F469260
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 613 | 359 | 1226 | 239 |
Family's Representative Sequence
| Representative Sequence | 3300025913|Ga0207695_10045170|Ga0207695_100451705 |
| Length | 281 |
| Sequence | VTLVSQAGQAMMLDHPAARAAANHVLHLAAAPGFVAPGPNDFDLRSVFYTNNVWLTKASLLLVLSFFIIVIAFRASIRKADVVPGKFQYAGEAAYGFVRDGIARDMIGERDFKRYVPLLVAMFYFVLVNNLFGLVPFLQFPSFARAGFAYGLAGMVWIIYNGIGMARKGPLGYLKHQTVPGGVPPWILLEFLSNIIIRPITLALRLFANMFAGHLLLLLFAGGADYLLIHAQGPLVKPGGVLSFGMGFMVGFLELLVEVLQAYVFTLLTASYISGAIADEH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 6 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 7 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 8 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 9 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 10 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 11 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 23 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 24 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 25 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 26 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 27 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 28 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 29 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 30 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 31 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 32 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 33 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 34 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 35 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 36 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 39 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 40 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 56 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 57 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 58 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 59 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 60 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 61 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 62 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 63 | 3300023438 | Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.stcc | Metatranscriptome | Rhizosphere |
| 64 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 66 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 90 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 92 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 93 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 94 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 95 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 96 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 97 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 98 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 99 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 100 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 101 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 102 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 103 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 104 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 105 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 106 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 107 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 108 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 109 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 110 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 111 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 112 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 113 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 114 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 115 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 116 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 117 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 118 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 119 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 120 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 121 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 122 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 123 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 124 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 125 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 126 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 127 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 128 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 129 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 130 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 131 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 132 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 133 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 134 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 135 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 136 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 137 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 138 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 139 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 140 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 141 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 142 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 143 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 177 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 178 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 179 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 180 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 181 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 182 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 183 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 184 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 185 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 186 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 187 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 188 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 189 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 190 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 191 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 192 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 193 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 194 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 195 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 196 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 197 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 198 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 199 | 3300049131 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 200 | 3300049132 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 201 | 3300049133 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 202 | 3300049134 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 203 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 204 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 205 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 206 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 207 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 208 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 209 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 210 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 211 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 212 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 213 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 214 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 215 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 216 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 217 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 218 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 219 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 220 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 221 | 3300049543 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 222 | 3300049545 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 223 | 3300049546 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 224 | 3300049547 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 225 | 3300049548 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 226 | 3300049549 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 227 | 3300049550 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 228 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 229 | 3300049552 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 230 | 3300049553 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 231 | 3300049554 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 232 | 3300049556 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 233 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 237 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 246 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 252 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 253 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 254 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 257 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 260 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 261 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 262 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 264 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 267 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 268 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 269 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 270 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 272 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 273 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 274 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 275 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 276 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 277 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 278 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 279 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 280 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 281 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 282 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 283 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 284 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 285 | 3300059514 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 286 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 287 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 288 | 3300059607 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 289 | 3300059609 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 227R_SD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 290 | 3300059622 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 291 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 292 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 293 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 294 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 295 | 3300059631 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 296 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 297 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 298 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 299 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 300 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 301 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 302 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 303 | 3300059648 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 304 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 305 | 3300059650 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 69R_SD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 306 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 307 | 3300059653 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 308 | 3300059657 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 156R_AW_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 309 | 3300059658 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 310 | 3300059660 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 311 | 3300060243 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 1R_CW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 312 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 313 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 314 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 315 | 2515154129 | Salinispora pacifica CNS103 | Isolate | Rhizosphere |
| 316 | 2515154155 | Actinopolymorpha alba DSM 45243 | Isolate | Rhizosphere |
| 317 | 2515154202 | Salinispora pacifica CNT084 | Isolate | Rhizosphere |
| 318 | 2643221604 | Nocardioides sp. Root190 | Isolate | Unclassified |
| 319 | 2643221641 | Nocardioides sp. Root122 | Isolate | Unclassified |
| 320 | 2643221711 | Terrabacter sp. Root85 | Isolate | Unclassified |
| 321 | 2690315906 | Arthrobacter sp. OY3WO11 | Isolate | Unclassified |
| 322 | 2739367898 | Nocardioides sp. CF479 | Isolate | Unclassified |
| 323 | 2775506735 | Arthrobacter sp. S95 1704 | Isolate | Unclassified |
| 324 | 2808606357 | Arthrobacter sp. SLBN-122 | Isolate | Unclassified |
| 325 | 2808606360 | Arthrobacter sp. SLBN-112 | Isolate | Unclassified |
| 326 | 2808606366 | Arthrobacter sp. SLBN-83 | Isolate | Unclassified |
| 327 | 2808606370 | Arthrobacter sp. SLBN-100 | Isolate | Unclassified |
| 328 | 2808606371 | Arthrobacter sp. SLBN-53 | Isolate | Unclassified |
| 329 | 2811994871 | Arthrobacter sp. SLBN-179 | Isolate | Unclassified |
| 330 | 2816332119 | Kribbella amoyensis DSM 24683 | Isolate | Rhizosphere |
| 331 | 2844849076 | Arthrobacter cupressi DSM 24664 | Isolate | Rhizosphere |
| 332 | 2855386786 | Nocardioides ferulae EGI 63112 | Isolate | Unclassified |
| 333 | 2857740372 | Paenarthrobacter sp. R-74611 | Isolate | Unclassified |
| 334 | 2904497146 | Arthrobacter sp. 1276 | Isolate | Rhizosphere |
| 335 | 2904776348 | Paenarthrobacter sp. 1092 | Isolate | Rhizosphere |
| 336 | 2910809715 | Paenarthrobacter sp. CM16 | Isolate | Unclassified |
| 337 | 2919034639 | Paenarthrobacter nitroguajacolicus 247 | Isolate | Rhizosphere |
| 338 | 2919059106 | Arthrobacter sp. 1088 | Isolate | Rhizosphere |
| 339 | 2919391150 | Arthrobacter ipis 2973 | Isolate | Unclassified |
| 340 | 2919538618 | Paenarthrobacter nitroguajacolicus 3945 | Isolate | Unclassified |
| 341 | 2932426870 | Paenarthrobacter sp. 4246 | Isolate | Rhizosphere |
| 342 | 2933418574 | Jeotgalibacillus campisalis 4120 | Isolate | Rhizosphere |
| 343 | 2939598168 | Arthrobacter sp. 754 | Isolate | Rhizosphere |
| 344 | 2939647034 | Arthrobacter sp. 2762 | Isolate | Rhizosphere |
| 345 | 2939674588 | Arthrobacter bambusae 3552 | Isolate | Rhizosphere |
| 346 | 2945916053 | Arthrobacter ulcerisalmonis W1I2 | Isolate | Rhizosphere |
| 347 | 2945920336 | Pseudarthrobacter siccitolerans W1I3 | Isolate | Rhizosphere |
| 348 | 2945941187 | Arthrobacter pascens W1I14 | Isolate | Rhizosphere |
| 349 | 2945956166 | Arthrobacter globiformus W2I3 | Isolate | Rhizosphere |
| 350 | 2946024296 | Arthrobacter woluwensis W4I2 | Isolate | Rhizosphere |
| 351 | 2946037020 | Arthrobacter sp. W4I7 | Isolate | Rhizosphere |
| 352 | 2946059875 | Arthrobacter sp. SLBN-112 | Isolate | Rhizosphere |
| 353 | 2953998280 | Pseudarthrobacter sp. W1I19 | Isolate | Rhizosphere |
| 354 | 2974302888 | Pseudarthrobacter sp. SORGH_AS 212 | Isolate | Unclassified |
| 355 | 8004021418 | Arthrobacter sp. SDTb3-6 | Isolate | Rhizosphere |
| 356 | 8004025490 | Arthrobacter wenxiniae AETb3-4 | Isolate | Rhizosphere |
| 357 | 8054107350 | Arthrobacter rhizosphaerae CCNWLXL 1-35 | Isolate | Rhizosphere |
| 358 | 8054609563 | Nocardioides astragali CGMCC 4.7327 | Isolate | Nodule |
| 359 | 8056054917 | Glycomyces luteolus NEAU-A15 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 59.87 |
| Metatranscriptomes | 32.79 |
| Isolates | 7.34 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.61 |
| Nodule | 0.16 |
| Rhizoplane | 5.06 |
| Rhizosphere | 86.3 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207695_10045170 | 3300025913 | Bacteria | 4679 |
| 2 | JGI24740J21852_10008668 | 3300001979 | Bacteria | 4036 |
| 3 | JGI24740J21852_10039999 | 3300001979 | Bacteria | 1425 |
| 4 | JGI24739J22299_10020615 | 3300001989 | Bacteria | 2354 |
| 5 | JGI24737J22298_10009344 | 3300001990 | Bacteria | 3265 |
| 6 | rootH1_10142602 | 3300003316 | Bacteria | 2633 |
| 7 | rootL2_10053942 | 3300003322 | Bacteria | 12225 |
| 8 | Ga0006562J51391_1012297 | 3300003578 | Bacteria | 3582 |
| 9 | Ga0006562J51391_1043916 | 3300003578 | Bacteria | 1815 |
| 10 | Ga0055542_1002924 | 3300003762 | Bacteria | 5034 |
| 11 | Ga0055540_1016886 | 3300003792 | Bacteria | 2056 |
| 12 | Ga0058860_12209293 | 3300004801 | Bacteria | 3006 |
| 13 | Ga0065714_10121544 | 3300005288 | Bacteria | 1340 |
| 14 | Ga0065712_10182123 | 3300005290 | Bacteria | 1170 |
| 15 | Ga0070670_100120636 | 3300005331 | Bacteria | 2262 |
| 16 | Ga0070677_10009883 | 3300005333 | Bacteria | 3249 |
| 17 | Ga0070666_10104650 | 3300005335 | Bacteria | 1954 |
| 18 | Ga0070669_100013533 | 3300005353 | Bacteria | 5799 |
| 19 | Ga0070671_100008922 | 3300005355 | Bacteria | 8046 |
| 20 | Ga0070674_100274620 | 3300005356 | Bacteria | 1334 |
| 21 | Ga0070674_100294522 | 3300005356 | Bacteria | 1291 |
| 22 | Ga0070673_100080821 | 3300005364 | Bacteria | 2634 |
| 23 | Ga0070667_100007806 | 3300005367 | Bacteria | 8873 |
| 24 | Ga0070678_100046046 | 3300005456 | Bacteria | 3125 |
| 25 | Ga0070678_100062597 | 3300005456 | Bacteria | 2748 |
| 26 | Ga0070678_100156550 | 3300005456 | Bacteria | 1841 |
| 27 | Ga0068856_100180827 | 3300005614 | Bacteria | 2122 |
| 28 | Ga0068859_100001140 | 3300005617 | Bacteria | 27061 |
| 29 | Ga0068861_100529633 | 3300005719 | Bacteria | 1070 |
| 30 | Ga0068858_100290220 | 3300005842 | Bacteria | 1559 |
| 31 | Ga0081455_10038410 | 3300005937 | Bacteria | 4240 |
| 32 | Ga0081538_10070061 | 3300005981 | Bacteria | 1938 |
| 33 | Ga0081540_1055632 | 3300005983 | Bacteria | 1926 |
| 34 | Ga0075365_10073130 | 3300006038 | Bacteria | 2310 |
| 35 | Ga0075364_10026836 | 3300006051 | Bacteria | 3677 |
| 36 | Ga0075432_10008799 | 3300006058 | Bacteria | 3445 |
| 37 | Ga0075428_100006863 | 3300006844 | Bacteria | 12651 |
| 38 | Ga0075428_100418972 | 3300006844 | Bacteria | 1435 |
| 39 | Ga0075430_100004192 | 3300006846 | Bacteria | 12168 |
| 40 | Ga0075431_100008746 | 3300006847 | Bacteria | 10143 |
| 41 | Ga0075429_100004098 | 3300006880 | Bacteria | 12483 |
| 42 | Ga0097620_100001140 | 3300006931 | Bacteria | 27061 |
| 43 | Ga0105251_10089782 | 3300009011 | Bacteria | 1413 |
| 44 | Ga0105244_10002819 | 3300009036 | Bacteria | 12897 |
| 45 | Ga0105244_10102845 | 3300009036 | Bacteria | 1396 |
| 46 | Ga0105244_10115705 | 3300009036 | Bacteria | 1302 |
| 47 | Ga0105244_10130489 | 3300009036 | Bacteria | 1213 |
| 48 | Ga0105240_10060407 | 3300009093 | Bacteria | 4725 |
| 49 | Ga0105247_10019947 | 3300009101 | Bacteria | 4028 |
| 50 | Ga0114129_10025186 | 3300009147 | Bacteria | 8432 |
| 51 | Ga0114129_10111341 | 3300009147 | Bacteria | 3777 |
| 52 | Ga0105243_10060271 | 3300009148 | Bacteria | 3031 |
| 53 | Ga0105243_10084920 | 3300009148 | Bacteria | 2594 |
| 54 | Ga0105248_10168115 | 3300009177 | Bacteria | 2472 |
| 55 | Ga0105237_10006612 | 3300009545 | Bacteria | 12814 |
| 56 | Ga0105238_10318038 | 3300009551 | Bacteria | 1542 |
| 57 | Ga0105239_10039506 | 3300010375 | Bacteria | 5170 |
| 58 | Ga0105239_10240958 | 3300010375 | Bacteria | 2030 |
| 59 | Ga0105246_10004332 | 3300011119 | Bacteria | 8633 |
| 60 | Ga0105246_10024371 | 3300011119 | Bacteria | 3931 |
| 61 | Ga0105246_10075690 | 3300011119 | Bacteria | 2384 |
| 62 | Ga0105246_10182777 | 3300011119 | Bacteria | 1616 |
| 63 | Ga0157373_10012600 | 3300013100 | Bacteria | 6216 |
| 64 | Ga0157373_10221172 | 3300013100 | Bacteria | 1336 |
| 65 | Ga0157371_10005178 | 3300013102 | Bacteria | 11096 |
| 66 | Ga0157371_10018271 | 3300013102 | Bacteria | 5187 |
| 67 | Ga0157371_10481678 | 3300013102 | Bacteria | 915 |
| 68 | Ga0157370_10016411 | 3300013104 | Bacteria | 7497 |
| 69 | Ga0157370_10173016 | 3300013104 | Bacteria | 2007 |
| 70 | Ga0157369_10240404 | 3300013105 | Bacteria | 1891 |
| 71 | Ga0157372_10181842 | 3300013307 | Bacteria | 2434 |
| 72 | Ga0157380_10124383 | 3300014326 | Bacteria | 2190 |
| 73 | Ga0163161_10073380 | 3300017792 | Bacteria | 2507 |
| 74 | Ga0197907_10041850 | 3300020069 | Bacteria | 1279 |
| 75 | Ga0197907_10883299 | 3300020069 | Bacteria | 2272 |
| 76 | Ga0197907_10921460 | 3300020069 | Bacteria | 1680 |
| 77 | Ga0206356_11642392 | 3300020070 | Bacteria | 2340 |
| 78 | Ga0206349_1149272 | 3300020075 | Bacteria | 1862 |
| 79 | Ga0206349_1501613 | 3300020075 | Bacteria | 1752 |
| 80 | Ga0206349_1523504 | 3300020075 | Bacteria | 1883 |
| 81 | Ga0206349_1617487 | 3300020075 | Bacteria | 4234 |
| 82 | Ga0206355_1209876 | 3300020076 | Bacteria | 2324 |
| 83 | Ga0206355_1462619 | 3300020076 | Bacteria | 1207 |
| 84 | Ga0206355_1645477 | 3300020076 | Bacteria | 1923 |
| 85 | Ga0206355_1679439 | 3300020076 | Bacteria | 1138 |
| 86 | Ga0206352_10018184 | 3300020078 | Bacteria | 1877 |
| 87 | Ga0206350_11389734 | 3300020080 | Bacteria | 1175 |
| 88 | Ga0206353_10001084 | 3300020082 | Bacteria | 1395 |
| 89 | Ga0206353_11001418 | 3300020082 | Bacteria | 1771 |
| 90 | Ga0224712_10087087 | 3300022467 | Bacteria | 1301 |
| 91 | Ga0256720_141024 | 3300023438 | Bacteria | 1288 |
| 92 | Ga0209148_1003798 | 3300025254 | Bacteria | 3962 |
| 93 | Ga0209129_1000028 | 3300025258 | Bacteria | 405451 |
| 94 | Ga0209025_1000112 | 3300025294 | Bacteria | 218958 |
| 95 | Ga0209051_1002422 | 3300025303 | Bacteria | 13408 |
| 96 | Ga0209051_1025638 | 3300025303 | Bacteria | 2393 |
| 97 | Ga0207697_10003796 | 3300025315 | Bacteria | 7377 |
| 98 | Ga0207655_1003724 | 3300025728 | Bacteria | 11198 |
| 99 | Ga0207655_1005422 | 3300025728 | Bacteria | 8673 |
| 100 | Ga0207655_1036397 | 3300025728 | Bacteria | 2183 |
| 101 | Ga0207682_10006529 | 3300025893 | Bacteria | 4693 |
| 102 | Ga0207682_10231952 | 3300025893 | Bacteria | 856 |
| 103 | Ga0207710_10009691 | 3300025900 | Bacteria | 4048 |
| 104 | Ga0207680_10016041 | 3300025903 | Bacteria | 3923 |
| 105 | Ga0207647_10012992 | 3300025904 | Bacteria | 5784 |
| 106 | Ga0207647_10040553 | 3300025904 | Bacteria | 2932 |
| 107 | Ga0207645_10000942 | 3300025907 | Bacteria | 24175 |
| 108 | Ga0207671_10020897 | 3300025914 | Bacteria | 4977 |
| 109 | Ga0207681_10028062 | 3300025923 | Bacteria | 3644 |
| 110 | Ga0207694_10164834 | 3300025924 | Bacteria | 1792 |
| 111 | Ga0207659_10214258 | 3300025926 | Bacteria | 1545 |
| 112 | Ga0207644_10025495 | 3300025931 | Bacteria | 4066 |
| 113 | Ga0207709_10015059 | 3300025935 | Bacteria | 4283 |
| 114 | Ga0207709_10099249 | 3300025935 | Bacteria | 1921 |
| 115 | Ga0207669_10063795 | 3300025937 | Bacteria | 2276 |
| 116 | Ga0207669_10197284 | 3300025937 | Bacteria | 1458 |
| 117 | Ga0207691_10000527 | 3300025940 | Bacteria | 38169 |
| 118 | Ga0207711_10160477 | 3300025941 | Bacteria | 2034 |
| 119 | Ga0207651_10049192 | 3300025960 | Bacteria | 2855 |
| 120 | Ga0207658_10003895 | 3300025986 | Bacteria | 10500 |
| 121 | Ga0207658_10148048 | 3300025986 | Bacteria | 1909 |
| 122 | Ga0207639_10167737 | 3300026041 | Bacteria | 1856 |
| 123 | Ga0207683_10004866 | 3300026121 | Bacteria | 11556 |
| 124 | Ga0209974_10008938 | 3300027876 | Bacteria | 3411 |
| 125 | Ga0207428_10001932 | 3300027907 | Bacteria | 21004 |
| 126 | Ga0207428_10120650 | 3300027907 | Bacteria | 2010 |
| 127 | Ga0268266_10681680 | 3300028379 | Bacteria | 990 |
| 128 | Ga0316181_1102513 | 3300030744 | Bacteria | 1662 |
| 129 | Ga0316181_1173341 | 3300030744 | Bacteria | 2568 |
| 130 | Ga0316181_1254166 | 3300030744 | Bacteria | 1480 |
| 131 | Ga0316182_1156000 | 3300030745 | Bacteria | 1537 |
| 132 | Ga0307513_10416796 | 3300031456 | Bacteria | 1074 |
| 133 | Ga0307509_10463488 | 3300031507 | Bacteria | 959 |
| 134 | Ga0307408_100022658 | 3300031548 | Bacteria | 4270 |
| 135 | Ga0307408_100058737 | 3300031548 | Bacteria | 2797 |
| 136 | Ga0307408_100061230 | 3300031548 | Bacteria | 2747 |
| 137 | Ga0307408_100337469 | 3300031548 | Bacteria | 1274 |
| 138 | Ga0307408_100373679 | 3300031548 | Bacteria | 1216 |
| 139 | Ga0307405_10043363 | 3300031731 | Bacteria | 2744 |
| 140 | Ga0307405_10058297 | 3300031731 | Bacteria | 2429 |
| 141 | Ga0307405_10188428 | 3300031731 | Bacteria | 1487 |
| 142 | Ga0307405_10195115 | 3300031731 | Bacteria | 1465 |
| 143 | Ga0307413_10030191 | 3300031824 | Bacteria | 3042 |
| 144 | Ga0307518_10219325 | 3300031838 | Bacteria | 1243 |
| 145 | Ga0307410_10014648 | 3300031852 | Bacteria | 4622 |
| 146 | Ga0307410_10046522 | 3300031852 | Bacteria | 2895 |
| 147 | Ga0307410_10047562 | 3300031852 | Bacteria | 2867 |
| 148 | Ga0307410_10049727 | 3300031852 | Bacteria | 2815 |
| 149 | Ga0307410_10050622 | 3300031852 | Bacteria | 2794 |
| 150 | Ga0307410_10312157 | 3300031852 | Bacteria | 1244 |
| 151 | Ga0307406_10073271 | 3300031901 | Bacteria | 2251 |
| 152 | Ga0307406_10111665 | 3300031901 | Bacteria | 1883 |
| 153 | Ga0307406_10226513 | 3300031901 | Bacteria | 1393 |
| 154 | Ga0307406_10302240 | 3300031901 | Bacteria | 1230 |
| 155 | Ga0307406_10432736 | 3300031901 | Bacteria | 1051 |
| 156 | Ga0307406_10439279 | 3300031901 | Bacteria | 1044 |
| 157 | Ga0307406_10449759 | 3300031901 | Bacteria | 1033 |
| 158 | Ga0307407_10045209 | 3300031903 | Bacteria | 2486 |
| 159 | Ga0307407_10063809 | 3300031903 | Bacteria | 2162 |
| 160 | Ga0307412_10004948 | 3300031911 | Bacteria | 7444 |
| 161 | Ga0307412_10023570 | 3300031911 | Bacteria | 3789 |
| 162 | Ga0307412_10034210 | 3300031911 | Bacteria | 3237 |
| 163 | Ga0307412_10037342 | 3300031911 | Bacteria | 3120 |
| 164 | Ga0307412_10088021 | 3300031911 | Bacteria | 2165 |
| 165 | Ga0307409_100023923 | 3300031995 | Bacteria | 4245 |
| 166 | Ga0307409_100047274 | 3300031995 | Bacteria | 3264 |
| 167 | Ga0307409_100060223 | 3300031995 | Bacteria | 2959 |
| 168 | Ga0307409_100177437 | 3300031995 | Bacteria | 1882 |
| 169 | Ga0307409_100195237 | 3300031995 | Bacteria | 1806 |
| 170 | Ga0307409_100344083 | 3300031995 | Bacteria | 1404 |
| 171 | Ga0307409_100429921 | 3300031995 | Bacteria | 1269 |
| 172 | Ga0307416_100092498 | 3300032002 | Bacteria | 2601 |
| 173 | Ga0307416_100134643 | 3300032002 | Bacteria | 2232 |
| 174 | Ga0307416_100153618 | 3300032002 | Bacteria | 2115 |
| 175 | Ga0307416_100159686 | 3300032002 | Bacteria | 2081 |
| 176 | Ga0307416_100310269 | 3300032002 | Bacteria | 1573 |
| 177 | Ga0307414_10026643 | 3300032004 | Bacteria | 3723 |
| 178 | Ga0307414_10064402 | 3300032004 | Bacteria | 2610 |
| 179 | Ga0307414_10068752 | 3300032004 | Bacteria | 2543 |
| 180 | Ga0307414_10138120 | 3300032004 | Bacteria | 1904 |
| 181 | Ga0307414_10585305 | 3300032004 | Bacteria | 999 |
| 182 | Ga0307411_10016889 | 3300032005 | Bacteria | 4141 |
| 183 | Ga0307411_10028542 | 3300032005 | Bacteria | 3394 |
| 184 | Ga0307411_10081536 | 3300032005 | Bacteria | 2228 |
| 185 | Ga0307411_10123976 | 3300032005 | Bacteria | 1875 |
| 186 | Ga0307411_10252366 | 3300032005 | Bacteria | 1388 |
| 187 | Ga0307415_100048499 | 3300032126 | Bacteria | 2866 |
| 188 | Ga0307415_100059697 | 3300032126 | Bacteria | 2631 |
| 189 | Ga0307415_100092016 | 3300032126 | Bacteria | 2198 |
| 190 | Ga0307415_100110064 | 3300032126 | Bacteria | 2042 |
| 191 | Ga0373941_0182822 | 3300035115 | Bacteria | 788 |
| 192 | Ga0395899_0007503 | 3300037312 | Bacteria | 8426 |
| 193 | Ga0395899_0173817 | 3300037312 | Bacteria | 1515 |
| 194 | Ga0395900_0002047 | 3300037418 | Bacteria | 22659 |
| 195 | Ga0395900_0040941 | 3300037418 | Bacteria | 4776 |
| 196 | Ga0395898_0008893 | 3300037466 | Bacteria | 10582 |
| 197 | Ga0395898_0152921 | 3300037466 | Bacteria | 2207 |
| 198 | Ga0395898_0221610 | 3300037466 | Bacteria | 1804 |
| 199 | Ga0395898_0315705 | 3300037466 | Bacteria | 1491 |
| 200 | Ga0395905_0156926 | 3300037471 | Bacteria | 2140 |
| 201 | Ga0395901_0004494 | 3300038443 | Bacteria | 14064 |
| 202 | Ga0395901_0059247 | 3300038443 | Bacteria | 3983 |
| 203 | Ga0395901_0113352 | 3300038443 | Bacteria | 2847 |
| 204 | Ga0395901_0337104 | 3300038443 | Bacteria | 1558 |
| 205 | Ga0439436_0003335 | 3300041404 | Bacteria | 4871 |
| 206 | Ga0439436_0005666 | 3300041404 | Bacteria | 3828 |
| 207 | Ga0439438_004099 | 3300041405 | Bacteria | 5692 |
| 208 | Ga0439438_005948 | 3300041405 | Bacteria | 4405 |
| 209 | Ga0439439_0016589 | 3300041406 | Bacteria | 1805 |
| 210 | Ga0439466_0004675 | 3300041411 | Bacteria | 5258 |
| 211 | Ga0439466_0007953 | 3300041411 | Bacteria | 3998 |
| 212 | Ga0451797_1003365 | 3300041453 | Bacteria | 1551 |
| 213 | Ga0451845_0363161 | 3300041501 | Bacteria | 1035 |
| 214 | Ga0451843_0590751 | 3300041509 | Bacteria | 2058 |
| 215 | Ga0451853_0268759 | 3300041512 | Bacteria | 7039 |
| 216 | Ga0439433_0001597 | 3300041999 | Bacteria | 4709 |
| 217 | Ga0439433_0003189 | 3300041999 | Bacteria | 3517 |
| 218 | Ga0439442_000016 | 3300042002 | Bacteria | 46336 |
| 219 | Ga0439442_000103 | 3300042002 | Bacteria | 20871 |
| 220 | Ga0439442_023625 | 3300042002 | Bacteria | 1278 |
| 221 | Ga0439432_039357 | 3300042006 | Bacteria | 1503 |
| 222 | Ga0439449_0003489 | 3300042007 | Bacteria | 6109 |
| 223 | Ga0439449_0004784 | 3300042007 | Bacteria | 5223 |
| 224 | Ga0439449_0076015 | 3300042007 | Bacteria | 1238 |
| 225 | Ga0439452_018798 | 3300042010 | Bacteria | 1835 |
| 226 | Ga0439457_001975 | 3300042014 | Bacteria | 6030 |
| 227 | Ga0439457_041282 | 3300042014 | Bacteria | 1028 |
| 228 | Ga0439462_0025474 | 3300042015 | Bacteria | 1557 |
| 229 | Ga0450919_003602 | 3300042121 | Bacteria | 1922 |
| 230 | Ga0450906_006011 | 3300042145 | Bacteria | 2469 |
| 231 | Ga0450907_000274 | 3300042146 | Bacteria | 17342 |
| 232 | Ga0450908_013218 | 3300042184 | Bacteria | 1490 |
| 233 | Ga0450909_003926 | 3300042185 | Bacteria | 2117 |
| 234 | Ga0439434_0000202 | 3300042435 | Bacteria | 16473 |
| 235 | Ga0466969_0068421 | 3300044656 | Bacteria | 1711 |
| 236 | Ga0466966_0050994 | 3300044684 | Bacteria | 2631 |
| 237 | Ga0466963_0127715 | 3300044694 | Bacteria | 1754 |
| 238 | Ga0466971_0169276 | 3300044719 | Bacteria | 1025 |
| 239 | Ga0466970_0084939 | 3300044765 | Bacteria | 1714 |
| 240 | Ga0466957_0159309 | 3300044842 | Bacteria | 1465 |
| 241 | Ga0466957_0176370 | 3300044842 | Bacteria | 1394 |
| 242 | Ga0466959_0032012 | 3300045049 | Bacteria | 3892 |
| 243 | Ga0466967_0464771 | 3300045976 | Bacteria | 1238 |
| 244 | Ga0495638_0132184 | 3300046460 | Bacteria | 1465 |
| 245 | Ga0495580_0056310 | 3300046472 | Bacteria | 2769 |
| 246 | Ga0495580_0409965 | 3300046472 | Bacteria | 913 |
| 247 | Ga0495582_0060883 | 3300046473 | Bacteria | 2083 |
| 248 | Ga0495582_0088619 | 3300046473 | Bacteria | 1724 |
| 249 | Ga0495582_0188850 | 3300046473 | Bacteria | 1175 |
| 250 | Ga0495639_0010502 | 3300046475 | Bacteria | 3987 |
| 251 | Ga0495639_0170178 | 3300046475 | Bacteria | 1057 |
| 252 | Ga0495662_0019060 | 3300046476 | Bacteria | 3320 |
| 253 | Ga0495664_0005410 | 3300046477 | Bacteria | 7012 |
| 254 | Ga0495585_0024179 | 3300046492 | Bacteria | 3486 |
| 255 | Ga0495610_0068428 | 3300046512 | Bacteria | 1664 |
| 256 | Ga0495630_0037154 | 3300046517 | Bacteria | 3641 |
| 257 | Ga0495642_0053663 | 3300046528 | Bacteria | 1661 |
| 258 | Ga0495654_0045045 | 3300046530 | Bacteria | 2178 |
| 259 | Ga0495665_0060943 | 3300046531 | Bacteria | 1992 |
| 260 | Ga0495665_0191076 | 3300046531 | Bacteria | 1062 |
| 261 | Ga0495586_0033294 | 3300046535 | Bacteria | 2765 |
| 262 | Ga0495587_0008041 | 3300046536 | Bacteria | 6805 |
| 263 | Ga0495645_0006259 | 3300046543 | Bacteria | 8249 |
| 264 | Ga0495633_0059573 | 3300046558 | Bacteria | 1790 |
| 265 | Ga0495667_0015845 | 3300046559 | Bacteria | 5096 |
| 266 | Ga0495656_0028445 | 3300046615 | Bacteria | 2242 |
| 267 | Ga0495611_0178884 | 3300046648 | Bacteria | 991 |
| 268 | Ga0495659_0011805 | 3300046664 | Bacteria | 2817 |
| 269 | Ga0495588_0038153 | 3300046674 | Bacteria | 2443 |
| 270 | Ga0495588_0100785 | 3300046674 | Bacteria | 1517 |
| 271 | Ga0495588_0144375 | 3300046674 | Bacteria | 1257 |
| 272 | Ga0495658_0035093 | 3300046683 | Bacteria | 2757 |
| 273 | Ga0495670_0009605 | 3300046691 | Bacteria | 4752 |
| 274 | Ga0495600_0019690 | 3300046809 | Bacteria | 4312 |
| 275 | Ga0495581_0002129 | 3300047315 | Bacteria | 11164 |
| 276 | Ga0495581_0027488 | 3300047315 | Bacteria | 3298 |
| 277 | Ga0495604_0126028 | 3300047317 | Bacteria | 1846 |
| 278 | Ga0495636_0029889 | 3300047318 | Bacteria | 2225 |
| 279 | Ga0495636_0031043 | 3300047318 | Bacteria | 2188 |
| 280 | Ga0495674_0339998 | 3300047319 | Bacteria | 1220 |
| 281 | Ga0495676_0015037 | 3300047321 | Bacteria | 6908 |
| 282 | Ga0495680_0037272 | 3300047322 | Bacteria | 3895 |
| 283 | Ga0495675_0001496 | 3300047444 | Bacteria | 14149 |
| 284 | Ga0495685_015400 | 3300047447 | Bacteria | 2607 |
| 285 | Ga0495681_0103278 | 3300047470 | Bacteria | 1243 |
| 286 | Ga0496100_0043681 | 3300048903 | Bacteria | 2867 |
| 287 | Ga0496100_0182164 | 3300048903 | Bacteria | 1519 |
| 288 | Ga0496100_0265377 | 3300048903 | Bacteria | 1274 |
| 289 | Ga0496101_0015365 | 3300048904 | Bacteria | 5157 |
| 290 | Ga0496101_0020137 | 3300048904 | Bacteria | 4562 |
| 291 | Ga0496101_0127102 | 3300048904 | Bacteria | 1932 |
| 292 | Ga0496101_0177163 | 3300048904 | Bacteria | 1640 |
| 293 | Ga0496102_0000271 | 3300048905 | Bacteria | 66136 |
| 294 | Ga0496102_0012522 | 3300048905 | Bacteria | 7343 |
| 295 | Ga0496103_0000053 | 3300048906 | Bacteria | 148944 |
| 296 | Ga0496103_0045184 | 3300048906 | Bacteria | 2717 |
| 297 | Ga0496103_0110700 | 3300048906 | Bacteria | 1744 |
| 298 | Ga0496103_0205817 | 3300048906 | Bacteria | 1265 |
| 299 | Ga0496104_0164326 | 3300048907 | Bacteria | 2128 |
| 300 | Ga0496104_0195195 | 3300048907 | Bacteria | 1936 |
| 301 | Ga0496106_0122011 | 3300048909 | Bacteria | 2037 |
| 302 | Ga0496106_0390337 | 3300048909 | Bacteria | 1119 |
| 303 | Ga0496107_0266600 | 3300048910 | Bacteria | 1274 |
| 304 | Ga0496108_0150270 | 3300048911 | Bacteria | 2009 |
| 305 | Ga0496108_0357468 | 3300048911 | Bacteria | 1274 |
| 306 | Ga0496109_0174477 | 3300048912 | Bacteria | 2017 |
| 307 | Ga0496109_0754654 | 3300048912 | Bacteria | 911 |
| 308 | Ga0496110_0057751 | 3300048913 | Bacteria | 3416 |
| 309 | Ga0496110_0203120 | 3300048913 | Bacteria | 1801 |
| 310 | Ga0496110_0398032 | 3300048913 | Bacteria | 1255 |
| 311 | Ga0496112_0118245 | 3300048915 | Bacteria | 2620 |
| 312 | Ga0496113_0090874 | 3300048916 | Bacteria | 2352 |
| 313 | Ga0496114_0043173 | 3300048917 | Bacteria | 3739 |
| 314 | Ga0496114_0164721 | 3300048917 | Bacteria | 1929 |
| 315 | Ga0496115_0211087 | 3300048918 | Bacteria | 1603 |
| 316 | Ga0496118_0049847 | 3300048921 | Bacteria | 3220 |
| 317 | Ga0496118_0123005 | 3300048921 | Bacteria | 1686 |
| 318 | Ga0496119_0000595 | 3300048922 | Bacteria | 48961 |
| 319 | Ga0496119_0109368 | 3300048922 | Bacteria | 1537 |
| 320 | Ga0496121_0127495 | 3300048924 | Bacteria | 1911 |
| 321 | Ga0496124_0015199 | 3300048927 | Bacteria | 7390 |
| 322 | Ga0496125_0256166 | 3300048928 | Bacteria | 1100 |
| 323 | Ga0501306_000630 | 3300049127 | Bacteria | 2824 |
| 324 | Ga0501306_015079 | 3300049127 | Bacteria | 1025 |
| 325 | Ga0501306_021831 | 3300049127 | Bacteria | 899 |
| 326 | Ga0501306_022516 | 3300049127 | Bacteria | 889 |
| 327 | Ga0501306_024025 | 3300049127 | Bacteria | 869 |
| 328 | Ga0501308_000083 | 3300049128 | Bacteria | 4162 |
| 329 | Ga0501308_004929 | 3300049128 | Bacteria | 1309 |
| 330 | Ga0501309_000371 | 3300049129 | Bacteria | 3449 |
| 331 | Ga0501309_003031 | 3300049129 | Bacteria | 1874 |
| 332 | Ga0501310_000002 | 3300049130 | Bacteria | 24441 |
| 333 | Ga0501310_001752 | 3300049130 | Bacteria | 2004 |
| 334 | Ga0501310_002019 | 3300049130 | Bacteria | 1894 |
| 335 | Ga0501310_002136 | 3300049130 | Bacteria | 1857 |
| 336 | Ga0501310_016611 | 3300049130 | Bacteria | 884 |
| 337 | Ga0501341_01371 | 3300049131 | Bacteria | 1207 |
| 338 | Ga0501341_02237 | 3300049131 | Bacteria | 1032 |
| 339 | Ga0501343_004628 | 3300049132 | Bacteria | 1038 |
| 340 | Ga0501343_005512 | 3300049132 | Bacteria | 972 |
| 341 | Ga0501344_01177 | 3300049133 | Bacteria | 1231 |
| 342 | Ga0501344_01720 | 3300049133 | Bacteria | 1085 |
| 343 | Ga0501345_01269 | 3300049134 | Bacteria | 954 |
| 344 | Ga0501304_000152 | 3300049160 | Bacteria | 2867 |
| 345 | Ga0501305_003672 | 3300049161 | Bacteria | 1753 |
| 346 | Ga0501305_012042 | 3300049161 | Bacteria | 1178 |
| 347 | Ga0501305_031410 | 3300049161 | Bacteria | 829 |
| 348 | Ga0501307_000524 | 3300049162 | Bacteria | 2680 |
| 349 | Ga0501307_005915 | 3300049162 | Bacteria | 1304 |
| 350 | Ga0501307_009172 | 3300049162 | Bacteria | 1127 |
| 351 | Ga0501311_000172 | 3300049527 | Bacteria | 3669 |
| 352 | Ga0501311_004801 | 3300049527 | Bacteria | 1455 |
| 353 | Ga0501311_008481 | 3300049527 | Bacteria | 1206 |
| 354 | Ga0501312_008443 | 3300049528 | Bacteria | 1338 |
| 355 | Ga0501312_013519 | 3300049528 | Bacteria | 1136 |
| 356 | Ga0501313_016251 | 3300049529 | Bacteria | 892 |
| 357 | Ga0501314_003192 | 3300049530 | Bacteria | 1311 |
| 358 | Ga0501314_003869 | 3300049530 | Bacteria | 1222 |
| 359 | Ga0501315_000142 | 3300049531 | Bacteria | 4061 |
| 360 | Ga0501315_002033 | 3300049531 | Bacteria | 1844 |
| 361 | Ga0501316_000181 | 3300049532 | Bacteria | 3625 |
| 362 | Ga0501316_013348 | 3300049532 | Bacteria | 970 |
| 363 | Ga0501316_013591 | 3300049532 | Bacteria | 963 |
| 364 | Ga0501317_000111 | 3300049533 | Bacteria | 4331 |
| 365 | Ga0501317_000301 | 3300049533 | Bacteria | 3227 |
| 366 | Ga0501317_004488 | 3300049533 | Bacteria | 1454 |
| 367 | Ga0501317_006458 | 3300049533 | Bacteria | 1291 |
| 368 | Ga0501318_000130 | 3300049534 | Bacteria | 3542 |
| 369 | Ga0501318_007728 | 3300049534 | Bacteria | 1132 |
| 370 | Ga0501318_008279 | 3300049534 | Bacteria | 1107 |
| 371 | Ga0501318_015714 | 3300049534 | Bacteria | 907 |
| 372 | Ga0501319_001789 | 3300049535 | Bacteria | 1296 |
| 373 | Ga0501319_003795 | 3300049535 | Bacteria | 1027 |
| 374 | Ga0501319_005402 | 3300049535 | Bacteria | 916 |
| 375 | Ga0501320_000234 | 3300049536 | Bacteria | 2887 |
| 376 | Ga0501320_014770 | 3300049536 | Bacteria | 847 |
| 377 | Ga0501320_018746 | 3300049536 | Bacteria | 784 |
| 378 | Ga0501321_000208 | 3300049537 | Bacteria | 3357 |
| 379 | Ga0501321_003000 | 3300049537 | Bacteria | 1514 |
| 380 | Ga0501321_009285 | 3300049537 | Bacteria | 1059 |
| 381 | Ga0501321_013811 | 3300049537 | Bacteria | 932 |
| 382 | Ga0501321_014726 | 3300049537 | Bacteria | 913 |
| 383 | Ga0501322_000484 | 3300049538 | Bacteria | 1892 |
| 384 | Ga0501322_005534 | 3300049538 | Bacteria | 877 |
| 385 | Ga0501323_001384 | 3300049539 | Bacteria | 2132 |
| 386 | Ga0501323_008626 | 3300049539 | Bacteria | 1186 |
| 387 | Ga0501323_014194 | 3300049539 | Bacteria | 994 |
| 388 | Ga0501323_018360 | 3300049539 | Bacteria | 905 |
| 389 | Ga0501323_022393 | 3300049539 | Bacteria | 842 |
| 390 | Ga0501324_000068 | 3300049540 | Bacteria | 3635 |
| 391 | Ga0501324_002138 | 3300049540 | Bacteria | 1402 |
| 392 | Ga0501324_007614 | 3300049540 | Bacteria | 939 |
| 393 | Ga0501324_014776 | 3300049540 | Bacteria | 752 |
| 394 | Ga0501325_000164 | 3300049541 | Bacteria | 2560 |
| 395 | Ga0501325_008168 | 3300049541 | Bacteria | 903 |
| 396 | Ga0501325_012408 | 3300049541 | Bacteria | 802 |
| 397 | Ga0501327_01646 | 3300049543 | Bacteria | 1096 |
| 398 | Ga0501329_00615 | 3300049545 | Bacteria | 1328 |
| 399 | Ga0501329_01624 | 3300049545 | Bacteria | 1008 |
| 400 | Ga0501330_000025 | 3300049546 | Bacteria | 3750 |
| 401 | Ga0501330_002794 | 3300049546 | Bacteria | 1007 |
| 402 | Ga0501331_00074 | 3300049547 | Bacteria | 2981 |
| 403 | Ga0501332_00168 | 3300049548 | Bacteria | 2380 |
| 404 | Ga0501332_02226 | 3300049548 | Bacteria | 1072 |
| 405 | Ga0501333_000126 | 3300049549 | Bacteria | 2713 |
| 406 | Ga0501334_02914 | 3300049550 | Bacteria | 1039 |
| 407 | Ga0501335_000157 | 3300049551 | Bacteria | 3530 |
| 408 | Ga0501335_010556 | 3300049551 | Bacteria | 893 |
| 409 | Ga0501336_002506 | 3300049552 | Bacteria | 1183 |
| 410 | Ga0501336_003457 | 3300049552 | Bacteria | 1068 |
| 411 | Ga0501336_004922 | 3300049552 | Bacteria | 952 |
| 412 | Ga0501337_003618 | 3300049553 | Bacteria | 987 |
| 413 | Ga0501337_003840 | 3300049553 | Bacteria | 966 |
| 414 | Ga0501338_00806 | 3300049554 | Bacteria | 1531 |
| 415 | Ga0501338_01338 | 3300049554 | Bacteria | 1299 |
| 416 | Ga0501340_000052 | 3300049556 | Bacteria | 3246 |
| 417 | Ga0501340_000703 | 3300049556 | Bacteria | 1592 |
| 418 | Ga0501340_001742 | 3300049556 | Bacteria | 1206 |
| 419 | Ga0501031_0007437 | 3300049568 | Bacteria | 7139 |
| 420 | Ga0501031_0033272 | 3300049568 | Bacteria | 3362 |
| 421 | Ga0501032_0000380 | 3300049569 | Bacteria | 36690 |
| 422 | Ga0501032_0000405 | 3300049569 | Bacteria | 35578 |
| 423 | Ga0501032_0019357 | 3300049569 | Bacteria | 4762 |
| 424 | Ga0501032_0033526 | 3300049569 | Bacteria | 3518 |
| 425 | Ga0501032_0065868 | 3300049569 | Bacteria | 2422 |
| 426 | Ga0501034_0000051 | 3300049571 | Bacteria | 210960 |
| 427 | Ga0501036_0047687 | 3300049572 | Bacteria | 3627 |
| 428 | Ga0501036_0102000 | 3300049572 | Bacteria | 2427 |
| 429 | Ga0501036_0257113 | 3300049572 | Bacteria | 1463 |
| 430 | Ga0501036_0326044 | 3300049572 | Bacteria | 1283 |
| 431 | Ga0501036_0526236 | 3300049572 | Bacteria | 983 |
| 432 | Ga0501037_0005792 | 3300049573 | Bacteria | 9025 |
| 433 | Ga0501037_0010079 | 3300049573 | Bacteria | 6932 |
| 434 | Ga0501037_0106630 | 3300049573 | Bacteria | 2019 |
| 435 | Ga0501037_0420005 | 3300049573 | Bacteria | 915 |
| 436 | Ga0501038_0019718 | 3300049574 | Bacteria | 6071 |
| 437 | Ga0501038_0099598 | 3300049574 | Bacteria | 2422 |
| 438 | Ga0501039_0001155 | 3300049575 | Bacteria | 19447 |
| 439 | Ga0501039_0111117 | 3300049575 | Bacteria | 2142 |
| 440 | Ga0501042_0099916 | 3300049578 | Bacteria | 2086 |
| 441 | Ga0501042_0125117 | 3300049578 | Bacteria | 1851 |
| 442 | Ga0501043_0001210 | 3300049579 | Bacteria | 22716 |
| 443 | Ga0501043_0006168 | 3300049579 | Bacteria | 9630 |
| 444 | Ga0501043_0073181 | 3300049579 | Bacteria | 2692 |
| 445 | Ga0501043_0307784 | 3300049579 | Bacteria | 1209 |
| 446 | Ga0501043_0330582 | 3300049579 | Bacteria | 1161 |
| 447 | Ga0501048_0017941 | 3300049582 | Bacteria | 5208 |
| 448 | Ga0501067_0015413 | 3300049583 | Bacteria | 4231 |
| 449 | Ga0501068_0043904 | 3300049584 | Bacteria | 2690 |
| 450 | Ga0501069_0301360 | 3300049585 | Bacteria | 940 |
| 451 | Ga0501071_0029931 | 3300049587 | Bacteria | 3847 |
| 452 | Ga0501071_0130726 | 3300049587 | Bacteria | 1865 |
| 453 | Ga0501071_0234556 | 3300049587 | Bacteria | 1383 |
| 454 | Ga0501071_0360706 | 3300049587 | Bacteria | 1107 |
| 455 | Ga0501072_0008893 | 3300049588 | Bacteria | 7631 |
| 456 | Ga0501072_0054196 | 3300049588 | Bacteria | 3159 |
| 457 | Ga0501072_0068550 | 3300049588 | Bacteria | 2800 |
| 458 | Ga0501073_0231508 | 3300049589 | Bacteria | 1276 |
| 459 | Ga0501076_0028296 | 3300049592 | Bacteria | 4350 |
| 460 | Ga0501077_0005990 | 3300049593 | Bacteria | 7427 |
| 461 | Ga0501198_005314 | 3300049649 | Bacteria | 1810 |
| 462 | Ga0501217_061862 | 3300049661 | Bacteria | 1002 |
| 463 | Ga0501227_030278 | 3300049665 | Bacteria | 1295 |
| 464 | Ga0501079_0005360 | 3300049741 | Bacteria | 9550 |
| 465 | Ga0501081_0025216 | 3300049743 | Bacteria | 3999 |
| 466 | Ga0501279_004441 | 3300049775 | Bacteria | 1842 |
| 467 | Ga0501279_005137 | 3300049775 | Bacteria | 1718 |
| 468 | Ga0501035_0091206 | 3300049822 | Bacteria | 2682 |
| 469 | Ga0501045_0002793 | 3300049824 | Bacteria | 11936 |
| 470 | Ga0501045_0059732 | 3300049824 | Bacteria | 2794 |
| 471 | nmdc:mga03n38_58924_c1 | 3300050490 | Bacteria | 1741 |
| 472 | nmdc:mga00v17_50694_c1 | 3300050491 | Bacteria | 2523 |
| 473 | nmdc:mga0yw44_162537_c1 | 3300050492 | Bacteria | 1462 |
| 474 | nmdc:mga05p37_6969_c1 | 3300050507 | Bacteria | 13321 |
| 475 | nmdc:mga05p37_76500_c1 | 3300050507 | Bacteria | 4120 |
| 476 | nmdc:mga09592_19307_c1 | 3300050508 | Bacteria | 5597 |
| 477 | nmdc:mga0qj67_6313_c1 | 3300050509 | Bacteria | 8701 |
| 478 | nmdc:mga06r32_4780_c1 | 3300050510 | Bacteria | 12186 |
| 479 | Ga0500646_0023405 | 3300053090 | Bacteria | 1656 |
| 480 | Ga0500566_0300775 | 3300053094 | Bacteria | 755 |
| 481 | Ga0500620_014041 | 3300053155 | Bacteria | 2225 |
| 482 | Ga0500637_0154621 | 3300053178 | Bacteria | 1324 |
| 483 | Ga0501084_0052991 | 3300054114 | Bacteria | 3394 |
| 484 | Ga0587084_017739 | 3300059477 | Bacteria | 1030 |
| 485 | Ga0587066_016477 | 3300059490 | Bacteria | 1165 |
| 486 | Ga0587070_001320 | 3300059491 | Bacteria | 2522 |
| 487 | Ga0587070_013189 | 3300059491 | Bacteria | 1270 |
| 488 | Ga0587073_0024611 | 3300059492 | Bacteria | 1190 |
| 489 | Ga0587077_003663 | 3300059493 | Bacteria | 1953 |
| 490 | Ga0587077_019041 | 3300059493 | Bacteria | 1190 |
| 491 | Ga0587077_019919 | 3300059493 | Bacteria | 1173 |
| 492 | Ga0587083_0021385 | 3300059505 | Bacteria | 1201 |
| 493 | Ga0587083_0028320 | 3300059505 | Bacteria | 1096 |
| 494 | Ga0587085_010450 | 3300059506 | Bacteria | 1232 |
| 495 | Ga0587086_002039 | 3300059507 | Bacteria | 1843 |
| 496 | Ga0587086_002437 | 3300059507 | Bacteria | 1758 |
| 497 | Ga0587088_000794 | 3300059508 | Bacteria | 2922 |
| 498 | Ga0587088_002769 | 3300059508 | Bacteria | 2043 |
| 499 | Ga0587088_014855 | 3300059508 | Bacteria | 1218 |
| 500 | Ga0587088_015782 | 3300059508 | Bacteria | 1195 |
| 501 | Ga0587088_024393 | 3300059508 | Bacteria | 1036 |
| 502 | Ga0587089_010032 | 3300059509 | Bacteria | 1173 |
| 503 | Ga0587089_011278 | 3300059509 | Bacteria | 1124 |
| 504 | Ga0587090_000034 | 3300059510 | Bacteria | 7273 |
| 505 | Ga0587090_007167 | 3300059510 | Bacteria | 1457 |
| 506 | Ga0587090_014147 | 3300059510 | Bacteria | 1163 |
| 507 | Ga0587090_015786 | 3300059510 | Bacteria | 1121 |
| 508 | Ga0587091_005864 | 3300059511 | Bacteria | 1697 |
| 509 | Ga0587091_029733 | 3300059511 | Bacteria | 1017 |
| 510 | Ga0587092_001227 | 3300059512 | Bacteria | 2430 |
| 511 | Ga0587092_007352 | 3300059512 | Bacteria | 1424 |
| 512 | Ga0587094_005556 | 3300059513 | Bacteria | 1477 |
| 513 | Ga0587095_000680 | 3300059514 | Bacteria | 1849 |
| 514 | Ga0587098_001287 | 3300059604 | Bacteria | 1881 |
| 515 | Ga0587098_002772 | 3300059604 | Bacteria | 1513 |
| 516 | Ga0587098_004032 | 3300059604 | Bacteria | 1359 |
| 517 | Ga0587098_007112 | 3300059604 | Bacteria | 1156 |
| 518 | Ga0587098_009233 | 3300059604 | Bacteria | 1066 |
| 519 | Ga0587098_009847 | 3300059604 | Bacteria | 1046 |
| 520 | Ga0587106_011584 | 3300059605 | Bacteria | 1166 |
| 521 | Ga0587125_000208 | 3300059607 | Bacteria | 2931 |
| 522 | Ga0587125_002100 | 3300059607 | Bacteria | 1555 |
| 523 | Ga0587125_002578 | 3300059607 | Bacteria | 1466 |
| 524 | Ga0587131_001424 | 3300059609 | Bacteria | 1172 |
| 525 | Ga0587099_002919 | 3300059622 | Bacteria | 1385 |
| 526 | Ga0587101_000681 | 3300059623 | Bacteria | 2566 |
| 527 | Ga0587115_002343 | 3300059626 | Bacteria | 1869 |
| 528 | Ga0587115_003213 | 3300059626 | Bacteria | 1701 |
| 529 | Ga0587117_002450 | 3300059627 | Bacteria | 1734 |
| 530 | Ga0587128_000082 | 3300059630 | Bacteria | 4616 |
| 531 | Ga0587128_007708 | 3300059630 | Bacteria | 1369 |
| 532 | Ga0587130_002448 | 3300059631 | Bacteria | 1499 |
| 533 | Ga0587130_005051 | 3300059631 | Bacteria | 1171 |
| 534 | Ga0587062_006715 | 3300059639 | Bacteria | 1317 |
| 535 | Ga0587062_016541 | 3300059639 | Bacteria | 998 |
| 536 | Ga0587067_004373 | 3300059640 | Bacteria | 1838 |
| 537 | Ga0587067_017258 | 3300059640 | Bacteria | 1196 |
| 538 | Ga0587068_001676 | 3300059641 | Bacteria | 2549 |
| 539 | Ga0587068_004719 | 3300059641 | Bacteria | 1817 |
| 540 | Ga0587069_002709 | 3300059642 | Bacteria | 1825 |
| 541 | Ga0587072_000523 | 3300059643 | Bacteria | 3956 |
| 542 | Ga0587072_001753 | 3300059643 | Bacteria | 2775 |
| 543 | Ga0587072_005473 | 3300059643 | Bacteria | 1897 |
| 544 | Ga0587072_010836 | 3300059643 | Bacteria | 1480 |
| 545 | Ga0587075_003006 | 3300059644 | Bacteria | 1841 |
| 546 | Ga0587075_007821 | 3300059644 | Bacteria | 1352 |
| 547 | Ga0587076_002658 | 3300059645 | Bacteria | 2033 |
| 548 | Ga0587076_015707 | 3300059645 | Bacteria | 1184 |
| 549 | Ga0587076_017196 | 3300059645 | Bacteria | 1150 |
| 550 | Ga0587100_000571 | 3300059648 | Bacteria | 1823 |
| 551 | Ga0587100_002951 | 3300059648 | Bacteria | 1136 |
| 552 | Ga0587102_005100 | 3300059649 | Bacteria | 1147 |
| 553 | Ga0587104_002186 | 3300059650 | Bacteria | 1117 |
| 554 | Ga0587107_008721 | 3300059652 | Bacteria | 1178 |
| 555 | Ga0587107_010232 | 3300059652 | Bacteria | 1124 |
| 556 | Ga0587107_010253 | 3300059652 | Bacteria | 1123 |
| 557 | Ga0587108_002523 | 3300059653 | Bacteria | 1234 |
| 558 | Ga0587118_00745 | 3300059657 | Bacteria | 1762 |
| 559 | Ga0587119_002625 | 3300059658 | Bacteria | 1640 |
| 560 | Ga0587124_000497 | 3300059660 | Bacteria | 2175 |
| 561 | Ga0587060_001337 | 3300060243 | Bacteria | 1599 |
| 562 | Ga0587071_005777 | 3300060344 | Bacteria | 1908 |
| 563 | Ga0587071_006967 | 3300060344 | Bacteria | 1786 |
| 564 | Ga0587071_035127 | 3300060344 | Bacteria | 983 |
| 565 | Ga0587111_0018281 | 3300060346 | Bacteria | 1317 |
| 566 | Ga0587111_0027023 | 3300060346 | Bacteria | 1147 |
| 567 | Ga0587111_0053978 | 3300060346 | Bacteria | 895 |
| 568 | Ga0530510_0092484 | 3300061734 | Bacteria | 2207 |
| 569 | 2515718591 | 2515154129 | Bacteria | 5584369 |
| 570 | 2515854041 | 2515154155 | Bacteria | 7985436 |
| 571 | 2516082745 | 2515154202 | Bacteria | 5471270 |
| 572 | 2644036497 | 2643221604 | Bacteria | 5014917 |
| 573 | 2644230714 | 2643221641 | Bacteria | 4490190 |
| 574 | 2644608803 | 2643221711 | Bacteria | 4865335 |
| 575 | 2691514479 | 2690315906 | Bacteria | 4517044 |
| 576 | 2740167652 | 2739367898 | Bacteria | 4367674 |
| 577 | 2775655191 | 2775506735 | Bacteria | 4556596 |
| 578 | 2808827560 | 2808606357 | Bacteria | 4466944 |
| 579 | 2808852927 | 2808606360 | Bacteria | 4404006 |
| 580 | 2808878623 | 2808606366 | Bacteria | 4415912 |
| 581 | 2808891795 | 2808606370 | Bacteria | 4942454 |
| 582 | 2808896925 | 2808606371 | Bacteria | 4251511 |
| 583 | 2812320654 | 2811994871 | Bacteria | 4497550 |
| 584 | 2816427171 | 2816332119 | Bacteria | 8120218 |
| 585 | 2844849421 | 2844849076 | Bacteria | 4091819 |
| 586 | 2855390667 | 2855386786 | Bacteria | 4752232 |
| 587 | 2857741436 | 2857740372 | Bacteria | 4782044 |
| 588 | 2904499970 | 2904497146 | Bacteria | 4731781 |
| 589 | 2904776520 | 2904776348 | Bacteria | 4658726 |
| 590 | 2910809945 | 2910809715 | Bacteria | 4982797 |
| 591 | 2919037645 | 2919034639 | Bacteria | 4763403 |
| 592 | 2919061806 | 2919059106 | Bacteria | 4991624 |
| 593 | 2919391301 | 2919391150 | Bacteria | 4884741 |
| 594 | 2919542036 | 2919538618 | Bacteria | 4677069 |
| 595 | 2932429129 | 2932426870 | Bacteria | 4547726 |
| 596 | 2933420613 | 2933418574 | Bacteria | 4476724 |
| 597 | 2939598532 | 2939598168 | Bacteria | 4687164 |
| 598 | 2939648982 | 2939647034 | Bacteria | 4681660 |
| 599 | 2939676177 | 2939674588 | Bacteria | 4844420 |
| 600 | 2945918414 | 2945916053 | Bacteria | 4555517 |
| 601 | 2945921302 | 2945920336 | Bacteria | 4501603 |
| 602 | 2945942523 | 2945941187 | Bacteria | 4682474 |
| 603 | 2945959719 | 2945956166 | Bacteria | 5110334 |
| 604 | 2946026304 | 2946024296 | Bacteria | 3508095 |
| 605 | 2946038454 | 2946037020 | Bacteria | 4900426 |
| 606 | 2946062270 | 2946059875 | Bacteria | 4386623 |
| 607 | 2953999728 | 2953998280 | Bacteria | 4812144 |
| 608 | 2974306438 | 2974302888 | Bacteria | 4369871 |
| 609 | 8004022191 | 8004021418 | Bacteria | 4313954 |
| 610 | 8004027792 | 8004025490 | Bacteria | 4327753 |
| 611 | 8054111146 | 8054107350 | Bacteria | 5022511 |
| 612 | 8054613220 | 8054609563 | Bacteria | 5170090 |
| 613 | 8056056167 | 8056054917 | Bacteria | 5736694 |
| 614 | Ga0207695_10045170 | |||
| 615 | JGI24740J21852_10008668 | |||
| 616 | JGI24740J21852_10039999 | |||
| 617 | JGI24739J22299_10020615 | |||
| 618 | JGI24737J22298_10009344 | |||
| 619 | rootH1_10142602 | |||
| 620 | rootL2_10053942 | |||
| 621 | Ga0006562J51391_1012297 | |||
| 622 | Ga0006562J51391_1043916 | |||
| 623 | Ga0055542_1002924 | |||
| 624 | Ga0055540_1016886 | |||
| 625 | Ga0058860_12209293 | |||
| 626 | Ga0065714_10121544 | |||
| 627 | Ga0065712_10182123 | |||
| 628 | Ga0070670_100120636 | |||
| 629 | Ga0070677_10009883 | |||
| 630 | Ga0070666_10104650 | |||
| 631 | Ga0070669_100013533 | |||
| 632 | Ga0070671_100008922 | |||
| 633 | Ga0070674_100274620 | |||
| 634 | Ga0070674_100294522 | |||
| 635 | Ga0070673_100080821 | |||
| 636 | Ga0070667_100007806 | |||
| 637 | Ga0070678_100046046 | |||
| 638 | Ga0070678_100062597 | |||
| 639 | Ga0070678_100156550 | |||
| 640 | Ga0068856_100180827 | |||
| 641 | Ga0068859_100001140 | |||
| 642 | Ga0068861_100529633 | |||
| 643 | Ga0068858_100290220 | |||
| 644 | Ga0081455_10038410 | |||
| 645 | Ga0081538_10070061 | |||
| 646 | Ga0081540_1055632 | |||
| 647 | Ga0075365_10073130 | |||
| 648 | Ga0075364_10026836 | |||
| 649 | Ga0075432_10008799 | |||
| 650 | Ga0075428_100006863 | |||
| 651 | Ga0075428_100418972 | |||
| 652 | Ga0075430_100004192 | |||
| 653 | Ga0075431_100008746 | |||
| 654 | Ga0075429_100004098 | |||
| 655 | Ga0097620_100001140 | |||
| 656 | Ga0105251_10089782 | |||
| 657 | Ga0105244_10002819 | |||
| 658 | Ga0105244_10102845 | |||
| 659 | Ga0105244_10115705 | |||
| 660 | Ga0105244_10130489 | |||
| 661 | Ga0105240_10060407 | |||
| 662 | Ga0105247_10019947 | |||
| 663 | Ga0114129_10025186 | |||
| 664 | Ga0114129_10111341 | |||
| 665 | Ga0105243_10060271 | |||
| 666 | Ga0105243_10084920 | |||
| 667 | Ga0105248_10168115 | |||
| 668 | Ga0105237_10006612 | |||
| 669 | Ga0105238_10318038 | |||
| 670 | Ga0105239_10039506 | |||
| 671 | Ga0105239_10240958 | |||
| 672 | Ga0105246_10004332 | |||
| 673 | Ga0105246_10024371 | |||
| 674 | Ga0105246_10075690 | |||
| 675 | Ga0105246_10182777 | |||
| 676 | Ga0157373_10012600 | |||
| 677 | Ga0157373_10221172 | |||
| 678 | Ga0157371_10005178 | |||
| 679 | Ga0157371_10018271 | |||
| 680 | Ga0157371_10481678 | |||
| 681 | Ga0157370_10016411 | |||
| 682 | Ga0157370_10173016 | |||
| 683 | Ga0157369_10240404 | |||
| 684 | Ga0157372_10181842 | |||
| 685 | Ga0157380_10124383 | |||
| 686 | Ga0163161_10073380 | |||
| 687 | Ga0197907_10041850 | |||
| 688 | Ga0197907_10883299 | |||
| 689 | Ga0197907_10921460 | |||
| 690 | Ga0206356_11642392 | |||
| 691 | Ga0206349_1149272 | |||
| 692 | Ga0206349_1501613 | |||
| 693 | Ga0206349_1523504 | |||
| 694 | Ga0206349_1617487 | |||
| 695 | Ga0206355_1209876 | |||
| 696 | Ga0206355_1462619 | |||
| 697 | Ga0206355_1645477 | |||
| 698 | Ga0206355_1679439 | |||
| 699 | Ga0206352_10018184 | |||
| 700 | Ga0206350_11389734 | |||
| 701 | Ga0206353_10001084 | |||
| 702 | Ga0206353_11001418 | |||
| 703 | Ga0224712_10087087 | |||
| 704 | Ga0256720_141024 | |||
| 705 | Ga0209148_1003798 | |||
| 706 | Ga0209129_1000028 | |||
| 707 | Ga0209025_1000112 | |||
| 708 | Ga0209051_1002422 | |||
| 709 | Ga0209051_1025638 | |||
| 710 | Ga0207697_10003796 | |||
| 711 | Ga0207655_1003724 | |||
| 712 | Ga0207655_1005422 | |||
| 713 | Ga0207655_1036397 | |||
| 714 | Ga0207682_10006529 | |||
| 715 | Ga0207682_10231952 | |||
| 716 | Ga0207710_10009691 | |||
| 717 | Ga0207680_10016041 | |||
| 718 | Ga0207647_10012992 | |||
| 719 | Ga0207647_10040553 | |||
| 720 | Ga0207645_10000942 | |||
| 721 | Ga0207671_10020897 | |||
| 722 | Ga0207681_10028062 | |||
| 723 | Ga0207694_10164834 | |||
| 724 | Ga0207659_10214258 | |||
| 725 | Ga0207644_10025495 | |||
| 726 | Ga0207709_10015059 | |||
| 727 | Ga0207709_10099249 | |||
| 728 | Ga0207669_10063795 | |||
| 729 | Ga0207669_10197284 | |||
| 730 | Ga0207691_10000527 | |||
| 731 | Ga0207711_10160477 | |||
| 732 | Ga0207651_10049192 | |||
| 733 | Ga0207658_10003895 | |||
| 734 | Ga0207658_10148048 | |||
| 735 | Ga0207639_10167737 | |||
| 736 | Ga0207683_10004866 | |||
| 737 | Ga0209974_10008938 | |||
| 738 | Ga0207428_10001932 | |||
| 739 | Ga0207428_10120650 | |||
| 740 | Ga0268266_10681680 | |||
| 741 | Ga0316181_1102513 | |||
| 742 | Ga0316181_1173341 | |||
| 743 | Ga0316181_1254166 | |||
| 744 | Ga0316182_1156000 | |||
| 745 | Ga0307513_10416796 | |||
| 746 | Ga0307509_10463488 | |||
| 747 | Ga0307408_100022658 | |||
| 748 | Ga0307408_100058737 | |||
| 749 | Ga0307408_100061230 | |||
| 750 | Ga0307408_100337469 | |||
| 751 | Ga0307408_100373679 | |||
| 752 | Ga0307405_10043363 | |||
| 753 | Ga0307405_10058297 | |||
| 754 | Ga0307405_10188428 | |||
| 755 | Ga0307405_10195115 | |||
| 756 | Ga0307413_10030191 | |||
| 757 | Ga0307518_10219325 | |||
| 758 | Ga0307410_10014648 | |||
| 759 | Ga0307410_10046522 | |||
| 760 | Ga0307410_10047562 | |||
| 761 | Ga0307410_10049727 | |||
| 762 | Ga0307410_10050622 | |||
| 763 | Ga0307410_10312157 | |||
| 764 | Ga0307406_10073271 | |||
| 765 | Ga0307406_10111665 | |||
| 766 | Ga0307406_10226513 | |||
| 767 | Ga0307406_10302240 | |||
| 768 | Ga0307406_10432736 | |||
| 769 | Ga0307406_10439279 | |||
| 770 | Ga0307406_10449759 | |||
| 771 | Ga0307407_10045209 | |||
| 772 | Ga0307407_10063809 | |||
| 773 | Ga0307412_10004948 | |||
| 774 | Ga0307412_10023570 | |||
| 775 | Ga0307412_10034210 | |||
| 776 | Ga0307412_10037342 | |||
| 777 | Ga0307412_10088021 | |||
| 778 | Ga0307409_100023923 | |||
| 779 | Ga0307409_100047274 | |||
| 780 | Ga0307409_100060223 | |||
| 781 | Ga0307409_100177437 | |||
| 782 | Ga0307409_100195237 | |||
| 783 | Ga0307409_100344083 | |||
| 784 | Ga0307409_100429921 | |||
| 785 | Ga0307416_100092498 | |||
| 786 | Ga0307416_100134643 | |||
| 787 | Ga0307416_100153618 | |||
| 788 | Ga0307416_100159686 | |||
| 789 | Ga0307416_100310269 | |||
| 790 | Ga0307414_10026643 | |||
| 791 | Ga0307414_10064402 | |||
| 792 | Ga0307414_10068752 | |||
| 793 | Ga0307414_10138120 | |||
| 794 | Ga0307414_10585305 | |||
| 795 | Ga0307411_10016889 | |||
| 796 | Ga0307411_10028542 | |||
| 797 | Ga0307411_10081536 | |||
| 798 | Ga0307411_10123976 | |||
| 799 | Ga0307411_10252366 | |||
| 800 | Ga0307415_100048499 | |||
| 801 | Ga0307415_100059697 | |||
| 802 | Ga0307415_100092016 | |||
| 803 | Ga0307415_100110064 | |||
| 804 | Ga0373941_0182822 | |||
| 805 | Ga0395899_0007503 | |||
| 806 | Ga0395899_0173817 | |||
| 807 | Ga0395900_0002047 | |||
| 808 | Ga0395900_0040941 | |||
| 809 | Ga0395898_0008893 | |||
| 810 | Ga0395898_0152921 | |||
| 811 | Ga0395898_0221610 | |||
| 812 | Ga0395898_0315705 | |||
| 813 | Ga0395905_0156926 | |||
| 814 | Ga0395901_0004494 | |||
| 815 | Ga0395901_0059247 | |||
| 816 | Ga0395901_0113352 | |||
| 817 | Ga0395901_0337104 | |||
| 818 | Ga0439436_0003335 | |||
| 819 | Ga0439436_0005666 | |||
| 820 | Ga0439438_004099 | |||
| 821 | Ga0439438_005948 | |||
| 822 | Ga0439439_0016589 | |||
| 823 | Ga0439466_0004675 | |||
| 824 | Ga0439466_0007953 | |||
| 825 | Ga0451797_1003365 | |||
| 826 | Ga0451845_0363161 | |||
| 827 | Ga0451843_0590751 | |||
| 828 | Ga0451853_0268759 | |||
| 829 | Ga0439433_0001597 | |||
| 830 | Ga0439433_0003189 | |||
| 831 | Ga0439442_000016 | |||
| 832 | Ga0439442_000103 | |||
| 833 | Ga0439442_023625 | |||
| 834 | Ga0439432_039357 | |||
| 835 | Ga0439449_0003489 | |||
| 836 | Ga0439449_0004784 | |||
| 837 | Ga0439449_0076015 | |||
| 838 | Ga0439452_018798 | |||
| 839 | Ga0439457_001975 | |||
| 840 | Ga0439457_041282 | |||
| 841 | Ga0439462_0025474 | |||
| 842 | Ga0450919_003602 | |||
| 843 | Ga0450906_006011 | |||
| 844 | Ga0450907_000274 | |||
| 845 | Ga0450908_013218 | |||
| 846 | Ga0450909_003926 | |||
| 847 | Ga0439434_0000202 | |||
| 848 | Ga0466969_0068421 | |||
| 849 | Ga0466966_0050994 | |||
| 850 | Ga0466963_0127715 | |||
| 851 | Ga0466971_0169276 | |||
| 852 | Ga0466970_0084939 | |||
| 853 | Ga0466957_0159309 | |||
| 854 | Ga0466957_0176370 | |||
| 855 | Ga0466959_0032012 | |||
| 856 | Ga0466967_0464771 | |||
| 857 | Ga0495638_0132184 | |||
| 858 | Ga0495580_0056310 | |||
| 859 | Ga0495580_0409965 | |||
| 860 | Ga0495582_0060883 | |||
| 861 | Ga0495582_0088619 | |||
| 862 | Ga0495582_0188850 | |||
| 863 | Ga0495639_0010502 | |||
| 864 | Ga0495639_0170178 | |||
| 865 | Ga0495662_0019060 | |||
| 866 | Ga0495664_0005410 | |||
| 867 | Ga0495585_0024179 | |||
| 868 | Ga0495610_0068428 | |||
| 869 | Ga0495630_0037154 | |||
| 870 | Ga0495642_0053663 | |||
| 871 | Ga0495654_0045045 | |||
| 872 | Ga0495665_0060943 | |||
| 873 | Ga0495665_0191076 | |||
| 874 | Ga0495586_0033294 | |||
| 875 | Ga0495587_0008041 | |||
| 876 | Ga0495645_0006259 | |||
| 877 | Ga0495633_0059573 | |||
| 878 | Ga0495667_0015845 | |||
| 879 | Ga0495656_0028445 | |||
| 880 | Ga0495611_0178884 | |||
| 881 | Ga0495659_0011805 | |||
| 882 | Ga0495588_0038153 | |||
| 883 | Ga0495588_0100785 | |||
| 884 | Ga0495588_0144375 | |||
| 885 | Ga0495658_0035093 | |||
| 886 | Ga0495670_0009605 | |||
| 887 | Ga0495600_0019690 | |||
| 888 | Ga0495581_0002129 | |||
| 889 | Ga0495581_0027488 | |||
| 890 | Ga0495604_0126028 | |||
| 891 | Ga0495636_0029889 | |||
| 892 | Ga0495636_0031043 | |||
| 893 | Ga0495674_0339998 | |||
| 894 | Ga0495676_0015037 | |||
| 895 | Ga0495680_0037272 | |||
| 896 | Ga0495675_0001496 | |||
| 897 | Ga0495685_015400 | |||
| 898 | Ga0495681_0103278 | |||
| 899 | Ga0496100_0043681 | |||
| 900 | Ga0496100_0182164 | |||
| 901 | Ga0496100_0265377 | |||
| 902 | Ga0496101_0015365 | |||
| 903 | Ga0496101_0020137 | |||
| 904 | Ga0496101_0127102 | |||
| 905 | Ga0496101_0177163 | |||
| 906 | Ga0496102_0000271 | |||
| 907 | Ga0496102_0012522 | |||
| 908 | Ga0496103_0000053 | |||
| 909 | Ga0496103_0045184 | |||
| 910 | Ga0496103_0110700 | |||
| 911 | Ga0496103_0205817 | |||
| 912 | Ga0496104_0164326 | |||
| 913 | Ga0496104_0195195 | |||
| 914 | Ga0496106_0122011 | |||
| 915 | Ga0496106_0390337 | |||
| 916 | Ga0496107_0266600 | |||
| 917 | Ga0496108_0150270 | |||
| 918 | Ga0496108_0357468 | |||
| 919 | Ga0496109_0174477 | |||
| 920 | Ga0496109_0754654 | |||
| 921 | Ga0496110_0057751 | |||
| 922 | Ga0496110_0203120 | |||
| 923 | Ga0496110_0398032 | |||
| 924 | Ga0496112_0118245 | |||
| 925 | Ga0496113_0090874 | |||
| 926 | Ga0496114_0043173 | |||
| 927 | Ga0496114_0164721 | |||
| 928 | Ga0496115_0211087 | |||
| 929 | Ga0496118_0049847 | |||
| 930 | Ga0496118_0123005 | |||
| 931 | Ga0496119_0000595 | |||
| 932 | Ga0496119_0109368 | |||
| 933 | Ga0496121_0127495 | |||
| 934 | Ga0496124_0015199 | |||
| 935 | Ga0496125_0256166 | |||
| 936 | Ga0501306_000630 | |||
| 937 | Ga0501306_015079 | |||
| 938 | Ga0501306_021831 | |||
| 939 | Ga0501306_022516 | |||
| 940 | Ga0501306_024025 | |||
| 941 | Ga0501308_000083 | |||
| 942 | Ga0501308_004929 | |||
| 943 | Ga0501309_000371 | |||
| 944 | Ga0501309_003031 | |||
| 945 | Ga0501310_000002 | |||
| 946 | Ga0501310_001752 | |||
| 947 | Ga0501310_002019 | |||
| 948 | Ga0501310_002136 | |||
| 949 | Ga0501310_016611 | |||
| 950 | Ga0501341_01371 | |||
| 951 | Ga0501341_02237 | |||
| 952 | Ga0501343_004628 | |||
| 953 | Ga0501343_005512 | |||
| 954 | Ga0501344_01177 | |||
| 955 | Ga0501344_01720 | |||
| 956 | Ga0501345_01269 | |||
| 957 | Ga0501304_000152 | |||
| 958 | Ga0501305_003672 | |||
| 959 | Ga0501305_012042 | |||
| 960 | Ga0501305_031410 | |||
| 961 | Ga0501307_000524 | |||
| 962 | Ga0501307_005915 | |||
| 963 | Ga0501307_009172 | |||
| 964 | Ga0501311_000172 | |||
| 965 | Ga0501311_004801 | |||
| 966 | Ga0501311_008481 | |||
| 967 | Ga0501312_008443 | |||
| 968 | Ga0501312_013519 | |||
| 969 | Ga0501313_016251 | |||
| 970 | Ga0501314_003192 | |||
| 971 | Ga0501314_003869 | |||
| 972 | Ga0501315_000142 | |||
| 973 | Ga0501315_002033 | |||
| 974 | Ga0501316_000181 | |||
| 975 | Ga0501316_013348 | |||
| 976 | Ga0501316_013591 | |||
| 977 | Ga0501317_000111 | |||
| 978 | Ga0501317_000301 | |||
| 979 | Ga0501317_004488 | |||
| 980 | Ga0501317_006458 | |||
| 981 | Ga0501318_000130 | |||
| 982 | Ga0501318_007728 | |||
| 983 | Ga0501318_008279 | |||
| 984 | Ga0501318_015714 | |||
| 985 | Ga0501319_001789 | |||
| 986 | Ga0501319_003795 | |||
| 987 | Ga0501319_005402 | |||
| 988 | Ga0501320_000234 | |||
| 989 | Ga0501320_014770 | |||
| 990 | Ga0501320_018746 | |||
| 991 | Ga0501321_000208 | |||
| 992 | Ga0501321_003000 | |||
| 993 | Ga0501321_009285 | |||
| 994 | Ga0501321_013811 | |||
| 995 | Ga0501321_014726 | |||
| 996 | Ga0501322_000484 | |||
| 997 | Ga0501322_005534 | |||
| 998 | Ga0501323_001384 | |||
| 999 | Ga0501323_008626 | |||
| 1000 | Ga0501323_014194 | |||
| 1001 | Ga0501323_018360 | |||
| 1002 | Ga0501323_022393 | |||
| 1003 | Ga0501324_000068 | |||
| 1004 | Ga0501324_002138 | |||
| 1005 | Ga0501324_007614 | |||
| 1006 | Ga0501324_014776 | |||
| 1007 | Ga0501325_000164 | |||
| 1008 | Ga0501325_008168 | |||
| 1009 | Ga0501325_012408 | |||
| 1010 | Ga0501327_01646 | |||
| 1011 | Ga0501329_00615 | |||
| 1012 | Ga0501329_01624 | |||
| 1013 | Ga0501330_000025 | |||
| 1014 | Ga0501330_002794 | |||
| 1015 | Ga0501331_00074 | |||
| 1016 | Ga0501332_00168 | |||
| 1017 | Ga0501332_02226 | |||
| 1018 | Ga0501333_000126 | |||
| 1019 | Ga0501334_02914 | |||
| 1020 | Ga0501335_000157 | |||
| 1021 | Ga0501335_010556 | |||
| 1022 | Ga0501336_002506 | |||
| 1023 | Ga0501336_003457 | |||
| 1024 | Ga0501336_004922 | |||
| 1025 | Ga0501337_003618 | |||
| 1026 | Ga0501337_003840 | |||
| 1027 | Ga0501338_00806 | |||
| 1028 | Ga0501338_01338 | |||
| 1029 | Ga0501340_000052 | |||
| 1030 | Ga0501340_000703 | |||
| 1031 | Ga0501340_001742 | |||
| 1032 | Ga0501031_0007437 | |||
| 1033 | Ga0501031_0033272 | |||
| 1034 | Ga0501032_0000380 | |||
| 1035 | Ga0501032_0000405 | |||
| 1036 | Ga0501032_0019357 | |||
| 1037 | Ga0501032_0033526 | |||
| 1038 | Ga0501032_0065868 | |||
| 1039 | Ga0501034_0000051 | |||
| 1040 | Ga0501036_0047687 | |||
| 1041 | Ga0501036_0102000 | |||
| 1042 | Ga0501036_0257113 | |||
| 1043 | Ga0501036_0326044 | |||
| 1044 | Ga0501036_0526236 | |||
| 1045 | Ga0501037_0005792 | |||
| 1046 | Ga0501037_0010079 | |||
| 1047 | Ga0501037_0106630 | |||
| 1048 | Ga0501037_0420005 | |||
| 1049 | Ga0501038_0019718 | |||
| 1050 | Ga0501038_0099598 | |||
| 1051 | Ga0501039_0001155 | |||
| 1052 | Ga0501039_0111117 | |||
| 1053 | Ga0501042_0099916 | |||
| 1054 | Ga0501042_0125117 | |||
| 1055 | Ga0501043_0001210 | |||
| 1056 | Ga0501043_0006168 | |||
| 1057 | Ga0501043_0073181 | |||
| 1058 | Ga0501043_0307784 | |||
| 1059 | Ga0501043_0330582 | |||
| 1060 | Ga0501048_0017941 | |||
| 1061 | Ga0501067_0015413 | |||
| 1062 | Ga0501068_0043904 | |||
| 1063 | Ga0501069_0301360 | |||
| 1064 | Ga0501071_0029931 | |||
| 1065 | Ga0501071_0130726 | |||
| 1066 | Ga0501071_0234556 | |||
| 1067 | Ga0501071_0360706 | |||
| 1068 | Ga0501072_0008893 | |||
| 1069 | Ga0501072_0054196 | |||
| 1070 | Ga0501072_0068550 | |||
| 1071 | Ga0501073_0231508 | |||
| 1072 | Ga0501076_0028296 | |||
| 1073 | Ga0501077_0005990 | |||
| 1074 | Ga0501198_005314 | |||
| 1075 | Ga0501217_061862 | |||
| 1076 | Ga0501227_030278 | |||
| 1077 | Ga0501079_0005360 | |||
| 1078 | Ga0501081_0025216 | |||
| 1079 | Ga0501279_004441 | |||
| 1080 | Ga0501279_005137 | |||
| 1081 | Ga0501035_0091206 | |||
| 1082 | Ga0501045_0002793 | |||
| 1083 | Ga0501045_0059732 | |||
| 1084 | nmdc:mga03n38_58924_c1 | |||
| 1085 | nmdc:mga00v17_50694_c1 | |||
| 1086 | nmdc:mga0yw44_162537_c1 | |||
| 1087 | nmdc:mga05p37_6969_c1 | |||
| 1088 | nmdc:mga05p37_76500_c1 | |||
| 1089 | nmdc:mga09592_19307_c1 | |||
| 1090 | nmdc:mga0qj67_6313_c1 | |||
| 1091 | nmdc:mga06r32_4780_c1 | |||
| 1092 | Ga0500646_0023405 | |||
| 1093 | Ga0500566_0300775 | |||
| 1094 | Ga0500620_014041 | |||
| 1095 | Ga0500637_0154621 | |||
| 1096 | Ga0501084_0052991 | |||
| 1097 | Ga0587084_017739 | |||
| 1098 | Ga0587066_016477 | |||
| 1099 | Ga0587070_001320 | |||
| 1100 | Ga0587070_013189 | |||
| 1101 | Ga0587073_0024611 | |||
| 1102 | Ga0587077_003663 | |||
| 1103 | Ga0587077_019041 | |||
| 1104 | Ga0587077_019919 | |||
| 1105 | Ga0587083_0021385 | |||
| 1106 | Ga0587083_0028320 | |||
| 1107 | Ga0587085_010450 | |||
| 1108 | Ga0587086_002039 | |||
| 1109 | Ga0587086_002437 | |||
| 1110 | Ga0587088_000794 | |||
| 1111 | Ga0587088_002769 | |||
| 1112 | Ga0587088_014855 | |||
| 1113 | Ga0587088_015782 | |||
| 1114 | Ga0587088_024393 | |||
| 1115 | Ga0587089_010032 | |||
| 1116 | Ga0587089_011278 | |||
| 1117 | Ga0587090_000034 | |||
| 1118 | Ga0587090_007167 | |||
| 1119 | Ga0587090_014147 | |||
| 1120 | Ga0587090_015786 | |||
| 1121 | Ga0587091_005864 | |||
| 1122 | Ga0587091_029733 | |||
| 1123 | Ga0587092_001227 | |||
| 1124 | Ga0587092_007352 | |||
| 1125 | Ga0587094_005556 | |||
| 1126 | Ga0587095_000680 | |||
| 1127 | Ga0587098_001287 | |||
| 1128 | Ga0587098_002772 | |||
| 1129 | Ga0587098_004032 | |||
| 1130 | Ga0587098_007112 | |||
| 1131 | Ga0587098_009233 | |||
| 1132 | Ga0587098_009847 | |||
| 1133 | Ga0587106_011584 | |||
| 1134 | Ga0587125_000208 | |||
| 1135 | Ga0587125_002100 | |||
| 1136 | Ga0587125_002578 | |||
| 1137 | Ga0587131_001424 | |||
| 1138 | Ga0587099_002919 | |||
| 1139 | Ga0587101_000681 | |||
| 1140 | Ga0587115_002343 | |||
| 1141 | Ga0587115_003213 | |||
| 1142 | Ga0587117_002450 | |||
| 1143 | Ga0587128_000082 | |||
| 1144 | Ga0587128_007708 | |||
| 1145 | Ga0587130_002448 | |||
| 1146 | Ga0587130_005051 | |||
| 1147 | Ga0587062_006715 | |||
| 1148 | Ga0587062_016541 | |||
| 1149 | Ga0587067_004373 | |||
| 1150 | Ga0587067_017258 | |||
| 1151 | Ga0587068_001676 | |||
| 1152 | Ga0587068_004719 | |||
| 1153 | Ga0587069_002709 | |||
| 1154 | Ga0587072_000523 | |||
| 1155 | Ga0587072_001753 | |||
| 1156 | Ga0587072_005473 | |||
| 1157 | Ga0587072_010836 | |||
| 1158 | Ga0587075_003006 | |||
| 1159 | Ga0587075_007821 | |||
| 1160 | Ga0587076_002658 | |||
| 1161 | Ga0587076_015707 | |||
| 1162 | Ga0587076_017196 | |||
| 1163 | Ga0587100_000571 | |||
| 1164 | Ga0587100_002951 | |||
| 1165 | Ga0587102_005100 | |||
| 1166 | Ga0587104_002186 | |||
| 1167 | Ga0587107_008721 | |||
| 1168 | Ga0587107_010232 | |||
| 1169 | Ga0587107_010253 | |||
| 1170 | Ga0587108_002523 | |||
| 1171 | Ga0587118_00745 | |||
| 1172 | Ga0587119_002625 | |||
| 1173 | Ga0587124_000497 | |||
| 1174 | Ga0587060_001337 | |||
| 1175 | Ga0587071_005777 | |||
| 1176 | Ga0587071_006967 | |||
| 1177 | Ga0587071_035127 | |||
| 1178 | Ga0587111_0018281 | |||
| 1179 | Ga0587111_0027023 | |||
| 1180 | Ga0587111_0053978 | |||
| 1181 | Ga0530510_0092484 | |||
| 1182 | 2515718591 | |||
| 1183 | 2515854041 | |||
| 1184 | 2516082745 | |||
| 1185 | 2644036497 | |||
| 1186 | 2644230714 | |||
| 1187 | 2644608803 | |||
| 1188 | 2691514479 | |||
| 1189 | 2740167652 | |||
| 1190 | 2775655191 | |||
| 1191 | 2808827560 | |||
| 1192 | 2808852927 | |||
| 1193 | 2808878623 | |||
| 1194 | 2808891795 | |||
| 1195 | 2808896925 | |||
| 1196 | 2812320654 | |||
| 1197 | 2816427171 | |||
| 1198 | 2844849421 | |||
| 1199 | 2855390667 | |||
| 1200 | 2857741436 | |||
| 1201 | 2904499970 | |||
| 1202 | 2904776520 | |||
| 1203 | 2910809945 | |||
| 1204 | 2919037645 | |||
| 1205 | 2919061806 | |||
| 1206 | 2919391301 | |||
| 1207 | 2919542036 | |||
| 1208 | 2932429129 | |||
| 1209 | 2933420613 | |||
| 1210 | 2939598532 | |||
| 1211 | 2939648982 | |||
| 1212 | 2939676177 | |||
| 1213 | 2945918414 | |||
| 1214 | 2945921302 | |||
| 1215 | 2945942523 | |||
| 1216 | 2945959719 | |||
| 1217 | 2946026304 | |||
| 1218 | 2946038454 | |||
| 1219 | 2946062270 | |||
| 1220 | 2953999728 | |||
| 1221 | 2974306438 | |||
| 1222 | 8004022191 | |||
| 1223 | 8004027792 | |||
| 1224 | 8054111146 | |||
| 1225 | 8054613220 | |||
| 1226 | 8056056167 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6b2z-assembly1.cif.gz_a | cryo-em structure of the dimeric fo region of yeast mitochondrial atp synthase | 0.8165 | 31 | 257 |
| 7tjy-assembly1.cif.gz_T | yeast atp synthase state 1catalytic(a) without exogenous atp backbone model | 0.8107 | 30 | 256 |
| 6wtd-assembly1.cif.gz_X | monomer yeast atp synthase fo reconstituted in nanodisc with inhibitor of bedaquiline bound | 0.7983 | 34 | 256 |
| 7jg8-assembly1.cif.gz_a | cryo-em structure of bedaquiline-saturated mycobacterium smegmatis atp synthase rotational state 1 (backbone model) | 0.7981 | 33 | 256 |
| 7tjy-assembly1.cif.gz_T | yeast atp synthase state 1catalytic(a) without exogenous atp backbone model | 0.7951 | 30 | 256 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_M1FN39_66_236_1.20.120.220 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);ATP synthase, F0 complex, subunit A | 0.8538 | 87 | 256 | 1.20.120.220 |
| af_Q27559_82_244_1.20.120.220 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);ATP synthase, F0 complex, subunit A | 0.8384 | 88 | 256 | 1.20.120.220 |
| af_M1FN39_66_236_1.20.120.220 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);ATP synthase, F0 complex, subunit A | 0.8227 | 87 | 256 | 1.20.120.220 |
| af_Q27559_82_244_1.20.120.220 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);ATP synthase, F0 complex, subunit A | 0.8155 | 88 | 256 | 1.20.120.220 |
| af_P00854_92_259_1.20.120.220 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);ATP synthase, F0 complex, subunit A | 0.7888 | 87 | 258 | 1.20.120.220 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7X0LQZ8-F1-model_v4 | ATP synthase subunit a (ATP synthase F0 sector subunit a) (F-ATPase subunit 6) | 0.9175 | 6 | 260 |
GO:0005886
GO:0045263 GO:0046933 |
| AF-A0A4P5S1Y1-F1-model_v4 | ATP synthase subunit a (ATP synthase F0 sector subunit a) (F-ATPase subunit 6) | 0.9088 | 15 | 260 |
GO:0005886
GO:0045263 GO:0046933 |
| AF-A0A4R4PIR7-F1-model_v4 | ATP synthase subunit a (ATP synthase F0 sector subunit a) (F-ATPase subunit 6) | 0.9086 | 6 | 260 |
GO:0005886
GO:0045263 GO:0046933 |
| AF-A0A7W3T670-F1-model_v4 | ATP synthase subunit a (ATP synthase F0 sector subunit a) (F-ATPase subunit 6) | 0.9084 | 6 | 260 |
GO:0005886
GO:0045263 GO:0046933 |
| AF-A0A7W3TE50-F1-model_v4 | ATP synthase subunit a (ATP synthase F0 sector subunit a) (F-ATPase subunit 6) | 0.9082 | 6 | 260 |
GO:0005886
GO:0045263 GO:0046933 |