F469236

General Info

Members Datasets Scaffolds Average Seq Length
613 327 591 330

Family's Representative Sequence

Representative Sequence 3300005842|Ga0068858_100000034|Ga0068858_10000003457
Length 369
Sequence VTETMPAPAPAAVRPGAGGRPPDGTPTSENRTMVEALGAALRDAMAADDRVVVFGEDVGALGGVFRVTSGLRDAFGDERCFDTPLAEAGIVGFAVGMAMYGSRPVVELQFDAFAYPAFEQIVSHVAKMSARTAGRVRLPIVLRIPYGGGIGAVEHHSDSSEAYYAHTAGLKVVTPSTPADAYVLLRAAIDDPDPVVFLEPKRLYWNRSPQPDVDVPPAPLGRAAVRRAGQDVTLITYGPAVPLALAAAQAAAGRGWSVEVVDLRTLVPFDDETVVASVRRTGRALVVHEASGFAGMGAEIAARVSERCFHSLAAPILRVTGFDVPYPPPKLEQHHLPGVARILGALGRLQWDDQPDTYWLAGPPPGDRR

Samples

Sample ID Description Type Environment
1 2508501039 Frankia saprophytica CN3 Isolate Nodule
2 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
3 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
4 2687453737 Frankia sp. BMG5.36 Isolate Nodule
5 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
6 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
7 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
8 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
9 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
10 2867475112 Streptomyces sp. TM32 Isolate Unclassified
11 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
12 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
13 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
14 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
15 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
16 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
17 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
18 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
19 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
20 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
21 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
22 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
23 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
24 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
25 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
26 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
27 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
28 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
29 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
30 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
32 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
33 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
34 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
35 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
36 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
37 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
38 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
39 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
40 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
41 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
42 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
43 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
44 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
45 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
46 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
47 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
48 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
49 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
50 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
51 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
52 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
53 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
54 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
55 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
56 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
57 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
58 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
59 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
60 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
61 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
62 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
63 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
64 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
65 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
66 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
67 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
68 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
69 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
70 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
71 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
72 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
73 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
74 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
75 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
76 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
77 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
78 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
79 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
80 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
81 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
82 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
83 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
84 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
85 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
86 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
87 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
88 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
89 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
90 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
91 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
92 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
93 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
94 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
95 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
96 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
97 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
98 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
99 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
100 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
101 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
103 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
104 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
105 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
107 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
108 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
110 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
111 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
112 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
113 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
114 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
115 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
116 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
117 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
118 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
119 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
120 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
121 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
122 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
123 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
124 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
125 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
126 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
127 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
133 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
134 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
184 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
185 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
189 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
190 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
191 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
192 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
193 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
194 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
195 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
196 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
197 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
198 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
199 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
200 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
201 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
202 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
203 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
204 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
205 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
206 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
207 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
208 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
209 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
210 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
211 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
212 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
213 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
214 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
215 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
216 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
217 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
218 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
219 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
220 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
221 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
222 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
223 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
224 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
225 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
226 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
227 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
228 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
229 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
230 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
231 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
232 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
233 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
234 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
235 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
236 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
237 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
238 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
239 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
240 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
241 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
242 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
243 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
244 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
245 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
246 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
247 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
248 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
249 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
250 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
251 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
252 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
253 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
254 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
255 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
256 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
257 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
258 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
259 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
260 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
261 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
262 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
263 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
264 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
265 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
281 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
282 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
283 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
284 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
285 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
286 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
287 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
288 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
289 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
290 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
291 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
292 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
293 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
294 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
295 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
296 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
297 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
298 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
299 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
302 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
303 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
304 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
305 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
306 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
307 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
308 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
309 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
310 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
311 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
312 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
313 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
314 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
315 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
316 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
317 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
318 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
319 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
320 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
321 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
322 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
323 8002775197 Frankia nepalensis CN7 Isolate Nodule
324 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
325 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
326 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
327 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.11
Metatranscriptomes 1.31
Isolates 3.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.45
Nodule 1.14
Rhizoplane 2.94
Rhizosphere 88.91
Stem 0
Stem Tuber 0
Unclassified 4.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1000320 3300001904 Bacteria 8931
2 JGI24736J21556_1000835 3300001904 Bacteria 5686
3 JGI24741J21665_1000003 3300001915 Bacteria 56179
4 JGI24740J21852_10003002 3300001979 Bacteria 7467
5 JGI24739J22299_10001560 3300001989 Bacteria 8672
6 JGI24739J22299_10004735 3300001989 Bacteria 5195
7 JGI24739J22299_10025391 3300001989 Bacteria 2084
8 JGI24737J22298_10001968 3300001990 Bacteria 7342
9 JGI24737J22298_10002768 3300001990 Bacteria 6207
10 JGI24735J21928_10000770 3300002067 Bacteria 11406
11 JGI24738J21930_10000689 3300002075 Bacteria 9725
12 JGI24738J21930_10003624 3300002075 Bacteria 3872
13 JGI24738J21930_10005740 3300002075 Bacteria 2952
14 JGI24749J21850_1000044 3300002076 Bacteria 23119
15 JGI24035J26624_1000876 3300002126 Bacteria 2842
16 JGI24751J29686_10000022 3300002459 Bacteria 104477
17 JGI24751J29686_10005563 3300002459 Bacteria 2565
18 JGI25406J46586_10014214 3300003203 Bacteria 3391
19 JGI25165J46597_1000034 3300003214 Bacteria 292458
20 JGI25405J52794_10013597 3300003911 Bacteria 1581
21 Ga0065704_10102919 3300005289 Bacteria 2189
22 Ga0065707_10081965 3300005295 Bacteria 26987
23 Ga0065707_10086988 3300005295 Bacteria 5213
24 Ga0065707_10169986 3300005295 Bacteria 1492
25 Ga0070658_10000350 3300005327 Bacteria 39927
26 Ga0070658_10001152 3300005327 Bacteria 22551
27 Ga0070658_10016110 3300005327 Bacteria 5979
28 Ga0070676_10110835 3300005328 Bacteria 1708
29 Ga0070683_100000631 3300005329 Bacteria 25315
30 Ga0070683_100016882 3300005329 Bacteria 6441
31 Ga0070683_100022589 3300005329 Bacteria 5624
32 Ga0070683_100024863 3300005329 Bacteria 5371
33 Ga0070683_100332915 3300005329 Bacteria 1445
34 Ga0070690_100006085 3300005330 Bacteria 6828
35 Ga0070670_100000006 3300005331 Bacteria 319420
36 Ga0070670_100015890 3300005331 Bacteria 6460
37 Ga0070670_100250693 3300005331 Bacteria 1542
38 Ga0070666_10161404 3300005335 Bacteria 1567
39 Ga0070680_100001048 3300005336 Bacteria 19770
40 Ga0070680_100046550 3300005336 Bacteria 3529
41 Ga0070682_100003544 3300005337 Bacteria 8637
42 Ga0070660_100083364 3300005339 Bacteria 2511
43 Ga0070660_100133309 3300005339 Bacteria 1989
44 Ga0070660_100196146 3300005339 Bacteria 1637
45 Ga0070660_100470551 3300005339 Bacteria 1044
46 Ga0070661_100087755 3300005344 Bacteria 2301
47 Ga0070661_100146245 3300005344 Bacteria 1784
48 Ga0070661_100225696 3300005344 Bacteria 1438
49 Ga0070692_10088845 3300005345 Bacteria 1676
50 Ga0070668_100000015 3300005347 Bacteria 106650
51 Ga0070669_100000036 3300005353 Bacteria 137564
52 Ga0070669_100362547 3300005353 Bacteria 1179
53 Ga0070675_100020528 3300005354 Bacteria 5271
54 Ga0070671_100000247 3300005355 Bacteria 36402
55 Ga0070671_100043603 3300005355 Bacteria 3728
56 Ga0070659_100029919 3300005366 Bacteria 4211
57 Ga0070659_100248267 3300005366 Bacteria 1474
58 Ga0070659_100397146 3300005366 Bacteria 1163
59 Ga0070667_100000017 3300005367 Bacteria 230531
60 Ga0070667_100001359 3300005367 Bacteria 21936
61 Ga0070667_100003397 3300005367 Bacteria 13559
62 Ga0070714_100024737 3300005435 Bacteria 4948
63 Ga0070713_100001271 3300005436 Bacteria 16127
64 Ga0070713_100467234 3300005436 Bacteria 1187
65 Ga0070700_100003943 3300005441 Bacteria 7705
66 Ga0070708_100021161 3300005445 Bacteria 5494
67 Ga0070708_100139942 3300005445 Bacteria 2244
68 Ga0070663_100007281 3300005455 Bacteria 6726
69 Ga0070678_100066473 3300005456 Bacteria 2680
70 Ga0070662_100020670 3300005457 Bacteria 4488
71 Ga0070662_100133581 3300005457 Bacteria 1916
72 Ga0070681_10000869 3300005458 Bacteria 25460
73 Ga0068867_100211526 3300005459 Bacteria 1558
74 Ga0070685_10089877 3300005466 Bacteria 1857
75 Ga0070707_100001272 3300005468 Bacteria 24810
76 Ga0070707_100329680 3300005468 Bacteria 1483
77 Ga0070698_100030713 3300005471 Bacteria 5570
78 Ga0070699_100018535 3300005518 Bacteria 5978
79 Ga0070679_100000267 3300005530 Bacteria 43860
80 Ga0070679_100481640 3300005530 Bacteria 1185
81 Ga0070684_100001926 3300005535 Bacteria 15227
82 Ga0070697_100088459 3300005536 Bacteria 2558
83 Ga0068853_100001543 3300005539 Bacteria 16739
84 Ga0068853_100028039 3300005539 Bacteria 4736
85 Ga0068853_100231006 3300005539 Bacteria 1692
86 Ga0070672_100099114 3300005543 Bacteria 2361
87 Ga0070686_100117902 3300005544 Bacteria 1818
88 Ga0070665_100000419 3300005548 Bacteria 62030
89 Ga0070665_100030769 3300005548 Bacteria 5402
90 Ga0070665_100388769 3300005548 Bacteria 1403
91 Ga0070704_100173916 3300005549 Bacteria 1715
92 Ga0068855_100002277 3300005563 Bacteria 23721
93 Ga0068855_100006052 3300005563 Bacteria 14754
94 Ga0068855_100110096 3300005563 Bacteria 3162
95 Ga0068855_100127061 3300005563 Bacteria 2914
96 Ga0068855_100482761 3300005563 Bacteria 1349
97 Ga0070664_100005716 3300005564 Bacteria 10020
98 Ga0070664_100007324 3300005564 Bacteria 8896
99 Ga0068857_100000056 3300005577 Bacteria 62615
100 Ga0068857_100017241 3300005577 Bacteria 6328
101 Ga0068857_100048634 3300005577 Bacteria 3764
102 Ga0068857_100051144 3300005577 Bacteria 3664
103 Ga0068857_100209739 3300005577 Bacteria 1777
104 Ga0068854_100001739 3300005578 Bacteria 13293
105 Ga0068854_100017388 3300005578 Bacteria 4811
106 Ga0068854_100110303 3300005578 Bacteria 2074
107 Ga0068856_100000485 3300005614 Bacteria 44052
108 Ga0068856_100001249 3300005614 Bacteria 26713
109 Ga0068856_100019458 3300005614 Bacteria 6590
110 Ga0068856_100020122 3300005614 Bacteria 6483
111 Ga0070702_100090835 3300005615 Bacteria 1852
112 Ga0068852_100000316 3300005616 Bacteria 32795
113 Ga0068852_100012076 3300005616 Bacteria 6540
114 Ga0068852_100049837 3300005616 Bacteria 3585
115 Ga0068852_100105385 3300005616 Bacteria 2555
116 Ga0068852_100134351 3300005616 Bacteria 2283
117 Ga0068852_100169825 3300005616 Bacteria 2043
118 Ga0068859_100001073 3300005617 Bacteria 27987
119 Ga0068864_100000014 3300005618 Bacteria 308927
120 Ga0068864_100019246 3300005618 Bacteria 5707
121 Ga0068864_100022356 3300005618 Bacteria 5302
122 Ga0068864_100165964 3300005618 Bacteria 2010
123 Ga0068864_100304568 3300005618 Bacteria 1493
124 Ga0068861_100000365 3300005719 Bacteria 25954
125 Ga0068861_100003589 3300005719 Bacteria 10337
126 Ga0068851_10051792 3300005834 Bacteria 2086
127 Ga0068870_10016755 3300005840 Bacteria 3509
128 Ga0068863_100000051 3300005841 Bacteria 127526
129 Ga0068863_100011881 3300005841 Bacteria 8415
130 Ga0068863_100033255 3300005841 Bacteria 4912
131 Ga0068858_100000034 3300005842 Bacteria 140680
132 Ga0068858_100000303 3300005842 Bacteria 52646
133 Ga0068858_100113383 3300005842 Bacteria 2532
134 Ga0068860_100000056 3300005843 Bacteria 202751
135 Ga0068860_100000187 3300005843 Bacteria 98756
136 Ga0068862_100000007 3300005844 Bacteria 313933
137 Ga0068862_100000108 3300005844 Bacteria 99413
138 Ga0068862_100011909 3300005844 Bacteria 7184
139 Ga0068862_100117134 3300005844 Bacteria 2344
140 Ga0068862_100177726 3300005844 Bacteria 1909
141 Ga0081455_10002170 3300005937 Bacteria 23415
142 Ga0081455_10007650 3300005937 Bacteria 11349
143 Ga0081538_10000056 3300005981 Bacteria 103929
144 Ga0081540_1010072 3300005983 Bacteria 6435
145 Ga0081539_10002722 3300005985 Bacteria 23921
146 Ga0075368_10068095 3300006042 Bacteria 1434
147 Ga0075432_10000050 3300006058 Bacteria 22789
148 Ga0075367_10001465 3300006178 Bacteria 10180
149 Ga0068871_100062302 3300006358 Bacteria 3048
150 Ga0075428_100205758 3300006844 Bacteria 2127
151 Ga0075430_100014354 3300006846 Bacteria 6751
152 Ga0075431_100362858 3300006847 Bacteria 1455
153 Ga0075433_10000264 3300006852 Bacteria 30682
154 Ga0075433_10101847 3300006852 Unclassified 2543
155 Ga0075434_100000012 3300006871 Bacteria 83539
156 Ga0075434_100028821 3300006871 Bacteria 5459
157 Ga0075436_100000674 3300006914 Bacteria 22490
158 Ga0075436_100039592 3300006914 Bacteria 3253
159 Ga0075436_100107311 3300006914 Bacteria 1948
160 Ga0097620_100001073 3300006931 Bacteria 27987
161 Ga0075435_100008287 3300007076 Bacteria 7449
162 Ga0075435_100020306 3300007076 Bacteria 5087
163 Ga0105251_10012092 3300009011 Bacteria 4898
164 Ga0105240_10001747 3300009093 Bacteria 36697
165 Ga0105240_10002962 3300009093 Bacteria 26742
166 Ga0105240_10017212 3300009093 Bacteria 9750
167 Ga0111539_10026281 3300009094 Bacteria 7120
168 Ga0111539_10066027 3300009094 Bacteria 4273
169 Ga0111539_10071083 3300009094 Bacteria 4106
170 Ga0105245_10024404 3300009098 Bacteria 5309
171 Ga0105245_10032771 3300009098 Bacteria 4600
172 Ga0105245_10034508 3300009098 Bacteria 4488
173 Ga0105245_10483682 3300009098 Bacteria 1252
174 Ga0105247_10009785 3300009101 Bacteria 5809
175 Ga0114129_10094436 3300009147 Bacteria 4142
176 Ga0114129_10152316 3300009147 Bacteria 3164
177 Ga0105241_10005398 3300009174 Bacteria 9450
178 Ga0105241_10035383 3300009174 Bacteria 3756
179 Ga0105242_10226614 3300009176 Bacteria 1673
180 Ga0105248_10000028 3300009177 Bacteria 225683
181 Ga0105248_10000522 3300009177 Bacteria 43686
182 Ga0105248_10007630 3300009177 Bacteria 11886
183 Ga0105248_10250841 3300009177 Bacteria 1992
184 Ga0105237_10003199 3300009545 Bacteria 19643
185 Ga0105237_10003715 3300009545 Bacteria 17976
186 Ga0105237_10003902 3300009545 Bacteria 17484
187 Ga0105237_10027834 3300009545 Bacteria 5759
188 Ga0105237_10060391 3300009545 Bacteria 3793
189 Ga0105238_10000412 3300009551 Bacteria 45119
190 Ga0105238_10041469 3300009551 Bacteria 4662
191 Ga0105238_10055286 3300009551 Bacteria 3985
192 Ga0105238_10105086 3300009551 Bacteria 2805
193 Ga0105238_10109616 3300009551 Bacteria 2742
194 Ga0105238_10122517 3300009551 Bacteria 2580
195 Ga0105249_10027494 3300009553 Bacteria 5133
196 Ga0105239_10037599 3300010375 Bacteria 5304
197 Ga0105239_10120986 3300010375 Bacteria 2907
198 Ga0157324_1001452 3300012506 Bacteria 1312
199 Ga0157373_10036500 3300013100 Bacteria 3527
200 Ga0157373_10093793 3300013100 Bacteria 2114
201 Ga0157371_10007101 3300013102 Bacteria 9103
202 Ga0157370_10002158 3300013104 Bacteria 24021
203 Ga0157370_10052766 3300013104 Bacteria 3880
204 Ga0157370_10235947 3300013104 Bacteria 1692
205 Ga0157369_10012466 3300013105 Bacteria 9645
206 Ga0157369_10296475 3300013105 Bacteria 1683
207 Ga0163162_10240941 3300013306 Bacteria 1939
208 Ga0157372_10041914 3300013307 Bacteria 5061
209 Ga0163163_10012150 3300014325 Bacteria 7834
210 Ga0163163_10047911 3300014325 Bacteria 4201
211 Ga0157380_10000108 3300014326 Bacteria 45269
212 Ga0157377_10125577 3300014745 Bacteria 1560
213 Ga0157379_10001804 3300014968 Bacteria 17660
214 Ga0157379_10092133 3300014968 Bacteria 2719
215 Ga0157379_10183260 3300014968 Bacteria 1892
216 Ga0206356_10245307 3300020070 Bacteria 3835
217 Ga0206349_1510461 3300020075 Bacteria 1918
218 Ga0206352_10299992 3300020078 Bacteria 1630
219 Ga0206350_10137420 3300020080 Bacteria 1009
220 Ga0206350_10247341 3300020080 Bacteria 5070
221 Ga0206350_10426173 3300020080 Bacteria 1367
222 Ga0224712_10000335 3300022467 Bacteria 8951
223 Ga0224712_10014543 3300022467 Bacteria 2538
224 Ga0209233_1000028 3300025261 Bacteria 642062
225 Ga0209233_1020625 3300025261 Bacteria 1724
226 Ga0207426_1002259 3300025302 Bacteria 12748
227 Ga0207656_10001573 3300025321 Bacteria 7590
228 Ga0207656_10122849 3300025321 Bacteria 1210
229 Ga0207710_10013639 3300025900 Bacteria 3419
230 Ga0207688_10001558 3300025901 Bacteria 12073
231 Ga0207688_10073172 3300025901 Bacteria 1947
232 Ga0207647_10003366 3300025904 Bacteria 11988
233 Ga0207647_10008851 3300025904 Bacteria 7182
234 Ga0207645_10063142 3300025907 Bacteria 2366
235 Ga0207643_10000797 3300025908 Bacteria 19195
236 Ga0207705_10000009 3300025909 Bacteria 576128
237 Ga0207705_10013102 3300025909 Bacteria 5984
238 Ga0207705_10029498 3300025909 Bacteria 3910
239 Ga0207684_10002195 3300025910 Bacteria 19958
240 Ga0207684_10113154 3300025910 Bacteria 2323
241 Ga0207654_10002589 3300025911 Bacteria 9179
242 Ga0207707_10000668 3300025912 Bacteria 34029
243 Ga0207707_10135997 3300025912 Bacteria 2149
244 Ga0207695_10001602 3300025913 Bacteria 36745
245 Ga0207695_10002541 3300025913 Bacteria 26799
246 Ga0207695_10009522 3300025913 Bacteria 12011
247 Ga0207671_10001958 3300025914 Bacteria 22715
248 Ga0207671_10002424 3300025914 Bacteria 19965
249 Ga0207671_10007412 3300025914 Bacteria 9518
250 Ga0207671_10069127 3300025914 Bacteria 2633
251 Ga0207660_10005180 3300025917 Bacteria 8473
252 Ga0207660_10142856 3300025917 Bacteria 1831
253 Ga0207657_10020601 3300025919 Bacteria 6228
254 Ga0207657_10044562 3300025919 Bacteria 3899
255 Ga0207657_10080644 3300025919 Bacteria 2735
256 Ga0207657_10167727 3300025919 Bacteria 1780
257 Ga0207649_10012024 3300025920 Bacteria 4788
258 Ga0207652_10000079 3300025921 Bacteria 105322
259 Ga0207652_10393688 3300025921 Bacteria 1250
260 Ga0207646_10008726 3300025922 Bacteria 10115
261 Ga0207646_10134322 3300025922 Bacteria 2228
262 Ga0207646_10205739 3300025922 Bacteria 1778
263 Ga0207681_10000001 3300025923 Bacteria 1105841
264 Ga0207681_10002181 3300025923 Bacteria 12481
265 Ga0207694_10003521 3300025924 Bacteria 12425
266 Ga0207694_10009212 3300025924 Bacteria 7449
267 Ga0207694_10059983 3300025924 Bacteria 2960
268 Ga0207694_10274034 3300025924 Bacteria 1384
269 Ga0207650_10000023 3300025925 Bacteria 308148
270 Ga0207650_10003806 3300025925 Bacteria 10316
271 Ga0207659_10017229 3300025926 Bacteria 4715
272 Ga0207687_10137146 3300025927 Bacteria 1852
273 Ga0207687_10141419 3300025927 Bacteria 1826
274 Ga0207700_10000762 3300025928 Bacteria 18587
275 Ga0207664_10013589 3300025929 Bacteria 5851
276 Ga0207664_10014234 3300025929 Bacteria 5737
277 Ga0207644_10000139 3300025931 Bacteria 51953
278 Ga0207644_10129184 3300025931 Bacteria 1932
279 Ga0207644_10358028 3300025931 Bacteria 1186
280 Ga0207690_10004301 3300025932 Bacteria 8403
281 Ga0207690_10009103 3300025932 Bacteria 5892
282 Ga0207690_10045438 3300025932 Bacteria 2901
283 Ga0207706_10024125 3300025933 Bacteria 5454
284 Ga0207706_10031241 3300025933 Bacteria 4745
285 Ga0207670_10048503 3300025936 Bacteria 2834
286 Ga0207691_10060823 3300025940 Bacteria 3432
287 Ga0207711_10000090 3300025941 Bacteria 97320
288 Ga0207711_10001173 3300025941 Bacteria 24920
289 Ga0207711_10002657 3300025941 Bacteria 15804
290 Ga0207711_10041980 3300025941 Bacteria 3896
291 Ga0207689_10033621 3300025942 Bacteria 4260
292 Ga0207661_10000103 3300025944 Bacteria 54134
293 Ga0207661_10007796 3300025944 Bacteria 7625
294 Ga0207661_10014150 3300025944 Bacteria 5838
295 Ga0207661_10050803 3300025944 Bacteria 3306
296 Ga0207661_10062031 3300025944 Bacteria 3023
297 Ga0207661_10084923 3300025944 Bacteria 2623
298 Ga0207661_10102517 3300025944 Bacteria 2406
299 Ga0207679_10078958 3300025945 Bacteria 2508
300 Ga0207667_10000812 3300025949 Bacteria 40505
301 Ga0207667_10001775 3300025949 Bacteria 27157
302 Ga0207667_10011969 3300025949 Bacteria 10042
303 Ga0207667_10068034 3300025949 Bacteria 3709
304 Ga0207667_10231671 3300025949 Bacteria 1891
305 Ga0207668_10000012 3300025972 Bacteria 182541
306 Ga0207640_10003292 3300025981 Bacteria 8709
307 Ga0207640_10005076 3300025981 Bacteria 7162
308 Ga0207658_10000011 3300025986 Bacteria 239620
309 Ga0207658_10001130 3300025986 Bacteria 21490
310 Ga0207658_10002434 3300025986 Bacteria 13608
311 Ga0207658_10063754 3300025986 Bacteria 2763
312 Ga0207703_10000057 3300026035 Bacteria 140694
313 Ga0207703_10000529 3300026035 Bacteria 39299
314 Ga0207703_10003805 3300026035 Bacteria 12534
315 Ga0207703_10206175 3300026035 Bacteria 1750
316 Ga0207639_10001324 3300026041 Bacteria 16766
317 Ga0207639_10002192 3300026041 Bacteria 13151
318 Ga0207639_10023342 3300026041 Bacteria 4466
319 Ga0207639_10068556 3300026041 Bacteria 2764
320 Ga0207639_10141726 3300026041 Bacteria 2003
321 Ga0207678_10000983 3300026067 Bacteria 25970
322 Ga0207678_10004985 3300026067 Bacteria 11908
323 Ga0207678_10008746 3300026067 Bacteria 8912
324 Ga0207708_10020704 3300026075 Bacteria 4961
325 Ga0207708_10084089 3300026075 Bacteria 2447
326 Ga0207702_10001729 3300026078 Bacteria 21487
327 Ga0207702_10001804 3300026078 Bacteria 21073
328 Ga0207702_10001928 3300026078 Bacteria 20276
329 Ga0207702_10009748 3300026078 Bacteria 8064
330 Ga0207702_10010356 3300026078 Bacteria 7808
331 Ga0207641_10000115 3300026088 Bacteria 118497
332 Ga0207641_10000261 3300026088 Bacteria 66553
333 Ga0207641_10000906 3300026088 Bacteria 30745
334 Ga0207641_10015345 3300026088 Bacteria 6278
335 Ga0207641_10082857 3300026088 Bacteria 2787
336 Ga0207648_10225227 3300026089 Bacteria 1667
337 Ga0207676_10000017 3300026095 Bacteria 308709
338 Ga0207676_10002586 3300026095 Bacteria 12904
339 Ga0207676_10259744 3300026095 Bacteria 1567
340 Ga0207676_10324656 3300026095 Bacteria 1414
341 Ga0207674_10000825 3300026116 Bacteria 40282
342 Ga0207674_10002248 3300026116 Bacteria 24465
343 Ga0207674_10004674 3300026116 Bacteria 16437
344 Ga0207674_10024725 3300026116 Bacteria 6411
345 Ga0207674_10043930 3300026116 Bacteria 4605
346 Ga0207674_10048279 3300026116 Bacteria 4357
347 Ga0207674_10131803 3300026116 Bacteria 2462
348 Ga0207674_10218267 3300026116 Bacteria 1855
349 Ga0207675_100000380 3300026118 Bacteria 42566
350 Ga0207675_100009290 3300026118 Bacteria 9219
351 Ga0207675_100023115 3300026118 Bacteria 5781
352 Ga0207675_100042195 3300026118 Bacteria 4258
353 Ga0207683_10001599 3300026121 Bacteria 20364
354 Ga0207698_10000252 3300026142 Bacteria 32804
355 Ga0207698_10015401 3300026142 Bacteria 5119
356 Ga0207698_10040208 3300026142 Bacteria 3472
357 Ga0207698_10066589 3300026142 Bacteria 2836
358 Ga0207698_10212989 3300026142 Bacteria 1740
359 Ga0207698_10327345 3300026142 Bacteria 1438
360 Ga0209813_10005445 3300027866 Bacteria 3089
361 Ga0207428_10006574 3300027907 Bacteria 10717
362 Ga0207428_10135863 3300027907 Bacteria 1880
363 Ga0268266_10001716 3300028379 Bacteria 25097
364 Ga0268266_10005489 3300028379 Bacteria 11806
365 Ga0268266_10036558 3300028379 Bacteria 4181
366 Ga0268266_10218201 3300028379 Bacteria 1752
367 Ga0268265_10000002 3300028380 Bacteria 1035381
368 Ga0268265_10000429 3300028380 Bacteria 44619
369 Ga0268265_10006576 3300028380 Bacteria 7865
370 Ga0268264_10000040 3300028381 Bacteria 373714
371 Ga0268264_10000089 3300028381 Bacteria 234760
372 Ga0268264_10288204 3300028381 Bacteria 1541
373 Ga0265318_10009570 3300028577 Bacteria 4254
374 Ga0307511_10093820 3300030521 Bacteria 2015
375 Ga0307511_10184429 3300030521 Bacteria 1117
376 Ga0265340_10024944 3300031247 Bacteria 3033
377 Ga0307513_10001824 3300031456 Bacteria 30233
378 Ga0307513_10017622 3300031456 Bacteria 8560
379 Ga0307513_10093855 3300031456 Bacteria 3048
380 Ga0307408_100003036 3300031548 Bacteria 11592
381 Ga0307408_100008166 3300031548 Bacteria 6915
382 Ga0307514_10071690 3300031649 Bacteria 2597
383 Ga0265314_10009422 3300031711 Bacteria 8236
384 Ga0265314_10174810 3300031711 Bacteria 1293
385 Ga0316576_10002154 3300031727 Bacteria 11099
386 Ga0307405_10013863 3300031731 Bacteria 4313
387 Ga0307405_10039855 3300031731 Bacteria 2842
388 Ga0307405_10077955 3300031731 Bacteria 2155
389 Ga0316577_10056501 3300031733 Bacteria 2190
390 Ga0307413_10017580 3300031824 Bacteria 3728
391 Ga0307410_10007513 3300031852 Bacteria 5972
392 Ga0307410_10156768 3300031852 Bacteria 1701
393 Ga0307410_10392303 3300031852 Bacteria 1119
394 Ga0307406_10000021 3300031901 Bacteria 98265
395 Ga0307406_10000142 3300031901 Bacteria 42391
396 Ga0307406_10002033 3300031901 Bacteria 11048
397 Ga0307406_10016712 3300031901 Bacteria 4269
398 Ga0307407_10000926 3300031903 Bacteria 9928
399 Ga0307412_10001578 3300031911 Bacteria 12554
400 Ga0307412_10006261 3300031911 Bacteria 6718
401 Ga0307412_10007651 3300031911 Bacteria 6136
402 Ga0307412_10022958 3300031911 Bacteria 3832
403 Ga0307409_100001681 3300031995 Bacteria 11138
404 Ga0307409_100138395 3300031995 Bacteria 2093
405 Ga0307409_100144955 3300031995 Bacteria 2052
406 Ga0307416_100000198 3300032002 Bacteria 31466
407 Ga0307416_100017246 3300032002 Bacteria 5045
408 Ga0307416_100097071 3300032002 Bacteria 2550
409 Ga0307416_100638990 3300032002 Bacteria 1148
410 Ga0307414_10142901 3300032004 Bacteria 1876
411 Ga0307414_10213057 3300032004 Bacteria 1580
412 Ga0307411_10014192 3300032005 Bacteria 4425
413 Ga0307415_100026006 3300032126 Bacteria 3684
414 Ga0307415_100436187 3300032126 Bacteria 1128
415 Ga0316583_10013966 3300032133 Bacteria 2896
416 Ga0373956_0003092 3300035119 Bacteria 6734
417 Ga0373955_0036607 3300035172 Bacteria 2605
418 Ga0373931_0098292 3300035691 Bacteria 1643
419 Ga0373937_0263722 3300036401 Bacteria 1625
420 Ga0316584_0011920 3300036712 Bacteria 6124
421 Ga0395899_0017676 3300037312 Bacteria 5432
422 Ga0395900_0156843 3300037418 Bacteria 2325
423 Ga0395898_0089464 3300037466 Bacteria 2963
424 Ga0395905_0006562 3300037471 Bacteria 11688
425 Ga0395905_0009660 3300037471 Bacteria 9415
426 Ga0395905_0113931 3300037471 Bacteria 2541
427 Ga0316581_0008927 3300037588 Bacteria 2742
428 Ga0395901_0321143 3300038443 Bacteria 1602
429 Ga0436360_0076518 3300039438 Bacteria 1389
430 Ga0436361_0231868 3300039447 Bacteria 59358
431 Ga0436361_0355012 3300039447 Bacteria 1435
432 Ga0436363_1719758 3300039450 Bacteria 1689
433 Ga0451833_0579776 3300041491 Bacteria 14024
434 Ga0451853_0174754 3300041512 Bacteria 2748
435 Ga0439463_008971 3300042016 Bacteria 2463
436 Ga0466969_0000809 3300044656 Bacteria 16987
437 Ga0466973_0193982 3300044659 Bacteria 1522
438 Ga0466966_0032687 3300044684 Bacteria 3370
439 Ga0466961_0003474 3300044693 Bacteria 9822
440 Ga0466963_0041656 3300044694 Bacteria 3012
441 Ga0466971_0000747 3300044719 Bacteria 13034
442 Ga0466957_0199275 3300044842 Bacteria 1314
443 Ga0466960_0158893 3300044901 Bacteria 1212
444 Ga0466959_0003399 3300045049 Bacteria 10405
445 Ga0466959_0290549 3300045049 Bacteria 1121
446 Ga0466958_0004599 3300045836 Bacteria 7307
447 Ga0466958_0052703 3300045836 Bacteria 2466
448 Ga0466967_0096331 3300045976 Bacteria 2699
449 Ga0495638_0030552 3300046460 Bacteria 3466
450 Ga0495638_0101965 3300046460 Unclassified 1715
451 Ga0495651_0065185 3300046462 Bacteria 2782
452 Ga0495594_0073918 3300046499 Bacteria 1898
453 Ga0495610_0001266 3300046512 Bacteria 22642
454 Ga0495616_0000032 3300046513 Bacteria 130692
455 Ga0495648_0093730 3300046524 Bacteria 1674
456 Ga0495668_0007996 3300046616 Bacteria 6665
457 Ga0495588_0037265 3300046674 Bacteria 2470
458 Ga0495623_0004777 3300046679 Bacteria 8901
459 Ga0495669_0002049 3300046684 Bacteria 8260
460 Ga0495604_0003161 3300047317 Bacteria 13164
461 Ga0495674_0135549 3300047319 Bacteria 2072
462 Ga0496101_0042132 3300048904 Bacteria 3259
463 Ga0496104_0003197 3300048907 Bacteria 14079
464 Ga0496104_0162245 3300048907 Bacteria 2144
465 Ga0496104_0174615 3300048907 Bacteria 2059
466 Ga0496104_0206200 3300048907 Bacteria 1877
467 Ga0496104_0247280 3300048907 Bacteria 1696
468 Ga0496105_0001623 3300048908 Bacteria 15986
469 Ga0496106_0013329 3300048909 Bacteria 6069
470 Ga0496107_0058803 3300048910 Bacteria 2780
471 Ga0496110_0058037 3300048913 Bacteria 3409
472 Ga0496110_0124760 3300048913 Bacteria 2322
473 Ga0496112_0002334 3300048915 Bacteria 15229
474 Ga0496112_0100129 3300048915 Bacteria 2868
475 Ga0496112_0200554 3300048915 Bacteria 1954
476 Ga0496113_0087845 3300048916 Bacteria 2391
477 Ga0496113_0340895 3300048916 Bacteria 1202
478 Ga0496114_0082590 3300048917 Bacteria 2716
479 Ga0496115_0086675 3300048918 Bacteria 2555
480 Ga0496117_0000503 3300048920 Bacteria 64599
481 Ga0496117_0017111 3300048920 Bacteria 6069
482 Ga0496118_0017771 3300048921 Bacteria 6455
483 Ga0496118_0071823 3300048921 Bacteria 2489
484 Ga0496119_0141998 3300048922 Bacteria 1296
485 Ga0496121_0004432 3300048924 Bacteria 18884
486 Ga0496121_0010241 3300048924 Bacteria 10608
487 Ga0496121_0176017 3300048924 Bacteria 1549
488 Ga0496125_0007608 3300048928 Bacteria 11500
489 Ga0496126_0003473 3300048929 Bacteria 19892
490 Ga0496126_0053450 3300048929 Bacteria 3665
491 Ga0501031_0000066 3300049568 Bacteria 56603
492 Ga0501031_0008941 3300049568 Bacteria 6512
493 Ga0501031_0014985 3300049568 Bacteria 5036
494 Ga0501032_0000178 3300049569 Bacteria 52170
495 Ga0501032_0056757 3300049569 Bacteria 2631
496 Ga0501033_0000203 3300049570 Bacteria 56963
497 Ga0501033_0005182 3300049570 Bacteria 10360
498 Ga0501033_0008551 3300049570 Bacteria 7919
499 Ga0501033_0062851 3300049570 Bacteria 2734
500 Ga0501034_0002100 3300049571 Bacteria 24877
501 Ga0501034_0035348 3300049571 Bacteria 5066
502 Ga0501036_0000420 3300049572 Bacteria 29953
503 Ga0501036_0013760 3300049572 Bacteria 6729
504 Ga0501036_0075638 3300049572 Bacteria 2847
505 Ga0501036_0348734 3300049572 Bacteria 1236
506 Ga0501037_0000375 3300049573 Bacteria 37216
507 Ga0501038_0000789 3300049574 Bacteria 28041
508 Ga0501038_0026942 3300049574 Bacteria 5116
509 Ga0501038_0062003 3300049574 Bacteria 3196
510 Ga0501039_0000255 3300049575 Bacteria 38934
511 Ga0501039_0074650 3300049575 Bacteria 2635
512 Ga0501040_0010022 3300049576 Bacteria 6189
513 Ga0501041_0009860 3300049577 Bacteria 5623
514 Ga0501042_0065610 3300049578 Bacteria 2594
515 Ga0501043_0000993 3300049579 Bacteria 25005
516 Ga0501043_0002717 3300049579 Bacteria 14807
517 Ga0501043_0060377 3300049579 Bacteria 2976
518 Ga0501046_0000420 3300049580 Bacteria 42319
519 Ga0501046_0000864 3300049580 Bacteria 29483
520 Ga0501046_0035096 3300049580 Bacteria 4042
521 Ga0501046_0110422 3300049580 Bacteria 2101
522 Ga0501047_0000043 3300049581 Bacteria 175522
523 Ga0501047_0002096 3300049581 Bacteria 19073
524 Ga0501047_0338018 3300049581 Bacteria 1344
525 Ga0501048_0000058 3300049582 Bacteria 56039
526 Ga0501048_0026736 3300049582 Bacteria 4199
527 Ga0501048_0028100 3300049582 Bacteria 4084
528 Ga0501048_0138801 3300049582 Bacteria 1719
529 Ga0501067_0024844 3300049583 Bacteria 3322
530 Ga0501069_0000268 3300049585 Bacteria 23610
531 Ga0501069_0029577 3300049585 Bacteria 3006
532 Ga0501070_0000892 3300049586 Bacteria 27153
533 Ga0501070_0016262 3300049586 Bacteria 6252
534 Ga0501071_0223671 3300049587 Bacteria 1417
535 Ga0501071_0238294 3300049587 Bacteria 1371
536 Ga0501072_0060563 3300049588 Bacteria 2984
537 Ga0501072_0097004 3300049588 Bacteria 2343
538 Ga0501073_0002513 3300049589 Bacteria 13704
539 Ga0501073_0293334 3300049589 Bacteria 1122
540 Ga0501074_0000253 3300049590 Bacteria 30133
541 Ga0501075_0012217 3300049591 Bacteria 6095
542 Ga0501076_0021698 3300049592 Bacteria 4929
543 Ga0501076_0062051 3300049592 Bacteria 2976
544 Ga0501077_0016335 3300049593 Bacteria 4678
545 Ga0501223_000095 3300049663 Bacteria 25891
546 Ga0501224_000014 3300049664 Bacteria 91830
547 Ga0501233_000081 3300049668 Bacteria 12508
548 Ga0501235_000196 3300049669 Bacteria 10665
549 Ga0501249_000024 3300049679 Bacteria 92031
550 Ga0501225_0000023 3300049705 Bacteria 51838
551 Ga0501234_000139 3300049707 Bacteria 9672
552 Ga0501079_0039983 3300049741 Bacteria 3618
553 Ga0501079_0133653 3300049741 Bacteria 1931
554 Ga0501079_0218977 3300049741 Bacteria 1487
555 Ga0501080_0011694 3300049742 Bacteria 8041
556 Ga0501080_0094907 3300049742 Bacteria 2770
557 Ga0501035_0005573 3300049822 Bacteria 11896
558 Ga0501035_0038465 3300049822 Bacteria 4331
559 Ga0501044_0009897 3300049823 Bacteria 10361
560 Ga0501044_0015913 3300049823 Bacteria 8095
561 Ga0501044_0084783 3300049823 Bacteria 3202
562 Ga0501045_0006663 3300049824 Bacteria 8004
563 Ga0501226_000037 3300049853 Bacteria 64584
564 nmdc:mga06z11_19165_c1 3300050494 Bacteria 3140
565 nmdc:mga04h51_2049_c1 3300050495 Bacteria 4727
566 nmdc:mga05p37_275644_c1 3300050507 Bacteria 2008
567 nmdc:mga08y16_214808_c1 3300050511 Bacteria 1992
568 nmdc:mga08y16_54742_c1 3300050511 Bacteria 4169
569 nmdc:mga0n895_52280_c1 3300050512 Bacteria 4010
570 nmdc:mga0n895_97374_c1 3300050512 Bacteria 2948
571 nmdc:mga0rr50_39932_c1 3300050513 Bacteria 3408
572 nmdc:mga0rr50_75311_c1 3300050513 Bacteria 2587
573 nmdc:mga08x19_17568_c1 3300050514 Bacteria 4379
574 nmdc:mga08x19_33184_c1 3300050514 Bacteria 3257
575 nmdc:mga08x19_54580_c1 3300050514 Bacteria 2573
576 nmdc:mga0a205_33644_c1 3300050515 Bacteria 4915
577 nmdc:mga0a205_5588_c1 3300050515 Bacteria 11327
578 nmdc:mga0a205_88567_c1 3300050515 Plasmid 2991
579 Ga0495601_0156371 3300053077 Bacteria 1489
580 Ga0495619_0209867 3300053085 Bacteria 1348
581 Ga0500647_0010299 3300053091 Bacteria 4132
582 Ga0500594_0003007 3300053118 Bacteria 3688
583 Ga0500568_0000070 3300053139 Bacteria 99663
584 Ga0500588_0073098 3300053146 Bacteria 1129
585 Ga0500604_0006712 3300053151 Bacteria 3046
586 Ga0500624_000006 3300053157 Bacteria 184937
587 Ga0501084_0006078 3300054114 Bacteria 9931
588 Ga0501084_0048611 3300054114 Bacteria 3550
589 Ga0501082_0382852 3300060353 Bacteria 1227
590 Ga0466962_0001901 3300061719 Bacteria 9828
591 Ga0530510_0014590 3300061734 Bacteria 5543

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037418 Ga0395900_0156843 Ga0395900_0156843_877_1833 304
2 3300037466 Ga0395898_0089464 Ga0395898_0089464_908_1864 304
3 3300005844 Ga0068862_100117134 Ga0068862_1001171343 308
4 3300049580 Ga0501046_0000420 Ga0501046_0000420_5894_6895 308
5 3300006914 Ga0075436_100039592 Ga0075436_1000395922 309
6 3300050514 nmdc:mga08x19_33184_c1 nmdc:mga08x19_33184_c1_1629_2600 309
7 3300049568 Ga0501031_0008941 Ga0501031_0008941_933_1871 310
8 3300049570 Ga0501033_0008551 Ga0501033_0008551_5694_6632 310
9 3300049572 Ga0501036_0075638 Ga0501036_0075638_870_1808 310
10 3300049574 Ga0501038_0026942 Ga0501038_0026942_940_1878 310
11 3300049582 Ga0501048_0026736 Ga0501048_0026736_2191_3129 310
12 3300049586 Ga0501070_0016262 Ga0501070_0016262_1089_2027 310
13 3300049592 Ga0501076_0062051 Ga0501076_0062051_70_1035 310
14 3300049741 Ga0501079_0218977 Ga0501079_0218977_249_1187 310
15 3300031727 Ga0316576_10002154 Ga0316576_100021545 311
16 3300053146 Ga0500588_0073098 Ga0500588_0073098_20_955 311
17 iso_pu_bacteria 2687453737 2689964427 311
18 3300009101 Ga0105247_10009785 Ga0105247_100097855 312
19 3300014968 Ga0157379_10001804 Ga0157379_1000180411 312
20 3300048907 Ga0496104_0247280 Ga0496104_0247280_665_1678 312
21 3300048924 Ga0496121_0004432 Ga0496121_0004432_13965_14978 312
22 3300009177 Ga0105248_10000028 Ga0105248_10000028145 313
23 3300048920 Ga0496117_0017111 Ga0496117_0017111_4810_5817 313
24 3300048921 Ga0496118_0071823 Ga0496118_0071823_1327_2334 313
25 3300035119 Ga0373956_0003092 Ga0373956_0003092_4540_5499 314
26 3300048915 Ga0496112_0100129 Ga0496112_0100129_568_1527 314
27 3300048916 Ga0496113_0087845 Ga0496113_0087845_301_1260 314
28 3300053077 Ga0495601_0156371 Ga0495601_0156371_11_970 314
29 iso_pu_bacteria 8047710418 8047713284 314
30 3300025900 Ga0207710_10013639 Ga0207710_100136394 315
31 iso_pu_bacteria 2929212328 2929218954 315
32 iso_pu_bacteria 2939657138 2939658479 315
33 3300005842 Ga0068858_100000034 Ga0068858_10000003457 316
34 3300026035 Ga0207703_10000057 Ga0207703_1000005768 316
35 3300036712 Ga0316584_0011920 Ga0316584_0011920_950_1924 316
36 3300037588 Ga0316581_0008927 Ga0316581_0008927_1140_2105 316
37 3300050515 nmdc:mga0a205_88567_c1 nmdc:mga0a205_88567_c1_1311_2303 316
38 iso_pu_bacteria 2816332119 2816422694 316
39 3300005329 Ga0070683_100024863 Ga0070683_1000248632 317
40 3300022467 Ga0224712_10014543 Ga0224712_100145432 317
41 3300025944 Ga0207661_10062031 Ga0207661_100620312 317
42 3300049583 Ga0501067_0024844 Ga0501067_0024844_1460_2419 317
43 3300049585 Ga0501069_0029577 Ga0501069_0029577_1876_2835 317
44 3300049587 Ga0501071_0223671 Ga0501071_0223671_41_1021 317
45 3300060353 Ga0501082_0382852 Ga0501082_0382852_210_1190 317
46 iso_pu_bacteria 2643221682 2644459321 317
47 iso_pu_bacteria 2876377896 2876378293 317
48 iso_pu_bacteria 2938014810 2938018840 317
49 iso_pu_bacteria 8025413630 8025418851 317
50 iso_pu_bacteria 8033684223 8033689029 317
51 3300005327 Ga0070658_10001152 Ga0070658_100011529 318
52 3300020080 Ga0206350_10137420 Ga0206350_101374201 318
53 3300025909 Ga0207705_10029498 Ga0207705_100294983 318
54 3300025912 Ga0207707_10135997 Ga0207707_101359971 318
55 3300025922 Ga0207646_10134322 Ga0207646_101343222 318
56 3300025944 Ga0207661_10084923 Ga0207661_100849233 318
57 3300028577 Ga0265318_10009570 Ga0265318_100095703 318
58 3300030521 Ga0307511_10184429 Ga0307511_101844292 318
59 3300031247 Ga0265340_10024944 Ga0265340_100249442 318
60 3300031711 Ga0265314_10009422 Ga0265314_100094224 318
61 3300031901 Ga0307406_10000142 Ga0307406_1000014246 318
62 3300046684 Ga0495669_0002049 Ga0495669_0002049_3502_4473 318
63 3300048920 Ga0496117_0000503 Ga0496117_0000503_17891_18862 318
64 3300048921 Ga0496118_0017771 Ga0496118_0017771_4243_5214 318
65 3300048928 Ga0496125_0007608 Ga0496125_0007608_2058_3029 318
66 3300048929 Ga0496126_0003473 Ga0496126_0003473_803_1774 318
67 3300049570 Ga0501033_0000203 Ga0501033_0000203_22639_23640 318
68 3300049571 Ga0501034_0035348 Ga0501034_0035348_1795_2793 318
69 3300049581 Ga0501047_0338018 Ga0501047_0338018_227_1225 318
70 3300049589 Ga0501073_0293334 Ga0501073_0293334_46_1044 318
71 3300049742 Ga0501080_0094907 Ga0501080_0094907_1587_2585 318
72 iso_pu_bacteria 2867475112 2867480365 318
73 iso_pu_bacteria 2997451912 2997458934 318
74 iso_pu_bacteria 8054160619 8054160939 318
75 3300002459 JGI24751J29686_10005563 JGI24751J29686_100055632 319
76 3300003203 JGI25406J46586_10014214 JGI25406J46586_100142143 319
77 3300003911 JGI25405J52794_10013597 JGI25405J52794_100135972 319
78 3300005328 Ga0070676_10110835 Ga0070676_101108352 319
79 3300005329 Ga0070683_100000631 Ga0070683_10000063122 319
80 3300005329 Ga0070683_100022589 Ga0070683_1000225895 319
81 3300005331 Ga0070670_100250693 Ga0070670_1002506931 319
82 3300005336 Ga0070680_100001048 Ga0070680_1000010482 319
83 3300005336 Ga0070680_100046550 Ga0070680_1000465502 319
84 3300005337 Ga0070682_100003544 Ga0070682_1000035446 319
85 3300005339 Ga0070660_100133309 Ga0070660_1001333092 319
86 3300005344 Ga0070661_100146245 Ga0070661_1001462452 319
87 3300005345 Ga0070692_10088845 Ga0070692_100888452 319
88 3300005355 Ga0070671_100043603 Ga0070671_1000436032 319
89 3300005436 Ga0070713_100001271 Ga0070713_1000012714 319
90 3300005445 Ga0070708_100021161 Ga0070708_1000211615 319
91 3300005445 Ga0070708_100139942 Ga0070708_1001399421 319
92 3300005456 Ga0070678_100066473 Ga0070678_1000664732 319
93 3300005458 Ga0070681_10000869 Ga0070681_100008699 319
94 3300005459 Ga0068867_100211526 Ga0068867_1002115262 319
95 3300005471 Ga0070698_100030713 Ga0070698_1000307132 319
96 3300005518 Ga0070699_100018535 Ga0070699_1000185355 319
97 3300005530 Ga0070679_100000267 Ga0070679_10000026726 319
98 3300005530 Ga0070679_100481640 Ga0070679_1004816401 319
99 3300005535 Ga0070684_100001926 Ga0070684_1000019268 319
100 3300005539 Ga0068853_100231006 Ga0068853_1002310062 319
101 3300005543 Ga0070672_100099114 Ga0070672_1000991142 319
102 3300005548 Ga0070665_100388769 Ga0070665_1003887691 319
103 3300005564 Ga0070664_100005716 Ga0070664_1000057168 319
104 3300005577 Ga0068857_100000056 Ga0068857_10000005647 319
105 3300005578 Ga0068854_100110303 Ga0068854_1001103032 319
106 3300005614 Ga0068856_100000485 Ga0068856_10000048543 319
107 3300005615 Ga0070702_100090835 Ga0070702_1000908352 319
108 3300005618 Ga0068864_100165964 Ga0068864_1001659642 319
109 3300005840 Ga0068870_10016755 Ga0068870_100167552 319
110 3300005841 Ga0068863_100011881 Ga0068863_1000118817 319
111 3300005937 Ga0081455_10002170 Ga0081455_1000217022 319
112 3300005937 Ga0081455_10007650 Ga0081455_1000765012 319
113 3300005981 Ga0081538_10000056 Ga0081538_1000005618 319
114 3300005983 Ga0081540_1010072 Ga0081540_10100722 319
115 3300005985 Ga0081539_10002722 Ga0081539_1000272217 319
116 3300006042 Ga0075368_10068095 Ga0075368_100680952 319
117 3300006058 Ga0075432_10000050 Ga0075432_1000005011 319
118 3300006178 Ga0075367_10001465 Ga0075367_100014659 319
119 3300006358 Ga0068871_100062302 Ga0068871_1000623023 319
120 3300006844 Ga0075428_100205758 Ga0075428_1002057582 319
121 3300006847 Ga0075431_100362858 Ga0075431_1003628582 319
122 3300006852 Ga0075433_10000264 Ga0075433_100002648 319
123 3300006871 Ga0075434_100000012 Ga0075434_10000001269 319
124 3300006871 Ga0075434_100028821 Ga0075434_1000288214 319
125 3300006914 Ga0075436_100000674 Ga0075436_1000006742 319
126 3300006914 Ga0075436_100107311 Ga0075436_1001073112 319
127 3300007076 Ga0075435_100008287 Ga0075435_1000082873 319
128 3300007076 Ga0075435_100020306 Ga0075435_1000203063 319
129 3300009011 Ga0105251_10012092 Ga0105251_100120923 319
130 3300009094 Ga0111539_10026281 Ga0111539_100262813 319
131 3300009094 Ga0111539_10066027 Ga0111539_100660273 319
132 3300009098 Ga0105245_10024404 Ga0105245_100244044 319
133 3300009147 Ga0114129_10152316 Ga0114129_101523162 319
134 3300009174 Ga0105241_10005398 Ga0105241_100053988 319
135 3300009176 Ga0105242_10226614 Ga0105242_102266142 319
136 3300009177 Ga0105248_10250841 Ga0105248_102508412 319
137 3300009545 Ga0105237_10060391 Ga0105237_100603911 319
138 3300010375 Ga0105239_10120986 Ga0105239_101209862 319
139 3300012506 Ga0157324_1001452 Ga0157324_10014521 319
140 3300013100 Ga0157373_10036500 Ga0157373_100365002 319
141 3300013104 Ga0157370_10235947 Ga0157370_102359472 319
142 3300013306 Ga0163162_10240941 Ga0163162_102409412 319
143 3300013307 Ga0157372_10041914 Ga0157372_100419143 319
144 3300014745 Ga0157377_10125577 Ga0157377_101255772 319
145 3300014968 Ga0157379_10092133 Ga0157379_100921332 319
146 3300020070 Ga0206356_10245307 Ga0206356_102453073 319
147 3300020075 Ga0206349_1510461 Ga0206349_15104612 319
148 3300020078 Ga0206352_10299992 Ga0206352_102999922 319
149 3300020080 Ga0206350_10247341 Ga0206350_102473412 319
150 3300020080 Ga0206350_10426173 Ga0206350_104261732 319
151 3300022467 Ga0224712_10000335 Ga0224712_100003356 319
152 3300025901 Ga0207688_10001558 Ga0207688_1000155810 319
153 3300025907 Ga0207645_10063142 Ga0207645_100631422 319
154 3300025908 Ga0207643_10000797 Ga0207643_100007972 319
155 3300025910 Ga0207684_10002195 Ga0207684_1000219517 319
156 3300025912 Ga0207707_10000668 Ga0207707_1000066819 319
157 3300025917 Ga0207660_10005180 Ga0207660_100051802 319
158 3300025917 Ga0207660_10142856 Ga0207660_101428562 319
159 3300025919 Ga0207657_10080644 Ga0207657_100806442 319
160 3300025920 Ga0207649_10012024 Ga0207649_100120242 319
161 3300025921 Ga0207652_10000079 Ga0207652_1000007989 319
162 3300025921 Ga0207652_10393688 Ga0207652_103936882 319
163 3300025926 Ga0207659_10017229 Ga0207659_100172292 319
164 3300025927 Ga0207687_10137146 Ga0207687_101371462 319
165 3300025928 Ga0207700_10000762 Ga0207700_1000076213 319
166 3300025929 Ga0207664_10013589 Ga0207664_100135896 319
167 3300025931 Ga0207644_10129184 Ga0207644_101291842 319
168 3300025932 Ga0207690_10045438 Ga0207690_100454383 319
169 3300025936 Ga0207670_10048503 Ga0207670_100485032 319
170 3300025940 Ga0207691_10060823 Ga0207691_100608232 319
171 3300025941 Ga0207711_10041980 Ga0207711_100419802 319
172 3300025942 Ga0207689_10033621 Ga0207689_100336211 319
173 3300025944 Ga0207661_10000103 Ga0207661_1000010336 319
174 3300025944 Ga0207661_10007796 Ga0207661_100077964 319
175 3300025944 Ga0207661_10014150 Ga0207661_100141505 319
176 3300025944 Ga0207661_10050803 Ga0207661_100508032 319
177 3300025945 Ga0207679_10078958 Ga0207679_100789582 319
178 3300025986 Ga0207658_10063754 Ga0207658_100637542 319
179 3300026041 Ga0207639_10141726 Ga0207639_101417262 319
180 3300026067 Ga0207678_10004985 Ga0207678_1000498510 319
181 3300026075 Ga0207708_10084089 Ga0207708_100840892 319
182 3300026078 Ga0207702_10010356 Ga0207702_100103567 319
183 3300026088 Ga0207641_10015345 Ga0207641_100153454 319
184 3300026089 Ga0207648_10225227 Ga0207648_102252272 319
185 3300026095 Ga0207676_10259744 Ga0207676_102597442 319
186 3300026116 Ga0207674_10002248 Ga0207674_1000224810 319
187 3300026116 Ga0207674_10043930 Ga0207674_100439303 319
188 3300026121 Ga0207683_10001599 Ga0207683_1000159910 319
189 3300027866 Ga0209813_10005445 Ga0209813_100054453 319
190 3300027907 Ga0207428_10006574 Ga0207428_100065743 319
191 3300027907 Ga0207428_10135863 Ga0207428_101358632 319
192 3300028379 Ga0268266_10036558 Ga0268266_100365582 319
193 3300028381 Ga0268264_10288204 Ga0268264_102882041 319
194 3300030521 Ga0307511_10093820 Ga0307511_100938202 319
195 3300031731 Ga0307405_10039855 Ga0307405_100398552 319
196 3300031852 Ga0307410_10007513 Ga0307410_100075132 319
197 3300031852 Ga0307410_10392303 Ga0307410_103923031 319
198 3300031901 Ga0307406_10000021 Ga0307406_1000002190 319
199 3300031901 Ga0307406_10002033 Ga0307406_100020334 319
200 3300031903 Ga0307407_10000926 Ga0307407_100009263 319
201 3300031911 Ga0307412_10022958 Ga0307412_100229581 319
202 3300031995 Ga0307409_100001681 Ga0307409_1000016811 319
203 3300031995 Ga0307409_100138395 Ga0307409_1001383952 319
204 3300032002 Ga0307416_100000198 Ga0307416_1000001982 319
205 3300032002 Ga0307416_100097071 Ga0307416_1000970712 319
206 3300032004 Ga0307414_10142901 Ga0307414_101429012 319
207 3300032005 Ga0307411_10014192 Ga0307411_100141922 319
208 3300032126 Ga0307415_100026006 Ga0307415_1000260062 319
209 3300035172 Ga0373955_0036607 Ga0373955_0036607_926_1900 319
210 3300036401 Ga0373937_0263722 Ga0373937_0263722_84_1058 319
211 3300038443 Ga0395901_0321143 Ga0395901_0321143_184_1158 319
212 3300042016 Ga0439463_008971 Ga0439463_008971_43_1017 319
213 3300044901 Ga0466960_0158893 Ga0466960_0158893_213_1187 319
214 3300045049 Ga0466959_0290549 Ga0466959_0290549_24_998 319
215 3300046460 Ga0495638_0101965 Ga0495638_0101965_232_1233 319
216 3300046674 Ga0495588_0037265 Ga0495588_0037265_724_1698 319
217 3300047319 Ga0495674_0135549 Ga0495674_0135549_394_1368 319
218 3300048907 Ga0496104_0174615 Ga0496104_0174615_289_1263 319
219 3300048907 Ga0496104_0206200 Ga0496104_0206200_133_1107 319
220 3300048909 Ga0496106_0013329 Ga0496106_0013329_4371_5345 319
221 3300048910 Ga0496107_0058803 Ga0496107_0058803_1631_2605 319
222 3300048913 Ga0496110_0058037 Ga0496110_0058037_401_1375 319
223 3300048913 Ga0496110_0124760 Ga0496110_0124760_1199_2173 319
224 3300048917 Ga0496114_0082590 Ga0496114_0082590_1410_2384 319
225 3300048918 Ga0496115_0086675 Ga0496115_0086675_751_1725 319
226 3300048924 Ga0496121_0010241 Ga0496121_0010241_9258_10232 319
227 3300049568 Ga0501031_0000066 Ga0501031_0000066_13907_14881 319
228 3300049568 Ga0501031_0014985 Ga0501031_0014985_1356_2330 319
229 3300049569 Ga0501032_0000178 Ga0501032_0000178_5344_6318 319
230 3300049569 Ga0501032_0056757 Ga0501032_0056757_712_1686 319
231 3300049570 Ga0501033_0005182 Ga0501033_0005182_6741_7715 319
232 3300049570 Ga0501033_0062851 Ga0501033_0062851_818_1792 319
233 3300049571 Ga0501034_0002100 Ga0501034_0002100_20964_21938 319
234 3300049572 Ga0501036_0000420 Ga0501036_0000420_12351_13325 319
235 3300049572 Ga0501036_0013760 Ga0501036_0013760_2711_3685 319
236 3300049573 Ga0501037_0000375 Ga0501037_0000375_3819_4793 319
237 3300049574 Ga0501038_0000789 Ga0501038_0000789_6104_7078 319
238 3300049575 Ga0501039_0000255 Ga0501039_0000255_34419_35393 319
239 3300049575 Ga0501039_0074650 Ga0501039_0074650_63_1037 319
240 3300049576 Ga0501040_0010022 Ga0501040_0010022_2576_3550 319
241 3300049577 Ga0501041_0009860 Ga0501041_0009860_3717_4691 319
242 3300049578 Ga0501042_0065610 Ga0501042_0065610_576_1550 319
243 3300049579 Ga0501043_0000993 Ga0501043_0000993_20964_21938 319
244 3300049579 Ga0501043_0060377 Ga0501043_0060377_1816_2790 319
245 3300049580 Ga0501046_0000864 Ga0501046_0000864_16588_17562 319
246 3300049580 Ga0501046_0035096 Ga0501046_0035096_2674_3648 319
247 3300049581 Ga0501047_0002096 Ga0501047_0002096_11996_12970 319
248 3300049582 Ga0501048_0000058 Ga0501048_0000058_16127_17101 319
249 3300049582 Ga0501048_0028100 Ga0501048_0028100_1735_2709 319
250 3300049585 Ga0501069_0000268 Ga0501069_0000268_15972_16946 319
251 3300049586 Ga0501070_0000892 Ga0501070_0000892_20964_21938 319
252 3300049587 Ga0501071_0238294 Ga0501071_0238294_291_1265 319
253 3300049588 Ga0501072_0060563 Ga0501072_0060563_200_1174 319
254 3300049588 Ga0501072_0097004 Ga0501072_0097004_761_1735 319
255 3300049589 Ga0501073_0002513 Ga0501073_0002513_7727_8701 319
256 3300049590 Ga0501074_0000253 Ga0501074_0000253_10727_11701 319
257 3300049591 Ga0501075_0012217 Ga0501075_0012217_4038_5012 319
258 3300049592 Ga0501076_0021698 Ga0501076_0021698_1347_2321 319
259 3300049741 Ga0501079_0039983 Ga0501079_0039983_1583_2557 319
260 3300049742 Ga0501080_0011694 Ga0501080_0011694_4108_5082 319
261 3300049822 Ga0501035_0005573 Ga0501035_0005573_7193_8167 319
262 3300049822 Ga0501035_0038465 Ga0501035_0038465_3296_4270 319
263 3300049823 Ga0501044_0009897 Ga0501044_0009897_2646_3620 319
264 3300049824 Ga0501045_0006663 Ga0501045_0006663_4392_5366 319
265 3300050494 nmdc:mga06z11_19165_c1 nmdc:mga06z11_19165_c1_250_1224 319
266 3300050495 nmdc:mga04h51_2049_c1 nmdc:mga04h51_2049_c1_3473_4447 319
267 3300050511 nmdc:mga08y16_214808_c1 nmdc:mga08y16_214808_c1_260_1234 319
268 3300050512 nmdc:mga0n895_52280_c1 nmdc:mga0n895_52280_c1_940_1914 319
269 3300050512 nmdc:mga0n895_97374_c1 nmdc:mga0n895_97374_c1_1592_2566 319
270 3300050513 nmdc:mga0rr50_39932_c1 nmdc:mga0rr50_39932_c1_1531_2505 319
271 3300050513 nmdc:mga0rr50_75311_c1 nmdc:mga0rr50_75311_c1_1165_2139 319
272 3300050514 nmdc:mga08x19_17568_c1 nmdc:mga08x19_17568_c1_2689_3663 319
273 3300050514 nmdc:mga08x19_54580_c1 nmdc:mga08x19_54580_c1_1246_2220 319
274 3300050515 nmdc:mga0a205_33644_c1 nmdc:mga0a205_33644_c1_283_1257 319
275 3300050515 nmdc:mga0a205_5588_c1 nmdc:mga0a205_5588_c1_1602_2576 319
276 3300053139 Ga0500568_0000070 Ga0500568_0000070_28051_29052 319
277 3300054114 Ga0501084_0006078 Ga0501084_0006078_3765_4739 319
278 3300054114 Ga0501084_0048611 Ga0501084_0048611_1191_2165 319
279 3300061734 Ga0530510_0014590 Ga0530510_0014590_3102_4076 319
280 3300005329 Ga0070683_100016882 Ga0070683_1000168822 320
281 3300005330 Ga0070690_100006085 Ga0070690_1000060852 320
282 3300005344 Ga0070661_100225696 Ga0070661_1002256962 320
283 3300005354 Ga0070675_100020528 Ga0070675_1000205285 320
284 3300005366 Ga0070659_100029919 Ga0070659_1000299192 320
285 3300005436 Ga0070713_100467234 Ga0070713_1004672341 320
286 3300005441 Ga0070700_100003943 Ga0070700_1000039439 320
287 3300005468 Ga0070707_100329680 Ga0070707_1003296802 320
288 3300005544 Ga0070686_100117902 Ga0070686_1001179022 320
289 3300005564 Ga0070664_100007324 Ga0070664_1000073248 320
290 3300005844 Ga0068862_100177726 Ga0068862_1001777262 320
291 3300009098 Ga0105245_10032771 Ga0105245_100327712 320
292 3300009147 Ga0114129_10094436 Ga0114129_100944363 320
293 3300013102 Ga0157371_10007101 Ga0157371_100071015 320
294 3300025901 Ga0207688_10073172 Ga0207688_100731722 320
295 3300025919 Ga0207657_10167727 Ga0207657_101677271 320
296 3300025922 Ga0207646_10205739 Ga0207646_102057392 320
297 3300025927 Ga0207687_10141419 Ga0207687_101414192 320
298 3300025932 Ga0207690_10004301 Ga0207690_100043015 320
299 3300025932 Ga0207690_10009103 Ga0207690_100091036 320
300 3300025944 Ga0207661_10102517 Ga0207661_101025172 320
301 3300026035 Ga0207703_10206175 Ga0207703_102061752 320
302 3300026075 Ga0207708_10020704 Ga0207708_100207043 320
303 3300026116 Ga0207674_10218267 Ga0207674_102182671 320
304 3300026118 Ga0207675_100042195 Ga0207675_1000421953 320
305 3300031711 Ga0265314_10174810 Ga0265314_101748102 320
306 3300032002 Ga0307416_100638990 Ga0307416_1006389902 320
307 3300032126 Ga0307415_100436187 Ga0307415_1004361871 320
308 3300041491 Ga0451833_0579776 Ga0451833_0579776_348_1331 320
309 3300049582 Ga0501048_0138801 Ga0501048_0138801_714_1691 320
310 3300049593 Ga0501077_0016335 Ga0501077_0016335_74_1051 320
311 3300050507 nmdc:mga05p37_275644_c1 nmdc:mga05p37_275644_c1_969_1940 320
312 3300050511 nmdc:mga08y16_54742_c1 nmdc:mga08y16_54742_c1_1029_2006 320
313 iso_pu_bacteria 2818991472 2819741509 320
314 3300003214 JGI25165J46597_1000034 JGI25165J46597_100003438 321
315 3300005366 Ga0070659_100397146 Ga0070659_1003971461 321
316 3300005435 Ga0070714_100024737 Ga0070714_1000247373 321
317 3300005468 Ga0070707_100001272 Ga0070707_1000012727 321
318 3300005536 Ga0070697_100088459 Ga0070697_1000884593 321
319 3300006852 Ga0075433_10101847 Ga0075433_101018472 321
320 3300010375 Ga0105239_10037599 Ga0105239_100375998 321
321 3300014325 Ga0163163_10012150 Ga0163163_100121502 321
322 3300025261 Ga0209233_1000028 Ga0209233_100002842 321
323 3300025910 Ga0207684_10113154 Ga0207684_101131542 321
324 3300025922 Ga0207646_10008726 Ga0207646_100087263 321
325 3300025929 Ga0207664_10014234 Ga0207664_100142343 321
326 3300026088 Ga0207641_10082857 Ga0207641_100828572 321
327 3300031456 Ga0307513_10001824 Ga0307513_1000182415 321
328 3300035691 Ga0373931_0098292 Ga0373931_0098292_212_1192 321
329 3300037471 Ga0395905_0006562 Ga0395905_0006562_260_1267 321
330 3300037471 Ga0395905_0009660 Ga0395905_0009660_6840_7847 321
331 3300039438 Ga0436360_0076518 Ga0436360_0076518_13_1020 321
332 3300039450 Ga0436363_1719758 Ga0436363_1719758_564_1571 321
333 3300044694 Ga0466963_0041656 Ga0466963_0041656_631_1611 321
334 3300044842 Ga0466957_0199275 Ga0466957_0199275_58_1038 321
335 3300045836 Ga0466958_0052703 Ga0466958_0052703_1048_2028 321
336 3300045976 Ga0466967_0096331 Ga0466967_0096331_1407_2387 321
337 3300046460 Ga0495638_0030552 Ga0495638_0030552_1400_2407 321
338 3300048915 Ga0496112_0002334 Ga0496112_0002334_14207_15187 321
339 3300048915 Ga0496112_0200554 Ga0496112_0200554_171_1151 321
340 3300048916 Ga0496113_0340895 Ga0496113_0340895_47_1027 321
341 3300053085 Ga0495619_0209867 Ga0495619_0209867_53_1045 321
342 3300005548 Ga0070665_100030769 Ga0070665_1000307692 322
343 3300005549 Ga0070704_100173916 Ga0070704_1001739162 322
344 3300009094 Ga0111539_10071083 Ga0111539_100710832 322
345 3300025302 Ga0207426_1002259 Ga0207426_10022598 322
346 3300046499 Ga0495594_0073918 Ga0495594_0073918_648_1631 322
347 3300048907 Ga0496104_0162245 Ga0496104_0162245_184_1179 322
348 iso_pu_bacteria 2751185725 2753036692 322
349 iso_pu_bacteria 2751185792 2753324562 322
350 3300005339 Ga0070660_100470551 Ga0070660_1004705511 323
351 3300009545 Ga0105237_10003715 Ga0105237_100037152 323
352 3300025914 Ga0207671_10001958 Ga0207671_1000195822 323
353 3300046462 Ga0495651_0065185 Ga0495651_0065185_233_1204 323
354 3300046512 Ga0495610_0001266 Ga0495610_0001266_8729_9700 323
355 3300048904 Ga0496101_0042132 Ga0496101_0042132_1349_2368 323
356 3300005548 Ga0070665_100000419 Ga0070665_10000041922 324
357 3300009551 Ga0105238_10000412 Ga0105238_1000041229 324
358 3300009551 Ga0105238_10055286 Ga0105238_100552863 324
359 3300025261 Ga0209233_1020625 Ga0209233_10206252 324
360 3300025924 Ga0207694_10009212 Ga0207694_100092126 324
361 3300028379 Ga0268266_10001716 Ga0268266_100017163 324
362 3300028379 Ga0268266_10218201 Ga0268266_102182012 324
363 3300037312 Ga0395899_0017676 Ga0395899_0017676_2192_3166 324
364 3300046679 Ga0495623_0004777 Ga0495623_0004777_1291_2286 324
365 3300047317 Ga0495604_0003161 Ga0495604_0003161_5481_6476 324
366 3300048929 Ga0496126_0053450 Ga0496126_0053450_933_1907 324
367 iso_pu_bacteria 2508501039 2508675713 324
368 3300031649 Ga0307514_10071690 Ga0307514_100716902 325
369 3300031733 Ga0316577_10056501 Ga0316577_100565012 325
370 3300032133 Ga0316583_10013966 Ga0316583_100139662 325
371 3300053091 Ga0500647_0010299 Ga0500647_0010299_807_1784 325
372 3300025941 Ga0207711_10000090 Ga0207711_1000009053 328
373 iso_pu_bacteria 2939582691 2939586108 328
374 3300041512 Ga0451853_0174754 Ga0451853_0174754_564_1583 329
375 3300044656 Ga0466969_0000809 Ga0466969_0000809_5151_6170 329
376 3300044684 Ga0466966_0032687 Ga0466966_0032687_2294_3313 329
377 3300044693 Ga0466961_0003474 Ga0466961_0003474_5661_6680 329
378 3300044719 Ga0466971_0000747 Ga0466971_0000747_10177_11196 329
379 3300045049 Ga0466959_0003399 Ga0466959_0003399_2059_3078 329
380 3300045836 Ga0466958_0004599 Ga0466958_0004599_1898_2917 329
381 3300046513 Ga0495616_0000032 Ga0495616_0000032_89411_90403 329
382 3300046616 Ga0495668_0007996 Ga0495668_0007996_2438_3430 329
383 3300053151 Ga0500604_0006712 Ga0500604_0006712_1062_2054 329
384 3300061719 Ga0466962_0001901 Ga0466962_0001901_4875_5894 329
385 iso_pu_bacteria 2879163058 2879163873 329
386 iso_pu_bacteria 8002775197 8002780405 329
387 3300005353 Ga0070669_100362547 Ga0070669_1003625471 330
388 3300009098 Ga0105245_10034508 Ga0105245_100345086 330
389 3300039447 Ga0436361_0355012 Ga0436361_0355012_335_1330 330
390 3300049741 Ga0501079_0133653 Ga0501079_0133653_877_1884 330
391 3300009098 Ga0105245_10483682 Ga0105245_104836822 331
392 iso_pu_bacteria 2675902999 2676200827 331
393 iso_pu_bacteria 2773857921 2774845405 331
394 3300002126 JGI24035J26624_1000876 JGI24035J26624_10008762 332
395 3300005289 Ga0065704_10102919 Ga0065704_101029192 332
396 3300005295 Ga0065707_10169986 Ga0065707_101699861 332
397 3300005327 Ga0070658_10000350 Ga0070658_1000035035 332
398 3300005335 Ga0070666_10161404 Ga0070666_101614041 332
399 3300005367 Ga0070667_100001359 Ga0070667_10000135916 332
400 3300005466 Ga0070685_10089877 Ga0070685_100898773 332
401 3300005563 Ga0068855_100006052 Ga0068855_1000060526 332
402 3300005578 Ga0068854_100001739 Ga0068854_1000017392 332
403 3300005614 Ga0068856_100019458 Ga0068856_1000194586 332
404 3300005616 Ga0068852_100000316 Ga0068852_10000031627 332
405 3300005618 Ga0068864_100022356 Ga0068864_1000223563 332
406 3300005841 Ga0068863_100000051 Ga0068863_10000005185 332
407 3300005842 Ga0068858_100113383 Ga0068858_1001133832 332
408 3300005843 Ga0068860_100000187 Ga0068860_10000018734 332
409 3300005844 Ga0068862_100011909 Ga0068862_1000119098 332
410 3300009551 Ga0105238_10105086 Ga0105238_101050863 332
411 3300025904 Ga0207647_10008851 Ga0207647_100088515 332
412 3300025909 Ga0207705_10000009 Ga0207705_10000009118 332
413 3300025931 Ga0207644_10358028 Ga0207644_103580282 332
414 3300025949 Ga0207667_10068034 Ga0207667_100680345 332
415 3300025986 Ga0207658_10001130 Ga0207658_1000113015 332
416 3300026035 Ga0207703_10003805 Ga0207703_1000380512 332
417 3300026078 Ga0207702_10009748 Ga0207702_100097486 332
418 3300026088 Ga0207641_10000261 Ga0207641_1000026114 332
419 3300026142 Ga0207698_10000252 Ga0207698_1000025227 332
420 3300028379 Ga0268266_10005489 Ga0268266_1000548910 332
421 3300028380 Ga0268265_10006576 Ga0268265_100065762 332
422 3300028381 Ga0268264_10000040 Ga0268264_10000040338 332
423 3300039447 Ga0436361_0231868 Ga0436361_0231868_19872_20873 332
424 3300048907 Ga0496104_0003197 Ga0496104_0003197_12723_13721 332
425 3300048908 Ga0496105_0001623 Ga0496105_0001623_9952_10950 332
426 3300048922 Ga0496119_0141998 Ga0496119_0141998_129_1127 332
427 3300048924 Ga0496121_0176017 Ga0496121_0176017_497_1495 332
428 3300005331 Ga0070670_100015890 Ga0070670_1000158907 333
429 3300005347 Ga0070668_100000015 Ga0070668_10000001538 333
430 3300005355 Ga0070671_100000247 Ga0070671_10000024714 333
431 3300005367 Ga0070667_100000017 Ga0070667_10000001768 333
432 3300005616 Ga0068852_100134351 Ga0068852_1001343512 333
433 3300005618 Ga0068864_100019246 Ga0068864_1000192465 333
434 3300005841 Ga0068863_100033255 Ga0068863_1000332552 333
435 3300005842 Ga0068858_100000303 Ga0068858_10000030330 333
436 3300005843 Ga0068860_100000056 Ga0068860_100000056176 333
437 3300005844 Ga0068862_100000108 Ga0068862_10000010884 333
438 3300009553 Ga0105249_10027494 Ga0105249_100274941 333
439 3300025923 Ga0207681_10002181 Ga0207681_100021815 333
440 3300025925 Ga0207650_10003806 Ga0207650_100038065 333
441 3300025931 Ga0207644_10000139 Ga0207644_1000013913 333
442 3300025972 Ga0207668_10000012 Ga0207668_10000012173 333
443 3300025986 Ga0207658_10000011 Ga0207658_10000011175 333
444 3300026035 Ga0207703_10000529 Ga0207703_1000052913 333
445 3300026088 Ga0207641_10000115 Ga0207641_1000011556 333
446 3300026088 Ga0207641_10000906 Ga0207641_1000090614 333
447 3300026095 Ga0207676_10002586 Ga0207676_1000258612 333
448 3300026118 Ga0207675_100009290 Ga0207675_1000092902 333
449 3300026142 Ga0207698_10212989 Ga0207698_102129892 333
450 3300026142 Ga0207698_10327345 Ga0207698_103273451 333
451 3300028380 Ga0268265_10000429 Ga0268265_1000042934 333
452 3300028381 Ga0268264_10000089 Ga0268264_1000008974 333
453 3300031456 Ga0307513_10093855 Ga0307513_100938553 333
454 3300001989 JGI24739J22299_10004735 JGI24739J22299_100047353 334
455 3300002075 JGI24738J21930_10005740 JGI24738J21930_100057402 334
456 3300005295 Ga0065707_10086988 Ga0065707_100869886 334
457 3300005457 Ga0070662_100133581 Ga0070662_1001335813 334
458 3300005539 Ga0068853_100001543 Ga0068853_1000015435 334
459 3300005539 Ga0068853_100028039 Ga0068853_1000280395 334
460 3300005563 Ga0068855_100002277 Ga0068855_1000022774 334
461 3300005563 Ga0068855_100110096 Ga0068855_1001100964 334
462 3300005563 Ga0068855_100482761 Ga0068855_1004827612 334
463 3300005577 Ga0068857_100017241 Ga0068857_1000172414 334
464 3300005577 Ga0068857_100051144 Ga0068857_1000511444 334
465 3300005577 Ga0068857_100209739 Ga0068857_1002097391 334
466 3300005578 Ga0068854_100017388 Ga0068854_1000173883 334
467 3300005616 Ga0068852_100012076 Ga0068852_1000120764 334
468 3300005616 Ga0068852_100049837 Ga0068852_1000498375 334
469 3300005616 Ga0068852_100105385 Ga0068852_1001053852 334
470 3300005617 Ga0068859_100001073 Ga0068859_1000010731 334
471 3300005618 Ga0068864_100304568 Ga0068864_1003045682 334
472 3300005719 Ga0068861_100000365 Ga0068861_10000036510 334
473 3300006931 Ga0097620_100001073 Ga0097620_1000010731 334
474 3300009177 Ga0105248_10007630 Ga0105248_1000763010 334
475 3300009551 Ga0105238_10041469 Ga0105238_100414694 334
476 3300014968 Ga0157379_10183260 Ga0157379_101832602 334
477 3300025924 Ga0207694_10274034 Ga0207694_102740342 334
478 3300025933 Ga0207706_10031241 Ga0207706_100312412 334
479 3300025941 Ga0207711_10002657 Ga0207711_1000265714 334
480 3300025949 Ga0207667_10011969 Ga0207667_100119698 334
481 3300025949 Ga0207667_10231671 Ga0207667_102316712 334
482 3300026041 Ga0207639_10002192 Ga0207639_100021924 334
483 3300026041 Ga0207639_10023342 Ga0207639_100233426 334
484 3300026095 Ga0207676_10324656 Ga0207676_103246562 334
485 3300026116 Ga0207674_10000825 Ga0207674_1000082513 334
486 3300026116 Ga0207674_10004674 Ga0207674_100046744 334
487 3300026116 Ga0207674_10131803 Ga0207674_101318033 334
488 3300026118 Ga0207675_100000380 Ga0207675_10000038031 334
489 3300026142 Ga0207698_10040208 Ga0207698_100402083 334
490 3300031548 Ga0307408_100008166 Ga0307408_1000081669 334
491 3300031731 Ga0307405_10013863 Ga0307405_100138634 334
492 3300031731 Ga0307405_10077955 Ga0307405_100779552 334
493 3300031824 Ga0307413_10017580 Ga0307413_100175805 334
494 3300031901 Ga0307406_10016712 Ga0307406_100167125 334
495 3300031911 Ga0307412_10001578 Ga0307412_1000157814 334
496 3300031995 Ga0307409_100144955 Ga0307409_1001449553 334
497 3300032004 Ga0307414_10213057 Ga0307414_102130572 334
498 3300044659 Ga0466973_0193982 Ga0466973_0193982_45_1049 334
499 3300049572 Ga0501036_0348734 Ga0501036_0348734_86_1090 334
500 3300049579 Ga0501043_0002717 Ga0501043_0002717_3094_4098 334
501 3300049580 Ga0501046_0110422 Ga0501046_0110422_106_1110 334
502 3300049581 Ga0501047_0000043 Ga0501047_0000043_124957_125961 334
503 3300049679 Ga0501249_000024 Ga0501249_000024_89441_90445 334
504 3300049823 Ga0501044_0015913 Ga0501044_0015913_905_1909 334
505 3300053157 Ga0500624_000006 Ga0500624_000006_133001_134008 334
506 3300009551 Ga0105238_10109616 Ga0105238_101096164 335
507 3300025924 Ga0207694_10059983 Ga0207694_100599834 335
508 3300031911 Ga0307412_10007651 Ga0307412_100076514 335
509 3300037471 Ga0395905_0113931 Ga0395905_0113931_819_1829 335
510 3300046524 Ga0495648_0093730 Ga0495648_0093730_398_1411 335
511 3300049574 Ga0501038_0062003 Ga0501038_0062003_1917_2930 335
512 3300049663 Ga0501223_000095 Ga0501223_000095_3084_4094 335
513 3300049664 Ga0501224_000014 Ga0501224_000014_30342_31352 335
514 3300049668 Ga0501233_000081 Ga0501233_000081_3097_4107 335
515 3300049669 Ga0501235_000196 Ga0501235_000196_2481_3491 335
516 3300049705 Ga0501225_0000023 Ga0501225_0000023_12137_13147 335
517 3300049707 Ga0501234_000139 Ga0501234_000139_1829_2839 335
518 3300049853 Ga0501226_000037 Ga0501226_000037_60493_61503 335
519 3300053118 Ga0500594_0003007 Ga0500594_0003007_671_1684 335
520 3300013100 Ga0157373_10093793 Ga0157373_100937932 336
521 3300031456 Ga0307513_10017622 Ga0307513_100176228 336
522 3300005614 Ga0068856_100001249 Ga0068856_1000012497 337
523 3300009093 Ga0105240_10002962 Ga0105240_100029627 337
524 3300009545 Ga0105237_10003902 Ga0105237_1000390215 337
525 3300026078 Ga0207702_10001729 Ga0207702_100017294 337
526 3300049823 Ga0501044_0084783 Ga0501044_0084783_2047_3063 338
527 3300006846 Ga0075430_100014354 Ga0075430_1000143546 339
528 3300001904 JGI24736J21556_1000320 JGI24736J21556_10003209 340
529 3300001904 JGI24736J21556_1000835 JGI24736J21556_10008355 340
530 3300001915 JGI24741J21665_1000003 JGI24741J21665_100000342 340
531 3300001979 JGI24740J21852_10003002 JGI24740J21852_100030029 340
532 3300001989 JGI24739J22299_10001560 JGI24739J22299_100015608 340
533 3300001989 JGI24739J22299_10025391 JGI24739J22299_100253914 340
534 3300001990 JGI24737J22298_10001968 JGI24737J22298_100019684 340
535 3300001990 JGI24737J22298_10002768 JGI24737J22298_100027687 340
536 3300002067 JGI24735J21928_10000770 JGI24735J21928_100007706 340
537 3300002075 JGI24738J21930_10000689 JGI24738J21930_100006898 340
538 3300002075 JGI24738J21930_10003624 JGI24738J21930_100036245 340
539 3300002076 JGI24749J21850_1000044 JGI24749J21850_100004416 340
540 3300002459 JGI24751J29686_10000022 JGI24751J29686_10000022112 340
541 3300005295 Ga0065707_10081965 Ga0065707_1008196510 340
542 3300005327 Ga0070658_10016110 Ga0070658_100161107 340
543 3300005329 Ga0070683_100332915 Ga0070683_1003329152 340
544 3300005331 Ga0070670_100000006 Ga0070670_100000006175 340
545 3300005339 Ga0070660_100083364 Ga0070660_1000833641 340
546 3300005339 Ga0070660_100196146 Ga0070660_1001961462 340
547 3300005344 Ga0070661_100087755 Ga0070661_1000877554 340
548 3300005353 Ga0070669_100000036 Ga0070669_10000003612 340
549 3300005366 Ga0070659_100248267 Ga0070659_1002482672 340
550 3300005367 Ga0070667_100003397 Ga0070667_1000033972 340
551 3300005455 Ga0070663_100007281 Ga0070663_1000072813 340
552 3300005457 Ga0070662_100020670 Ga0070662_1000206703 340
553 3300005563 Ga0068855_100127061 Ga0068855_1001270613 340
554 3300005577 Ga0068857_100048634 Ga0068857_1000486344 340
555 3300005614 Ga0068856_100020122 Ga0068856_1000201224 340
556 3300005616 Ga0068852_100169825 Ga0068852_1001698254 340
557 3300005618 Ga0068864_100000014 Ga0068864_100000014140 340
558 3300005719 Ga0068861_100003589 Ga0068861_1000035899 340
559 3300005834 Ga0068851_10051792 Ga0068851_100517923 340
560 3300005844 Ga0068862_100000007 Ga0068862_100000007163 340
561 3300009093 Ga0105240_10001747 Ga0105240_1000174714 340
562 3300009093 Ga0105240_10017212 Ga0105240_100172126 340
563 3300009174 Ga0105241_10035383 Ga0105241_100353832 340
564 3300009177 Ga0105248_10000522 Ga0105248_1000052239 340
565 3300009545 Ga0105237_10003199 Ga0105237_1000319920 340
566 3300009545 Ga0105237_10027834 Ga0105237_100278344 340
567 3300009551 Ga0105238_10122517 Ga0105238_101225174 340
568 3300013104 Ga0157370_10002158 Ga0157370_1000215822 340
569 3300013104 Ga0157370_10052766 Ga0157370_100527663 340
570 3300013105 Ga0157369_10012466 Ga0157369_100124669 340
571 3300013105 Ga0157369_10296475 Ga0157369_102964752 340
572 3300014325 Ga0163163_10047911 Ga0163163_100479114 340
573 3300014326 Ga0157380_10000108 Ga0157380_1000010811 340
574 3300025321 Ga0207656_10001573 Ga0207656_100015735 340
575 3300025321 Ga0207656_10122849 Ga0207656_101228492 340
576 3300025904 Ga0207647_10003366 Ga0207647_100033669 340
577 3300025909 Ga0207705_10013102 Ga0207705_100131027 340
578 3300025911 Ga0207654_10002589 Ga0207654_100025896 340
579 3300025913 Ga0207695_10001602 Ga0207695_1000160214 340
580 3300025913 Ga0207695_10002541 Ga0207695_100025417 340
581 3300025913 Ga0207695_10009522 Ga0207695_1000952210 340
582 3300025914 Ga0207671_10002424 Ga0207671_100024247 340
583 3300025914 Ga0207671_10007412 Ga0207671_100074124 340
584 3300025914 Ga0207671_10069127 Ga0207671_100691273 340
585 3300025919 Ga0207657_10020601 Ga0207657_100206016 340
586 3300025919 Ga0207657_10044562 Ga0207657_100445626 340
587 3300025923 Ga0207681_10000001 Ga0207681_10000001134 340
588 3300025924 Ga0207694_10003521 Ga0207694_100035218 340
589 3300025925 Ga0207650_10000023 Ga0207650_10000023135 340
590 3300025933 Ga0207706_10024125 Ga0207706_100241256 340
591 3300025941 Ga0207711_10001173 Ga0207711_1000117319 340
592 3300025949 Ga0207667_10000812 Ga0207667_1000081234 340
593 3300025949 Ga0207667_10001775 Ga0207667_100017758 340
594 3300025981 Ga0207640_10003292 Ga0207640_100032928 340
595 3300025981 Ga0207640_10005076 Ga0207640_100050766 340
596 3300025986 Ga0207658_10002434 Ga0207658_1000243414 340
597 3300026041 Ga0207639_10001324 Ga0207639_100013248 340
598 3300026041 Ga0207639_10068556 Ga0207639_100685564 340
599 3300026067 Ga0207678_10000983 Ga0207678_100009837 340
600 3300026067 Ga0207678_10008746 Ga0207678_100087466 340
601 3300026078 Ga0207702_10001804 Ga0207702_100018048 340
602 3300026078 Ga0207702_10001928 Ga0207702_1000192815 340
603 3300026095 Ga0207676_10000017 Ga0207676_10000017137 340
604 3300026116 Ga0207674_10024725 Ga0207674_100247254 340
605 3300026116 Ga0207674_10048279 Ga0207674_100482794 340
606 3300026118 Ga0207675_100023115 Ga0207675_1000231152 340
607 3300026142 Ga0207698_10015401 Ga0207698_100154012 340
608 3300026142 Ga0207698_10066589 Ga0207698_100665893 340
609 3300028380 Ga0268265_10000002 Ga0268265_10000002140 340
610 3300031548 Ga0307408_100003036 Ga0307408_10000303611 340
611 3300031852 Ga0307410_10156768 Ga0307410_101567683 340
612 3300031911 Ga0307412_10006261 Ga0307412_100062616 340
613 3300032002 Ga0307416_100017246 Ga0307416_1000172467 340

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02780

Transketolase_C

Transketolase, C-terminal domain

221

342

0.98

PF02779

Transket_pyr

Transketolase, pyrimidine binding domain

29

206

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1umd-assembly1.cif.gz_D branched-chain 2-oxo acid dehydrogenase (e1) from thermus thermophilus hb8 with 4-methyl-2-oxopentanoate as an intermediate 0.9766 16 339
1w88-assembly2.cif.gz_F the crystal structure of pyruvate dehydrogenase e1(d180n,e183q) bound to the peripheral subunit binding domain of e2 0.9752 16 338
1w88-assembly2.cif.gz_H the crystal structure of pyruvate dehydrogenase e1(d180n,e183q) bound to the peripheral subunit binding domain of e2 0.9746 16 339
3duf-assembly2.cif.gz_H snapshots of catalysis in the e1 subunit of the pyruvate dehydrogenase multi-enzyme complex 0.9744 16 338
6cer-assembly1.cif.gz_D human pyruvate dehydrogenase complex e1 component v138m mutation 0.9722 16 338
ID Description Score Start End Superfamily
af_Q10G39_79_267_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9781 18 206 3.40.50.970
af_Q2FY53_193_326_3.40.50.920 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9728 208 340 3.40.50.920
af_E5RPJ6_273_405_3.40.50.920 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9704 208 340 3.40.50.920
af_Q8IL09_280_409_3.40.50.920 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9667 208 335 3.40.50.920
af_E5RPJ6_273_405_3.40.50.920 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9634 208 340 3.40.50.920
ID Description Score Start End GO Terms
AF-A0A7V3YH18-F1-model_v4 Pyruvate dehydrogenase E1 component subunit alpha (EC 1.2.4.1) 0.9867 16 339 GO:0004739
GO:0006086
GO:0043231
AF-A0A2M7AD36-F1-model_v4 Alpha-ketoacid dehydrogenase subunit beta 0.9859 16 338 GO:0004739
AF-A0A541C5Q7-F1-model_v4 Alpha-ketoacid dehydrogenase subunit beta 0.9859 16 338 GO:0003824
AF-A0A4Q5QEV2-F1-model_v4 Alpha-ketoacid dehydrogenase subunit beta 0.9858 178 339 GO:0003824
AF-A0A2G9YA15-F1-model_v4 Dehydrogenase 0.9856 60 208

Feature Viewer

pLDDT pTM Quality
92.71 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map