ga0055538_1000033 3300003751 Bacteria 195914
23 Ga0055539_1000015 3300003752 Bacteria 376599
24 Ga0055539_1000045 3300003752 Bacteria 195316
25 Ga0055533_1000018 3300003756 Bacteria 376599
26 Ga0055533_1000054 3300003756 Bacteria 195914
27 Ga0055532_1000018 3300003758 Bacteria 305466
28 Ga0055525_1000020 3300003759 Bacteria 376599
29 Ga0055525_1000065 3300003759 Bacteria 195779
30 Ga0055527_1000415 3300003760 Bacteria 17616
31 Ga0055527_1002589 3300003760 Bacteria 2982
32 Ga0055535_1001029 3300003761 Bacteria 17616
33 Ga0055535_1003154 3300003761 Bacteria 4921
34 Ga0055542_1001409 3300003762 Bacteria 12120
35 Ga0055529_1004271 3300003763 Bacteria 2190
36 Ga0055526_1007909 3300003771 Bacteria 5415
37 Ga0055526_1018284 3300003771 Bacteria 2623
38 Ga0055537_1015077 3300003773 Bacteria 1372
39 Ga0055524_1000281 3300003775 Bacteria 50001
40 Ga0055524_1028848 3300003775 Bacteria 1655
41 Ga0055536_1000044 3300003781 Bacteria 123111
42 Ga0055534_1000584 3300003784 Bacteria 19110
43 Ga0055534_1005553 3300003784 Bacteria 3346
44 Ga0055540_1074552 3300003792 Bacteria 658
45 Ga0055531_10009435 3300003794 Bacteria 4984
46 Ga0055541_1000011 3300003841 Bacteria 376599
47 Ga0055541_1000031 3300003841 Bacteria 195914
48 Ga0065165_1001400 3300005262 Bacteria 26315
49 Ga0065704_10070139 3300005289 Bacteria 529843
50 Ga0065707_10083069 3300005295 Bacteria 10627
51 Ga0070666_10120429 3300005335 Bacteria 1820
52 Ga0070666_10257873 3300005335 Bacteria 1236
53 Ga0070666_10841099 3300005335 Bacteria 677
54 Ga0070660_100000032 3300005339 Bacteria 85304
55 Ga0070660_100006752 3300005339 Bacteria 7962
56 Ga0070661_100091075 3300005344 Bacteria 2259
57 Ga0070668_100217816 3300005347 Bacteria 1573
58 Ga0070659_100000035 3300005366 Bacteria 115022
59 Ga0070709_10187962 3300005434 Bacteria 1455
60 Ga0070663_100000222 3300005455 Bacteria 28738
61 Ga0070663_100088981 3300005455 Bacteria 2284
62 Ga0070663_100113649 3300005455 Bacteria 2038
63 Ga0070678_100184437 3300005456 Bacteria 1711
64 Ga0070665_100311225 3300005548 Bacteria 1579
65 Ga0068855_100000763 3300005563 Bacteria 39665
66 Ga0068855_100031855 3300005563 Bacteria 6294
67 Ga0068855_100097688 3300005563 Bacteria 3383
68 Ga0068855_101196260 3300005563 Bacteria 790
69 Ga0068857_100083556 3300005577 Bacteria 2852
70 Ga0068854_100004210 3300005578 Bacteria 9060
71 Ga0068856_100327497 3300005614 Bacteria 1549
72 Ga0068852_100722091 3300005616 Bacteria 1007
73 Ga0068851_10174315 3300005834 Bacteria 1188
74 Ga0068851_10405205 3300005834 Bacteria 803
75 Ga0068858_100397505 3300005842 Bacteria 1324
76 Ga0070717_11348501 3300006028 Bacteria 648
77 Ga0075364_10365262 3300006051 Bacteria 984
78 Ga0070716_100050405 3300006173 Bacteria 2363
79 Ga0075366_10001087 3300006195 Bacteria 13355
80 Ga0075428_100010312 3300006844 Bacteria 10369
81 Ga0079104_1003995 3300006946 Bacteria 6551
82 Ga0099826_10000018 3300006948 Bacteria 198330
83 Ga0105251_10161125 3300009011 Bacteria 1011
84 Ga0105244_10031581 3300009036 Bacteria 2810
85 Ga0105244_10070631 3300009036 Bacteria 1742
86 Ga0105250_10000010 3300009092 Bacteria 298384
87 Ga0105250_10004503 3300009092 Bacteria 6402
88 Ga0105240_10017231 3300009093 Bacteria 9744
89 Ga0105240_10030539 3300009093 Bacteria 7003
90 Ga0105240_10043049 3300009093 Bacteria 5749
91 Ga0105240_10062072 3300009093 Bacteria 4654
92 Ga0105240_10984954 3300009093 Bacteria 902
93 Ga0105245_10613889 3300009098 Bacteria 1115
94 Ga0105241_11190003 3300009174 Bacteria 721
95 Ga0105248_10500894 3300009177 Bacteria 1369
96 Ga0105237_10023983 3300009545 Bacteria 6242
97 Ga0105237_10093311 3300009545 Bacteria 2999
98 Ga0105237_10122579 3300009545 Bacteria 2593
99 Ga0105237_10439810 3300009545 Bacteria 1310
100 Ga0105237_11057960 3300009545 Bacteria 818
101 Ga0105238_10000004 3300009551 Bacteria 390514
102 Ga0105238_10101063 3300009551 Bacteria 2867
103 Ga0105238_10151743 3300009551 Bacteria 2292
104 Ga0105239_10002820 3300010375 Bacteria 21739
105 Ga0105239_10010789 3300010375 Bacteria 10206
106 Ga0157371_10013404 3300013102 Bacteria 6226
107 Ga0157370_10004029 3300013104 Bacteria 17072
108 Ga0157370_10304339 3300013104 Bacteria 1471
109 Ga0157369_10001942 3300013105 Bacteria 24889
110 Ga0157374_10710152 3300013296 Bacteria 1019
111 Ga0163162_10036635 3300013306 Bacteria 4892
112 Ga0163162_12104359 3300013306 Bacteria 647
113 Ga0157372_10323749 3300013307 Bacteria 1795
114 Ga0157380_12949522 3300014326 Bacteria 542
115 Ga0182008_10004241 3300014497 Bacteria 8406
116 Ga0182008_10145724 3300014497 Bacteria 1186
117 Ga0182008_10362177 3300014497 Bacteria 771
118 Ga0157379_10000049 3300014968 Bacteria 74565
119 Ga0182006_1000112 3300015261 Bacteria 87378
120 Ga0182006_1050940 3300015261 Bacteria 1594
121 Ga0182007_10000020 3300015262 Bacteria 194053
122 Ga0182007_10017224 3300015262 Bacteria 2645
123 Ga0182007_10024254 3300015262 Bacteria 2124
124 Ga0182007_10032155 3300015262 Bacteria 1783
125 Ga0182005_1000001 3300015265 Bacteria 1014869
126 Ga0182005_1000118 3300015265 Bacteria 57357
127 Ga0182005_1053401 3300015265 Bacteria 1100
128 Ga0183361_10012 3300016635 Bacteria 203395
129 Ga0163161_10039155 3300017792 Bacteria 3402
130 Ga0206355_1360317 3300020076 Bacteria 604
131 Ga0206350_10320270 3300020080 Bacteria 756
132 Ga0206350_11216288 3300020080 Bacteria 722
133 Ga0206354_10473152 3300020081 Bacteria 2096
134 Ga0213872_10008589 3300021361 Bacteria 4939
135 Ga0213872_10132756 3300021361 Bacteria 1096
136 Ga0213872_10454948 3300021361 Bacteria 514
137 Ga0224712_10137122 3300022467 Bacteria 1074
138 Ga0209435_100007 3300025206 Bacteria 516857
139 Ga0209435_100623 3300025206 Bacteria 6462
140 Ga0209784_100025 3300025224 Bacteria 376681
141 Ga0209784_100048 3300025224 Bacteria 198885
142 Ga0209566_100025 3300025225 Bacteria 376681
143 Ga0209566_100060 3300025225 Bacteria 198885
144 Ga0209674_100042 3300025226 Bacteria 376681
145 Ga0209674_100082 3300025226 Bacteria 198885
146 Ga0209672_100038 3300025228 Bacteria 286731
147 Ga0209672_100952 3300025228 Bacteria 12904
148 Ga0209672_105499 3300025228 Bacteria 2164
149 Ga0209147_100017 3300025229 Bacteria 516857
150 Ga0209147_100259 3300025229 Bacteria 49184
151 Ga0209563_100046 3300025230 Bacteria 376681
152 Ga0209563_100082 3300025230 Bacteria 198750
153 Ga0207427_100829 3300025231 Bacteria 13818
154 Ga0209437_100125 3300025233 Bacteria 198146
155 Ga0209258_100109 3300025242 Bacteria 203881
156 Ga0209258_100215 3300025242 Bacteria 114444
157 Ga0209646_1000044 3300025246 Bacteria 334596
158 Ga0209646_1000133 3300025246 Bacteria 125401
159 Ga0209026_1000774 3300025250 Bacteria 17883
160 Ga0209026_1001042 3300025250 Bacteria 13542
161 Ga0209677_100027 3300025253 Bacteria 376681
162 Ga0209677_100046 3300025253 Bacteria 198287
163 Ga0209148_1000844 3300025254 Bacteria 21726
164 Ga0209148_1027150 3300025254 Bacteria 883
165 Ga0209759_1000048 3300025256 Bacteria 224817
166 Ga0209759_1000187 3300025256 Bacteria 100012
167 Ga0209759_1005558 3300025256 Bacteria 4384
168 Ga0209759_1015976 3300025256 Bacteria 1915
169 Ga0209233_1000138 3300025261 Bacteria 198287
170 Ga0209565_1000174 3300025263 Bacteria 82914
171 Ga0209565_1002133 3300025263 Bacteria 7497
172 Ga0209455_1004560 3300025272 Bacteria 4495
173 Ga0209455_1005569 3300025272 Bacteria 3866
174 Ga0209673_1015157 3300025273 Bacteria 2944
175 Ga0209130_1007122 3300025284 Bacteria 3504
176 Ga0209675_1000100 3300025291 Bacteria 128565
177 Ga0209675_1001095 3300025291 Bacteria 16645
178 Ga0209675_1004980 3300025291 Bacteria 5716
179 Ga0209675_1005120 3300025291 Bacteria 5581
180 Ga0209676_1000141 3300025292 Bacteria 175894
181 Ga0209676_1066430 3300025292 Bacteria 874
182 Ga0209025_1000390 3300025294 Bacteria 90952
183 Ga0209025_1000755 3300025294 Bacteria 54059
184 Ga0209025_1001457 3300025294 Bacteria 30940
185 Ga0209025_1006408 3300025294 Bacteria 9148
186 Ga0209025_1019891 3300025294 Bacteria 3706
187 Ga0209564_1001462 3300025295 Bacteria 23992
188 Ga0209564_1003294 3300025295 Bacteria 11224
189 Ga0209564_1011309 3300025295 Bacteria 4011
190 Ga0209256_1000434 3300025299 Bacteria 64801
191 Ga0209256_1001596 3300025299 Bacteria 22189
192 Ga0207426_1000037 3300025302 Bacteria 442735
193 Ga0207426_1001791 3300025302 Bacteria 16051
194 Ga0209051_1004798 3300025303 Bacteria 8153
195 Ga0209051_1049645 3300025303 Bacteria 1412
196 Ga0207656_10160428 3300025321 Bacteria 1070
197 Ga0207696_1000133 3300025711 Bacteria 131987
198 Ga0207696_1005177 3300025711 Bacteria 5458
199 Ga0207655_1068552 3300025728 Bacteria 1330
200 Ga0207713_1002908 3300025735 Bacteria 11990
201 Ga0207680_10317563 3300025903 Bacteria 1089
202 Ga0207680_11089891 3300025903 Bacteria 571
203 Ga0207647_10000608 3300025904 Bacteria 27922
204 Ga0207647_10003231 3300025904 Bacteria 12223
205 Ga0207647_10022621 3300025904 Bacteria 4172
206 Ga0207695_10001007 3300025913 Bacteria 49769
207 Ga0207695_10110658 3300025913 Bacteria 2727
208 Ga0207695_10128123 3300025913 Bacteria 2498
209 Ga0207695_10366880 3300025913 Bacteria 1326
210 Ga0207695_11313531 3300025913 Bacteria 604
211 Ga0207671_10002362 3300025914 Bacteria 20313
212 Ga0207671_10080640 3300025914 Bacteria 2440
213 Ga0207671_10092086 3300025914 Bacteria 2285
214 Ga0207671_10183593 3300025914 Bacteria 1629
215 Ga0207671_10185055 3300025914 Bacteria 1622
216 Ga0207657_10000051 3300025919 Bacteria 109129
217 Ga0207657_10000131 3300025919 Bacteria 75479
218 Ga0207649_10045441 3300025920 Bacteria 2693
219 Ga0207694_10000021 3300025924 Bacteria 300246
220 Ga0207694_10165073 3300025924 Bacteria 1790
221 Ga0207690_10000034 3300025932 Bacteria 149574
222 Ga0207706_10467047 3300025933 Bacteria 1091
223 Ga0207709_10819038 3300025935 Bacteria 752
224 Ga0207665_10080086 3300025939 Bacteria 2246
225 Ga0207711_10047482 3300025941 Bacteria 3670
226 Ga0207667_10000235 3300025949 Bacteria 77134
227 Ga0207667_10037973 3300025949 Bacteria 5146
228 Ga0207667_10039101 3300025949 Bacteria 5058
229 Ga0207640_10009807 3300025981 Bacteria 5371
230 Ga0207678_10001810 3300026067 Bacteria 19587
231 Ga0207678_10069274 3300026067 Bacteria 3025
232 Ga0207674_10099524 3300026116 Bacteria 2890
233 Ga0209281_1003252 3300027111 Bacteria 5523
234 Ga0209969_1002580 3300027360 Bacteria 2507
235 Ga0209996_1011383 3300027395 Bacteria 1187
236 Ga0209984_1001023 3300027424 Bacteria 2978
237 Ga0209968_1011039 3300027526 Bacteria 1394
238 Ga0209982_1000948 3300027552 Bacteria 3828
239 Ga0209983_1002199 3300027665 Bacteria 4293
240 Ga0209282_1000063 3300027666 Bacteria 93789
241 Ga0209971_1001547 3300027682 Bacteria 5690
242 Ga0209974_10005787 3300027876 Bacteria 4335
243 Ga0268266_10083192 3300028379 Bacteria 2794
244 Ga0268266_10408931 3300028379 Bacteria 1284
245 Ga0265334_10000402 3300028573 Bacteria 22758
246 Ga0265338_10000113 3300028800 Bacteria 150993
247 Ga0265338_10119274 3300028800 Bacteria 2106
248 Ga0265332_10000026 3300031238 Bacteria 193153
249 Ga0307509_10000145 3300031507 Bacteria 107492
250 Ga0307408_100016129 3300031548 Bacteria 4982
251 Ga0307406_10001924 3300031901 Bacteria 11317
252 Ga0307409_100001814 3300031995 Bacteria 10830
253 Ga0307415_100254220 3300032126 Bacteria 1430
254 Ga0316592_1096843 3300033524 Bacteria 677
255 Ga0373946_0060798 3300035171 Bacteria 1607
256 Ga0373937_0124447 3300036401 Bacteria 2404
257 Ga0373937_0387695 3300036401 Bacteria 1325
258 Ga0395899_0022113 3300037312 Bacteria 4822
259 Ga0395899_0058642 3300037312 Bacteria 2839
260 Ga0395899_0404001 3300037312 Bacteria 903
261 Ga0395900_0002362 3300037418 Bacteria 20872
262 Ga0395900_0065798 3300037418 Bacteria 3724
263 Ga0395900_0206106 3300037418 Bacteria 1987
264 Ga0395898_0000792 3300037466 Bacteria 53811
265 Ga0395898_0006662 3300037466 Bacteria 12318
266 Ga0395898_0020242 3300037466 Bacteria 6760
267 Ga0395898_0232430 3300037466 Bacteria 1758
268 Ga0395898_0570638 3300037466 Bacteria 1074
269 Ga0395905_0000813 3300037471 Bacteria 40988
270 Ga0395905_0005540 3300037471 Bacteria 12882
271 Ga0395905_0899359 3300037471 Bacteria 788
272 Ga0395905_1212326 3300037471 Bacteria 658
273 Ga0395901_0000003 3300038443 Bacteria 701538
274 Ga0395901_0000180 3300038443 Bacteria 81881
275 Ga0395901_0000887 3300038443 Bacteria 32901
276 Ga0395901_0088575 3300038443 Bacteria 3238
277 Ga0395901_0518996 3300038443 Bacteria 1210
278 Ga0237819_06728 3300038705 Bacteria 1705
279 Ga0237819_12094 3300038705 Bacteria 1076
280 Ga0436360_0491784 3300039438 Bacteria 1689
281 Ga0436361_0266834 3300039447 Bacteria 548
282 Ga0436361_0321406 3300039447 Bacteria 4407
283 Ga0436361_0633092 3300039447 Bacteria 1422
284 Ga0436361_1043697 3300039447 Bacteria 1110
285 Ga0451789_1261723 3300041443 Bacteria 678
286 Ga0451793_1378092 3300041452 Bacteria 890
287 Ga0451798_0896809 3300041458 Bacteria 1233
288 Ga0451807_2204438 3300041486 Bacteria 861
289 Ga0451835_0930639 3300041492 Bacteria 796
290 Ga0451839_1531924 3300041496 Bacteria 1258
291 Ga0451841_1156474 3300041498 Bacteria 1414
292 Ga0451843_1479918 3300041509 Bacteria 571
293 Ga0451855_0537433 3300041511 Bacteria 1126
294 Ga0439432_047114 3300042006 Bacteria 1353
295 Ga0466969_0089520 3300044656 Bacteria 1460
296 Ga0466972_0079611 3300044658 Bacteria 1560
297 Ga0466972_0183867 3300044658 Bacteria 980
298 Ga0466982_0098412 3300044672 Bacteria 1812
299 Ga0453683_0112851 3300044673 Bacteria 1710
300 Ga0466965_0006639 3300044683 Bacteria 5270
301 Ga0466965_0189943 3300044683 Bacteria 1086
302 Ga0466965_0472365 3300044683 Bacteria 700
303 Ga0466966_0005778 3300044684 Bacteria 8151
304 Ga0466966_0014130 3300044684 Bacteria 5283
305 Ga0466961_0005254 3300044693 Bacteria 8150
306 Ga0466961_0233516 3300044693 Bacteria 1131
307 Ga0466963_0425991 3300044694 Bacteria 936
308 Ga0466963_0638606 3300044694 Bacteria 751
309 Ga0466964_0373505 3300044706 Bacteria 738
310 Ga0453684_0000040 3300044712 Bacteria 690210
311 Ga0466971_0015018 3300044719 Bacteria 3406
312 Ga0466971_0018548 3300044719 Bacteria 3082
313 Ga0466968_0006354 3300044735 Bacteria 4450
314 Ga0466970_0025169 3300044765 Bacteria 3115
315 Ga0466970_0210398 3300044765 Bacteria 1083
316 Ga0466957_0020806 3300044842 Bacteria 3860
317 Ga0466957_0144345 3300044842 Bacteria 1535
318 Ga0466957_0615036 3300044842 Bacteria 761
319 Ga0466960_0367037 3300044901 Bacteria 824
320 Ga0466960_0495089 3300044901 Bacteria 715
321 Ga0466959_0013608 3300045049 Bacteria 5900
322 Ga0466959_0217894 3300045049 Bacteria 1324
323 Ga0466959_0262441 3300045049 Bacteria 1189
324 Ga0451576_0037303 3300045051 Bacteria 5149
325 Ga0466958_0010813 3300045836 Bacteria 5123
326 Ga0466958_0213495 3300045836 Bacteria 1230
327 Ga0466958_0477196 3300045836 Bacteria 808
328 Ga0495603_0004003 3300046455 Bacteria 8772
329 Ga0495590_0043053 3300046457 Bacteria 1575
330 Ga0495629_0001732 3300046459 Bacteria 17109
331 Ga0495638_0097173 3300046460 Bacteria 1766
332 Ga0495651_0030481 3300046462 Bacteria 4206
333 Ga0495653_0019152 3300046463 Bacteria 5552
334 Ga0495653_0118852 3300046463 Bacteria 1887
335 Ga0495653_0287634 3300046463 Bacteria 1076
336 Ga0495650_0002944 3300046471 Bacteria 12897
337 Ga0495650_0256486 3300046471 Bacteria 593
338 Ga0495580_0029510 3300046472 Bacteria 3980
339 Ga0495605_0003621 3300046474 Bacteria 9166
340 Ga0495605_0005538 3300046474 Bacteria 7347
341 Ga0495605_0054550 3300046474 Bacteria 1935
342 Ga0495639_0290183 3300046475 Bacteria 814
343 Ga0495662_0060546 3300046476 Bacteria 1828
344 Ga0495664_0049255 3300046477 Bacteria 2501
345 Ga0495664_0110828 3300046477 Bacteria 1656
346 Ga0495664_0128081 3300046477 Bacteria 1536
347 Ga0495664_0263450 3300046477 Bacteria 1042
348 Ga0495584_0079048 3300046491 Bacteria 1655
349 Ga0495596_0000845 3300046500 Bacteria 18533
350 Ga0495596_0073129 3300046500 Bacteria 1331
351 Ga0495607_0016273 3300046501 Bacteria 4802
352 Ga0495583_0023424 3300046506 Bacteria 3124
353 Ga0495583_0038920 3300046506 Bacteria 2244
354 Ga0495606_0004958 3300046507 Bacteria 12997
355 Ga0495606_0131355 3300046507 Bacteria 1488
356 Ga0495606_0419774 3300046507 Bacteria 692
357 Ga0495608_0003969 3300046511 Bacteria 10626
358 Ga0495608_0022983 3300046511 Bacteria 4275
359 Ga0495608_0151115 3300046511 Bacteria 1480
360 Ga0495610_0003098 3300046512 Bacteria 13264
361 Ga0495616_0008782 3300046513 Bacteria 5950
362 Ga0495616_0053497 3300046513 Bacteria 2006
363 Ga0495628_0001866 3300046516 Bacteria 19122
364 Ga0495628_0006103 3300046516 Bacteria 10537
365 Ga0495628_0083791 3300046516 Bacteria 2475
366 Ga0495628_0439791 3300046516 Bacteria 948
367 Ga0495630_0457182 3300046517 Bacteria 978
368 Ga0495644_0046337 3300046523 Bacteria 1634
369 Ga0495648_0018991 3300046524 Bacteria 4849
370 Ga0495648_0031046 3300046524 Bacteria 3524
371 Ga0495666_0206526 3300046526 Bacteria 902
372 Ga0495642_0052992 3300046528 Bacteria 1671
373 Ga0495652_0006302 3300046529 Bacteria 11050
374 Ga0495652_0047614 3300046529 Bacteria 3676
375 Ga0495652_0144710 3300046529 Bacteria 1865
376 Ga0495654_0145764 3300046530 Bacteria 1051
377 Ga0495665_0109733 3300046531 Bacteria 1447
378 Ga0495665_0119025 3300046531 Bacteria 1383
379 Ga0495586_0130486 3300046535 Bacteria 1407
380 Ga0495586_0243564 3300046535 Bacteria 1025
381 Ga0495609_0007032 3300046538 Bacteria 5668
382 Ga0495597_0084452 3300046542 Bacteria 1354
383 Ga0495597_0348533 3300046542 Bacteria 568
384 Ga0495645_0006241 3300046543 Bacteria 8257
385 Ga0495645_0011392 3300046543 Bacteria 6256
386 Ga0495645_0126632 3300046543 Bacteria 1794
387 Ga0495667_0037279 3300046559 Bacteria 3241
388 Ga0495656_0034494 3300046615 Bacteria 2072
389 Ga0495656_0056546 3300046615 Bacteria 1696
390 Ga0495668_0257076 3300046616 Bacteria 956
391 Ga0495611_0105597 3300046648 Bacteria 1310
392 Ga0495625_0295868 3300046660 Bacteria 1037
393 Ga0495625_0534536 3300046660 Bacteria 712
394 Ga0495661_0017791 3300046665 Bacteria 4685
395 Ga0495661_0146552 3300046665 Bacteria 1279
396 Ga0495657_0040791 3300046675 Bacteria 3181
397 Ga0495599_0002151 3300046678 Bacteria 11458
398 Ga0495623_0015772 3300046679 Bacteria 4884
399 Ga0495623_0018230 3300046679 Bacteria 4533
400 Ga0495623_0040897 3300046679 Bacteria 2958
401 Ga0495646_0000331 3300046680 Bacteria 24355
402 Ga0495646_0065842 3300046680 Bacteria 2144
403 Ga0495646_0188776 3300046680 Bacteria 1127
404 Ga0495658_0066530 3300046683 Bacteria 2082
405 Ga0495669_0029127 3300046684 Bacteria 2420
406 Ga0495669_0037002 3300046684 Bacteria 2159
407 Ga0495669_0379476 3300046684 Bacteria 684
408 Ga0495624_0031021 3300046690 Bacteria 3479
409 Ga0495624_0084242 3300046690 Bacteria 1965
410 Ga0495624_0140789 3300046690 Bacteria 1477
411 Ga0495671_0002939 3300046692 Bacteria 10605
412 Ga0495671_0355838 3300046692 Bacteria 702
413 Ga0495649_0021267 3300046694 Bacteria 3635
414 Ga0495649_0106031 3300046694 Bacteria 1492
415 Ga0495649_0428173 3300046694 Bacteria 662
416 Ga0495589_0016255 3300046794 Bacteria 3824
417 Ga0495589_0066572 3300046794 Bacteria 1764
418 Ga0495600_0013625 3300046809 Bacteria 5114
419 Ga0495600_0246466 3300046809 Bacteria 1137
420 Ga0495600_0324606 3300046809 Bacteria 968
421 Ga0495660_0206382 3300046810 Bacteria 935
422 Ga0495604_0011114 3300047317 Bacteria 7147
423 Ga0495604_0169175 3300047317 Bacteria 1538
424 Ga0495604_0439836 3300047317 Bacteria 853
425 Ga0495636_0002527 3300047318 Bacteria 7020
426 Ga0495636_0517716 3300047318 Bacteria 578
427 Ga0495674_0029256 3300047319 Bacteria 5019
428 Ga0495674_0197177 3300047319 Bacteria 1672
429 Ga0495672_0002512 3300047320 Bacteria 16771
430 Ga0495672_0082399 3300047320 Bacteria 1789
431 Ga0495683_0027196 3300047323 Bacteria 2926
432 Ga0495683_0265441 3300047323 Bacteria 748
433 Ga0495687_112097 3300047443 Bacteria 1000
434 Ga0495677_0051940 3300047445 Bacteria 1510
435 Ga0495677_0285580 3300047445 Bacteria 648
436 Ga0495679_015535 3300047446 Bacteria 2781
437 Ga0495685_079015 3300047447 Bacteria 1096
438 Ga0495673_0243281 3300047469 Bacteria 659
439 Ga0495686_0000014 3300047472 Bacteria 474014
440 Ga0495593_0110149 3300047673 Bacteria 1406
441 Ga0495602_0017748 3300048088 Bacteria 7124
442 Ga0495602_0107177 3300048088 Bacteria 2278
443 Ga0495626_0098337 3300048091 Bacteria 1278
444 Ga0496100_0008832 3300048903 Bacteria 5637
445 Ga0496100_0016348 3300048903 Bacteria 4355
446 Ga0496100_0084267 3300048903 Bacteria 2154
447 Ga0496100_0222420 3300048903 Bacteria 1386
448 Ga0496100_0671933 3300048903 Bacteria 807
449 Ga0496100_0749940 3300048903 Bacteria 763
450 Ga0496101_0031993 3300048904 Bacteria 3700
451 Ga0496101_0111761 3300048904 Bacteria 2057
452 Ga0496101_0165145 3300048904 Bacteria 1699
453 Ga0496101_0238008 3300048904 Bacteria 1416
454 Ga0496102_0000661 3300048905 Bacteria 34418
455 Ga0496102_0079999 3300048905 Bacteria 3010
456 Ga0496102_0142680 3300048905 Bacteria 2246
457 Ga0496102_0444801 3300048905 Bacteria 1216
458 Ga0496102_0901743 3300048905 Bacteria 806
459 Ga0496103_0001616 3300048906 Bacteria 14787
460 Ga0496103_0309620 3300048906 Bacteria 1016
461 Ga0496104_0080317 3300048907 Bacteria 3109
462 Ga0496104_0154788 3300048907 Bacteria 2200
463 Ga0496104_0232015 3300048907 Bacteria 1757
464 Ga0496104_0927386 3300048907 Bacteria 776
465 Ga0496105_0035791 3300048908 Bacteria 4088
466 Ga0496105_0272444 3300048908 Bacteria 1367
467 Ga0496105_0314136 3300048908 Bacteria 1257
468 Ga0496106_0358611 3300048909 Bacteria 1171
469 Ga0496107_0010382 3300048910 Bacteria 6471
470 Ga0496107_0565826 3300048910 Bacteria 841
471 Ga0496108_0227400 3300048911 Bacteria 1622
472 Ga0496109_0159185 3300048912 Bacteria 2115
473 Ga0496110_0000055 3300048913 Bacteria 57895
474 Ga0496111_0060848 3300048914 Bacteria 2737
475 Ga0496111_0503059 3300048914 Bacteria 892
476 Ga0496113_0038038 3300048916 Bacteria 3535
477 Ga0496114_0005374 3300048917 Bacteria 10016
478 Ga0496114_0332107 3300048917 Bacteria 1344
479 Ga0496115_0257785 3300048918 Bacteria 1434
480 Ga0496115_0886841 3300048918 Bacteria 689
481 Ga0496116_0009836 3300048919 Bacteria 8099
482 Ga0496116_0017083 3300048919 Bacteria 5650
483 Ga0496116_0021038 3300048919 Bacteria 4932
484 Ga0496117_0000094 3300048920 Bacteria 201853
485 Ga0496117_0020755 3300048920 Bacteria 5346
486 Ga0496117_0055517 3300048920 Bacteria 2767
487 Ga0496117_0260800 3300048920 Bacteria 939
488 Ga0496118_0000071 3300048921 Bacteria 201853
489 Ga0496118_0002811 3300048921 Bacteria 22806
490 Ga0496118_0118494 3300048921 Bacteria 1733
491 Ga0496119_0075970 3300048922 Bacteria 1950
492 Ga0496119_0307617 3300048922 Bacteria 779
493 Ga0496119_0322061 3300048922 Bacteria 756
494 Ga0496120_0240147 3300048923 Bacteria 855
495 Ga0496121_0016109 3300048924 Bacteria 7745
496 Ga0496121_0017999 3300048924 Bacteria 7159
497 Ga0496121_0027352 3300048924 Bacteria 5338
498 Ga0496121_0093918 3300048924 Bacteria 2334
499 Ga0496121_0406748 3300048924 Bacteria 889
500 Ga0496121_0610862 3300048924 Bacteria 671
501 Ga0496122_0001303 3300048925 Bacteria 41143
502 Ga0496122_0003123 3300048925 Bacteria 22187
503 Ga0496122_0021375 3300048925 Bacteria 5795
504 Ga0496122_0058759 3300048925 Bacteria 2844
505 Ga0496122_0147471 3300048925 Bacteria 1459
506 Ga0496123_0004461 3300048926 Bacteria 14692
507 Ga0496123_0005043 3300048926 Bacteria 13508
508 Ga0496123_0077630 3300048926 Bacteria 2039
509 Ga0496123_0140910 3300048926 Bacteria 1318
510 Ga0496124_0226582 3300048927 Bacteria 1401
511 Ga0496124_0230176 3300048927 Bacteria 1386
512 Ga0496125_0109846 3300048928 Bacteria 2001
513 Ga0496125_0277511 3300048928 Bacteria 1040
514 Ga0496126_0004283 3300048929 Bacteria 17159
515 Ga0496126_0175701 3300048929 Bacteria 1822
516 Ga0496126_0396279 3300048929 Bacteria 1121
517 Ga0501305_045614 3300049161 Bacteria 724
518 Ga0495678_092518 3300049459 Bacteria 1062
519 Ga0495682_0003624 3300049460 Bacteria 6810
520 Ga0501318_086593 3300049534 Bacteria 514
521 Ga0501032_0439606 3300049569 Bacteria 836
522 Ga0501033_0002842 3300049570 Bacteria 14508
523 Ga0501034_0001676 3300049571 Bacteria 28558
524 Ga0501034_0110212 3300049571 Bacteria 2744
525 Ga0501034_0903086 3300049571 Bacteria 771
526 Ga0501037_0322356 3300049573 Bacteria 1070
527 Ga0501047_0004231 3300049581 Bacteria 13513
528 Ga0501047_0055057 3300049581 Bacteria 3847
529 Ga0501070_0568359 3300049586 Bacteria 906
530 Ga0501074_0101267 3300049590 Bacteria 2062
531 Ga0501079_0294698 3300049741 Bacteria 1269
532 Ga0501080_0103747 3300049742 Bacteria 2637
533 Ga0501080_1375150 3300049742 Bacteria 603
534 Ga0501081_0050053 3300049743 Bacteria 2878
535 Ga0501279_072708 3300049775 Bacteria 581
536 Ga0501035_0040498 3300049822 Bacteria 4210
537 Ga0501035_0318047 3300049822 Bacteria 1308
538 Ga0501044_0014793 3300049823 Bacteria 8412
539 Ga0501044_0279870 3300049823 Bacteria 1602
540 nmdc:mga00v17_333412_c1 3300050491 Bacteria 986
541 nmdc:mga0k408_18383_c1 3300050493 Bacteria 3902
542 nmdc:mga0k408_1877_c1 3300050493 Bacteria 11265
543 Ga0495601_0004204 3300053077 Bacteria 8304
544 Ga0495601_0717882 3300053077 Bacteria 637
545 Ga0495619_0336888 3300053085 Bacteria 1044
546 Ga0500643_003797 3300053087 Bacteria 7061
547 Ga0500595_005316 3300053119 Bacteria 5638
548 Ga0500618_006459 3300053125 Bacteria 3437
549 Ga0500574_000067 3300053141 Bacteria 11756
550 Ga0500590_090625 3300053148 Bacteria 1485
551 Ga0500616_0097314 3300053153 Bacteria 1445
552 Ga0500619_007917 3300053154 Bacteria 2549
553 Ga0590074_000395 3300059423 Bacteria 6237
554 Ga0590075_002071 3300059424 Bacteria 4836
555 Ga0590077_000266 3300059426 Bacteria 14827
556 Ga0587077_043152 3300059493 Bacteria 913
557 Ga0587086_011045 3300059507 Bacteria 1103
558 Ga0587089_020444 3300059509 Bacteria 912
559 Ga0587090_039129 3300059510 Bacteria 827
560 Ga0587090_039280 3300059510 Bacteria 826
561 Ga0587091_057690 3300059511 Bacteria 816
562 Ga0587109_039592 3300059624 Bacteria 929
563 Ga0587115_027978 3300059626 Bacteria 823
564 Ga0587065_03325 3300060245 Bacteria 882
565 Ga0587081_03844 3300060246 Bacteria 956
566 Ga0501082_0416674 3300060353 Bacteria 1173
567 Ga0466962_0029794 3300061719 Bacteria 2612

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003322 rootL2_10145991 rootL2_101459913 154
2 3300003322 rootL2_10189899 rootL2_101898993 154
3 3300003322 rootL2_10329721 rootL2_103297213 154
4 3300003323 rootH1_10039841 rootH1_1003984157 154
5 3300005434 Ga0070709_10187962 Ga0070709_101879622 154
6 3300006173 Ga0070716_100050405 Ga0070716_1000504052 154
7 3300006195 Ga0075366_10001087 Ga0075366_100010872 154
8 3300014326 Ga0157380_12949522 Ga0157380_129495221 154
9 3300025939 Ga0207665_10080086 Ga0207665_100800862 154
10 3300027360 Ga0209969_1002580 Ga0209969_10025802 154
11 3300027395 Ga0209996_1011383 Ga0209996_10113831 154
12 3300027424 Ga0209984_1001023 Ga0209984_10010232 154
13 3300027526 Ga0209968_1011039 Ga0209968_10110392 154
14 3300027552 Ga0209982_1000948 Ga0209982_10009483 154
15 3300027665 Ga0209983_1002199 Ga0209983_10021993 154
16 3300027682 Ga0209971_1001547 Ga0209971_10015472 154
17 3300027876 Ga0209974_10005787 Ga0209974_100057872 154
18 3300031548 Ga0307408_100016129 Ga0307408_1000161294 154
19 3300031901 Ga0307406_10001924 Ga0307406_1000192410 154
20 3300041452 Ga0451793_1378092 Ga0451793_1378092_43_510 154
21 3300041458 Ga0451798_0896809 Ga0451798_0896809_339_809 154
22 3300048914 Ga0496111_0503059 Ga0496111_0503059_91_558 154
23 3300048917 Ga0496114_0332107 Ga0496114_0332107_39_509 154
24 3300049161 Ga0501305_045614 Ga0501305_045614_114_581 154
25 3300049571 Ga0501034_0110212 Ga0501034_0110212_83_613 154
26 3300049581 Ga0501047_0055057 Ga0501047_0055057_3069_3599 154
27 3300049586 Ga0501070_0568359 Ga0501070_0568359_45_575 154
28 3300049775 Ga0501279_072708 Ga0501279_072708_84_554 154
29 3300050493 nmdc:mga0k408_1877_c1 nmdc:mga0k408_1877_c1_896_1366 154
30 3300006844 Ga0075428_100010312 Ga0075428_1000103128 155
31 3300025935 Ga0207709_10819038 Ga0207709_108190382 155
32 3300049741 Ga0501079_0294698 Ga0501079_0294698_133_606 155
33 3300049743 Ga0501081_0050053 Ga0501081_0050053_1459_1932 155
34 3300060353 Ga0501082_0416674 Ga0501082_0416674_249_722 155
35 3300005295 Ga0065707_10083069 Ga0065707_100830693 156
36 3300025291 Ga0209675_1001095 Ga0209675_100109510 156
37 3300025292 Ga0209676_1066430 Ga0209676_10664301 156
38 3300025711 Ga0207696_1000133 Ga0207696_1000133113 156
39 3300031238 Ga0265332_10000026 Ga0265332_1000002677 156
40 3300031507 Ga0307509_10000145 Ga0307509_1000014516 156
41 3300031995 Ga0307409_100001814 Ga0307409_1000018149 156
42 3300032126 Ga0307415_100254220 Ga0307415_1002542201 156
43 3300033524 Ga0316592_1096843 Ga0316592_10968431 156
44 3300041486 Ga0451807_2204438 Ga0451807_2204438_361_837 156
45 3300041492 Ga0451835_0930639 Ga0451835_0930639_154_630 156
46 3300041496 Ga0451839_1531924 Ga0451839_1531924_125_601 156
47 3300041498 Ga0451841_1156474 Ga0451841_1156474_116_592 156
48 3300041509 Ga0451843_1479918 Ga0451843_1479918_48_521 156
49 3300041511 Ga0451855_0537433 Ga0451855_0537433_509_985 156
50 3300044673 Ga0453683_0112851 Ga0453683_0112851_62_532 156
51 3300045051 Ga0451576_0037303 Ga0451576_0037303_2030_2500 156
52 3300053087 Ga0500643_003797 Ga0500643_003797_6180_6656 156
53 3300053153 Ga0500616_0097314 Ga0500616_0097314_588_1070 156
54 3300059510 Ga0587090_039280 Ga0587090_039280_12_488 156
55 iso_pu_bacteria 2511231003 2511251429 156
56 iso_pu_bacteria 2818991436 2819544657 156
57 iso_pu_bacteria 2818991445 2819593875 156
58 3300021361 Ga0213872_10454948 Ga0213872_104549481 157
59 3300028573 Ga0265334_10000402 Ga0265334_100004028 157
60 3300039447 Ga0436361_0266834 Ga0436361_0266834_27_503 157
61 3300049534 Ga0501318_086593 Ga0501318_086593_14_490 157
62 3300049570 Ga0501033_0002842 Ga0501033_0002842_42_584 157
63 3300049823 Ga0501044_0279870 Ga0501044_0279870_246_722 157
64 iso_pu_bacteria 2501025502 2501078880 157
65 iso_pu_bacteria 2510917013 2511089518 157
66 iso_pu_bacteria 2513237082 2513551551 157
67 iso_pu_bacteria 2513237083 2513560202 157
68 iso_pu_bacteria 2513237166 2514046265 157
69 iso_pu_bacteria 2519103095 2519457870 157
70 iso_pu_bacteria 2562617112 2563061881 157
71 iso_pu_bacteria 2582581311 2585295174 157
72 iso_pu_bacteria 2600255067 2600814643 157
73 iso_pu_bacteria 2617270889 2617917244 157
74 iso_pu_bacteria 2711768613 2713478283 157
75 iso_pu_bacteria 2721755763 2723879439 157
76 iso_pu_bacteria 2816332253 2817260052 157
77 iso_pu_bacteria 2816332256 2817277716 157
78 iso_pu_bacteria 2816332286 2817456871 157
79 iso_pu_bacteria 2848694841 2848700633 157
80 iso_pu_bacteria 2856287931 2856289182 157
81 iso_pu_bacteria 2857357740 2857363447 157
82 iso_pu_bacteria 2883087390 2883094713 157
83 iso_pu_bacteria 2901300506 2901312458 157
84 iso_pu_bacteria 2913844669 2913848627 157
85 iso_pu_bacteria 2913939268 2913941667 157
86 iso_pu_bacteria 2921643360 2921643750 157
87 iso_pu_bacteria 2928157003 2928159876 157
88 iso_pu_bacteria 2928163908 2928164083 157
89 iso_pu_bacteria 2981990288 2981994313 157
90 iso_pu_bacteria 641736154 642419227 157
91 iso_pu_bacteria 642555144 642602710 157
92 iso_pu_bacteria 8003955200 8003957469 157
93 iso_pu_bacteria 8020807995 8020812271 157
94 iso_pu_bacteria 8040167225 8040172274 157
95 iso_pu_bacteria 8040173305 8040175775 157
96 3300013306 Ga0163162_12104359 Ga0163162_121043592 158
97 3300036401 Ga0373937_0387695 Ga0373937_0387695_747_1223 158
98 3300037466 Ga0395898_0570638 Ga0395898_0570638_221_703 158
99 3300037471 Ga0395905_0000813 Ga0395905_0000813_16162_16644 158
100 3300037471 Ga0395905_1212326 Ga0395905_1212326_68_550 158
101 3300038443 Ga0395901_0088575 Ga0395901_0088575_1547_2029 158
102 3300044712 Ga0453684_0000040 Ga0453684_0000040_386821_387303 158
103 iso_pu_bacteria 2511231026 2511386573 158
104 iso_pu_bacteria 2521172590 2521561162 158
105 iso_pu_bacteria 2551306416 2553005962 158
106 iso_pu_bacteria 2818991449 2819617540 158
107 iso_pu_bacteria 2904439833 2904442198 158
108 iso_pu_bacteria 2904530477 2904533487 158
109 iso_pu_bacteria 2904584206 2904586439 158
110 iso_pu_bacteria 2904589729 2904591748 158
111 iso_pu_bacteria 2904601388 2904602093 158
112 iso_pu_bacteria 2919046199 2919051236 158
113 iso_pu_bacteria 2919079590 2919083563 158
114 iso_pu_bacteria 2923510766 2923515001 158
115 iso_pu_bacteria 2928130867 2928133508 158
116 3300006051 Ga0075364_10365262 Ga0075364_103652621 159
117 3300009092 Ga0105250_10000010 Ga0105250_1000001010 159
118 3300014968 Ga0157379_10000049 Ga0157379_1000004911 159
119 3300050491 nmdc:mga00v17_333412_c1 nmdc:mga00v17_333412_c1_79_564 159
120 iso_pu_bacteria 2600255292 2601669110 159
121 iso_pu_bacteria 2900577576 2900581049 159
122 iso_pu_bacteria 2932410948 2932416414 159
123 iso_pu_bacteria 2932416698 2932417185 159
124 3300002705 JGI25156J39149_1001646 JGI25156J39149_10016463 160
125 3300002705 JGI25156J39149_1009851 JGI25156J39149_10098512 160
126 3300002738 JGI25154J39366_1000620 JGI25154J39366_10006203 160
127 3300002738 JGI25154J39366_1001336 JGI25154J39366_10013366 160
128 3300002741 JGI25157J39369_1000960 JGI25157J39369_100096010 160
129 3300003214 JGI25165J46597_1000067 JGI25165J46597_100006715 160
130 3300003751 Ga0055538_1000033 Ga0055538_100003315 160
131 3300003752 Ga0055539_1000045 Ga0055539_100004514 160
132 3300003756 Ga0055533_1000054 Ga0055533_100005415 160
133 3300003758 Ga0055532_1000018 Ga0055532_10000183 160
134 3300003759 Ga0055525_1000065 Ga0055525_100006515 160
135 3300003761 Ga0055535_1003154 Ga0055535_10031543 160
136 3300003794 Ga0055531_10009435 Ga0055531_100094353 160
137 3300003841 Ga0055541_1000031 Ga0055541_100003115 160
138 3300015262 Ga0182007_10017224 Ga0182007_100172243 160
139 3300015262 Ga0182007_10032155 Ga0182007_100321551 160
140 3300015265 Ga0182005_1000118 Ga0182005_100011843 160
141 3300025206 Ga0209435_100007 Ga0209435_100007196 160
142 3300025206 Ga0209435_100623 Ga0209435_1006233 160
143 3300025224 Ga0209784_100048 Ga0209784_10004814 160
144 3300025225 Ga0209566_100060 Ga0209566_10006014 160
145 3300025226 Ga0209674_100082 Ga0209674_10008214 160
146 3300025228 Ga0209672_105499 Ga0209672_1054992 160
147 3300025229 Ga0209147_100017 Ga0209147_100017276 160
148 3300025230 Ga0209563_100082 Ga0209563_10008214 160
149 3300025231 Ga0207427_100829 Ga0207427_10082911 160
150 3300025233 Ga0209437_100125 Ga0209437_10012513 160
151 3300025242 Ga0209258_100215 Ga0209258_100215108 160
152 3300025246 Ga0209646_1000044 Ga0209646_1000044117 160
153 3300025246 Ga0209646_1000133 Ga0209646_100013394 160
154 3300025250 Ga0209026_1000774 Ga0209026_100077413 160
155 3300025250 Ga0209026_1001042 Ga0209026_100104210 160
156 3300025253 Ga0209677_100046 Ga0209677_10004613 160
157 3300025254 Ga0209148_1027150 Ga0209148_10271502 160
158 3300025256 Ga0209759_1000048 Ga0209759_1000048196 160
159 3300025256 Ga0209759_1000187 Ga0209759_100018717 160
160 3300025261 Ga0209233_1000138 Ga0209233_100013813 160
161 3300025272 Ga0209455_1005569 Ga0209455_10055692 160
162 3300025294 Ga0209025_1006408 Ga0209025_10064085 160
163 3300046462 Ga0495651_0030481 Ga0495651_0030481_283_771 160
164 3300046463 Ga0495653_0019152 Ga0495653_0019152_1325_1813 160
165 3300046511 Ga0495608_0003969 Ga0495608_0003969_6903_7391 160
166 3300046511 Ga0495608_0022983 Ga0495608_0022983_1698_2186 160
167 3300046516 Ga0495628_0001866 Ga0495628_0001866_15490_15978 160
168 3300046516 Ga0495628_0006103 Ga0495628_0006103_6939_7427 160
169 3300046529 Ga0495652_0006302 Ga0495652_0006302_3527_4015 160
170 3300046529 Ga0495652_0047614 Ga0495652_0047614_2419_2907 160
171 3300046543 Ga0495645_0126632 Ga0495645_0126632_324_812 160
172 3300046648 Ga0495611_0105597 Ga0495611_0105597_439_927 160
173 3300046675 Ga0495657_0040791 Ga0495657_0040791_1514_2002 160
174 3300046678 Ga0495599_0002151 Ga0495599_0002151_7607_8095 160
175 3300046679 Ga0495623_0018230 Ga0495623_0018230_3648_4136 160
176 3300046679 Ga0495623_0040897 Ga0495623_0040897_1671_2159 160
177 3300046680 Ga0495646_0000331 Ga0495646_0000331_3792_4280 160
178 3300046680 Ga0495646_0065842 Ga0495646_0065842_1642_2130 160
179 3300046683 Ga0495658_0066530 Ga0495658_0066530_18_506 160
180 3300046690 Ga0495624_0031021 Ga0495624_0031021_1555_2043 160
181 3300046690 Ga0495624_0140789 Ga0495624_0140789_670_1158 160
182 3300046809 Ga0495600_0013625 Ga0495600_0013625_1239_1727 160
183 3300047317 Ga0495604_0011114 Ga0495604_0011114_2922_3410 160
184 3300048088 Ga0495602_0017748 Ga0495602_0017748_3651_4139 160
185 3300050493 nmdc:mga0k408_18383_c1 nmdc:mga0k408_18383_c1_18_506 160
186 3300053077 Ga0495601_0004204 Ga0495601_0004204_3157_3645 160
187 3300053077 Ga0495601_0717882 Ga0495601_0717882_118_606 160
188 3300053085 Ga0495619_0336888 Ga0495619_0336888_428_916 160
189 3300053119 Ga0500595_005316 Ga0500595_005316_1949_2437 160
190 3300053141 Ga0500574_000067 Ga0500574_000067_10973_11461 160
191 3300053154 Ga0500619_007917 Ga0500619_007917_1804_2292 160
192 iso_pu_bacteria 2885270888 2885277322 160
193 3300001979 JGI24740J21852_10035268 JGI24740J21852_100352682 161
194 3300001989 JGI24739J22299_10092257 JGI24739J22299_100922572 161
195 3300001990 JGI24737J22298_10109286 JGI24737J22298_101092861 161
196 3300002067 JGI24735J21928_10001085 JGI24735J21928_100010851 161
197 3300002067 JGI24735J21928_10134488 JGI24735J21928_101344881 161
198 3300003187 JGI25151J46595_10042717 JGI25151J46595_100427172 161
199 3300003187 JGI25151J46595_10075877 JGI25151J46595_100758772 161
200 3300003354 JGI25160J50197_1000171 JGI25160J50197_100017137 161
201 3300003760 Ga0055527_1000415 Ga0055527_100041510 161
202 3300003760 Ga0055527_1002589 Ga0055527_10025894 161
203 3300003761 Ga0055535_1001029 Ga0055535_100102910 161
204 3300003762 Ga0055542_1001409 Ga0055542_10014093 161
205 3300003763 Ga0055529_1004271 Ga0055529_10042713 161
206 3300003771 Ga0055526_1007909 Ga0055526_10079095 161
207 3300003771 Ga0055526_1018284 Ga0055526_10182843 161
208 3300003773 Ga0055537_1015077 Ga0055537_10150772 161
209 3300003775 Ga0055524_1000281 Ga0055524_10002813 161
210 3300003775 Ga0055524_1028848 Ga0055524_10288482 161
211 3300003781 Ga0055536_1000044 Ga0055536_1000044120 161
212 3300003784 Ga0055534_1000584 Ga0055534_10005842 161
213 3300003784 Ga0055534_1005553 Ga0055534_10055531 161
214 3300003792 Ga0055540_1074552 Ga0055540_10745521 161
215 3300005262 Ga0065165_1001400 Ga0065165_100140013 161
216 3300005335 Ga0070666_10120429 Ga0070666_101204292 161
217 3300005335 Ga0070666_10257873 Ga0070666_102578732 161
218 3300005335 Ga0070666_10841099 Ga0070666_108410991 161
219 3300005339 Ga0070660_100000032 Ga0070660_10000003251 161
220 3300005339 Ga0070660_100006752 Ga0070660_1000067522 161
221 3300005344 Ga0070661_100091075 Ga0070661_1000910753 161
222 3300005347 Ga0070668_100217816 Ga0070668_1002178162 161
223 3300005366 Ga0070659_100000035 Ga0070659_10000003584 161
224 3300005455 Ga0070663_100000222 Ga0070663_10000022216 161
225 3300005455 Ga0070663_100088981 Ga0070663_1000889813 161
226 3300005455 Ga0070663_100113649 Ga0070663_1001136493 161
227 3300005456 Ga0070678_100184437 Ga0070678_1001844372 161
228 3300005548 Ga0070665_100311225 Ga0070665_1003112252 161
229 3300005563 Ga0068855_100031855 Ga0068855_1000318553 161
230 3300005563 Ga0068855_100097688 Ga0068855_1000976883 161
231 3300005616 Ga0068852_100722091 Ga0068852_1007220912 161
232 3300005834 Ga0068851_10405205 Ga0068851_104052051 161
233 3300005842 Ga0068858_100397505 Ga0068858_1003975052 161
234 3300006028 Ga0070717_11348501 Ga0070717_113485011 161
235 3300006948 Ga0099826_10000018 Ga0099826_10000018139 161
236 3300009011 Ga0105251_10161125 Ga0105251_101611252 161
237 3300009036 Ga0105244_10070631 Ga0105244_100706312 161
238 3300009092 Ga0105250_10004503 Ga0105250_100045035 161
239 3300009093 Ga0105240_10017231 Ga0105240_100172319 161
240 3300009093 Ga0105240_10043049 Ga0105240_100430496 161
241 3300009098 Ga0105245_10613889 Ga0105245_106138892 161
242 3300009174 Ga0105241_11190003 Ga0105241_111900031 161
243 3300009177 Ga0105248_10500894 Ga0105248_105008942 161
244 3300009545 Ga0105237_10122579 Ga0105237_101225792 161
245 3300009545 Ga0105237_11057960 Ga0105237_110579601 161
246 3300009551 Ga0105238_10101063 Ga0105238_101010633 161
247 3300009551 Ga0105238_10151743 Ga0105238_101517432 161
248 3300010375 Ga0105239_10010789 Ga0105239_100107895 161
249 3300013102 Ga0157371_10013404 Ga0157371_100134044 161
250 3300013104 Ga0157370_10304339 Ga0157370_103043392 161
251 3300013105 Ga0157369_10001942 Ga0157369_100019425 161
252 3300013296 Ga0157374_10710152 Ga0157374_107101521 161
253 3300013306 Ga0163162_10036635 Ga0163162_100366356 161
254 3300013307 Ga0157372_10323749 Ga0157372_103237492 161
255 3300014497 Ga0182008_10004241 Ga0182008_100042411 161
256 3300014497 Ga0182008_10145724 Ga0182008_101457242 161
257 3300014497 Ga0182008_10362177 Ga0182008_103621771 161
258 3300015261 Ga0182006_1000112 Ga0182006_100011224 161
259 3300015261 Ga0182006_1050940 Ga0182006_10509403 161
260 3300015262 Ga0182007_10000020 Ga0182007_1000002082 161
261 3300015262 Ga0182007_10024254 Ga0182007_100242542 161
262 3300015265 Ga0182005_1000001 Ga0182005_100000183 161
263 3300015265 Ga0182005_1053401 Ga0182005_10534011 161
264 3300016635 Ga0183361_10012 Ga0183361_1001238 161
265 3300017792 Ga0163161_10039155 Ga0163161_100391552 161
266 3300020076 Ga0206355_1360317 Ga0206355_13603171 161
267 3300020080 Ga0206350_10320270 Ga0206350_103202701 161
268 3300020080 Ga0206350_11216288 Ga0206350_112162881 161
269 3300020081 Ga0206354_10473152 Ga0206354_104731522 161
270 3300022467 Ga0224712_10137122 Ga0224712_101371222 161
271 3300025228 Ga0209672_100038 Ga0209672_100038167 161
272 3300025228 Ga0209672_100952 Ga0209672_1009526 161
273 3300025229 Ga0209147_100259 Ga0209147_10025911 161
274 3300025242 Ga0209258_100109 Ga0209258_1001099 161
275 3300025254 Ga0209148_1000844 Ga0209148_10008449 161
276 3300025256 Ga0209759_1005558 Ga0209759_10055584 161
277 3300025256 Ga0209759_1015976 Ga0209759_10159762 161
278 3300025263 Ga0209565_1000174 Ga0209565_10001746 161
279 3300025263 Ga0209565_1002133 Ga0209565_10021335 161
280 3300025272 Ga0209455_1004560 Ga0209455_10045603 161
281 3300025273 Ga0209673_1015157 Ga0209673_10151574 161
282 3300025284 Ga0209130_1007122 Ga0209130_10071223 161
283 3300025291 Ga0209675_1000100 Ga0209675_100010047 161
284 3300025291 Ga0209675_1004980 Ga0209675_10049805 161
285 3300025291 Ga0209675_1005120 Ga0209675_10051205 161
286 3300025292 Ga0209676_1000141 Ga0209676_100014112 161
287 3300025294 Ga0209025_1000390 Ga0209025_10003909 161
288 3300025294 Ga0209025_1000755 Ga0209025_100075512 161
289 3300025294 Ga0209025_1001457 Ga0209025_100145710 161
290 3300025294 Ga0209025_1019891 Ga0209025_10198912 161
291 3300025295 Ga0209564_1001462 Ga0209564_10014626 161
292 3300025295 Ga0209564_1003294 Ga0209564_10032946 161
293 3300025295 Ga0209564_1011309 Ga0209564_10113095 161
294 3300025299 Ga0209256_1000434 Ga0209256_100043417 161
295 3300025299 Ga0209256_1001596 Ga0209256_100159612 161
296 3300025302 Ga0207426_1000037 Ga0207426_1000037173 161
297 3300025302 Ga0207426_1001791 Ga0207426_100179115 161
298 3300025303 Ga0209051_1004798 Ga0209051_10047983 161
299 3300025303 Ga0209051_1049645 Ga0209051_10496452 161
300 3300025711 Ga0207696_1005177 Ga0207696_10051772 161
301 3300025728 Ga0207655_1068552 Ga0207655_10685522 161
302 3300025735 Ga0207713_1002908 Ga0207713_10029089 161
303 3300025903 Ga0207680_10317563 Ga0207680_103175632 161
304 3300025903 Ga0207680_11089891 Ga0207680_110898911 161
305 3300025904 Ga0207647_10000608 Ga0207647_1000060821 161
306 3300025904 Ga0207647_10003231 Ga0207647_100032318 161
307 3300025904 Ga0207647_10022621 Ga0207647_100226215 161
308 3300025913 Ga0207695_10110658 Ga0207695_101106583 161
309 3300025913 Ga0207695_10128123 Ga0207695_101281231 161
310 3300025913 Ga0207695_10366880 Ga0207695_103668801 161
311 3300025913 Ga0207695_11313531 Ga0207695_113135311 161
312 3300025914 Ga0207671_10080640 Ga0207671_100806402 161
313 3300025914 Ga0207671_10183593 Ga0207671_101835931 161
314 3300025914 Ga0207671_10185055 Ga0207671_101850553 161
315 3300025919 Ga0207657_10000051 Ga0207657_1000005148 161
316 3300025919 Ga0207657_10000131 Ga0207657_100001312 161
317 3300025920 Ga0207649_10045441 Ga0207649_100454413 161
318 3300025924 Ga0207694_10165073 Ga0207694_101650732 161
319 3300025932 Ga0207690_10000034 Ga0207690_1000003483 161
320 3300025933 Ga0207706_10467047 Ga0207706_104670471 161
321 3300025941 Ga0207711_10047482 Ga0207711_100474822 161
322 3300025949 Ga0207667_10037973 Ga0207667_100379731 161
323 3300025949 Ga0207667_10039101 Ga0207667_100391014 161
324 3300026067 Ga0207678_10001810 Ga0207678_100018106 161
325 3300026067 Ga0207678_10069274 Ga0207678_100692741 161
326 3300027666 Ga0209282_1000063 Ga0209282_100006351 161
327 3300028379 Ga0268266_10083192 Ga0268266_100831922 161
328 3300028379 Ga0268266_10408931 Ga0268266_104089312 161
329 3300028800 Ga0265338_10000113 Ga0265338_1000011364 161
330 3300035171 Ga0373946_0060798 Ga0373946_0060798_1020_1511 161
331 3300036401 Ga0373937_0124447 Ga0373937_0124447_1849_2340 161
332 3300037312 Ga0395899_0058642 Ga0395899_0058642_10_498 161
333 3300037312 Ga0395899_0404001 Ga0395899_0404001_361_849 161
334 3300037418 Ga0395900_0002362 Ga0395900_0002362_8105_8593 161
335 3300037418 Ga0395900_0065798 Ga0395900_0065798_2531_3019 161
336 3300037418 Ga0395900_0206106 Ga0395900_0206106_975_1463 161
337 3300037466 Ga0395898_0000792 Ga0395898_0000792_50311_50799 161
338 3300037466 Ga0395898_0006662 Ga0395898_0006662_1182_1670 161
339 3300037466 Ga0395898_0020242 Ga0395898_0020242_782_1270 161
340 3300037466 Ga0395898_0232430 Ga0395898_0232430_507_995 161
341 3300037471 Ga0395905_0005540 Ga0395905_0005540_928_1416 161
342 3300037471 Ga0395905_0899359 Ga0395905_0899359_278_763 161
343 3300038443 Ga0395901_0000003 Ga0395901_0000003_514940_515428 161
344 3300038443 Ga0395901_0000180 Ga0395901_0000180_57202_57690 161
345 3300038443 Ga0395901_0000887 Ga0395901_0000887_24162_24650 161
346 3300038443 Ga0395901_0518996 Ga0395901_0518996_245_733 161
347 3300038705 Ga0237819_06728 Ga0237819_06728_63_554 161
348 3300038705 Ga0237819_12094 Ga0237819_12094_504_995 161
349 3300039438 Ga0436360_0491784 Ga0436360_0491784_280_768 161
350 3300039447 Ga0436361_1043697 Ga0436361_1043697_315_803 161
351 3300041443 Ga0451789_1261723 Ga0451789_1261723_82_579 161
352 3300044656 Ga0466969_0089520 Ga0466969_0089520_298_786 161
353 3300044658 Ga0466972_0079611 Ga0466972_0079611_175_663 161
354 3300044658 Ga0466972_0183867 Ga0466972_0183867_255_743 161
355 3300044672 Ga0466982_0098412 Ga0466982_0098412_1017_1505 161
356 3300044683 Ga0466965_0006639 Ga0466965_0006639_4722_5210 161
357 3300044683 Ga0466965_0472365 Ga0466965_0472365_82_570 161
358 3300044684 Ga0466966_0005778 Ga0466966_0005778_5081_5569 161
359 3300044684 Ga0466966_0014130 Ga0466966_0014130_2763_3251 161
360 3300044693 Ga0466961_0005254 Ga0466961_0005254_6374_6862 161
361 3300044693 Ga0466961_0233516 Ga0466961_0233516_388_876 161
362 3300044694 Ga0466963_0425991 Ga0466963_0425991_77_565 161
363 3300044694 Ga0466963_0638606 Ga0466963_0638606_192_680 161
364 3300044706 Ga0466964_0373505 Ga0466964_0373505_188_676 161
365 3300044719 Ga0466971_0015018 Ga0466971_0015018_1517_2005 161
366 3300044719 Ga0466971_0018548 Ga0466971_0018548_50_538 161
367 3300044735 Ga0466968_0006354 Ga0466968_0006354_2436_2924 161
368 3300044765 Ga0466970_0025169 Ga0466970_0025169_2471_2959 161
369 3300044765 Ga0466970_0210398 Ga0466970_0210398_245_733 161
370 3300044842 Ga0466957_0020806 Ga0466957_0020806_3294_3782 161
371 3300044842 Ga0466957_0144345 Ga0466957_0144345_654_1142 161
372 3300044842 Ga0466957_0615036 Ga0466957_0615036_209_697 161
373 3300044901 Ga0466960_0495089 Ga0466960_0495089_70_558 161
374 3300045049 Ga0466959_0013608 Ga0466959_0013608_4165_4653 161
375 3300045049 Ga0466959_0217894 Ga0466959_0217894_446_934 161
376 3300045049 Ga0466959_0262441 Ga0466959_0262441_374_862 161
377 3300045836 Ga0466958_0010813 Ga0466958_0010813_451_939 161
378 3300045836 Ga0466958_0213495 Ga0466958_0213495_334_822 161
379 3300045836 Ga0466958_0477196 Ga0466958_0477196_138_626 161
380 3300046455 Ga0495603_0004003 Ga0495603_0004003_2028_2516 161
381 3300046457 Ga0495590_0043053 Ga0495590_0043053_400_888 161
382 3300046459 Ga0495629_0001732 Ga0495629_0001732_11878_12366 161
383 3300046460 Ga0495638_0097173 Ga0495638_0097173_901_1389 161
384 3300046463 Ga0495653_0287634 Ga0495653_0287634_151_639 161
385 3300046471 Ga0495650_0002944 Ga0495650_0002944_6233_6721 161
386 3300046471 Ga0495650_0256486 Ga0495650_0256486_21_512 161
387 3300046472 Ga0495580_0029510 Ga0495580_0029510_1855_2343 161
388 3300046474 Ga0495605_0003621 Ga0495605_0003621_8084_8569 161
389 3300046474 Ga0495605_0005538 Ga0495605_0005538_1503_1991 161
390 3300046474 Ga0495605_0054550 Ga0495605_0054550_490_978 161
391 3300046475 Ga0495639_0290183 Ga0495639_0290183_201_689 161
392 3300046476 Ga0495662_0060546 Ga0495662_0060546_1095_1583 161
393 3300046477 Ga0495664_0049255 Ga0495664_0049255_1949_2440 161
394 3300046477 Ga0495664_0128081 Ga0495664_0128081_35_523 161
395 3300046477 Ga0495664_0263450 Ga0495664_0263450_28_516 161
396 3300046491 Ga0495584_0079048 Ga0495584_0079048_1120_1608 161
397 3300046500 Ga0495596_0000845 Ga0495596_0000845_16982_17467 161
398 3300046500 Ga0495596_0073129 Ga0495596_0073129_406_894 161
399 3300046501 Ga0495607_0016273 Ga0495607_0016273_883_1368 161
400 3300046506 Ga0495583_0023424 Ga0495583_0023424_1759_2247 161
401 3300046506 Ga0495583_0038920 Ga0495583_0038920_1339_1827 161
402 3300046511 Ga0495608_0151115 Ga0495608_0151115_182_670 161
403 3300046512 Ga0495610_0003098 Ga0495610_0003098_9054_9539 161
404 3300046513 Ga0495616_0008782 Ga0495616_0008782_2136_2621 161
405 3300046513 Ga0495616_0053497 Ga0495616_0053497_193_681 161
406 3300046516 Ga0495628_0439791 Ga0495628_0439791_350_841 161
407 3300046517 Ga0495630_0457182 Ga0495630_0457182_228_716 161
408 3300046523 Ga0495644_0046337 Ga0495644_0046337_485_973 161
409 3300046524 Ga0495648_0018991 Ga0495648_0018991_3401_3889 161
410 3300046524 Ga0495648_0031046 Ga0495648_0031046_2088_2573 161
411 3300046526 Ga0495666_0206526 Ga0495666_0206526_136_624 161
412 3300046528 Ga0495642_0052992 Ga0495642_0052992_1019_1507 161
413 3300046529 Ga0495652_0144710 Ga0495652_0144710_1363_1851 161
414 3300046530 Ga0495654_0145764 Ga0495654_0145764_103_591 161
415 3300046531 Ga0495665_0109733 Ga0495665_0109733_852_1340 161
416 3300046535 Ga0495586_0130486 Ga0495586_0130486_366_854 161
417 3300046538 Ga0495609_0007032 Ga0495609_0007032_4249_4734 161
418 3300046542 Ga0495597_0084452 Ga0495597_0084452_172_657 161
419 3300046542 Ga0495597_0348533 Ga0495597_0348533_36_524 161
420 3300046543 Ga0495645_0006241 Ga0495645_0006241_7211_7699 161
421 3300046543 Ga0495645_0011392 Ga0495645_0011392_2037_2525 161
422 3300046559 Ga0495667_0037279 Ga0495667_0037279_451_939 161
423 3300046615 Ga0495656_0056546 Ga0495656_0056546_624_1112 161
424 3300046616 Ga0495668_0257076 Ga0495668_0257076_389_877 161
425 3300046660 Ga0495625_0295868 Ga0495625_0295868_243_731 161
426 3300046660 Ga0495625_0534536 Ga0495625_0534536_159_647 161
427 3300046665 Ga0495661_0017791 Ga0495661_0017791_2966_3451 161
428 3300046665 Ga0495661_0146552 Ga0495661_0146552_694_1182 161
429 3300046684 Ga0495669_0029127 Ga0495669_0029127_1463_1951 161
430 3300046684 Ga0495669_0037002 Ga0495669_0037002_1544_2032 161
431 3300046684 Ga0495669_0379476 Ga0495669_0379476_14_502 161
432 3300046692 Ga0495671_0002939 Ga0495671_0002939_6888_7373 161
433 3300046694 Ga0495649_0106031 Ga0495649_0106031_561_1049 161
434 3300046694 Ga0495649_0428173 Ga0495649_0428173_104_592 161
435 3300046794 Ga0495589_0016255 Ga0495589_0016255_2778_3266 161
436 3300046809 Ga0495600_0324606 Ga0495600_0324606_259_747 161
437 3300046810 Ga0495660_0206382 Ga0495660_0206382_362_850 161
438 3300047317 Ga0495604_0169175 Ga0495604_0169175_891_1376 161
439 3300047319 Ga0495674_0029256 Ga0495674_0029256_858_1349 161
440 3300047320 Ga0495672_0002512 Ga0495672_0002512_14140_14631 161
441 3300047320 Ga0495672_0082399 Ga0495672_0082399_854_1339 161
442 3300047323 Ga0495683_0265441 Ga0495683_0265441_161_649 161
443 3300047443 Ga0495687_112097 Ga0495687_112097_212_700 161
444 3300047445 Ga0495677_0051940 Ga0495677_0051940_65_553 161
445 3300047445 Ga0495677_0285580 Ga0495677_0285580_43_531 161
446 3300047446 Ga0495679_015535 Ga0495679_015535_302_790 161
447 3300047447 Ga0495685_079015 Ga0495685_079015_445_930 161
448 3300047469 Ga0495673_0243281 Ga0495673_0243281_37_528 161
449 3300047472 Ga0495686_0000014 Ga0495686_0000014_298698_299189 161
450 3300048091 Ga0495626_0098337 Ga0495626_0098337_450_938 161
451 3300048903 Ga0496100_0008832 Ga0496100_0008832_306_794 161
452 3300048903 Ga0496100_0016348 Ga0496100_0016348_1922_2410 161
453 3300048903 Ga0496100_0084267 Ga0496100_0084267_482_970 161
454 3300048903 Ga0496100_0222420 Ga0496100_0222420_357_845 161
455 3300048903 Ga0496100_0671933 Ga0496100_0671933_206_694 161
456 3300048904 Ga0496101_0031993 Ga0496101_0031993_1902_2390 161
457 3300048904 Ga0496101_0165145 Ga0496101_0165145_335_823 161
458 3300048904 Ga0496101_0238008 Ga0496101_0238008_858_1346 161
459 3300048905 Ga0496102_0000661 Ga0496102_0000661_23668_24156 161
460 3300048905 Ga0496102_0444801 Ga0496102_0444801_385_873 161
461 3300048905 Ga0496102_0901743 Ga0496102_0901743_286_774 161
462 3300048906 Ga0496103_0001616 Ga0496103_0001616_1141_1629 161
463 3300048906 Ga0496103_0309620 Ga0496103_0309620_518_1006 161
464 3300048907 Ga0496104_0080317 Ga0496104_0080317_430_918 161
465 3300048907 Ga0496104_0154788 Ga0496104_0154788_1169_1657 161
466 3300048907 Ga0496104_0232015 Ga0496104_0232015_917_1405 161
467 3300048907 Ga0496104_0927386 Ga0496104_0927386_269_757 161
468 3300048908 Ga0496105_0035791 Ga0496105_0035791_1468_1956 161
469 3300048908 Ga0496105_0314136 Ga0496105_0314136_645_1133 161
470 3300048909 Ga0496106_0358611 Ga0496106_0358611_25_513 161
471 3300048910 Ga0496107_0010382 Ga0496107_0010382_1171_1659 161
472 3300048910 Ga0496107_0565826 Ga0496107_0565826_138_626 161
473 3300048911 Ga0496108_0227400 Ga0496108_0227400_896_1384 161
474 3300048912 Ga0496109_0159185 Ga0496109_0159185_1591_2079 161
475 3300048914 Ga0496111_0060848 Ga0496111_0060848_1740_2237 161
476 3300048916 Ga0496113_0038038 Ga0496113_0038038_466_954 161
477 3300048917 Ga0496114_0005374 Ga0496114_0005374_7046_7534 161
478 3300048918 Ga0496115_0257785 Ga0496115_0257785_822_1310 161
479 3300048918 Ga0496115_0886841 Ga0496115_0886841_159_647 161
480 3300048919 Ga0496116_0009836 Ga0496116_0009836_7130_7627 161
481 3300048919 Ga0496116_0017083 Ga0496116_0017083_907_1392 161
482 3300048919 Ga0496116_0021038 Ga0496116_0021038_4038_4523 161
483 3300048920 Ga0496117_0000094 Ga0496117_0000094_162785_163282 161
484 3300048920 Ga0496117_0020755 Ga0496117_0020755_4813_5301 161
485 3300048920 Ga0496117_0055517 Ga0496117_0055517_1755_2243 161
486 3300048920 Ga0496117_0260800 Ga0496117_0260800_411_899 161
487 3300048921 Ga0496118_0000071 Ga0496118_0000071_162785_163282 161
488 3300048921 Ga0496118_0002811 Ga0496118_0002811_22126_22614 161
489 3300048921 Ga0496118_0118494 Ga0496118_0118494_624_1112 161
490 3300048922 Ga0496119_0075970 Ga0496119_0075970_1168_1656 161
491 3300048922 Ga0496119_0307617 Ga0496119_0307617_66_563 161
492 3300048922 Ga0496119_0322061 Ga0496119_0322061_228_716 161
493 3300048923 Ga0496120_0240147 Ga0496120_0240147_326_814 161
494 3300048924 Ga0496121_0016109 Ga0496121_0016109_3331_3828 161
495 3300048924 Ga0496121_0017999 Ga0496121_0017999_1796_2284 161
496 3300048924 Ga0496121_0027352 Ga0496121_0027352_1030_1515 161
497 3300048924 Ga0496121_0093918 Ga0496121_0093918_1796_2284 161
498 3300048924 Ga0496121_0406748 Ga0496121_0406748_358_846 161
499 3300048924 Ga0496121_0610862 Ga0496121_0610862_34_522 161
500 3300048925 Ga0496122_0003123 Ga0496122_0003123_1975_2472 161
501 3300048925 Ga0496122_0021375 Ga0496122_0021375_4464_4949 161
502 3300048925 Ga0496122_0058759 Ga0496122_0058759_178_666 161
503 3300048925 Ga0496122_0147471 Ga0496122_0147471_301_789 161
504 3300048926 Ga0496123_0004461 Ga0496123_0004461_9087_9584 161
505 3300048926 Ga0496123_0005043 Ga0496123_0005043_903_1388 161
506 3300048926 Ga0496123_0077630 Ga0496123_0077630_133_621 161
507 3300048926 Ga0496123_0140910 Ga0496123_0140910_211_699 161
508 3300048927 Ga0496124_0226582 Ga0496124_0226582_287_775 161
509 3300048927 Ga0496124_0230176 Ga0496124_0230176_620_1117 161
510 3300048928 Ga0496125_0109846 Ga0496125_0109846_451_948 161
511 3300048928 Ga0496125_0277511 Ga0496125_0277511_221_709 161
512 3300048929 Ga0496126_0004283 Ga0496126_0004283_4707_5195 161
513 3300048929 Ga0496126_0175701 Ga0496126_0175701_214_702 161
514 3300048929 Ga0496126_0396279 Ga0496126_0396279_120_617 161
515 3300049459 Ga0495678_092518 Ga0495678_092518_290_778 161
516 3300049460 Ga0495682_0003624 Ga0495682_0003624_534_1022 161
517 3300049571 Ga0501034_0001676 Ga0501034_0001676_22608_23093 161
518 3300049571 Ga0501034_0903086 Ga0501034_0903086_11_514 161
519 3300049573 Ga0501037_0322356 Ga0501037_0322356_52_555 161
520 3300049742 Ga0501080_1375150 Ga0501080_1375150_22_525 161
521 3300049822 Ga0501035_0318047 Ga0501035_0318047_628_1131 161
522 3300061719 Ga0466962_0029794 Ga0466962_0029794_490_978 161
523 3300003751 Ga0055538_1000010 Ga0055538_100001073 162
524 3300003752 Ga0055539_1000015 Ga0055539_100001573 162
525 3300003756 Ga0055533_1000018 Ga0055533_100001873 162
526 3300003759 Ga0055525_1000020 Ga0055525_100002073 162
527 3300003841 Ga0055541_1000011 Ga0055541_100001173 162
528 3300005563 Ga0068855_100000763 Ga0068855_10000076315 162
529 3300005563 Ga0068855_101196260 Ga0068855_1011962601 162
530 3300005577 Ga0068857_100083556 Ga0068857_1000835563 162
531 3300005578 Ga0068854_100004210 Ga0068854_1000042103 162
532 3300005614 Ga0068856_100327497 Ga0068856_1003274972 162
533 3300005834 Ga0068851_10174315 Ga0068851_101743151 162
534 3300006946 Ga0079104_1003995 Ga0079104_10039956 162
535 3300009036 Ga0105244_10031581 Ga0105244_100315814 162
536 3300009093 Ga0105240_10062072 Ga0105240_100620721 162
537 3300009093 Ga0105240_10984954 Ga0105240_109849542 162
538 3300009545 Ga0105237_10023983 Ga0105237_100239836 162
539 3300009545 Ga0105237_10093311 Ga0105237_100933113 162
540 3300009551 Ga0105238_10000004 Ga0105238_10000004144 162
541 3300010375 Ga0105239_10002820 Ga0105239_1000282015 162
542 3300021361 Ga0213872_10008589 Ga0213872_100085892 162
543 3300021361 Ga0213872_10132756 Ga0213872_101327562 162
544 3300025224 Ga0209784_100025 Ga0209784_10002573 162
545 3300025225 Ga0209566_100025 Ga0209566_10002573 162
546 3300025226 Ga0209674_100042 Ga0209674_10004273 162
547 3300025230 Ga0209563_100046 Ga0209563_10004673 162
548 3300025253 Ga0209677_100027 Ga0209677_10002773 162
549 3300025321 Ga0207656_10160428 Ga0207656_101604281 162
550 3300025913 Ga0207695_10001007 Ga0207695_1000100724 162
551 3300025914 Ga0207671_10002362 Ga0207671_100023622 162
552 3300025914 Ga0207671_10092086 Ga0207671_100920862 162
553 3300025924 Ga0207694_10000021 Ga0207694_1000002162 162
554 3300025949 Ga0207667_10000235 Ga0207667_1000023544 162
555 3300025981 Ga0207640_10009807 Ga0207640_100098071 162
556 3300026116 Ga0207674_10099524 Ga0207674_100995243 162
557 3300027111 Ga0209281_1003252 Ga0209281_10032524 162
558 3300028800 Ga0265338_10119274 Ga0265338_101192742 162
559 3300037312 Ga0395899_0022113 Ga0395899_0022113_102_593 162
560 3300039447 Ga0436361_0321406 Ga0436361_0321406_3845_4339 162
561 3300039447 Ga0436361_0633092 Ga0436361_0633092_433_933 162
562 3300042006 Ga0439432_047114 Ga0439432_047114_703_1293 162
563 3300047318 Ga0495636_0517716 Ga0495636_0517716_79_567 162
564 3300048925 Ga0496122_0001303 Ga0496122_0001303_22076_22624 162
565 3300049569 Ga0501032_0439606 Ga0501032_0439606_312_824 162
566 3300049581 Ga0501047_0004231 Ga0501047_0004231_7810_8322 162
567 3300049590 Ga0501074_0101267 Ga0501074_0101267_1462_1974 162
568 3300049742 Ga0501080_0103747 Ga0501080_0103747_1683_2195 162
569 3300049822 Ga0501035_0040498 Ga0501035_0040498_2352_2864 162
570 3300049823 Ga0501044_0014793 Ga0501044_0014793_4313_4825 162
571 3300053125 Ga0500618_006459 Ga0500618_006459_1107_1601 162
572 3300053148 Ga0500590_090625 Ga0500590_090625_788_1297 162
573 3300059423 Ga0590074_000395 Ga0590074_000395_3517_4011 162
574 3300059424 Ga0590075_002071 Ga0590075_002071_2989_3483 162
575 3300059426 Ga0590077_000266 Ga0590077_000266_2778_3272 162
576 3300048913 Ga0496110_0000055 Ga0496110_0000055_9158_9655 165
577 3300046615 Ga0495656_0034494 Ga0495656_0034494_1270_1770 166
578 3300047318 Ga0495636_0002527 Ga0495636_0002527_4499_4999 166
579 3300059493 Ga0587077_043152 Ga0587077_043152_281_799 170
580 3300059507 Ga0587086_011045 Ga0587086_011045_281_799 170
581 3300059509 Ga0587089_020444 Ga0587089_020444_281_799 170
582 3300059510 Ga0587090_039129 Ga0587090_039129_281_799 170
583 3300059511 Ga0587091_057690 Ga0587091_057690_27_545 170
584 3300059624 Ga0587109_039592 Ga0587109_039592_131_649 170
585 3300059626 Ga0587115_027978 Ga0587115_027978_27_545 170
586 3300060245 Ga0587065_03325 Ga0587065_03325_281_799 170
587 3300060246 Ga0587081_03844 Ga0587081_03844_281_799 170
588 3300009093 Ga0105240_10030539 Ga0105240_100305392 176
589 3300009545 Ga0105237_10439810 Ga0105237_104398101 176
590 3300013104 Ga0157370_10004029 Ga0157370_1000402911 176
591 3300044683 Ga0466965_0189943 Ga0466965_0189943_215_754 176
592 3300044901 Ga0466960_0367037 Ga0466960_0367037_220_759 176
593 3300046463 Ga0495653_0118852 Ga0495653_0118852_1038_1574 176
594 3300046477 Ga0495664_0110828 Ga0495664_0110828_956_1492 176
595 3300046507 Ga0495606_0004958 Ga0495606_0004958_5871_6410 176
596 3300046507 Ga0495606_0131355 Ga0495606_0131355_550_1086 176
597 3300046507 Ga0495606_0419774 Ga0495606_0419774_137_673 176
598 3300046516 Ga0495628_0083791 Ga0495628_0083791_319_855 176
599 3300046531 Ga0495665_0119025 Ga0495665_0119025_301_837 176
600 3300046535 Ga0495586_0243564 Ga0495586_0243564_157_693 176
601 3300046679 Ga0495623_0015772 Ga0495623_0015772_3044_3580 176
602 3300046680 Ga0495646_0188776 Ga0495646_0188776_177_713 176
603 3300046690 Ga0495624_0084242 Ga0495624_0084242_923_1459 176
604 3300046692 Ga0495671_0355838 Ga0495671_0355838_25_564 176
605 3300046694 Ga0495649_0021267 Ga0495649_0021267_206_745 176
606 3300046794 Ga0495589_0066572 Ga0495589_0066572_739_1278 176
607 3300046809 Ga0495600_0246466 Ga0495600_0246466_483_1019 176
608 3300047317 Ga0495604_0439836 Ga0495604_0439836_150_686 176
609 3300047319 Ga0495674_0197177 Ga0495674_0197177_995_1531 176
610 3300047323 Ga0495683_0027196 Ga0495683_0027196_1383_1922 176
611 3300047673 Ga0495593_0110149 Ga0495593_0110149_818_1354 176
612 3300048088 Ga0495602_0107177 Ga0495602_0107177_429_965 176
613 3300048903 Ga0496100_0749940 Ga0496100_0749940_140_676 176
614 3300048904 Ga0496101_0111761 Ga0496101_0111761_365_901 176
615 3300048905 Ga0496102_0079999 Ga0496102_0079999_1328_1864 176
616 3300048905 Ga0496102_0142680 Ga0496102_0142680_1328_1864 176
617 3300048908 Ga0496105_0272444 Ga0496105_0272444_699_1235 176
618 3300005289 Ga0065704_10070139 Ga0065704_10070139102 187
619 2162886007 SwRhRL2b_contig_3111171 SwRhRL2b_0976.00001320 193

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00210

Ferritin

Ferritin-like domain

22

164

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ff9-assembly1.cif.gz_B crystal structure of apo dps protein (pa0962) from pseudomonas aeruginosa (orthorhombic form) 0.9878 39 193
8ff9-assembly1.cif.gz_B crystal structure of apo dps protein (pa0962) from pseudomonas aeruginosa (orthorhombic form) 0.9753 39 193
1jig-assembly1.cif.gz_A dlp-2 from bacillus anthracis 0.9625 50 193
2d5k-assembly1.cif.gz_B crystal structure of dps from staphylococcus aureus 0.961 51 193
6lkp-assembly1.cif.gz_F-2 crystal structure of dps1 from the thermophilic non-heterocystous filamentous cyanobacterium thermoleptolyngbya sp. o-77 0.959 41 193
ID Description Score Start End Superfamily
2d5kD00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9601 49 193 1.20.1260.10
1ji5D00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9582 53 193 1.20.1260.10
4cybA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9576 39 193 1.20.1260.10
2xgwA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9557 49 191 1.20.1260.10
1n1qA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9528 45 193 1.20.1260.10
ID Description Score Start End GO Terms
AF-A0A0S8F4Y2-F1-model_v4 Ferritin 0.9976 39 193 GO:0008199
GO:0016722
AF-A0A329P5B3-F1-model_v4 deleted 0.9964 39 178
AF-A0A6M0AMB4-F1-model_v4 DNA starvation/stationary phase protection protein 0.9961 45 163 GO:0008199
GO:0016722
AF-M6KP73-F1-model_v4 Ferritin-like protein 0.9946 58 193 GO:0008199
GO:0016722
AF-A0A0S8B9K7-F1-model_v4 Ferritin 0.9945 41 193 GO:0008199
GO:0016722

Feature Viewer

pLDDT pTM Quality
87.99 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map