F469260

General Info

Members Datasets Scaffolds Average Seq Length
613 359 1226 239

Family's Representative Sequence

Representative Sequence 3300025913|Ga0207695_10045170|Ga0207695_100451705
Length 281
Sequence VTLVSQAGQAMMLDHPAARAAANHVLHLAAAPGFVAPGPNDFDLRSVFYTNNVWLTKASLLLVLSFFIIVIAFRASIRKADVVPGKFQYAGEAAYGFVRDGIARDMIGERDFKRYVPLLVAMFYFVLVNNLFGLVPFLQFPSFARAGFAYGLAGMVWIIYNGIGMARKGPLGYLKHQTVPGGVPPWILLEFLSNIIIRPITLALRLFANMFAGHLLLLLFAGGADYLLIHAQGPLVKPGGVLSFGMGFMVGFLELLVEVLQAYVFTLLTASYISGAIADEH

Samples

Sample ID Description Type Environment
1 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
8 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
9 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
10 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
11 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
28 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
29 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
30 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
31 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
38 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
54 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
55 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
59 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300023438 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.stcc Metatranscriptome Rhizosphere
64 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
66 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
67 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
90 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
92 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
93 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
94 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
95 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
96 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
97 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
98 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
99 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
100 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
101 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
102 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
103 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
104 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
105 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
106 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
107 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
108 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
109 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
110 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
111 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
112 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
113 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
114 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
115 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
116 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
117 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
118 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
119 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
120 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
121 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
122 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
123 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
124 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
125 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
126 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
127 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
128 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
129 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
130 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
131 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
132 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
133 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
134 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
135 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
136 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
137 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
138 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
139 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
140 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
141 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
142 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
143 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
144 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
145 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
146 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
147 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
148 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
149 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
150 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
151 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
152 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
153 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
154 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
155 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
156 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
157 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
158 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
159 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
160 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
161 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
162 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
163 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
164 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
165 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
166 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
167 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
168 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
169 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
170 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
171 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
172 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
173 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
174 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
175 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
176 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
177 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
178 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
179 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
180 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
181 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
182 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
183 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
184 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
185 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
186 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
187 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
188 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
189 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
190 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
191 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
192 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
193 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
194 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
195 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300049133 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300049134 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300049543 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300049545 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300049547 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300049548 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300049554 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
244 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
245 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
246 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
247 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
248 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
249 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
250 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
251 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
252 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
253 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
254 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
255 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
256 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
257 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
259 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
260 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
261 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
262 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
263 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
264 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
265 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
266 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
267 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
268 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
269 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
270 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
271 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
272 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
273 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
274 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
275 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
276 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
277 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
278 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
279 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
280 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
281 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
282 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
283 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
284 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
285 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
286 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
287 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
288 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
289 3300059609 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 227R_SD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
290 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
291 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
292 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
293 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
294 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
295 3300059631 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
296 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
297 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
298 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
299 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
300 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
301 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
302 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
303 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
304 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
305 3300059650 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 69R_SD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
306 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
307 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
308 3300059657 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 156R_AW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
309 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
310 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
311 3300060243 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 1R_CW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
312 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
313 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
314 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
315 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
316 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
317 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
318 2643221604 Nocardioides sp. Root190 Isolate Unclassified
319 2643221641 Nocardioides sp. Root122 Isolate Unclassified
320 2643221711 Terrabacter sp. Root85 Isolate Unclassified
321 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
322 2739367898 Nocardioides sp. CF479 Isolate Unclassified
323 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
324 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
325 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
326 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
327 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
328 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
329 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
330 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
331 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
332 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
333 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
334 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
335 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
336 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
337 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
338 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
339 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
340 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
341 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
342 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
343 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
344 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
345 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
346 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
347 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
348 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
349 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
350 2946024296 Arthrobacter woluwensis W4I2 Isolate Rhizosphere
351 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
352 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
353 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
354 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
355 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
356 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
357 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere
358 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule
359 8056054917 Glycomyces luteolus NEAU-A15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 59.87
Metatranscriptomes 32.79
Isolates 7.34

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.61
Nodule 0.16
Rhizoplane 5.06
Rhizosphere 86.3
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207695_10045170 3300025913 Bacteria 4679
2 JGI24740J21852_10008668 3300001979 Bacteria 4036
3 JGI24740J21852_10039999 3300001979 Bacteria 1425
4 JGI24739J22299_10020615 3300001989 Bacteria 2354
5 JGI24737J22298_10009344 3300001990 Bacteria 3265
6 rootH1_10142602 3300003316 Bacteria 2633
7 rootL2_10053942 3300003322 Bacteria 12225
8 Ga0006562J51391_1012297 3300003578 Bacteria 3582
9 Ga0006562J51391_1043916 3300003578 Bacteria 1815
10 Ga0055542_1002924 3300003762 Bacteria 5034
11 Ga0055540_1016886 3300003792 Bacteria 2056
12 Ga0058860_12209293 3300004801 Bacteria 3006
13 Ga0065714_10121544 3300005288 Bacteria 1340
14 Ga0065712_10182123 3300005290 Bacteria 1170
15 Ga0070670_100120636 3300005331 Bacteria 2262
16 Ga0070677_10009883 3300005333 Bacteria 3249
17 Ga0070666_10104650 3300005335 Bacteria 1954
18 Ga0070669_100013533 3300005353 Bacteria 5799
19 Ga0070671_100008922 3300005355 Bacteria 8046
20 Ga0070674_100274620 3300005356 Bacteria 1334
21 Ga0070674_100294522 3300005356 Bacteria 1291
22 Ga0070673_100080821 3300005364 Bacteria 2634
23 Ga0070667_100007806 3300005367 Bacteria 8873
24 Ga0070678_100046046 3300005456 Bacteria 3125
25 Ga0070678_100062597 3300005456 Bacteria 2748
26 Ga0070678_100156550 3300005456 Bacteria 1841
27 Ga0068856_100180827 3300005614 Bacteria 2122
28 Ga0068859_100001140 3300005617 Bacteria 27061
29 Ga0068861_100529633 3300005719 Bacteria 1070
30 Ga0068858_100290220 3300005842 Bacteria 1559
31 Ga0081455_10038410 3300005937 Bacteria 4240
32 Ga0081538_10070061 3300005981 Bacteria 1938
33 Ga0081540_1055632 3300005983 Bacteria 1926
34 Ga0075365_10073130 3300006038 Bacteria 2310
35 Ga0075364_10026836 3300006051 Bacteria 3677
36 Ga0075432_10008799 3300006058 Bacteria 3445
37 Ga0075428_100006863 3300006844 Bacteria 12651
38 Ga0075428_100418972 3300006844 Bacteria 1435
39 Ga0075430_100004192 3300006846 Bacteria 12168
40 Ga0075431_100008746 3300006847 Bacteria 10143
41 Ga0075429_100004098 3300006880 Bacteria 12483
42 Ga0097620_100001140 3300006931 Bacteria 27061
43 Ga0105251_10089782 3300009011 Bacteria 1413
44 Ga0105244_10002819 3300009036 Bacteria 12897
45 Ga0105244_10102845 3300009036 Bacteria 1396
46 Ga0105244_10115705 3300009036 Bacteria 1302
47 Ga0105244_10130489 3300009036 Bacteria 1213
48 Ga0105240_10060407 3300009093 Bacteria 4725
49 Ga0105247_10019947 3300009101 Bacteria 4028
50 Ga0114129_10025186 3300009147 Bacteria 8432
51 Ga0114129_10111341 3300009147 Bacteria 3777
52 Ga0105243_10060271 3300009148 Bacteria 3031
53 Ga0105243_10084920 3300009148 Bacteria 2594
54 Ga0105248_10168115 3300009177 Bacteria 2472
55 Ga0105237_10006612 3300009545 Bacteria 12814
56 Ga0105238_10318038 3300009551 Bacteria 1542
57 Ga0105239_10039506 3300010375 Bacteria 5170
58 Ga0105239_10240958 3300010375 Bacteria 2030
59 Ga0105246_10004332 3300011119 Bacteria 8633
60 Ga0105246_10024371 3300011119 Bacteria 3931
61 Ga0105246_10075690 3300011119 Bacteria 2384
62 Ga0105246_10182777 3300011119 Bacteria 1616
63 Ga0157373_10012600 3300013100 Bacteria 6216
64 Ga0157373_10221172 3300013100 Bacteria 1336
65 Ga0157371_10005178 3300013102 Bacteria 11096
66 Ga0157371_10018271 3300013102 Bacteria 5187
67 Ga0157371_10481678 3300013102 Bacteria 915
68 Ga0157370_10016411 3300013104 Bacteria 7497
69 Ga0157370_10173016 3300013104 Bacteria 2007
70 Ga0157369_10240404 3300013105 Bacteria 1891
71 Ga0157372_10181842 3300013307 Bacteria 2434
72 Ga0157380_10124383 3300014326 Bacteria 2190
73 Ga0163161_10073380 3300017792 Bacteria 2507
74 Ga0197907_10041850 3300020069 Bacteria 1279
75 Ga0197907_10883299 3300020069 Bacteria 2272
76 Ga0197907_10921460 3300020069 Bacteria 1680
77 Ga0206356_11642392 3300020070 Bacteria 2340
78 Ga0206349_1149272 3300020075 Bacteria 1862
79 Ga0206349_1501613 3300020075 Bacteria 1752
80 Ga0206349_1523504 3300020075 Bacteria 1883
81 Ga0206349_1617487 3300020075 Bacteria 4234
82 Ga0206355_1209876 3300020076 Bacteria 2324
83 Ga0206355_1462619 3300020076 Bacteria 1207
84 Ga0206355_1645477 3300020076 Bacteria 1923
85 Ga0206355_1679439 3300020076 Bacteria 1138
86 Ga0206352_10018184 3300020078 Bacteria 1877
87 Ga0206350_11389734 3300020080 Bacteria 1175
88 Ga0206353_10001084 3300020082 Bacteria 1395
89 Ga0206353_11001418 3300020082 Bacteria 1771
90 Ga0224712_10087087 3300022467 Bacteria 1301
91 Ga0256720_141024 3300023438 Bacteria 1288
92 Ga0209148_1003798 3300025254 Bacteria 3962
93 Ga0209129_1000028 3300025258 Bacteria 405451
94 Ga0209025_1000112 3300025294 Bacteria 218958
95 Ga0209051_1002422 3300025303 Bacteria 13408
96 Ga0209051_1025638 3300025303 Bacteria 2393
97 Ga0207697_10003796 3300025315 Bacteria 7377
98 Ga0207655_1003724 3300025728 Bacteria 11198
99 Ga0207655_1005422 3300025728 Bacteria 8673
100 Ga0207655_1036397 3300025728 Bacteria 2183
101 Ga0207682_10006529 3300025893 Bacteria 4693
102 Ga0207682_10231952 3300025893 Bacteria 856
103 Ga0207710_10009691 3300025900 Bacteria 4048
104 Ga0207680_10016041 3300025903 Bacteria 3923
105 Ga0207647_10012992 3300025904 Bacteria 5784
106 Ga0207647_10040553 3300025904 Bacteria 2932
107 Ga0207645_10000942 3300025907 Bacteria 24175
108 Ga0207671_10020897 3300025914 Bacteria 4977
109 Ga0207681_10028062 3300025923 Bacteria 3644
110 Ga0207694_10164834 3300025924 Bacteria 1792
111 Ga0207659_10214258 3300025926 Bacteria 1545
112 Ga0207644_10025495 3300025931 Bacteria 4066
113 Ga0207709_10015059 3300025935 Bacteria 4283
114 Ga0207709_10099249 3300025935 Bacteria 1921
115 Ga0207669_10063795 3300025937 Bacteria 2276
116 Ga0207669_10197284 3300025937 Bacteria 1458
117 Ga0207691_10000527 3300025940 Bacteria 38169
118 Ga0207711_10160477 3300025941 Bacteria 2034
119 Ga0207651_10049192 3300025960 Bacteria 2855
120 Ga0207658_10003895 3300025986 Bacteria 10500
121 Ga0207658_10148048 3300025986 Bacteria 1909
122 Ga0207639_10167737 3300026041 Bacteria 1856
123 Ga0207683_10004866 3300026121 Bacteria 11556
124 Ga0209974_10008938 3300027876 Bacteria 3411
125 Ga0207428_10001932 3300027907 Bacteria 21004
126 Ga0207428_10120650 3300027907 Bacteria 2010
127 Ga0268266_10681680 3300028379 Bacteria 990
128 Ga0316181_1102513 3300030744 Bacteria 1662
129 Ga0316181_1173341 3300030744 Bacteria 2568
130 Ga0316181_1254166 3300030744 Bacteria 1480
131 Ga0316182_1156000 3300030745 Bacteria 1537
132 Ga0307513_10416796 3300031456 Bacteria 1074
133 Ga0307509_10463488 3300031507 Bacteria 959
134 Ga0307408_100022658 3300031548 Bacteria 4270
135 Ga0307408_100058737 3300031548 Bacteria 2797
136 Ga0307408_100061230 3300031548 Bacteria 2747
137 Ga0307408_100337469 3300031548 Bacteria 1274
138 Ga0307408_100373679 3300031548 Bacteria 1216
139 Ga0307405_10043363 3300031731 Bacteria 2744
140 Ga0307405_10058297 3300031731 Bacteria 2429
141 Ga0307405_10188428 3300031731 Bacteria 1487
142 Ga0307405_10195115 3300031731 Bacteria 1465
143 Ga0307413_10030191 3300031824 Bacteria 3042
144 Ga0307518_10219325 3300031838 Bacteria 1243
145 Ga0307410_10014648 3300031852 Bacteria 4622
146 Ga0307410_10046522 3300031852 Bacteria 2895
147 Ga0307410_10047562 3300031852 Bacteria 2867
148 Ga0307410_10049727 3300031852 Bacteria 2815
149 Ga0307410_10050622 3300031852 Bacteria 2794
150 Ga0307410_10312157 3300031852 Bacteria 1244
151 Ga0307406_10073271 3300031901 Bacteria 2251
152 Ga0307406_10111665 3300031901 Bacteria 1883
153 Ga0307406_10226513 3300031901 Bacteria 1393
154 Ga0307406_10302240 3300031901 Bacteria 1230
155 Ga0307406_10432736 3300031901 Bacteria 1051
156 Ga0307406_10439279 3300031901 Bacteria 1044
157 Ga0307406_10449759 3300031901 Bacteria 1033
158 Ga0307407_10045209 3300031903 Bacteria 2486
159 Ga0307407_10063809 3300031903 Bacteria 2162
160 Ga0307412_10004948 3300031911 Bacteria 7444
161 Ga0307412_10023570 3300031911 Bacteria 3789
162 Ga0307412_10034210 3300031911 Bacteria 3237
163 Ga0307412_10037342 3300031911 Bacteria 3120
164 Ga0307412_10088021 3300031911 Bacteria 2165
165 Ga0307409_100023923 3300031995 Bacteria 4245
166 Ga0307409_100047274 3300031995 Bacteria 3264
167 Ga0307409_100060223 3300031995 Bacteria 2959
168 Ga0307409_100177437 3300031995 Bacteria 1882
169 Ga0307409_100195237 3300031995 Bacteria 1806
170 Ga0307409_100344083 3300031995 Bacteria 1404
171 Ga0307409_100429921 3300031995 Bacteria 1269
172 Ga0307416_100092498 3300032002 Bacteria 2601
173 Ga0307416_100134643 3300032002 Bacteria 2232
174 Ga0307416_100153618 3300032002 Bacteria 2115
175 Ga0307416_100159686 3300032002 Bacteria 2081
176 Ga0307416_100310269 3300032002 Bacteria 1573
177 Ga0307414_10026643 3300032004 Bacteria 3723
178 Ga0307414_10064402 3300032004 Bacteria 2610
179 Ga0307414_10068752 3300032004 Bacteria 2543
180 Ga0307414_10138120 3300032004 Bacteria 1904
181 Ga0307414_10585305 3300032004 Bacteria 999
182 Ga0307411_10016889 3300032005 Bacteria 4141
183 Ga0307411_10028542 3300032005 Bacteria 3394
184 Ga0307411_10081536 3300032005 Bacteria 2228
185 Ga0307411_10123976 3300032005 Bacteria 1875
186 Ga0307411_10252366 3300032005 Bacteria 1388
187 Ga0307415_100048499 3300032126 Bacteria 2866
188 Ga0307415_100059697 3300032126 Bacteria 2631
189 Ga0307415_100092016 3300032126 Bacteria 2198
190 Ga0307415_100110064 3300032126 Bacteria 2042
191 Ga0373941_0182822 3300035115 Bacteria 788
192 Ga0395899_0007503 3300037312 Bacteria 8426
193 Ga0395899_0173817 3300037312 Bacteria 1515
194 Ga0395900_0002047 3300037418 Bacteria 22659
195 Ga0395900_0040941 3300037418 Bacteria 4776
196 Ga0395898_0008893 3300037466 Bacteria 10582
197 Ga0395898_0152921 3300037466 Bacteria 2207
198 Ga0395898_0221610 3300037466 Bacteria 1804
199 Ga0395898_0315705 3300037466 Bacteria 1491
200 Ga0395905_0156926 3300037471 Bacteria 2140
201 Ga0395901_0004494 3300038443 Bacteria 14064
202 Ga0395901_0059247 3300038443 Bacteria 3983
203 Ga0395901_0113352 3300038443 Bacteria 2847
204 Ga0395901_0337104 3300038443 Bacteria 1558
205 Ga0439436_0003335 3300041404 Bacteria 4871
206 Ga0439436_0005666 3300041404 Bacteria 3828
207 Ga0439438_004099 3300041405 Bacteria 5692
208 Ga0439438_005948 3300041405 Bacteria 4405
209 Ga0439439_0016589 3300041406 Bacteria 1805
210 Ga0439466_0004675 3300041411 Bacteria 5258
211 Ga0439466_0007953 3300041411 Bacteria 3998
212 Ga0451797_1003365 3300041453 Bacteria 1551
213 Ga0451845_0363161 3300041501 Bacteria 1035
214 Ga0451843_0590751 3300041509 Bacteria 2058
215 Ga0451853_0268759 3300041512 Bacteria 7039
216 Ga0439433_0001597 3300041999 Bacteria 4709
217 Ga0439433_0003189 3300041999 Bacteria 3517
218 Ga0439442_000016 3300042002 Bacteria 46336
219 Ga0439442_000103 3300042002 Bacteria 20871
220 Ga0439442_023625 3300042002 Bacteria 1278
221 Ga0439432_039357 3300042006 Bacteria 1503
222 Ga0439449_0003489 3300042007 Bacteria 6109
223 Ga0439449_0004784 3300042007 Bacteria 5223
224 Ga0439449_0076015 3300042007 Bacteria 1238
225 Ga0439452_018798 3300042010 Bacteria 1835
226 Ga0439457_001975 3300042014 Bacteria 6030
227 Ga0439457_041282 3300042014 Bacteria 1028
228 Ga0439462_0025474 3300042015 Bacteria 1557
229 Ga0450919_003602 3300042121 Bacteria 1922
230 Ga0450906_006011 3300042145 Bacteria 2469
231 Ga0450907_000274 3300042146 Bacteria 17342
232 Ga0450908_013218 3300042184 Bacteria 1490
233 Ga0450909_003926 3300042185 Bacteria 2117
234 Ga0439434_0000202 3300042435 Bacteria 16473
235 Ga0466969_0068421 3300044656 Bacteria 1711
236 Ga0466966_0050994 3300044684 Bacteria 2631
237 Ga0466963_0127715 3300044694 Bacteria 1754
238 Ga0466971_0169276 3300044719 Bacteria 1025
239 Ga0466970_0084939 3300044765 Bacteria 1714
240 Ga0466957_0159309 3300044842 Bacteria 1465
241 Ga0466957_0176370 3300044842 Bacteria 1394
242 Ga0466959_0032012 3300045049 Bacteria 3892
243 Ga0466967_0464771 3300045976 Bacteria 1238
244 Ga0495638_0132184 3300046460 Bacteria 1465
245 Ga0495580_0056310 3300046472 Bacteria 2769
246 Ga0495580_0409965 3300046472 Bacteria 913
247 Ga0495582_0060883 3300046473 Bacteria 2083
248 Ga0495582_0088619 3300046473 Bacteria 1724
249 Ga0495582_0188850 3300046473 Bacteria 1175
250 Ga0495639_0010502 3300046475 Bacteria 3987
251 Ga0495639_0170178 3300046475 Bacteria 1057
252 Ga0495662_0019060 3300046476 Bacteria 3320
253 Ga0495664_0005410 3300046477 Bacteria 7012
254 Ga0495585_0024179 3300046492 Bacteria 3486
255 Ga0495610_0068428 3300046512 Bacteria 1664
256 Ga0495630_0037154 3300046517 Bacteria 3641
257 Ga0495642_0053663 3300046528 Bacteria 1661
258 Ga0495654_0045045 3300046530 Bacteria 2178
259 Ga0495665_0060943 3300046531 Bacteria 1992
260 Ga0495665_0191076 3300046531 Bacteria 1062
261 Ga0495586_0033294 3300046535 Bacteria 2765
262 Ga0495587_0008041 3300046536 Bacteria 6805
263 Ga0495645_0006259 3300046543 Bacteria 8249
264 Ga0495633_0059573 3300046558 Bacteria 1790
265 Ga0495667_0015845 3300046559 Bacteria 5096
266 Ga0495656_0028445 3300046615 Bacteria 2242
267 Ga0495611_0178884 3300046648 Bacteria 991
268 Ga0495659_0011805 3300046664 Bacteria 2817
269 Ga0495588_0038153 3300046674 Bacteria 2443
270 Ga0495588_0100785 3300046674 Bacteria 1517
271 Ga0495588_0144375 3300046674 Bacteria 1257
272 Ga0495658_0035093 3300046683 Bacteria 2757
273 Ga0495670_0009605 3300046691 Bacteria 4752
274 Ga0495600_0019690 3300046809 Bacteria 4312
275 Ga0495581_0002129 3300047315 Bacteria 11164
276 Ga0495581_0027488 3300047315 Bacteria 3298
277 Ga0495604_0126028 3300047317 Bacteria 1846
278 Ga0495636_0029889 3300047318 Bacteria 2225
279 Ga0495636_0031043 3300047318 Bacteria 2188
280 Ga0495674_0339998 3300047319 Bacteria 1220
281 Ga0495676_0015037 3300047321 Bacteria 6908
282 Ga0495680_0037272 3300047322 Bacteria 3895
283 Ga0495675_0001496 3300047444 Bacteria 14149
284 Ga0495685_015400 3300047447 Bacteria 2607
285 Ga0495681_0103278 3300047470 Bacteria 1243
286 Ga0496100_0043681 3300048903 Bacteria 2867
287 Ga0496100_0182164 3300048903 Bacteria 1519
288 Ga0496100_0265377 3300048903 Bacteria 1274
289 Ga0496101_0015365 3300048904 Bacteria 5157
290 Ga0496101_0020137 3300048904 Bacteria 4562
291 Ga0496101_0127102 3300048904 Bacteria 1932
292 Ga0496101_0177163 3300048904 Bacteria 1640
293 Ga0496102_0000271 3300048905 Bacteria 66136
294 Ga0496102_0012522 3300048905 Bacteria 7343
295 Ga0496103_0000053 3300048906 Bacteria 148944
296 Ga0496103_0045184 3300048906 Bacteria 2717
297 Ga0496103_0110700 3300048906 Bacteria 1744
298 Ga0496103_0205817 3300048906 Bacteria 1265
299 Ga0496104_0164326 3300048907 Bacteria 2128
300 Ga0496104_0195195 3300048907 Bacteria 1936
301 Ga0496106_0122011 3300048909 Bacteria 2037
302 Ga0496106_0390337 3300048909 Bacteria 1119
303 Ga0496107_0266600 3300048910 Bacteria 1274
304 Ga0496108_0150270 3300048911 Bacteria 2009
305 Ga0496108_0357468 3300048911 Bacteria 1274
306 Ga0496109_0174477 3300048912 Bacteria 2017
307 Ga0496109_0754654 3300048912 Bacteria 911
308 Ga0496110_0057751 3300048913 Bacteria 3416
309 Ga0496110_0203120 3300048913 Bacteria 1801
310 Ga0496110_0398032 3300048913 Bacteria 1255
311 Ga0496112_0118245 3300048915 Bacteria 2620
312 Ga0496113_0090874 3300048916 Bacteria 2352
313 Ga0496114_0043173 3300048917 Bacteria 3739
314 Ga0496114_0164721 3300048917 Bacteria 1929
315 Ga0496115_0211087 3300048918 Bacteria 1603
316 Ga0496118_0049847 3300048921 Bacteria 3220
317 Ga0496118_0123005 3300048921 Bacteria 1686
318 Ga0496119_0000595 3300048922 Bacteria 48961
319 Ga0496119_0109368 3300048922 Bacteria 1537
320 Ga0496121_0127495 3300048924 Bacteria 1911
321 Ga0496124_0015199 3300048927 Bacteria 7390
322 Ga0496125_0256166 3300048928 Bacteria 1100
323 Ga0501306_000630 3300049127 Bacteria 2824
324 Ga0501306_015079 3300049127 Bacteria 1025
325 Ga0501306_021831 3300049127 Bacteria 899
326 Ga0501306_022516 3300049127 Bacteria 889
327 Ga0501306_024025 3300049127 Bacteria 869
328 Ga0501308_000083 3300049128 Bacteria 4162
329 Ga0501308_004929 3300049128 Bacteria 1309
330 Ga0501309_000371 3300049129 Bacteria 3449
331 Ga0501309_003031 3300049129 Bacteria 1874
332 Ga0501310_000002 3300049130 Bacteria 24441
333 Ga0501310_001752 3300049130 Bacteria 2004
334 Ga0501310_002019 3300049130 Bacteria 1894
335 Ga0501310_002136 3300049130 Bacteria 1857
336 Ga0501310_016611 3300049130 Bacteria 884
337 Ga0501341_01371 3300049131 Bacteria 1207
338 Ga0501341_02237 3300049131 Bacteria 1032
339 Ga0501343_004628 3300049132 Bacteria 1038
340 Ga0501343_005512 3300049132 Bacteria 972
341 Ga0501344_01177 3300049133 Bacteria 1231
342 Ga0501344_01720 3300049133 Bacteria 1085
343 Ga0501345_01269 3300049134 Bacteria 954
344 Ga0501304_000152 3300049160 Bacteria 2867
345 Ga0501305_003672 3300049161 Bacteria 1753
346 Ga0501305_012042 3300049161 Bacteria 1178
347 Ga0501305_031410 3300049161 Bacteria 829
348 Ga0501307_000524 3300049162 Bacteria 2680
349 Ga0501307_005915 3300049162 Bacteria 1304
350 Ga0501307_009172 3300049162 Bacteria 1127
351 Ga0501311_000172 3300049527 Bacteria 3669
352 Ga0501311_004801 3300049527 Bacteria 1455
353 Ga0501311_008481 3300049527 Bacteria 1206
354 Ga0501312_008443 3300049528 Bacteria 1338
355 Ga0501312_013519 3300049528 Bacteria 1136
356 Ga0501313_016251 3300049529 Bacteria 892
357 Ga0501314_003192 3300049530 Bacteria 1311
358 Ga0501314_003869 3300049530 Bacteria 1222
359 Ga0501315_000142 3300049531 Bacteria 4061
360 Ga0501315_002033 3300049531 Bacteria 1844
361 Ga0501316_000181 3300049532 Bacteria 3625
362 Ga0501316_013348 3300049532 Bacteria 970
363 Ga0501316_013591 3300049532 Bacteria 963
364 Ga0501317_000111 3300049533 Bacteria 4331
365 Ga0501317_000301 3300049533 Bacteria 3227
366 Ga0501317_004488 3300049533 Bacteria 1454
367 Ga0501317_006458 3300049533 Bacteria 1291
368 Ga0501318_000130 3300049534 Bacteria 3542
369 Ga0501318_007728 3300049534 Bacteria 1132
370 Ga0501318_008279 3300049534 Bacteria 1107
371 Ga0501318_015714 3300049534 Bacteria 907
372 Ga0501319_001789 3300049535 Bacteria 1296
373 Ga0501319_003795 3300049535 Bacteria 1027
374 Ga0501319_005402 3300049535 Bacteria 916
375 Ga0501320_000234 3300049536 Bacteria 2887
376 Ga0501320_014770 3300049536 Bacteria 847
377 Ga0501320_018746 3300049536 Bacteria 784
378 Ga0501321_000208 3300049537 Bacteria 3357
379 Ga0501321_003000 3300049537 Bacteria 1514
380 Ga0501321_009285 3300049537 Bacteria 1059
381 Ga0501321_013811 3300049537 Bacteria 932
382 Ga0501321_014726 3300049537 Bacteria 913
383 Ga0501322_000484 3300049538 Bacteria 1892
384 Ga0501322_005534 3300049538 Bacteria 877
385 Ga0501323_001384 3300049539 Bacteria 2132
386 Ga0501323_008626 3300049539 Bacteria 1186
387 Ga0501323_014194 3300049539 Bacteria 994
388 Ga0501323_018360 3300049539 Bacteria 905
389 Ga0501323_022393 3300049539 Bacteria 842
390 Ga0501324_000068 3300049540 Bacteria 3635
391 Ga0501324_002138 3300049540 Bacteria 1402
392 Ga0501324_007614 3300049540 Bacteria 939
393 Ga0501324_014776 3300049540 Bacteria 752
394 Ga0501325_000164 3300049541 Bacteria 2560
395 Ga0501325_008168 3300049541 Bacteria 903
396 Ga0501325_012408 3300049541 Bacteria 802
397 Ga0501327_01646 3300049543 Bacteria 1096
398 Ga0501329_00615 3300049545 Bacteria 1328
399 Ga0501329_01624 3300049545 Bacteria 1008
400 Ga0501330_000025 3300049546 Bacteria 3750
401 Ga0501330_002794 3300049546 Bacteria 1007
402 Ga0501331_00074 3300049547 Bacteria 2981
403 Ga0501332_00168 3300049548 Bacteria 2380
404 Ga0501332_02226 3300049548 Bacteria 1072
405 Ga0501333_000126 3300049549 Bacteria 2713
406 Ga0501334_02914 3300049550 Bacteria 1039
407 Ga0501335_000157 3300049551 Bacteria 3530
408 Ga0501335_010556 3300049551 Bacteria 893
409 Ga0501336_002506 3300049552 Bacteria 1183
410 Ga0501336_003457 3300049552 Bacteria 1068
411 Ga0501336_004922 3300049552 Bacteria 952
412 Ga0501337_003618 3300049553 Bacteria 987
413 Ga0501337_003840 3300049553 Bacteria 966
414 Ga0501338_00806 3300049554 Bacteria 1531
415 Ga0501338_01338 3300049554 Bacteria 1299
416 Ga0501340_000052 3300049556 Bacteria 3246
417 Ga0501340_000703 3300049556 Bacteria 1592
418 Ga0501340_001742 3300049556 Bacteria 1206
419 Ga0501031_0007437 3300049568 Bacteria 7139
420 Ga0501031_0033272 3300049568 Bacteria 3362
421 Ga0501032_0000380 3300049569 Bacteria 36690
422 Ga0501032_0000405 3300049569 Bacteria 35578
423 Ga0501032_0019357 3300049569 Bacteria 4762
424 Ga0501032_0033526 3300049569 Bacteria 3518
425 Ga0501032_0065868 3300049569 Bacteria 2422
426 Ga0501034_0000051 3300049571 Bacteria 210960
427 Ga0501036_0047687 3300049572 Bacteria 3627
428 Ga0501036_0102000 3300049572 Bacteria 2427
429 Ga0501036_0257113 3300049572 Bacteria 1463
430 Ga0501036_0326044 3300049572 Bacteria 1283
431 Ga0501036_0526236 3300049572 Bacteria 983
432 Ga0501037_0005792 3300049573 Bacteria 9025
433 Ga0501037_0010079 3300049573 Bacteria 6932
434 Ga0501037_0106630 3300049573 Bacteria 2019
435 Ga0501037_0420005 3300049573 Bacteria 915
436 Ga0501038_0019718 3300049574 Bacteria 6071
437 Ga0501038_0099598 3300049574 Bacteria 2422
438 Ga0501039_0001155 3300049575 Bacteria 19447
439 Ga0501039_0111117 3300049575 Bacteria 2142
440 Ga0501042_0099916 3300049578 Bacteria 2086
441 Ga0501042_0125117 3300049578 Bacteria 1851
442 Ga0501043_0001210 3300049579 Bacteria 22716
443 Ga0501043_0006168 3300049579 Bacteria 9630
444 Ga0501043_0073181 3300049579 Bacteria 2692
445 Ga0501043_0307784 3300049579 Bacteria 1209
446 Ga0501043_0330582 3300049579 Bacteria 1161
447 Ga0501048_0017941 3300049582 Bacteria 5208
448 Ga0501067_0015413 3300049583 Bacteria 4231
449 Ga0501068_0043904 3300049584 Bacteria 2690
450 Ga0501069_0301360 3300049585 Bacteria 940
451 Ga0501071_0029931 3300049587 Bacteria 3847
452 Ga0501071_0130726 3300049587 Bacteria 1865
453 Ga0501071_0234556 3300049587 Bacteria 1383
454 Ga0501071_0360706 3300049587 Bacteria 1107
455 Ga0501072_0008893 3300049588 Bacteria 7631
456 Ga0501072_0054196 3300049588 Bacteria 3159
457 Ga0501072_0068550 3300049588 Bacteria 2800
458 Ga0501073_0231508 3300049589 Bacteria 1276
459 Ga0501076_0028296 3300049592 Bacteria 4350
460 Ga0501077_0005990 3300049593 Bacteria 7427
461 Ga0501198_005314 3300049649 Bacteria 1810
462 Ga0501217_061862 3300049661 Bacteria 1002
463 Ga0501227_030278 3300049665 Bacteria 1295
464 Ga0501079_0005360 3300049741 Bacteria 9550
465 Ga0501081_0025216 3300049743 Bacteria 3999
466 Ga0501279_004441 3300049775 Bacteria 1842
467 Ga0501279_005137 3300049775 Bacteria 1718
468 Ga0501035_0091206 3300049822 Bacteria 2682
469 Ga0501045_0002793 3300049824 Bacteria 11936
470 Ga0501045_0059732 3300049824 Bacteria 2794
471 nmdc:mga03n38_58924_c1 3300050490 Bacteria 1741
472 nmdc:mga00v17_50694_c1 3300050491 Bacteria 2523
473 nmdc:mga0yw44_162537_c1 3300050492 Bacteria 1462
474 nmdc:mga05p37_6969_c1 3300050507 Bacteria 13321
475 nmdc:mga05p37_76500_c1 3300050507 Bacteria 4120
476 nmdc:mga09592_19307_c1 3300050508 Bacteria 5597
477 nmdc:mga0qj67_6313_c1 3300050509 Bacteria 8701
478 nmdc:mga06r32_4780_c1 3300050510 Bacteria 12186
479 Ga0500646_0023405 3300053090 Bacteria 1656
480 Ga0500566_0300775 3300053094 Bacteria 755
481 Ga0500620_014041 3300053155 Bacteria 2225
482 Ga0500637_0154621 3300053178 Bacteria 1324
483 Ga0501084_0052991 3300054114 Bacteria 3394
484 Ga0587084_017739 3300059477 Bacteria 1030
485 Ga0587066_016477 3300059490 Bacteria 1165
486 Ga0587070_001320 3300059491 Bacteria 2522
487 Ga0587070_013189 3300059491 Bacteria 1270
488 Ga0587073_0024611 3300059492 Bacteria 1190
489 Ga0587077_003663 3300059493 Bacteria 1953
490 Ga0587077_019041 3300059493 Bacteria 1190
491 Ga0587077_019919 3300059493 Bacteria 1173
492 Ga0587083_0021385 3300059505 Bacteria 1201
493 Ga0587083_0028320 3300059505 Bacteria 1096
494 Ga0587085_010450 3300059506 Bacteria 1232
495 Ga0587086_002039 3300059507 Bacteria 1843
496 Ga0587086_002437 3300059507 Bacteria 1758
497 Ga0587088_000794 3300059508 Bacteria 2922
498 Ga0587088_002769 3300059508 Bacteria 2043
499 Ga0587088_014855 3300059508 Bacteria 1218
500 Ga0587088_015782 3300059508 Bacteria 1195
501 Ga0587088_024393 3300059508 Bacteria 1036
502 Ga0587089_010032 3300059509 Bacteria 1173
503 Ga0587089_011278 3300059509 Bacteria 1124
504 Ga0587090_000034 3300059510 Bacteria 7273
505 Ga0587090_007167 3300059510 Bacteria 1457
506 Ga0587090_014147 3300059510 Bacteria 1163
507 Ga0587090_015786 3300059510 Bacteria 1121
508 Ga0587091_005864 3300059511 Bacteria 1697
509 Ga0587091_029733 3300059511 Bacteria 1017
510 Ga0587092_001227 3300059512 Bacteria 2430
511 Ga0587092_007352 3300059512 Bacteria 1424
512 Ga0587094_005556 3300059513 Bacteria 1477
513 Ga0587095_000680 3300059514 Bacteria 1849
514 Ga0587098_001287 3300059604 Bacteria 1881
515 Ga0587098_002772 3300059604 Bacteria 1513
516 Ga0587098_004032 3300059604 Bacteria 1359
517 Ga0587098_007112 3300059604 Bacteria 1156
518 Ga0587098_009233 3300059604 Bacteria 1066
519 Ga0587098_009847 3300059604 Bacteria 1046
520 Ga0587106_011584 3300059605 Bacteria 1166
521 Ga0587125_000208 3300059607 Bacteria 2931
522 Ga0587125_002100 3300059607 Bacteria 1555
523 Ga0587125_002578 3300059607 Bacteria 1466
524 Ga0587131_001424 3300059609 Bacteria 1172
525 Ga0587099_002919 3300059622 Bacteria 1385
526 Ga0587101_000681 3300059623 Bacteria 2566
527 Ga0587115_002343 3300059626 Bacteria 1869
528 Ga0587115_003213 3300059626 Bacteria 1701
529 Ga0587117_002450 3300059627 Bacteria 1734
530 Ga0587128_000082 3300059630 Bacteria 4616
531 Ga0587128_007708 3300059630 Bacteria 1369
532 Ga0587130_002448 3300059631 Bacteria 1499
533 Ga0587130_005051 3300059631 Bacteria 1171
534 Ga0587062_006715 3300059639 Bacteria 1317
535 Ga0587062_016541 3300059639 Bacteria 998
536 Ga0587067_004373 3300059640 Bacteria 1838
537 Ga0587067_017258 3300059640 Bacteria 1196
538 Ga0587068_001676 3300059641 Bacteria 2549
539 Ga0587068_004719 3300059641 Bacteria 1817
540 Ga0587069_002709 3300059642 Bacteria 1825
541 Ga0587072_000523 3300059643 Bacteria 3956
542 Ga0587072_001753 3300059643 Bacteria 2775
543 Ga0587072_005473 3300059643 Bacteria 1897
544 Ga0587072_010836 3300059643 Bacteria 1480
545 Ga0587075_003006 3300059644 Bacteria 1841
546 Ga0587075_007821 3300059644 Bacteria 1352
547 Ga0587076_002658 3300059645 Bacteria 2033
548 Ga0587076_015707 3300059645 Bacteria 1184
549 Ga0587076_017196 3300059645 Bacteria 1150
550 Ga0587100_000571 3300059648 Bacteria 1823
551 Ga0587100_002951 3300059648 Bacteria 1136
552 Ga0587102_005100 3300059649 Bacteria 1147
553 Ga0587104_002186 3300059650 Bacteria 1117
554 Ga0587107_008721 3300059652 Bacteria 1178
555 Ga0587107_010232 3300059652 Bacteria 1124
556 Ga0587107_010253 3300059652 Bacteria 1123
557 Ga0587108_002523 3300059653 Bacteria 1234
558 Ga0587118_00745 3300059657 Bacteria 1762
559 Ga0587119_002625 3300059658 Bacteria 1640
560 Ga0587124_000497 3300059660 Bacteria 2175
561 Ga0587060_001337 3300060243 Bacteria 1599
562 Ga0587071_005777 3300060344 Bacteria 1908
563 Ga0587071_006967 3300060344 Bacteria 1786
564 Ga0587071_035127 3300060344 Bacteria 983
565 Ga0587111_0018281 3300060346 Bacteria 1317
566 Ga0587111_0027023 3300060346 Bacteria 1147
567 Ga0587111_0053978 3300060346 Bacteria 895
568 Ga0530510_0092484 3300061734 Bacteria 2207
569 2515718591 2515154129 Bacteria 5584369
570 2515854041 2515154155 Bacteria 7985436
571 2516082745 2515154202 Bacteria 5471270
572 2644036497 2643221604 Bacteria 5014917
573 2644230714 2643221641 Bacteria 4490190
574 2644608803 2643221711 Bacteria 4865335
575 2691514479 2690315906 Bacteria 4517044
576 2740167652 2739367898 Bacteria 4367674
577 2775655191 2775506735 Bacteria 4556596
578 2808827560 2808606357 Bacteria 4466944
579 2808852927 2808606360 Bacteria 4404006
580 2808878623 2808606366 Bacteria 4415912
581 2808891795 2808606370 Bacteria 4942454
582 2808896925 2808606371 Bacteria 4251511
583 2812320654 2811994871 Bacteria 4497550
584 2816427171 2816332119 Bacteria 8120218
585 2844849421 2844849076 Bacteria 4091819
586 2855390667 2855386786 Bacteria 4752232
587 2857741436 2857740372 Bacteria 4782044
588 2904499970 2904497146 Bacteria 4731781
589 2904776520 2904776348 Bacteria 4658726
590 2910809945 2910809715 Bacteria 4982797
591 2919037645 2919034639 Bacteria 4763403
592 2919061806 2919059106 Bacteria 4991624
593 2919391301 2919391150 Bacteria 4884741
594 2919542036 2919538618 Bacteria 4677069
595 2932429129 2932426870 Bacteria 4547726
596 2933420613 2933418574 Bacteria 4476724
597 2939598532 2939598168 Bacteria 4687164
598 2939648982 2939647034 Bacteria 4681660
599 2939676177 2939674588 Bacteria 4844420
600 2945918414 2945916053 Bacteria 4555517
601 2945921302 2945920336 Bacteria 4501603
602 2945942523 2945941187 Bacteria 4682474
603 2945959719 2945956166 Bacteria 5110334
604 2946026304 2946024296 Bacteria 3508095
605 2946038454 2946037020 Bacteria 4900426
606 2946062270 2946059875 Bacteria 4386623
607 2953999728 2953998280 Bacteria 4812144
608 2974306438 2974302888 Bacteria 4369871
609 8004022191 8004021418 Bacteria 4313954
610 8004027792 8004025490 Bacteria 4327753
611 8054111146 8054107350 Bacteria 5022511
612 8054613220 8054609563 Bacteria 5170090
613 8056056167 8056054917 Bacteria 5736694
614 Ga0207695_10045170
615 JGI24740J21852_10008668
616 JGI24740J21852_10039999
617 JGI24739J22299_10020615
618 JGI24737J22298_10009344
619 rootH1_10142602
620 rootL2_10053942
621 Ga0006562J51391_1012297
622 Ga0006562J51391_1043916
623 Ga0055542_1002924
624 Ga0055540_1016886
625 Ga0058860_12209293
626 Ga0065714_10121544
627 Ga0065712_10182123
628 Ga0070670_100120636
629 Ga0070677_10009883
630 Ga0070666_10104650
631 Ga0070669_100013533
632 Ga0070671_100008922
633 Ga0070674_100274620
634 Ga0070674_100294522
635 Ga0070673_100080821
636 Ga0070667_100007806
637 Ga0070678_100046046
638 Ga0070678_100062597
639 Ga0070678_100156550
640 Ga0068856_100180827
641 Ga0068859_100001140
642 Ga0068861_100529633
643 Ga0068858_100290220
644 Ga0081455_10038410
645 Ga0081538_10070061
646 Ga0081540_1055632
647 Ga0075365_10073130
648 Ga0075364_10026836
649 Ga0075432_10008799
650 Ga0075428_100006863
651 Ga0075428_100418972
652 Ga0075430_100004192
653 Ga0075431_100008746
654 Ga0075429_100004098
655 Ga0097620_100001140
656 Ga0105251_10089782
657 Ga0105244_10002819
658 Ga0105244_10102845
659 Ga0105244_10115705
660 Ga0105244_10130489
661 Ga0105240_10060407
662 Ga0105247_10019947
663 Ga0114129_10025186
664 Ga0114129_10111341
665 Ga0105243_10060271
666 Ga0105243_10084920
667 Ga0105248_10168115
668 Ga0105237_10006612
669 Ga0105238_10318038
670 Ga0105239_10039506
671 Ga0105239_10240958
672 Ga0105246_10004332
673 Ga0105246_10024371
674 Ga0105246_10075690
675 Ga0105246_10182777
676 Ga0157373_10012600
677 Ga0157373_10221172
678 Ga0157371_10005178
679 Ga0157371_10018271
680 Ga0157371_10481678
681 Ga0157370_10016411
682 Ga0157370_10173016
683 Ga0157369_10240404
684 Ga0157372_10181842
685 Ga0157380_10124383
686 Ga0163161_10073380
687 Ga0197907_10041850
688 Ga0197907_10883299
689 Ga0197907_10921460
690 Ga0206356_11642392
691 Ga0206349_1149272
692 Ga0206349_1501613
693 Ga0206349_1523504
694 Ga0206349_1617487
695 Ga0206355_1209876
696 Ga0206355_1462619
697 Ga0206355_1645477
698 Ga0206355_1679439
699 Ga0206352_10018184
700 Ga0206350_11389734
701 Ga0206353_10001084
702 Ga0206353_11001418
703 Ga0224712_10087087
704 Ga0256720_141024
705 Ga0209148_1003798
706 Ga0209129_1000028
707 Ga0209025_1000112
708 Ga0209051_1002422
709 Ga0209051_1025638
710 Ga0207697_10003796
711 Ga0207655_1003724
712 Ga0207655_1005422
713 Ga0207655_1036397
714 Ga0207682_10006529
715 Ga0207682_10231952
716 Ga0207710_10009691
717 Ga0207680_10016041
718 Ga0207647_10012992
719 Ga0207647_10040553
720 Ga0207645_10000942
721 Ga0207671_10020897
722 Ga0207681_10028062
723 Ga0207694_10164834
724 Ga0207659_10214258
725 Ga0207644_10025495
726 Ga0207709_10015059
727 Ga0207709_10099249
728 Ga0207669_10063795
729 Ga0207669_10197284
730 Ga0207691_10000527
731 Ga0207711_10160477
732 Ga0207651_10049192
733 Ga0207658_10003895
734 Ga0207658_10148048
735 Ga0207639_10167737
736 Ga0207683_10004866
737 Ga0209974_10008938
738 Ga0207428_10001932
739 Ga0207428_10120650
740 Ga0268266_10681680
741 Ga0316181_1102513
742 Ga0316181_1173341
743 Ga0316181_1254166
744 Ga0316182_1156000
745 Ga0307513_10416796
746 Ga0307509_10463488
747 Ga0307408_100022658
748 Ga0307408_100058737
749 Ga0307408_100061230
750 Ga0307408_100337469
751 Ga0307408_100373679
752 Ga0307405_10043363
753 Ga0307405_10058297
754 Ga0307405_10188428
755 Ga0307405_10195115
756 Ga0307413_10030191
757 Ga0307518_10219325
758 Ga0307410_10014648
759 Ga0307410_10046522
760 Ga0307410_10047562
761 Ga0307410_10049727
762 Ga0307410_10050622
763 Ga0307410_10312157
764 Ga0307406_10073271
765 Ga0307406_10111665
766 Ga0307406_10226513
767 Ga0307406_10302240
768 Ga0307406_10432736
769 Ga0307406_10439279
770 Ga0307406_10449759
771 Ga0307407_10045209
772 Ga0307407_10063809
773 Ga0307412_10004948
774 Ga0307412_10023570
775 Ga0307412_10034210
776 Ga0307412_10037342
777 Ga0307412_10088021
778 Ga0307409_100023923
779 Ga0307409_100047274
780 Ga0307409_100060223
781 Ga0307409_100177437
782 Ga0307409_100195237
783 Ga0307409_100344083
784 Ga0307409_100429921
785 Ga0307416_100092498
786 Ga0307416_100134643
787 Ga0307416_100153618
788 Ga0307416_100159686
789 Ga0307416_100310269
790 Ga0307414_10026643
791 Ga0307414_10064402
792 Ga0307414_10068752
793 Ga0307414_10138120
794 Ga0307414_10585305
795 Ga0307411_10016889
796 Ga0307411_10028542
797 Ga0307411_10081536
798 Ga0307411_10123976
799 Ga0307411_10252366
800 Ga0307415_100048499
801 Ga0307415_100059697
802 Ga0307415_100092016
803 Ga0307415_100110064
804 Ga0373941_0182822
805 Ga0395899_0007503
806 Ga0395899_0173817
807 Ga0395900_0002047
808 Ga0395900_0040941
809 Ga0395898_0008893
810 Ga0395898_0152921
811 Ga0395898_0221610
812 Ga0395898_0315705
813 Ga0395905_0156926
814 Ga0395901_0004494
815 Ga0395901_0059247
816 Ga0395901_0113352
817 Ga0395901_0337104
818 Ga0439436_0003335
819 Ga0439436_0005666
820 Ga0439438_004099
821 Ga0439438_005948
822 Ga0439439_0016589
823 Ga0439466_0004675
824 Ga0439466_0007953
825 Ga0451797_1003365
826 Ga0451845_0363161
827 Ga0451843_0590751
828 Ga0451853_0268759
829 Ga0439433_0001597
830 Ga0439433_0003189
831 Ga0439442_000016
832 Ga0439442_000103
833 Ga0439442_023625
834 Ga0439432_039357
835 Ga0439449_0003489
836 Ga0439449_0004784
837 Ga0439449_0076015
838 Ga0439452_018798
839 Ga0439457_001975
840 Ga0439457_041282
841 Ga0439462_0025474
842 Ga0450919_003602
843 Ga0450906_006011
844 Ga0450907_000274
845 Ga0450908_013218
846 Ga0450909_003926
847 Ga0439434_0000202
848 Ga0466969_0068421
849 Ga0466966_0050994
850 Ga0466963_0127715
851 Ga0466971_0169276
852 Ga0466970_0084939
853 Ga0466957_0159309
854 Ga0466957_0176370
855 Ga0466959_0032012
856 Ga0466967_0464771
857 Ga0495638_0132184
858 Ga0495580_0056310
859 Ga0495580_0409965
860 Ga0495582_0060883
861 Ga0495582_0088619
862 Ga0495582_0188850
863 Ga0495639_0010502
864 Ga0495639_0170178
865 Ga0495662_0019060
866 Ga0495664_0005410
867 Ga0495585_0024179
868 Ga0495610_0068428
869 Ga0495630_0037154
870 Ga0495642_0053663
871 Ga0495654_0045045
872 Ga0495665_0060943
873 Ga0495665_0191076
874 Ga0495586_0033294
875 Ga0495587_0008041
876 Ga0495645_0006259
877 Ga0495633_0059573
878 Ga0495667_0015845
879 Ga0495656_0028445
880 Ga0495611_0178884
881 Ga0495659_0011805
882 Ga0495588_0038153
883 Ga0495588_0100785
884 Ga0495588_0144375
885 Ga0495658_0035093
886 Ga0495670_0009605
887 Ga0495600_0019690
888 Ga0495581_0002129
889 Ga0495581_0027488
890 Ga0495604_0126028
891 Ga0495636_0029889
892 Ga0495636_0031043
893 Ga0495674_0339998
894 Ga0495676_0015037
895 Ga0495680_0037272
896 Ga0495675_0001496
897 Ga0495685_015400
898 Ga0495681_0103278
899 Ga0496100_0043681
900 Ga0496100_0182164
901 Ga0496100_0265377
902 Ga0496101_0015365
903 Ga0496101_0020137
904 Ga0496101_0127102
905 Ga0496101_0177163
906 Ga0496102_0000271
907 Ga0496102_0012522
908 Ga0496103_0000053
909 Ga0496103_0045184
910 Ga0496103_0110700
911 Ga0496103_0205817
912 Ga0496104_0164326
913 Ga0496104_0195195
914 Ga0496106_0122011
915 Ga0496106_0390337
916 Ga0496107_0266600
917 Ga0496108_0150270
918 Ga0496108_0357468
919 Ga0496109_0174477
920 Ga0496109_0754654
921 Ga0496110_0057751
922 Ga0496110_0203120
923 Ga0496110_0398032
924 Ga0496112_0118245
925 Ga0496113_0090874
926 Ga0496114_0043173
927 Ga0496114_0164721
928 Ga0496115_0211087
929 Ga0496118_0049847
930 Ga0496118_0123005
931 Ga0496119_0000595
932 Ga0496119_0109368
933 Ga0496121_0127495
934 Ga0496124_0015199
935 Ga0496125_0256166
936 Ga0501306_000630
937 Ga0501306_015079
938 Ga0501306_021831
939 Ga0501306_022516
940 Ga0501306_024025
941 Ga0501308_000083
942 Ga0501308_004929
943 Ga0501309_000371
944 Ga0501309_003031
945 Ga0501310_000002
946 Ga0501310_001752
947 Ga0501310_002019
948 Ga0501310_002136
949 Ga0501310_016611
950 Ga0501341_01371
951 Ga0501341_02237
952 Ga0501343_004628
953 Ga0501343_005512
954 Ga0501344_01177
955 Ga0501344_01720
956 Ga0501345_01269
957 Ga0501304_000152
958 Ga0501305_003672
959 Ga0501305_012042
960 Ga0501305_031410
961 Ga0501307_000524
962 Ga0501307_005915
963 Ga0501307_009172
964 Ga0501311_000172
965 Ga0501311_004801
966 Ga0501311_008481
967 Ga0501312_008443
968 Ga0501312_013519
969 Ga0501313_016251
970 Ga0501314_003192
971 Ga0501314_003869
972 Ga0501315_000142
973 Ga0501315_002033
974 Ga0501316_000181
975 Ga0501316_013348
976 Ga0501316_013591
977 Ga0501317_000111
978 Ga0501317_000301
979 Ga0501317_004488
980 Ga0501317_006458
981 Ga0501318_000130
982 Ga0501318_007728
983 Ga0501318_008279
984 Ga0501318_015714
985 Ga0501319_001789
986 Ga0501319_003795
987 Ga0501319_005402
988 Ga0501320_000234
989 Ga0501320_014770
990 Ga0501320_018746
991 Ga0501321_000208
992 Ga0501321_003000
993 Ga0501321_009285
994 Ga0501321_013811
995 Ga0501321_014726
996 Ga0501322_000484
997 Ga0501322_005534
998 Ga0501323_001384
999 Ga0501323_008626
1000 Ga0501323_014194
1001 Ga0501323_018360
1002 Ga0501323_022393
1003 Ga0501324_000068
1004 Ga0501324_002138
1005 Ga0501324_007614
1006 Ga0501324_014776
1007 Ga0501325_000164
1008 Ga0501325_008168
1009 Ga0501325_012408
1010 Ga0501327_01646
1011 Ga0501329_00615
1012 Ga0501329_01624
1013 Ga0501330_000025
1014 Ga0501330_002794
1015 Ga0501331_00074
1016 Ga0501332_00168
1017 Ga0501332_02226
1018 Ga0501333_000126
1019 Ga0501334_02914
1020 Ga0501335_000157
1021 Ga0501335_010556
1022 Ga0501336_002506
1023 Ga0501336_003457
1024 Ga0501336_004922
1025 Ga0501337_003618
1026 Ga0501337_003840
1027 Ga0501338_00806
1028 Ga0501338_01338
1029 Ga0501340_000052
1030 Ga0501340_000703
1031 Ga0501340_001742
1032 Ga0501031_0007437
1033 Ga0501031_0033272
1034 Ga0501032_0000380
1035 Ga0501032_0000405
1036 Ga0501032_0019357
1037 Ga0501032_0033526
1038 Ga0501032_0065868
1039 Ga0501034_0000051
1040 Ga0501036_0047687
1041 Ga0501036_0102000
1042 Ga0501036_0257113
1043 Ga0501036_0326044
1044 Ga0501036_0526236
1045 Ga0501037_0005792
1046 Ga0501037_0010079
1047 Ga0501037_0106630
1048 Ga0501037_0420005
1049 Ga0501038_0019718
1050 Ga0501038_0099598
1051 Ga0501039_0001155
1052 Ga0501039_0111117
1053 Ga0501042_0099916
1054 Ga0501042_0125117
1055 Ga0501043_0001210
1056 Ga0501043_0006168
1057 Ga0501043_0073181
1058 Ga0501043_0307784
1059 Ga0501043_0330582
1060 Ga0501048_0017941
1061 Ga0501067_0015413
1062 Ga0501068_0043904
1063 Ga0501069_0301360
1064 Ga0501071_0029931
1065 Ga0501071_0130726
1066 Ga0501071_0234556
1067 Ga0501071_0360706
1068 Ga0501072_0008893
1069 Ga0501072_0054196
1070 Ga0501072_0068550
1071 Ga0501073_0231508
1072 Ga0501076_0028296
1073 Ga0501077_0005990
1074 Ga0501198_005314
1075 Ga0501217_061862
1076 Ga0501227_030278
1077 Ga0501079_0005360
1078 Ga0501081_0025216
1079 Ga0501279_004441
1080 Ga0501279_005137
1081 Ga0501035_0091206
1082 Ga0501045_0002793
1083 Ga0501045_0059732
1084 nmdc:mga03n38_58924_c1
1085 nmdc:mga00v17_50694_c1
1086 nmdc:mga0yw44_162537_c1
1087 nmdc:mga05p37_6969_c1
1088 nmdc:mga05p37_76500_c1
1089 nmdc:mga09592_19307_c1
1090 nmdc:mga0qj67_6313_c1
1091 nmdc:mga06r32_4780_c1
1092 Ga0500646_0023405
1093 Ga0500566_0300775
1094 Ga0500620_014041
1095 Ga0500637_0154621
1096 Ga0501084_0052991
1097 Ga0587084_017739
1098 Ga0587066_016477
1099 Ga0587070_001320
1100 Ga0587070_013189
1101 Ga0587073_0024611
1102 Ga0587077_003663
1103 Ga0587077_019041
1104 Ga0587077_019919
1105 Ga0587083_0021385
1106 Ga0587083_0028320
1107 Ga0587085_010450
1108 Ga0587086_002039
1109 Ga0587086_002437
1110 Ga0587088_000794
1111 Ga0587088_002769
1112 Ga0587088_014855
1113 Ga0587088_015782
1114 Ga0587088_024393
1115 Ga0587089_010032
1116 Ga0587089_011278
1117 Ga0587090_000034
1118 Ga0587090_007167
1119 Ga0587090_014147
1120 Ga0587090_015786
1121 Ga0587091_005864
1122 Ga0587091_029733
1123 Ga0587092_001227
1124 Ga0587092_007352
1125 Ga0587094_005556
1126 Ga0587095_000680
1127 Ga0587098_001287
1128 Ga0587098_002772
1129 Ga0587098_004032
1130 Ga0587098_007112
1131 Ga0587098_009233
1132 Ga0587098_009847
1133 Ga0587106_011584
1134 Ga0587125_000208
1135 Ga0587125_002100
1136 Ga0587125_002578
1137 Ga0587131_001424
1138 Ga0587099_002919
1139 Ga0587101_000681
1140 Ga0587115_002343
1141 Ga0587115_003213
1142 Ga0587117_002450
1143 Ga0587128_000082
1144 Ga0587128_007708
1145 Ga0587130_002448
1146 Ga0587130_005051
1147 Ga0587062_006715
1148 Ga0587062_016541
1149 Ga0587067_004373
1150 Ga0587067_017258
1151 Ga0587068_001676
1152 Ga0587068_004719
1153 Ga0587069_002709
1154 Ga0587072_000523
1155 Ga0587072_001753
1156 Ga0587072_005473
1157 Ga0587072_010836
1158 Ga0587075_003006
1159 Ga0587075_007821
1160 Ga0587076_002658
1161 Ga0587076_015707
1162 Ga0587076_017196
1163 Ga0587100_000571
1164 Ga0587100_002951
1165 Ga0587102_005100
1166 Ga0587104_002186
1167 Ga0587107_008721
1168 Ga0587107_010232
1169 Ga0587107_010253
1170 Ga0587108_002523
1171 Ga0587118_00745
1172 Ga0587119_002625
1173 Ga0587124_000497
1174 Ga0587060_001337
1175 Ga0587071_005777
1176 Ga0587071_006967
1177 Ga0587071_035127
1178 Ga0587111_0018281
1179 Ga0587111_0027023
1180 Ga0587111_0053978
1181 Ga0530510_0092484
1182 2515718591
1183 2515854041
1184 2516082745
1185 2644036497
1186 2644230714
1187 2644608803
1188 2691514479
1189 2740167652
1190 2775655191
1191 2808827560
1192 2808852927
1193 2808878623
1194 2808891795
1195 2808896925
1196 2812320654
1197 2816427171
1198 2844849421
1199 2855390667
1200 2857741436
1201 2904499970
1202 2904776520
1203 2910809945
1204 2919037645
1205 2919061806
1206 2919391301
1207 2919542036
1208 2932429129
1209 2933420613
1210 2939598532
1211 2939648982
1212 2939676177
1213 2945918414
1214 2945921302
1215 2945942523
1216 2945959719
1217 2946026304
1218 2946038454
1219 2946062270
1220 2953999728
1221 2974306438
1222 8004022191
1223 8004027792
1224 8054111146
1225 8054613220
1226 8056056167

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00119

ATP-synt_A

ATP synthase A chain

57

274

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
6b2z-assembly1.cif.gz_a cryo-em structure of the dimeric fo region of yeast mitochondrial atp synthase 0.8165 31 257
7tjy-assembly1.cif.gz_T yeast atp synthase state 1catalytic(a) without exogenous atp backbone model 0.8107 30 256
6wtd-assembly1.cif.gz_X monomer yeast atp synthase fo reconstituted in nanodisc with inhibitor of bedaquiline bound 0.7983 34 256
7jg8-assembly1.cif.gz_a cryo-em structure of bedaquiline-saturated mycobacterium smegmatis atp synthase rotational state 1 (backbone model) 0.7981 33 256
7tjy-assembly1.cif.gz_T yeast atp synthase state 1catalytic(a) without exogenous atp backbone model 0.7951 30 256
ID Description Score Start End Superfamily
af_M1FN39_66_236_1.20.120.220 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);ATP synthase, F0 complex, subunit A 0.8538 87 256 1.20.120.220
af_Q27559_82_244_1.20.120.220 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);ATP synthase, F0 complex, subunit A 0.8384 88 256 1.20.120.220
af_M1FN39_66_236_1.20.120.220 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);ATP synthase, F0 complex, subunit A 0.8227 87 256 1.20.120.220
af_Q27559_82_244_1.20.120.220 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);ATP synthase, F0 complex, subunit A 0.8155 88 256 1.20.120.220
af_P00854_92_259_1.20.120.220 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);ATP synthase, F0 complex, subunit A 0.7888 87 258 1.20.120.220
ID Description Score Start End GO Terms
AF-A0A7X0LQZ8-F1-model_v4 ATP synthase subunit a (ATP synthase F0 sector subunit a) (F-ATPase subunit 6) 0.9175 6 260 GO:0005886
GO:0045263
GO:0046933
AF-A0A4P5S1Y1-F1-model_v4 ATP synthase subunit a (ATP synthase F0 sector subunit a) (F-ATPase subunit 6) 0.9088 15 260 GO:0005886
GO:0045263
GO:0046933
AF-A0A4R4PIR7-F1-model_v4 ATP synthase subunit a (ATP synthase F0 sector subunit a) (F-ATPase subunit 6) 0.9086 6 260 GO:0005886
GO:0045263
GO:0046933
AF-A0A7W3T670-F1-model_v4 ATP synthase subunit a (ATP synthase F0 sector subunit a) (F-ATPase subunit 6) 0.9084 6 260 GO:0005886
GO:0045263
GO:0046933
AF-A0A7W3TE50-F1-model_v4 ATP synthase subunit a (ATP synthase F0 sector subunit a) (F-ATPase subunit 6) 0.9082 6 260 GO:0005886
GO:0045263
GO:0046933

Map