F469236
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 613 | 327 | 591 | 330 |
Family's Representative Sequence
| Representative Sequence | 3300005842|Ga0068858_100000034|Ga0068858_10000003457 |
| Length | 369 |
| Sequence | VTETMPAPAPAAVRPGAGGRPPDGTPTSENRTMVEALGAALRDAMAADDRVVVFGEDVGALGGVFRVTSGLRDAFGDERCFDTPLAEAGIVGFAVGMAMYGSRPVVELQFDAFAYPAFEQIVSHVAKMSARTAGRVRLPIVLRIPYGGGIGAVEHHSDSSEAYYAHTAGLKVVTPSTPADAYVLLRAAIDDPDPVVFLEPKRLYWNRSPQPDVDVPPAPLGRAAVRRAGQDVTLITYGPAVPLALAAAQAAAGRGWSVEVVDLRTLVPFDDETVVASVRRTGRALVVHEASGFAGMGAEIAARVSERCFHSLAAPILRVTGFDVPYPPPKLEQHHLPGVARILGALGRLQWDDQPDTYWLAGPPPGDRR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501039 | Frankia saprophytica CN3 | Isolate | Nodule |
| 2 | 2643221682 | Streptomyces sp. Root1319 | Isolate | Unclassified |
| 3 | 2675902999 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 4 | 2687453737 | Frankia sp. BMG5.36 | Isolate | Nodule |
| 5 | 2751185725 | Microbispora sp. NRRL B-24597 | Isolate | Unclassified |
| 6 | 2751185792 | Kitasatospora arboriphila NRRL B-24581 | Isolate | Unclassified |
| 7 | 2773857921 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 8 | 2816332119 | Kribbella amoyensis DSM 24683 | Isolate | Rhizosphere |
| 9 | 2818991472 | Kitasatospora viridis DSM 44826 | Isolate | Rhizosphere |
| 10 | 2867475112 | Streptomyces sp. TM32 | Isolate | Unclassified |
| 11 | 2876377896 | Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 | Isolate | Nodule |
| 12 | 2879163058 | Sphingomonas pokkalii L3B27 | Isolate | Rhizosphere |
| 13 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 14 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 15 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 16 | 2939657138 | Conyzicola nivalis 2857 | Isolate | Rhizosphere |
| 17 | 2997451912 | Streptomyces piniterrae jys28 | Isolate | Rhizosphere |
| 18 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 19 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 20 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 21 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 22 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 23 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 24 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 25 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 26 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 27 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 28 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 29 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 30 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 31 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 32 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 33 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 58 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 59 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 64 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 67 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 72 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 74 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 75 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 76 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 78 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 79 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 80 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 81 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 82 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 83 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 84 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 85 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 86 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 87 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 88 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 89 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 90 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 91 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 92 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 93 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 94 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 95 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 96 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 97 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 98 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 99 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 100 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 101 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 103 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300012506 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 | Metagenome | Rhizosphere |
| 117 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 128 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 130 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 131 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 132 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 184 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 185 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 189 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 190 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 191 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 192 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 193 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 194 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 195 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 196 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 197 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 198 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 199 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 200 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 201 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 202 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 203 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 204 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 205 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 206 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 207 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 208 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 209 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 210 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 211 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 212 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 213 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 214 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 215 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 216 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 217 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 218 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 219 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 220 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 221 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 222 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 223 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 224 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 225 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 226 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 227 | 3300044659 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E | Metagenome | Unclassified |
| 228 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 229 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 230 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 231 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 232 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 233 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 234 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 235 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 236 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 237 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 250 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 251 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 252 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 253 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 254 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 255 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 256 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 257 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 258 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 259 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 260 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 261 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 262 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 263 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 264 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 265 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 291 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 292 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 293 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 294 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 295 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 296 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 297 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 303 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 304 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 305 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 314 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 315 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 316 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 317 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 318 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 319 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 322 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 323 | 8002775197 | Frankia nepalensis CN7 | Isolate | Nodule |
| 324 | 8025413630 | Streptomyces sp. CAI-17 | Isolate | Rhizosphere |
| 325 | 8033684223 | Streptomyces phytophilus PIP175 | Isolate | Unclassified |
| 326 | 8047710418 | Umezawaea endophytica DSM 103496 | Isolate | Unclassified |
| 327 | 8054160619 | Streptomyces rhizoryzae RS10V-4 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.11 |
| Metatranscriptomes | 1.31 |
| Isolates | 3.59 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.45 |
| Nodule | 1.14 |
| Rhizoplane | 2.94 |
| Rhizosphere | 88.91 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.57 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1000320 | 3300001904 | Bacteria | 8931 |
| 2 | JGI24736J21556_1000835 | 3300001904 | Bacteria | 5686 |
| 3 | JGI24741J21665_1000003 | 3300001915 | Bacteria | 56179 |
| 4 | JGI24740J21852_10003002 | 3300001979 | Bacteria | 7467 |
| 5 | JGI24739J22299_10001560 | 3300001989 | Bacteria | 8672 |
| 6 | JGI24739J22299_10004735 | 3300001989 | Bacteria | 5195 |
| 7 | JGI24739J22299_10025391 | 3300001989 | Bacteria | 2084 |
| 8 | JGI24737J22298_10001968 | 3300001990 | Bacteria | 7342 |
| 9 | JGI24737J22298_10002768 | 3300001990 | Bacteria | 6207 |
| 10 | JGI24735J21928_10000770 | 3300002067 | Bacteria | 11406 |
| 11 | JGI24738J21930_10000689 | 3300002075 | Bacteria | 9725 |
| 12 | JGI24738J21930_10003624 | 3300002075 | Bacteria | 3872 |
| 13 | JGI24738J21930_10005740 | 3300002075 | Bacteria | 2952 |
| 14 | JGI24749J21850_1000044 | 3300002076 | Bacteria | 23119 |
| 15 | JGI24035J26624_1000876 | 3300002126 | Bacteria | 2842 |
| 16 | JGI24751J29686_10000022 | 3300002459 | Bacteria | 104477 |
| 17 | JGI24751J29686_10005563 | 3300002459 | Bacteria | 2565 |
| 18 | JGI25406J46586_10014214 | 3300003203 | Bacteria | 3391 |
| 19 | JGI25165J46597_1000034 | 3300003214 | Bacteria | 292458 |
| 20 | JGI25405J52794_10013597 | 3300003911 | Bacteria | 1581 |
| 21 | Ga0065704_10102919 | 3300005289 | Bacteria | 2189 |
| 22 | Ga0065707_10081965 | 3300005295 | Bacteria | 26987 |
| 23 | Ga0065707_10086988 | 3300005295 | Bacteria | 5213 |
| 24 | Ga0065707_10169986 | 3300005295 | Bacteria | 1492 |
| 25 | Ga0070658_10000350 | 3300005327 | Bacteria | 39927 |
| 26 | Ga0070658_10001152 | 3300005327 | Bacteria | 22551 |
| 27 | Ga0070658_10016110 | 3300005327 | Bacteria | 5979 |
| 28 | Ga0070676_10110835 | 3300005328 | Bacteria | 1708 |
| 29 | Ga0070683_100000631 | 3300005329 | Bacteria | 25315 |
| 30 | Ga0070683_100016882 | 3300005329 | Bacteria | 6441 |
| 31 | Ga0070683_100022589 | 3300005329 | Bacteria | 5624 |
| 32 | Ga0070683_100024863 | 3300005329 | Bacteria | 5371 |
| 33 | Ga0070683_100332915 | 3300005329 | Bacteria | 1445 |
| 34 | Ga0070690_100006085 | 3300005330 | Bacteria | 6828 |
| 35 | Ga0070670_100000006 | 3300005331 | Bacteria | 319420 |
| 36 | Ga0070670_100015890 | 3300005331 | Bacteria | 6460 |
| 37 | Ga0070670_100250693 | 3300005331 | Bacteria | 1542 |
| 38 | Ga0070666_10161404 | 3300005335 | Bacteria | 1567 |
| 39 | Ga0070680_100001048 | 3300005336 | Bacteria | 19770 |
| 40 | Ga0070680_100046550 | 3300005336 | Bacteria | 3529 |
| 41 | Ga0070682_100003544 | 3300005337 | Bacteria | 8637 |
| 42 | Ga0070660_100083364 | 3300005339 | Bacteria | 2511 |
| 43 | Ga0070660_100133309 | 3300005339 | Bacteria | 1989 |
| 44 | Ga0070660_100196146 | 3300005339 | Bacteria | 1637 |
| 45 | Ga0070660_100470551 | 3300005339 | Bacteria | 1044 |
| 46 | Ga0070661_100087755 | 3300005344 | Bacteria | 2301 |
| 47 | Ga0070661_100146245 | 3300005344 | Bacteria | 1784 |
| 48 | Ga0070661_100225696 | 3300005344 | Bacteria | 1438 |
| 49 | Ga0070692_10088845 | 3300005345 | Bacteria | 1676 |
| 50 | Ga0070668_100000015 | 3300005347 | Bacteria | 106650 |
| 51 | Ga0070669_100000036 | 3300005353 | Bacteria | 137564 |
| 52 | Ga0070669_100362547 | 3300005353 | Bacteria | 1179 |
| 53 | Ga0070675_100020528 | 3300005354 | Bacteria | 5271 |
| 54 | Ga0070671_100000247 | 3300005355 | Bacteria | 36402 |
| 55 | Ga0070671_100043603 | 3300005355 | Bacteria | 3728 |
| 56 | Ga0070659_100029919 | 3300005366 | Bacteria | 4211 |
| 57 | Ga0070659_100248267 | 3300005366 | Bacteria | 1474 |
| 58 | Ga0070659_100397146 | 3300005366 | Bacteria | 1163 |
| 59 | Ga0070667_100000017 | 3300005367 | Bacteria | 230531 |
| 60 | Ga0070667_100001359 | 3300005367 | Bacteria | 21936 |
| 61 | Ga0070667_100003397 | 3300005367 | Bacteria | 13559 |
| 62 | Ga0070714_100024737 | 3300005435 | Bacteria | 4948 |
| 63 | Ga0070713_100001271 | 3300005436 | Bacteria | 16127 |
| 64 | Ga0070713_100467234 | 3300005436 | Bacteria | 1187 |
| 65 | Ga0070700_100003943 | 3300005441 | Bacteria | 7705 |
| 66 | Ga0070708_100021161 | 3300005445 | Bacteria | 5494 |
| 67 | Ga0070708_100139942 | 3300005445 | Bacteria | 2244 |
| 68 | Ga0070663_100007281 | 3300005455 | Bacteria | 6726 |
| 69 | Ga0070678_100066473 | 3300005456 | Bacteria | 2680 |
| 70 | Ga0070662_100020670 | 3300005457 | Bacteria | 4488 |
| 71 | Ga0070662_100133581 | 3300005457 | Bacteria | 1916 |
| 72 | Ga0070681_10000869 | 3300005458 | Bacteria | 25460 |
| 73 | Ga0068867_100211526 | 3300005459 | Bacteria | 1558 |
| 74 | Ga0070685_10089877 | 3300005466 | Bacteria | 1857 |
| 75 | Ga0070707_100001272 | 3300005468 | Bacteria | 24810 |
| 76 | Ga0070707_100329680 | 3300005468 | Bacteria | 1483 |
| 77 | Ga0070698_100030713 | 3300005471 | Bacteria | 5570 |
| 78 | Ga0070699_100018535 | 3300005518 | Bacteria | 5978 |
| 79 | Ga0070679_100000267 | 3300005530 | Bacteria | 43860 |
| 80 | Ga0070679_100481640 | 3300005530 | Bacteria | 1185 |
| 81 | Ga0070684_100001926 | 3300005535 | Bacteria | 15227 |
| 82 | Ga0070697_100088459 | 3300005536 | Bacteria | 2558 |
| 83 | Ga0068853_100001543 | 3300005539 | Bacteria | 16739 |
| 84 | Ga0068853_100028039 | 3300005539 | Bacteria | 4736 |
| 85 | Ga0068853_100231006 | 3300005539 | Bacteria | 1692 |
| 86 | Ga0070672_100099114 | 3300005543 | Bacteria | 2361 |
| 87 | Ga0070686_100117902 | 3300005544 | Bacteria | 1818 |
| 88 | Ga0070665_100000419 | 3300005548 | Bacteria | 62030 |
| 89 | Ga0070665_100030769 | 3300005548 | Bacteria | 5402 |
| 90 | Ga0070665_100388769 | 3300005548 | Bacteria | 1403 |
| 91 | Ga0070704_100173916 | 3300005549 | Bacteria | 1715 |
| 92 | Ga0068855_100002277 | 3300005563 | Bacteria | 23721 |
| 93 | Ga0068855_100006052 | 3300005563 | Bacteria | 14754 |
| 94 | Ga0068855_100110096 | 3300005563 | Bacteria | 3162 |
| 95 | Ga0068855_100127061 | 3300005563 | Bacteria | 2914 |
| 96 | Ga0068855_100482761 | 3300005563 | Bacteria | 1349 |
| 97 | Ga0070664_100005716 | 3300005564 | Bacteria | 10020 |
| 98 | Ga0070664_100007324 | 3300005564 | Bacteria | 8896 |
| 99 | Ga0068857_100000056 | 3300005577 | Bacteria | 62615 |
| 100 | Ga0068857_100017241 | 3300005577 | Bacteria | 6328 |
| 101 | Ga0068857_100048634 | 3300005577 | Bacteria | 3764 |
| 102 | Ga0068857_100051144 | 3300005577 | Bacteria | 3664 |
| 103 | Ga0068857_100209739 | 3300005577 | Bacteria | 1777 |
| 104 | Ga0068854_100001739 | 3300005578 | Bacteria | 13293 |
| 105 | Ga0068854_100017388 | 3300005578 | Bacteria | 4811 |
| 106 | Ga0068854_100110303 | 3300005578 | Bacteria | 2074 |
| 107 | Ga0068856_100000485 | 3300005614 | Bacteria | 44052 |
| 108 | Ga0068856_100001249 | 3300005614 | Bacteria | 26713 |
| 109 | Ga0068856_100019458 | 3300005614 | Bacteria | 6590 |
| 110 | Ga0068856_100020122 | 3300005614 | Bacteria | 6483 |
| 111 | Ga0070702_100090835 | 3300005615 | Bacteria | 1852 |
| 112 | Ga0068852_100000316 | 3300005616 | Bacteria | 32795 |
| 113 | Ga0068852_100012076 | 3300005616 | Bacteria | 6540 |
| 114 | Ga0068852_100049837 | 3300005616 | Bacteria | 3585 |
| 115 | Ga0068852_100105385 | 3300005616 | Bacteria | 2555 |
| 116 | Ga0068852_100134351 | 3300005616 | Bacteria | 2283 |
| 117 | Ga0068852_100169825 | 3300005616 | Bacteria | 2043 |
| 118 | Ga0068859_100001073 | 3300005617 | Bacteria | 27987 |
| 119 | Ga0068864_100000014 | 3300005618 | Bacteria | 308927 |
| 120 | Ga0068864_100019246 | 3300005618 | Bacteria | 5707 |
| 121 | Ga0068864_100022356 | 3300005618 | Bacteria | 5302 |
| 122 | Ga0068864_100165964 | 3300005618 | Bacteria | 2010 |
| 123 | Ga0068864_100304568 | 3300005618 | Bacteria | 1493 |
| 124 | Ga0068861_100000365 | 3300005719 | Bacteria | 25954 |
| 125 | Ga0068861_100003589 | 3300005719 | Bacteria | 10337 |
| 126 | Ga0068851_10051792 | 3300005834 | Bacteria | 2086 |
| 127 | Ga0068870_10016755 | 3300005840 | Bacteria | 3509 |
| 128 | Ga0068863_100000051 | 3300005841 | Bacteria | 127526 |
| 129 | Ga0068863_100011881 | 3300005841 | Bacteria | 8415 |
| 130 | Ga0068863_100033255 | 3300005841 | Bacteria | 4912 |
| 131 | Ga0068858_100000034 | 3300005842 | Bacteria | 140680 |
| 132 | Ga0068858_100000303 | 3300005842 | Bacteria | 52646 |
| 133 | Ga0068858_100113383 | 3300005842 | Bacteria | 2532 |
| 134 | Ga0068860_100000056 | 3300005843 | Bacteria | 202751 |
| 135 | Ga0068860_100000187 | 3300005843 | Bacteria | 98756 |
| 136 | Ga0068862_100000007 | 3300005844 | Bacteria | 313933 |
| 137 | Ga0068862_100000108 | 3300005844 | Bacteria | 99413 |
| 138 | Ga0068862_100011909 | 3300005844 | Bacteria | 7184 |
| 139 | Ga0068862_100117134 | 3300005844 | Bacteria | 2344 |
| 140 | Ga0068862_100177726 | 3300005844 | Bacteria | 1909 |
| 141 | Ga0081455_10002170 | 3300005937 | Bacteria | 23415 |
| 142 | Ga0081455_10007650 | 3300005937 | Bacteria | 11349 |
| 143 | Ga0081538_10000056 | 3300005981 | Bacteria | 103929 |
| 144 | Ga0081540_1010072 | 3300005983 | Bacteria | 6435 |
| 145 | Ga0081539_10002722 | 3300005985 | Bacteria | 23921 |
| 146 | Ga0075368_10068095 | 3300006042 | Bacteria | 1434 |
| 147 | Ga0075432_10000050 | 3300006058 | Bacteria | 22789 |
| 148 | Ga0075367_10001465 | 3300006178 | Bacteria | 10180 |
| 149 | Ga0068871_100062302 | 3300006358 | Bacteria | 3048 |
| 150 | Ga0075428_100205758 | 3300006844 | Bacteria | 2127 |
| 151 | Ga0075430_100014354 | 3300006846 | Bacteria | 6751 |
| 152 | Ga0075431_100362858 | 3300006847 | Bacteria | 1455 |
| 153 | Ga0075433_10000264 | 3300006852 | Bacteria | 30682 |
| 154 | Ga0075433_10101847 | 3300006852 | Unclassified | 2543 |
| 155 | Ga0075434_100000012 | 3300006871 | Bacteria | 83539 |
| 156 | Ga0075434_100028821 | 3300006871 | Bacteria | 5459 |
| 157 | Ga0075436_100000674 | 3300006914 | Bacteria | 22490 |
| 158 | Ga0075436_100039592 | 3300006914 | Bacteria | 3253 |
| 159 | Ga0075436_100107311 | 3300006914 | Bacteria | 1948 |
| 160 | Ga0097620_100001073 | 3300006931 | Bacteria | 27987 |
| 161 | Ga0075435_100008287 | 3300007076 | Bacteria | 7449 |
| 162 | Ga0075435_100020306 | 3300007076 | Bacteria | 5087 |
| 163 | Ga0105251_10012092 | 3300009011 | Bacteria | 4898 |
| 164 | Ga0105240_10001747 | 3300009093 | Bacteria | 36697 |
| 165 | Ga0105240_10002962 | 3300009093 | Bacteria | 26742 |
| 166 | Ga0105240_10017212 | 3300009093 | Bacteria | 9750 |
| 167 | Ga0111539_10026281 | 3300009094 | Bacteria | 7120 |
| 168 | Ga0111539_10066027 | 3300009094 | Bacteria | 4273 |
| 169 | Ga0111539_10071083 | 3300009094 | Bacteria | 4106 |
| 170 | Ga0105245_10024404 | 3300009098 | Bacteria | 5309 |
| 171 | Ga0105245_10032771 | 3300009098 | Bacteria | 4600 |
| 172 | Ga0105245_10034508 | 3300009098 | Bacteria | 4488 |
| 173 | Ga0105245_10483682 | 3300009098 | Bacteria | 1252 |
| 174 | Ga0105247_10009785 | 3300009101 | Bacteria | 5809 |
| 175 | Ga0114129_10094436 | 3300009147 | Bacteria | 4142 |
| 176 | Ga0114129_10152316 | 3300009147 | Bacteria | 3164 |
| 177 | Ga0105241_10005398 | 3300009174 | Bacteria | 9450 |
| 178 | Ga0105241_10035383 | 3300009174 | Bacteria | 3756 |
| 179 | Ga0105242_10226614 | 3300009176 | Bacteria | 1673 |
| 180 | Ga0105248_10000028 | 3300009177 | Bacteria | 225683 |
| 181 | Ga0105248_10000522 | 3300009177 | Bacteria | 43686 |
| 182 | Ga0105248_10007630 | 3300009177 | Bacteria | 11886 |
| 183 | Ga0105248_10250841 | 3300009177 | Bacteria | 1992 |
| 184 | Ga0105237_10003199 | 3300009545 | Bacteria | 19643 |
| 185 | Ga0105237_10003715 | 3300009545 | Bacteria | 17976 |
| 186 | Ga0105237_10003902 | 3300009545 | Bacteria | 17484 |
| 187 | Ga0105237_10027834 | 3300009545 | Bacteria | 5759 |
| 188 | Ga0105237_10060391 | 3300009545 | Bacteria | 3793 |
| 189 | Ga0105238_10000412 | 3300009551 | Bacteria | 45119 |
| 190 | Ga0105238_10041469 | 3300009551 | Bacteria | 4662 |
| 191 | Ga0105238_10055286 | 3300009551 | Bacteria | 3985 |
| 192 | Ga0105238_10105086 | 3300009551 | Bacteria | 2805 |
| 193 | Ga0105238_10109616 | 3300009551 | Bacteria | 2742 |
| 194 | Ga0105238_10122517 | 3300009551 | Bacteria | 2580 |
| 195 | Ga0105249_10027494 | 3300009553 | Bacteria | 5133 |
| 196 | Ga0105239_10037599 | 3300010375 | Bacteria | 5304 |
| 197 | Ga0105239_10120986 | 3300010375 | Bacteria | 2907 |
| 198 | Ga0157324_1001452 | 3300012506 | Bacteria | 1312 |
| 199 | Ga0157373_10036500 | 3300013100 | Bacteria | 3527 |
| 200 | Ga0157373_10093793 | 3300013100 | Bacteria | 2114 |
| 201 | Ga0157371_10007101 | 3300013102 | Bacteria | 9103 |
| 202 | Ga0157370_10002158 | 3300013104 | Bacteria | 24021 |
| 203 | Ga0157370_10052766 | 3300013104 | Bacteria | 3880 |
| 204 | Ga0157370_10235947 | 3300013104 | Bacteria | 1692 |
| 205 | Ga0157369_10012466 | 3300013105 | Bacteria | 9645 |
| 206 | Ga0157369_10296475 | 3300013105 | Bacteria | 1683 |
| 207 | Ga0163162_10240941 | 3300013306 | Bacteria | 1939 |
| 208 | Ga0157372_10041914 | 3300013307 | Bacteria | 5061 |
| 209 | Ga0163163_10012150 | 3300014325 | Bacteria | 7834 |
| 210 | Ga0163163_10047911 | 3300014325 | Bacteria | 4201 |
| 211 | Ga0157380_10000108 | 3300014326 | Bacteria | 45269 |
| 212 | Ga0157377_10125577 | 3300014745 | Bacteria | 1560 |
| 213 | Ga0157379_10001804 | 3300014968 | Bacteria | 17660 |
| 214 | Ga0157379_10092133 | 3300014968 | Bacteria | 2719 |
| 215 | Ga0157379_10183260 | 3300014968 | Bacteria | 1892 |
| 216 | Ga0206356_10245307 | 3300020070 | Bacteria | 3835 |
| 217 | Ga0206349_1510461 | 3300020075 | Bacteria | 1918 |
| 218 | Ga0206352_10299992 | 3300020078 | Bacteria | 1630 |
| 219 | Ga0206350_10137420 | 3300020080 | Bacteria | 1009 |
| 220 | Ga0206350_10247341 | 3300020080 | Bacteria | 5070 |
| 221 | Ga0206350_10426173 | 3300020080 | Bacteria | 1367 |
| 222 | Ga0224712_10000335 | 3300022467 | Bacteria | 8951 |
| 223 | Ga0224712_10014543 | 3300022467 | Bacteria | 2538 |
| 224 | Ga0209233_1000028 | 3300025261 | Bacteria | 642062 |
| 225 | Ga0209233_1020625 | 3300025261 | Bacteria | 1724 |
| 226 | Ga0207426_1002259 | 3300025302 | Bacteria | 12748 |
| 227 | Ga0207656_10001573 | 3300025321 | Bacteria | 7590 |
| 228 | Ga0207656_10122849 | 3300025321 | Bacteria | 1210 |
| 229 | Ga0207710_10013639 | 3300025900 | Bacteria | 3419 |
| 230 | Ga0207688_10001558 | 3300025901 | Bacteria | 12073 |
| 231 | Ga0207688_10073172 | 3300025901 | Bacteria | 1947 |
| 232 | Ga0207647_10003366 | 3300025904 | Bacteria | 11988 |
| 233 | Ga0207647_10008851 | 3300025904 | Bacteria | 7182 |
| 234 | Ga0207645_10063142 | 3300025907 | Bacteria | 2366 |
| 235 | Ga0207643_10000797 | 3300025908 | Bacteria | 19195 |
| 236 | Ga0207705_10000009 | 3300025909 | Bacteria | 576128 |
| 237 | Ga0207705_10013102 | 3300025909 | Bacteria | 5984 |
| 238 | Ga0207705_10029498 | 3300025909 | Bacteria | 3910 |
| 239 | Ga0207684_10002195 | 3300025910 | Bacteria | 19958 |
| 240 | Ga0207684_10113154 | 3300025910 | Bacteria | 2323 |
| 241 | Ga0207654_10002589 | 3300025911 | Bacteria | 9179 |
| 242 | Ga0207707_10000668 | 3300025912 | Bacteria | 34029 |
| 243 | Ga0207707_10135997 | 3300025912 | Bacteria | 2149 |
| 244 | Ga0207695_10001602 | 3300025913 | Bacteria | 36745 |
| 245 | Ga0207695_10002541 | 3300025913 | Bacteria | 26799 |
| 246 | Ga0207695_10009522 | 3300025913 | Bacteria | 12011 |
| 247 | Ga0207671_10001958 | 3300025914 | Bacteria | 22715 |
| 248 | Ga0207671_10002424 | 3300025914 | Bacteria | 19965 |
| 249 | Ga0207671_10007412 | 3300025914 | Bacteria | 9518 |
| 250 | Ga0207671_10069127 | 3300025914 | Bacteria | 2633 |
| 251 | Ga0207660_10005180 | 3300025917 | Bacteria | 8473 |
| 252 | Ga0207660_10142856 | 3300025917 | Bacteria | 1831 |
| 253 | Ga0207657_10020601 | 3300025919 | Bacteria | 6228 |
| 254 | Ga0207657_10044562 | 3300025919 | Bacteria | 3899 |
| 255 | Ga0207657_10080644 | 3300025919 | Bacteria | 2735 |
| 256 | Ga0207657_10167727 | 3300025919 | Bacteria | 1780 |
| 257 | Ga0207649_10012024 | 3300025920 | Bacteria | 4788 |
| 258 | Ga0207652_10000079 | 3300025921 | Bacteria | 105322 |
| 259 | Ga0207652_10393688 | 3300025921 | Bacteria | 1250 |
| 260 | Ga0207646_10008726 | 3300025922 | Bacteria | 10115 |
| 261 | Ga0207646_10134322 | 3300025922 | Bacteria | 2228 |
| 262 | Ga0207646_10205739 | 3300025922 | Bacteria | 1778 |
| 263 | Ga0207681_10000001 | 3300025923 | Bacteria | 1105841 |
| 264 | Ga0207681_10002181 | 3300025923 | Bacteria | 12481 |
| 265 | Ga0207694_10003521 | 3300025924 | Bacteria | 12425 |
| 266 | Ga0207694_10009212 | 3300025924 | Bacteria | 7449 |
| 267 | Ga0207694_10059983 | 3300025924 | Bacteria | 2960 |
| 268 | Ga0207694_10274034 | 3300025924 | Bacteria | 1384 |
| 269 | Ga0207650_10000023 | 3300025925 | Bacteria | 308148 |
| 270 | Ga0207650_10003806 | 3300025925 | Bacteria | 10316 |
| 271 | Ga0207659_10017229 | 3300025926 | Bacteria | 4715 |
| 272 | Ga0207687_10137146 | 3300025927 | Bacteria | 1852 |
| 273 | Ga0207687_10141419 | 3300025927 | Bacteria | 1826 |
| 274 | Ga0207700_10000762 | 3300025928 | Bacteria | 18587 |
| 275 | Ga0207664_10013589 | 3300025929 | Bacteria | 5851 |
| 276 | Ga0207664_10014234 | 3300025929 | Bacteria | 5737 |
| 277 | Ga0207644_10000139 | 3300025931 | Bacteria | 51953 |
| 278 | Ga0207644_10129184 | 3300025931 | Bacteria | 1932 |
| 279 | Ga0207644_10358028 | 3300025931 | Bacteria | 1186 |
| 280 | Ga0207690_10004301 | 3300025932 | Bacteria | 8403 |
| 281 | Ga0207690_10009103 | 3300025932 | Bacteria | 5892 |
| 282 | Ga0207690_10045438 | 3300025932 | Bacteria | 2901 |
| 283 | Ga0207706_10024125 | 3300025933 | Bacteria | 5454 |
| 284 | Ga0207706_10031241 | 3300025933 | Bacteria | 4745 |
| 285 | Ga0207670_10048503 | 3300025936 | Bacteria | 2834 |
| 286 | Ga0207691_10060823 | 3300025940 | Bacteria | 3432 |
| 287 | Ga0207711_10000090 | 3300025941 | Bacteria | 97320 |
| 288 | Ga0207711_10001173 | 3300025941 | Bacteria | 24920 |
| 289 | Ga0207711_10002657 | 3300025941 | Bacteria | 15804 |
| 290 | Ga0207711_10041980 | 3300025941 | Bacteria | 3896 |
| 291 | Ga0207689_10033621 | 3300025942 | Bacteria | 4260 |
| 292 | Ga0207661_10000103 | 3300025944 | Bacteria | 54134 |
| 293 | Ga0207661_10007796 | 3300025944 | Bacteria | 7625 |
| 294 | Ga0207661_10014150 | 3300025944 | Bacteria | 5838 |
| 295 | Ga0207661_10050803 | 3300025944 | Bacteria | 3306 |
| 296 | Ga0207661_10062031 | 3300025944 | Bacteria | 3023 |
| 297 | Ga0207661_10084923 | 3300025944 | Bacteria | 2623 |
| 298 | Ga0207661_10102517 | 3300025944 | Bacteria | 2406 |
| 299 | Ga0207679_10078958 | 3300025945 | Bacteria | 2508 |
| 300 | Ga0207667_10000812 | 3300025949 | Bacteria | 40505 |
| 301 | Ga0207667_10001775 | 3300025949 | Bacteria | 27157 |
| 302 | Ga0207667_10011969 | 3300025949 | Bacteria | 10042 |
| 303 | Ga0207667_10068034 | 3300025949 | Bacteria | 3709 |
| 304 | Ga0207667_10231671 | 3300025949 | Bacteria | 1891 |
| 305 | Ga0207668_10000012 | 3300025972 | Bacteria | 182541 |
| 306 | Ga0207640_10003292 | 3300025981 | Bacteria | 8709 |
| 307 | Ga0207640_10005076 | 3300025981 | Bacteria | 7162 |
| 308 | Ga0207658_10000011 | 3300025986 | Bacteria | 239620 |
| 309 | Ga0207658_10001130 | 3300025986 | Bacteria | 21490 |
| 310 | Ga0207658_10002434 | 3300025986 | Bacteria | 13608 |
| 311 | Ga0207658_10063754 | 3300025986 | Bacteria | 2763 |
| 312 | Ga0207703_10000057 | 3300026035 | Bacteria | 140694 |
| 313 | Ga0207703_10000529 | 3300026035 | Bacteria | 39299 |
| 314 | Ga0207703_10003805 | 3300026035 | Bacteria | 12534 |
| 315 | Ga0207703_10206175 | 3300026035 | Bacteria | 1750 |
| 316 | Ga0207639_10001324 | 3300026041 | Bacteria | 16766 |
| 317 | Ga0207639_10002192 | 3300026041 | Bacteria | 13151 |
| 318 | Ga0207639_10023342 | 3300026041 | Bacteria | 4466 |
| 319 | Ga0207639_10068556 | 3300026041 | Bacteria | 2764 |
| 320 | Ga0207639_10141726 | 3300026041 | Bacteria | 2003 |
| 321 | Ga0207678_10000983 | 3300026067 | Bacteria | 25970 |
| 322 | Ga0207678_10004985 | 3300026067 | Bacteria | 11908 |
| 323 | Ga0207678_10008746 | 3300026067 | Bacteria | 8912 |
| 324 | Ga0207708_10020704 | 3300026075 | Bacteria | 4961 |
| 325 | Ga0207708_10084089 | 3300026075 | Bacteria | 2447 |
| 326 | Ga0207702_10001729 | 3300026078 | Bacteria | 21487 |
| 327 | Ga0207702_10001804 | 3300026078 | Bacteria | 21073 |
| 328 | Ga0207702_10001928 | 3300026078 | Bacteria | 20276 |
| 329 | Ga0207702_10009748 | 3300026078 | Bacteria | 8064 |
| 330 | Ga0207702_10010356 | 3300026078 | Bacteria | 7808 |
| 331 | Ga0207641_10000115 | 3300026088 | Bacteria | 118497 |
| 332 | Ga0207641_10000261 | 3300026088 | Bacteria | 66553 |
| 333 | Ga0207641_10000906 | 3300026088 | Bacteria | 30745 |
| 334 | Ga0207641_10015345 | 3300026088 | Bacteria | 6278 |
| 335 | Ga0207641_10082857 | 3300026088 | Bacteria | 2787 |
| 336 | Ga0207648_10225227 | 3300026089 | Bacteria | 1667 |
| 337 | Ga0207676_10000017 | 3300026095 | Bacteria | 308709 |
| 338 | Ga0207676_10002586 | 3300026095 | Bacteria | 12904 |
| 339 | Ga0207676_10259744 | 3300026095 | Bacteria | 1567 |
| 340 | Ga0207676_10324656 | 3300026095 | Bacteria | 1414 |
| 341 | Ga0207674_10000825 | 3300026116 | Bacteria | 40282 |
| 342 | Ga0207674_10002248 | 3300026116 | Bacteria | 24465 |
| 343 | Ga0207674_10004674 | 3300026116 | Bacteria | 16437 |
| 344 | Ga0207674_10024725 | 3300026116 | Bacteria | 6411 |
| 345 | Ga0207674_10043930 | 3300026116 | Bacteria | 4605 |
| 346 | Ga0207674_10048279 | 3300026116 | Bacteria | 4357 |
| 347 | Ga0207674_10131803 | 3300026116 | Bacteria | 2462 |
| 348 | Ga0207674_10218267 | 3300026116 | Bacteria | 1855 |
| 349 | Ga0207675_100000380 | 3300026118 | Bacteria | 42566 |
| 350 | Ga0207675_100009290 | 3300026118 | Bacteria | 9219 |
| 351 | Ga0207675_100023115 | 3300026118 | Bacteria | 5781 |
| 352 | Ga0207675_100042195 | 3300026118 | Bacteria | 4258 |
| 353 | Ga0207683_10001599 | 3300026121 | Bacteria | 20364 |
| 354 | Ga0207698_10000252 | 3300026142 | Bacteria | 32804 |
| 355 | Ga0207698_10015401 | 3300026142 | Bacteria | 5119 |
| 356 | Ga0207698_10040208 | 3300026142 | Bacteria | 3472 |
| 357 | Ga0207698_10066589 | 3300026142 | Bacteria | 2836 |
| 358 | Ga0207698_10212989 | 3300026142 | Bacteria | 1740 |
| 359 | Ga0207698_10327345 | 3300026142 | Bacteria | 1438 |
| 360 | Ga0209813_10005445 | 3300027866 | Bacteria | 3089 |
| 361 | Ga0207428_10006574 | 3300027907 | Bacteria | 10717 |
| 362 | Ga0207428_10135863 | 3300027907 | Bacteria | 1880 |
| 363 | Ga0268266_10001716 | 3300028379 | Bacteria | 25097 |
| 364 | Ga0268266_10005489 | 3300028379 | Bacteria | 11806 |
| 365 | Ga0268266_10036558 | 3300028379 | Bacteria | 4181 |
| 366 | Ga0268266_10218201 | 3300028379 | Bacteria | 1752 |
| 367 | Ga0268265_10000002 | 3300028380 | Bacteria | 1035381 |
| 368 | Ga0268265_10000429 | 3300028380 | Bacteria | 44619 |
| 369 | Ga0268265_10006576 | 3300028380 | Bacteria | 7865 |
| 370 | Ga0268264_10000040 | 3300028381 | Bacteria | 373714 |
| 371 | Ga0268264_10000089 | 3300028381 | Bacteria | 234760 |
| 372 | Ga0268264_10288204 | 3300028381 | Bacteria | 1541 |
| 373 | Ga0265318_10009570 | 3300028577 | Bacteria | 4254 |
| 374 | Ga0307511_10093820 | 3300030521 | Bacteria | 2015 |
| 375 | Ga0307511_10184429 | 3300030521 | Bacteria | 1117 |
| 376 | Ga0265340_10024944 | 3300031247 | Bacteria | 3033 |
| 377 | Ga0307513_10001824 | 3300031456 | Bacteria | 30233 |
| 378 | Ga0307513_10017622 | 3300031456 | Bacteria | 8560 |
| 379 | Ga0307513_10093855 | 3300031456 | Bacteria | 3048 |
| 380 | Ga0307408_100003036 | 3300031548 | Bacteria | 11592 |
| 381 | Ga0307408_100008166 | 3300031548 | Bacteria | 6915 |
| 382 | Ga0307514_10071690 | 3300031649 | Bacteria | 2597 |
| 383 | Ga0265314_10009422 | 3300031711 | Bacteria | 8236 |
| 384 | Ga0265314_10174810 | 3300031711 | Bacteria | 1293 |
| 385 | Ga0316576_10002154 | 3300031727 | Bacteria | 11099 |
| 386 | Ga0307405_10013863 | 3300031731 | Bacteria | 4313 |
| 387 | Ga0307405_10039855 | 3300031731 | Bacteria | 2842 |
| 388 | Ga0307405_10077955 | 3300031731 | Bacteria | 2155 |
| 389 | Ga0316577_10056501 | 3300031733 | Bacteria | 2190 |
| 390 | Ga0307413_10017580 | 3300031824 | Bacteria | 3728 |
| 391 | Ga0307410_10007513 | 3300031852 | Bacteria | 5972 |
| 392 | Ga0307410_10156768 | 3300031852 | Bacteria | 1701 |
| 393 | Ga0307410_10392303 | 3300031852 | Bacteria | 1119 |
| 394 | Ga0307406_10000021 | 3300031901 | Bacteria | 98265 |
| 395 | Ga0307406_10000142 | 3300031901 | Bacteria | 42391 |
| 396 | Ga0307406_10002033 | 3300031901 | Bacteria | 11048 |
| 397 | Ga0307406_10016712 | 3300031901 | Bacteria | 4269 |
| 398 | Ga0307407_10000926 | 3300031903 | Bacteria | 9928 |
| 399 | Ga0307412_10001578 | 3300031911 | Bacteria | 12554 |
| 400 | Ga0307412_10006261 | 3300031911 | Bacteria | 6718 |
| 401 | Ga0307412_10007651 | 3300031911 | Bacteria | 6136 |
| 402 | Ga0307412_10022958 | 3300031911 | Bacteria | 3832 |
| 403 | Ga0307409_100001681 | 3300031995 | Bacteria | 11138 |
| 404 | Ga0307409_100138395 | 3300031995 | Bacteria | 2093 |
| 405 | Ga0307409_100144955 | 3300031995 | Bacteria | 2052 |
| 406 | Ga0307416_100000198 | 3300032002 | Bacteria | 31466 |
| 407 | Ga0307416_100017246 | 3300032002 | Bacteria | 5045 |
| 408 | Ga0307416_100097071 | 3300032002 | Bacteria | 2550 |
| 409 | Ga0307416_100638990 | 3300032002 | Bacteria | 1148 |
| 410 | Ga0307414_10142901 | 3300032004 | Bacteria | 1876 |
| 411 | Ga0307414_10213057 | 3300032004 | Bacteria | 1580 |
| 412 | Ga0307411_10014192 | 3300032005 | Bacteria | 4425 |
| 413 | Ga0307415_100026006 | 3300032126 | Bacteria | 3684 |
| 414 | Ga0307415_100436187 | 3300032126 | Bacteria | 1128 |
| 415 | Ga0316583_10013966 | 3300032133 | Bacteria | 2896 |
| 416 | Ga0373956_0003092 | 3300035119 | Bacteria | 6734 |
| 417 | Ga0373955_0036607 | 3300035172 | Bacteria | 2605 |
| 418 | Ga0373931_0098292 | 3300035691 | Bacteria | 1643 |
| 419 | Ga0373937_0263722 | 3300036401 | Bacteria | 1625 |
| 420 | Ga0316584_0011920 | 3300036712 | Bacteria | 6124 |
| 421 | Ga0395899_0017676 | 3300037312 | Bacteria | 5432 |
| 422 | Ga0395900_0156843 | 3300037418 | Bacteria | 2325 |
| 423 | Ga0395898_0089464 | 3300037466 | Bacteria | 2963 |
| 424 | Ga0395905_0006562 | 3300037471 | Bacteria | 11688 |
| 425 | Ga0395905_0009660 | 3300037471 | Bacteria | 9415 |
| 426 | Ga0395905_0113931 | 3300037471 | Bacteria | 2541 |
| 427 | Ga0316581_0008927 | 3300037588 | Bacteria | 2742 |
| 428 | Ga0395901_0321143 | 3300038443 | Bacteria | 1602 |
| 429 | Ga0436360_0076518 | 3300039438 | Bacteria | 1389 |
| 430 | Ga0436361_0231868 | 3300039447 | Bacteria | 59358 |
| 431 | Ga0436361_0355012 | 3300039447 | Bacteria | 1435 |
| 432 | Ga0436363_1719758 | 3300039450 | Bacteria | 1689 |
| 433 | Ga0451833_0579776 | 3300041491 | Bacteria | 14024 |
| 434 | Ga0451853_0174754 | 3300041512 | Bacteria | 2748 |
| 435 | Ga0439463_008971 | 3300042016 | Bacteria | 2463 |
| 436 | Ga0466969_0000809 | 3300044656 | Bacteria | 16987 |
| 437 | Ga0466973_0193982 | 3300044659 | Bacteria | 1522 |
| 438 | Ga0466966_0032687 | 3300044684 | Bacteria | 3370 |
| 439 | Ga0466961_0003474 | 3300044693 | Bacteria | 9822 |
| 440 | Ga0466963_0041656 | 3300044694 | Bacteria | 3012 |
| 441 | Ga0466971_0000747 | 3300044719 | Bacteria | 13034 |
| 442 | Ga0466957_0199275 | 3300044842 | Bacteria | 1314 |
| 443 | Ga0466960_0158893 | 3300044901 | Bacteria | 1212 |
| 444 | Ga0466959_0003399 | 3300045049 | Bacteria | 10405 |
| 445 | Ga0466959_0290549 | 3300045049 | Bacteria | 1121 |
| 446 | Ga0466958_0004599 | 3300045836 | Bacteria | 7307 |
| 447 | Ga0466958_0052703 | 3300045836 | Bacteria | 2466 |
| 448 | Ga0466967_0096331 | 3300045976 | Bacteria | 2699 |
| 449 | Ga0495638_0030552 | 3300046460 | Bacteria | 3466 |
| 450 | Ga0495638_0101965 | 3300046460 | Unclassified | 1715 |
| 451 | Ga0495651_0065185 | 3300046462 | Bacteria | 2782 |
| 452 | Ga0495594_0073918 | 3300046499 | Bacteria | 1898 |
| 453 | Ga0495610_0001266 | 3300046512 | Bacteria | 22642 |
| 454 | Ga0495616_0000032 | 3300046513 | Bacteria | 130692 |
| 455 | Ga0495648_0093730 | 3300046524 | Bacteria | 1674 |
| 456 | Ga0495668_0007996 | 3300046616 | Bacteria | 6665 |
| 457 | Ga0495588_0037265 | 3300046674 | Bacteria | 2470 |
| 458 | Ga0495623_0004777 | 3300046679 | Bacteria | 8901 |
| 459 | Ga0495669_0002049 | 3300046684 | Bacteria | 8260 |
| 460 | Ga0495604_0003161 | 3300047317 | Bacteria | 13164 |
| 461 | Ga0495674_0135549 | 3300047319 | Bacteria | 2072 |
| 462 | Ga0496101_0042132 | 3300048904 | Bacteria | 3259 |
| 463 | Ga0496104_0003197 | 3300048907 | Bacteria | 14079 |
| 464 | Ga0496104_0162245 | 3300048907 | Bacteria | 2144 |
| 465 | Ga0496104_0174615 | 3300048907 | Bacteria | 2059 |
| 466 | Ga0496104_0206200 | 3300048907 | Bacteria | 1877 |
| 467 | Ga0496104_0247280 | 3300048907 | Bacteria | 1696 |
| 468 | Ga0496105_0001623 | 3300048908 | Bacteria | 15986 |
| 469 | Ga0496106_0013329 | 3300048909 | Bacteria | 6069 |
| 470 | Ga0496107_0058803 | 3300048910 | Bacteria | 2780 |
| 471 | Ga0496110_0058037 | 3300048913 | Bacteria | 3409 |
| 472 | Ga0496110_0124760 | 3300048913 | Bacteria | 2322 |
| 473 | Ga0496112_0002334 | 3300048915 | Bacteria | 15229 |
| 474 | Ga0496112_0100129 | 3300048915 | Bacteria | 2868 |
| 475 | Ga0496112_0200554 | 3300048915 | Bacteria | 1954 |
| 476 | Ga0496113_0087845 | 3300048916 | Bacteria | 2391 |
| 477 | Ga0496113_0340895 | 3300048916 | Bacteria | 1202 |
| 478 | Ga0496114_0082590 | 3300048917 | Bacteria | 2716 |
| 479 | Ga0496115_0086675 | 3300048918 | Bacteria | 2555 |
| 480 | Ga0496117_0000503 | 3300048920 | Bacteria | 64599 |
| 481 | Ga0496117_0017111 | 3300048920 | Bacteria | 6069 |
| 482 | Ga0496118_0017771 | 3300048921 | Bacteria | 6455 |
| 483 | Ga0496118_0071823 | 3300048921 | Bacteria | 2489 |
| 484 | Ga0496119_0141998 | 3300048922 | Bacteria | 1296 |
| 485 | Ga0496121_0004432 | 3300048924 | Bacteria | 18884 |
| 486 | Ga0496121_0010241 | 3300048924 | Bacteria | 10608 |
| 487 | Ga0496121_0176017 | 3300048924 | Bacteria | 1549 |
| 488 | Ga0496125_0007608 | 3300048928 | Bacteria | 11500 |
| 489 | Ga0496126_0003473 | 3300048929 | Bacteria | 19892 |
| 490 | Ga0496126_0053450 | 3300048929 | Bacteria | 3665 |
| 491 | Ga0501031_0000066 | 3300049568 | Bacteria | 56603 |
| 492 | Ga0501031_0008941 | 3300049568 | Bacteria | 6512 |
| 493 | Ga0501031_0014985 | 3300049568 | Bacteria | 5036 |
| 494 | Ga0501032_0000178 | 3300049569 | Bacteria | 52170 |
| 495 | Ga0501032_0056757 | 3300049569 | Bacteria | 2631 |
| 496 | Ga0501033_0000203 | 3300049570 | Bacteria | 56963 |
| 497 | Ga0501033_0005182 | 3300049570 | Bacteria | 10360 |
| 498 | Ga0501033_0008551 | 3300049570 | Bacteria | 7919 |
| 499 | Ga0501033_0062851 | 3300049570 | Bacteria | 2734 |
| 500 | Ga0501034_0002100 | 3300049571 | Bacteria | 24877 |
| 501 | Ga0501034_0035348 | 3300049571 | Bacteria | 5066 |
| 502 | Ga0501036_0000420 | 3300049572 | Bacteria | 29953 |
| 503 | Ga0501036_0013760 | 3300049572 | Bacteria | 6729 |
| 504 | Ga0501036_0075638 | 3300049572 | Bacteria | 2847 |
| 505 | Ga0501036_0348734 | 3300049572 | Bacteria | 1236 |
| 506 | Ga0501037_0000375 | 3300049573 | Bacteria | 37216 |
| 507 | Ga0501038_0000789 | 3300049574 | Bacteria | 28041 |
| 508 | Ga0501038_0026942 | 3300049574 | Bacteria | 5116 |
| 509 | Ga0501038_0062003 | 3300049574 | Bacteria | 3196 |
| 510 | Ga0501039_0000255 | 3300049575 | Bacteria | 38934 |
| 511 | Ga0501039_0074650 | 3300049575 | Bacteria | 2635 |
| 512 | Ga0501040_0010022 | 3300049576 | Bacteria | 6189 |
| 513 | Ga0501041_0009860 | 3300049577 | Bacteria | 5623 |
| 514 | Ga0501042_0065610 | 3300049578 | Bacteria | 2594 |
| 515 | Ga0501043_0000993 | 3300049579 | Bacteria | 25005 |
| 516 | Ga0501043_0002717 | 3300049579 | Bacteria | 14807 |
| 517 | Ga0501043_0060377 | 3300049579 | Bacteria | 2976 |
| 518 | Ga0501046_0000420 | 3300049580 | Bacteria | 42319 |
| 519 | Ga0501046_0000864 | 3300049580 | Bacteria | 29483 |
| 520 | Ga0501046_0035096 | 3300049580 | Bacteria | 4042 |
| 521 | Ga0501046_0110422 | 3300049580 | Bacteria | 2101 |
| 522 | Ga0501047_0000043 | 3300049581 | Bacteria | 175522 |
| 523 | Ga0501047_0002096 | 3300049581 | Bacteria | 19073 |
| 524 | Ga0501047_0338018 | 3300049581 | Bacteria | 1344 |
| 525 | Ga0501048_0000058 | 3300049582 | Bacteria | 56039 |
| 526 | Ga0501048_0026736 | 3300049582 | Bacteria | 4199 |
| 527 | Ga0501048_0028100 | 3300049582 | Bacteria | 4084 |
| 528 | Ga0501048_0138801 | 3300049582 | Bacteria | 1719 |
| 529 | Ga0501067_0024844 | 3300049583 | Bacteria | 3322 |
| 530 | Ga0501069_0000268 | 3300049585 | Bacteria | 23610 |
| 531 | Ga0501069_0029577 | 3300049585 | Bacteria | 3006 |
| 532 | Ga0501070_0000892 | 3300049586 | Bacteria | 27153 |
| 533 | Ga0501070_0016262 | 3300049586 | Bacteria | 6252 |
| 534 | Ga0501071_0223671 | 3300049587 | Bacteria | 1417 |
| 535 | Ga0501071_0238294 | 3300049587 | Bacteria | 1371 |
| 536 | Ga0501072_0060563 | 3300049588 | Bacteria | 2984 |
| 537 | Ga0501072_0097004 | 3300049588 | Bacteria | 2343 |
| 538 | Ga0501073_0002513 | 3300049589 | Bacteria | 13704 |
| 539 | Ga0501073_0293334 | 3300049589 | Bacteria | 1122 |
| 540 | Ga0501074_0000253 | 3300049590 | Bacteria | 30133 |
| 541 | Ga0501075_0012217 | 3300049591 | Bacteria | 6095 |
| 542 | Ga0501076_0021698 | 3300049592 | Bacteria | 4929 |
| 543 | Ga0501076_0062051 | 3300049592 | Bacteria | 2976 |
| 544 | Ga0501077_0016335 | 3300049593 | Bacteria | 4678 |
| 545 | Ga0501223_000095 | 3300049663 | Bacteria | 25891 |
| 546 | Ga0501224_000014 | 3300049664 | Bacteria | 91830 |
| 547 | Ga0501233_000081 | 3300049668 | Bacteria | 12508 |
| 548 | Ga0501235_000196 | 3300049669 | Bacteria | 10665 |
| 549 | Ga0501249_000024 | 3300049679 | Bacteria | 92031 |
| 550 | Ga0501225_0000023 | 3300049705 | Bacteria | 51838 |
| 551 | Ga0501234_000139 | 3300049707 | Bacteria | 9672 |
| 552 | Ga0501079_0039983 | 3300049741 | Bacteria | 3618 |
| 553 | Ga0501079_0133653 | 3300049741 | Bacteria | 1931 |
| 554 | Ga0501079_0218977 | 3300049741 | Bacteria | 1487 |
| 555 | Ga0501080_0011694 | 3300049742 | Bacteria | 8041 |
| 556 | Ga0501080_0094907 | 3300049742 | Bacteria | 2770 |
| 557 | Ga0501035_0005573 | 3300049822 | Bacteria | 11896 |
| 558 | Ga0501035_0038465 | 3300049822 | Bacteria | 4331 |
| 559 | Ga0501044_0009897 | 3300049823 | Bacteria | 10361 |
| 560 | Ga0501044_0015913 | 3300049823 | Bacteria | 8095 |
| 561 | Ga0501044_0084783 | 3300049823 | Bacteria | 3202 |
| 562 | Ga0501045_0006663 | 3300049824 | Bacteria | 8004 |
| 563 | Ga0501226_000037 | 3300049853 | Bacteria | 64584 |
| 564 | nmdc:mga06z11_19165_c1 | 3300050494 | Bacteria | 3140 |
| 565 | nmdc:mga04h51_2049_c1 | 3300050495 | Bacteria | 4727 |
| 566 | nmdc:mga05p37_275644_c1 | 3300050507 | Bacteria | 2008 |
| 567 | nmdc:mga08y16_214808_c1 | 3300050511 | Bacteria | 1992 |
| 568 | nmdc:mga08y16_54742_c1 | 3300050511 | Bacteria | 4169 |
| 569 | nmdc:mga0n895_52280_c1 | 3300050512 | Bacteria | 4010 |
| 570 | nmdc:mga0n895_97374_c1 | 3300050512 | Bacteria | 2948 |
| 571 | nmdc:mga0rr50_39932_c1 | 3300050513 | Bacteria | 3408 |
| 572 | nmdc:mga0rr50_75311_c1 | 3300050513 | Bacteria | 2587 |
| 573 | nmdc:mga08x19_17568_c1 | 3300050514 | Bacteria | 4379 |
| 574 | nmdc:mga08x19_33184_c1 | 3300050514 | Bacteria | 3257 |
| 575 | nmdc:mga08x19_54580_c1 | 3300050514 | Bacteria | 2573 |
| 576 | nmdc:mga0a205_33644_c1 | 3300050515 | Bacteria | 4915 |
| 577 | nmdc:mga0a205_5588_c1 | 3300050515 | Bacteria | 11327 |
| 578 | nmdc:mga0a205_88567_c1 | 3300050515 | Plasmid | 2991 |
| 579 | Ga0495601_0156371 | 3300053077 | Bacteria | 1489 |
| 580 | Ga0495619_0209867 | 3300053085 | Bacteria | 1348 |
| 581 | Ga0500647_0010299 | 3300053091 | Bacteria | 4132 |
| 582 | Ga0500594_0003007 | 3300053118 | Bacteria | 3688 |
| 583 | Ga0500568_0000070 | 3300053139 | Bacteria | 99663 |
| 584 | Ga0500588_0073098 | 3300053146 | Bacteria | 1129 |
| 585 | Ga0500604_0006712 | 3300053151 | Bacteria | 3046 |
| 586 | Ga0500624_000006 | 3300053157 | Bacteria | 184937 |
| 587 | Ga0501084_0006078 | 3300054114 | Bacteria | 9931 |
| 588 | Ga0501084_0048611 | 3300054114 | Bacteria | 3550 |
| 589 | Ga0501082_0382852 | 3300060353 | Bacteria | 1227 |
| 590 | Ga0466962_0001901 | 3300061719 | Bacteria | 9828 |
| 591 | Ga0530510_0014590 | 3300061734 | Bacteria | 5543 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300037418 | Ga0395900_0156843 | Ga0395900_0156843_877_1833 | 304 |
| 2 | 3300037466 | Ga0395898_0089464 | Ga0395898_0089464_908_1864 | 304 |
| 3 | 3300005844 | Ga0068862_100117134 | Ga0068862_1001171343 | 308 |
| 4 | 3300049580 | Ga0501046_0000420 | Ga0501046_0000420_5894_6895 | 308 |
| 5 | 3300006914 | Ga0075436_100039592 | Ga0075436_1000395922 | 309 |
| 6 | 3300050514 | nmdc:mga08x19_33184_c1 | nmdc:mga08x19_33184_c1_1629_2600 | 309 |
| 7 | 3300049568 | Ga0501031_0008941 | Ga0501031_0008941_933_1871 | 310 |
| 8 | 3300049570 | Ga0501033_0008551 | Ga0501033_0008551_5694_6632 | 310 |
| 9 | 3300049572 | Ga0501036_0075638 | Ga0501036_0075638_870_1808 | 310 |
| 10 | 3300049574 | Ga0501038_0026942 | Ga0501038_0026942_940_1878 | 310 |
| 11 | 3300049582 | Ga0501048_0026736 | Ga0501048_0026736_2191_3129 | 310 |
| 12 | 3300049586 | Ga0501070_0016262 | Ga0501070_0016262_1089_2027 | 310 |
| 13 | 3300049592 | Ga0501076_0062051 | Ga0501076_0062051_70_1035 | 310 |
| 14 | 3300049741 | Ga0501079_0218977 | Ga0501079_0218977_249_1187 | 310 |
| 15 | 3300031727 | Ga0316576_10002154 | Ga0316576_100021545 | 311 |
| 16 | 3300053146 | Ga0500588_0073098 | Ga0500588_0073098_20_955 | 311 |
| 17 | iso_pu_bacteria | 2687453737 | 2689964427 | 311 |
| 18 | 3300009101 | Ga0105247_10009785 | Ga0105247_100097855 | 312 |
| 19 | 3300014968 | Ga0157379_10001804 | Ga0157379_1000180411 | 312 |
| 20 | 3300048907 | Ga0496104_0247280 | Ga0496104_0247280_665_1678 | 312 |
| 21 | 3300048924 | Ga0496121_0004432 | Ga0496121_0004432_13965_14978 | 312 |
| 22 | 3300009177 | Ga0105248_10000028 | Ga0105248_10000028145 | 313 |
| 23 | 3300048920 | Ga0496117_0017111 | Ga0496117_0017111_4810_5817 | 313 |
| 24 | 3300048921 | Ga0496118_0071823 | Ga0496118_0071823_1327_2334 | 313 |
| 25 | 3300035119 | Ga0373956_0003092 | Ga0373956_0003092_4540_5499 | 314 |
| 26 | 3300048915 | Ga0496112_0100129 | Ga0496112_0100129_568_1527 | 314 |
| 27 | 3300048916 | Ga0496113_0087845 | Ga0496113_0087845_301_1260 | 314 |
| 28 | 3300053077 | Ga0495601_0156371 | Ga0495601_0156371_11_970 | 314 |
| 29 | iso_pu_bacteria | 8047710418 | 8047713284 | 314 |
| 30 | 3300025900 | Ga0207710_10013639 | Ga0207710_100136394 | 315 |
| 31 | iso_pu_bacteria | 2929212328 | 2929218954 | 315 |
| 32 | iso_pu_bacteria | 2939657138 | 2939658479 | 315 |
| 33 | 3300005842 | Ga0068858_100000034 | Ga0068858_10000003457 | 316 |
| 34 | 3300026035 | Ga0207703_10000057 | Ga0207703_1000005768 | 316 |
| 35 | 3300036712 | Ga0316584_0011920 | Ga0316584_0011920_950_1924 | 316 |
| 36 | 3300037588 | Ga0316581_0008927 | Ga0316581_0008927_1140_2105 | 316 |
| 37 | 3300050515 | nmdc:mga0a205_88567_c1 | nmdc:mga0a205_88567_c1_1311_2303 | 316 |
| 38 | iso_pu_bacteria | 2816332119 | 2816422694 | 316 |
| 39 | 3300005329 | Ga0070683_100024863 | Ga0070683_1000248632 | 317 |
| 40 | 3300022467 | Ga0224712_10014543 | Ga0224712_100145432 | 317 |
| 41 | 3300025944 | Ga0207661_10062031 | Ga0207661_100620312 | 317 |
| 42 | 3300049583 | Ga0501067_0024844 | Ga0501067_0024844_1460_2419 | 317 |
| 43 | 3300049585 | Ga0501069_0029577 | Ga0501069_0029577_1876_2835 | 317 |
| 44 | 3300049587 | Ga0501071_0223671 | Ga0501071_0223671_41_1021 | 317 |
| 45 | 3300060353 | Ga0501082_0382852 | Ga0501082_0382852_210_1190 | 317 |
| 46 | iso_pu_bacteria | 2643221682 | 2644459321 | 317 |
| 47 | iso_pu_bacteria | 2876377896 | 2876378293 | 317 |
| 48 | iso_pu_bacteria | 2938014810 | 2938018840 | 317 |
| 49 | iso_pu_bacteria | 8025413630 | 8025418851 | 317 |
| 50 | iso_pu_bacteria | 8033684223 | 8033689029 | 317 |
| 51 | 3300005327 | Ga0070658_10001152 | Ga0070658_100011529 | 318 |
| 52 | 3300020080 | Ga0206350_10137420 | Ga0206350_101374201 | 318 |
| 53 | 3300025909 | Ga0207705_10029498 | Ga0207705_100294983 | 318 |
| 54 | 3300025912 | Ga0207707_10135997 | Ga0207707_101359971 | 318 |
| 55 | 3300025922 | Ga0207646_10134322 | Ga0207646_101343222 | 318 |
| 56 | 3300025944 | Ga0207661_10084923 | Ga0207661_100849233 | 318 |
| 57 | 3300028577 | Ga0265318_10009570 | Ga0265318_100095703 | 318 |
| 58 | 3300030521 | Ga0307511_10184429 | Ga0307511_101844292 | 318 |
| 59 | 3300031247 | Ga0265340_10024944 | Ga0265340_100249442 | 318 |
| 60 | 3300031711 | Ga0265314_10009422 | Ga0265314_100094224 | 318 |
| 61 | 3300031901 | Ga0307406_10000142 | Ga0307406_1000014246 | 318 |
| 62 | 3300046684 | Ga0495669_0002049 | Ga0495669_0002049_3502_4473 | 318 |
| 63 | 3300048920 | Ga0496117_0000503 | Ga0496117_0000503_17891_18862 | 318 |
| 64 | 3300048921 | Ga0496118_0017771 | Ga0496118_0017771_4243_5214 | 318 |
| 65 | 3300048928 | Ga0496125_0007608 | Ga0496125_0007608_2058_3029 | 318 |
| 66 | 3300048929 | Ga0496126_0003473 | Ga0496126_0003473_803_1774 | 318 |
| 67 | 3300049570 | Ga0501033_0000203 | Ga0501033_0000203_22639_23640 | 318 |
| 68 | 3300049571 | Ga0501034_0035348 | Ga0501034_0035348_1795_2793 | 318 |
| 69 | 3300049581 | Ga0501047_0338018 | Ga0501047_0338018_227_1225 | 318 |
| 70 | 3300049589 | Ga0501073_0293334 | Ga0501073_0293334_46_1044 | 318 |
| 71 | 3300049742 | Ga0501080_0094907 | Ga0501080_0094907_1587_2585 | 318 |
| 72 | iso_pu_bacteria | 2867475112 | 2867480365 | 318 |
| 73 | iso_pu_bacteria | 2997451912 | 2997458934 | 318 |
| 74 | iso_pu_bacteria | 8054160619 | 8054160939 | 318 |
| 75 | 3300002459 | JGI24751J29686_10005563 | JGI24751J29686_100055632 | 319 |
| 76 | 3300003203 | JGI25406J46586_10014214 | JGI25406J46586_100142143 | 319 |
| 77 | 3300003911 | JGI25405J52794_10013597 | JGI25405J52794_100135972 | 319 |
| 78 | 3300005328 | Ga0070676_10110835 | Ga0070676_101108352 | 319 |
| 79 | 3300005329 | Ga0070683_100000631 | Ga0070683_10000063122 | 319 |
| 80 | 3300005329 | Ga0070683_100022589 | Ga0070683_1000225895 | 319 |
| 81 | 3300005331 | Ga0070670_100250693 | Ga0070670_1002506931 | 319 |
| 82 | 3300005336 | Ga0070680_100001048 | Ga0070680_1000010482 | 319 |
| 83 | 3300005336 | Ga0070680_100046550 | Ga0070680_1000465502 | 319 |
| 84 | 3300005337 | Ga0070682_100003544 | Ga0070682_1000035446 | 319 |
| 85 | 3300005339 | Ga0070660_100133309 | Ga0070660_1001333092 | 319 |
| 86 | 3300005344 | Ga0070661_100146245 | Ga0070661_1001462452 | 319 |
| 87 | 3300005345 | Ga0070692_10088845 | Ga0070692_100888452 | 319 |
| 88 | 3300005355 | Ga0070671_100043603 | Ga0070671_1000436032 | 319 |
| 89 | 3300005436 | Ga0070713_100001271 | Ga0070713_1000012714 | 319 |
| 90 | 3300005445 | Ga0070708_100021161 | Ga0070708_1000211615 | 319 |
| 91 | 3300005445 | Ga0070708_100139942 | Ga0070708_1001399421 | 319 |
| 92 | 3300005456 | Ga0070678_100066473 | Ga0070678_1000664732 | 319 |
| 93 | 3300005458 | Ga0070681_10000869 | Ga0070681_100008699 | 319 |
| 94 | 3300005459 | Ga0068867_100211526 | Ga0068867_1002115262 | 319 |
| 95 | 3300005471 | Ga0070698_100030713 | Ga0070698_1000307132 | 319 |
| 96 | 3300005518 | Ga0070699_100018535 | Ga0070699_1000185355 | 319 |
| 97 | 3300005530 | Ga0070679_100000267 | Ga0070679_10000026726 | 319 |
| 98 | 3300005530 | Ga0070679_100481640 | Ga0070679_1004816401 | 319 |
| 99 | 3300005535 | Ga0070684_100001926 | Ga0070684_1000019268 | 319 |
| 100 | 3300005539 | Ga0068853_100231006 | Ga0068853_1002310062 | 319 |
| 101 | 3300005543 | Ga0070672_100099114 | Ga0070672_1000991142 | 319 |
| 102 | 3300005548 | Ga0070665_100388769 | Ga0070665_1003887691 | 319 |
| 103 | 3300005564 | Ga0070664_100005716 | Ga0070664_1000057168 | 319 |
| 104 | 3300005577 | Ga0068857_100000056 | Ga0068857_10000005647 | 319 |
| 105 | 3300005578 | Ga0068854_100110303 | Ga0068854_1001103032 | 319 |
| 106 | 3300005614 | Ga0068856_100000485 | Ga0068856_10000048543 | 319 |
| 107 | 3300005615 | Ga0070702_100090835 | Ga0070702_1000908352 | 319 |
| 108 | 3300005618 | Ga0068864_100165964 | Ga0068864_1001659642 | 319 |
| 109 | 3300005840 | Ga0068870_10016755 | Ga0068870_100167552 | 319 |
| 110 | 3300005841 | Ga0068863_100011881 | Ga0068863_1000118817 | 319 |
| 111 | 3300005937 | Ga0081455_10002170 | Ga0081455_1000217022 | 319 |
| 112 | 3300005937 | Ga0081455_10007650 | Ga0081455_1000765012 | 319 |
| 113 | 3300005981 | Ga0081538_10000056 | Ga0081538_1000005618 | 319 |
| 114 | 3300005983 | Ga0081540_1010072 | Ga0081540_10100722 | 319 |
| 115 | 3300005985 | Ga0081539_10002722 | Ga0081539_1000272217 | 319 |
| 116 | 3300006042 | Ga0075368_10068095 | Ga0075368_100680952 | 319 |
| 117 | 3300006058 | Ga0075432_10000050 | Ga0075432_1000005011 | 319 |
| 118 | 3300006178 | Ga0075367_10001465 | Ga0075367_100014659 | 319 |
| 119 | 3300006358 | Ga0068871_100062302 | Ga0068871_1000623023 | 319 |
| 120 | 3300006844 | Ga0075428_100205758 | Ga0075428_1002057582 | 319 |
| 121 | 3300006847 | Ga0075431_100362858 | Ga0075431_1003628582 | 319 |
| 122 | 3300006852 | Ga0075433_10000264 | Ga0075433_100002648 | 319 |
| 123 | 3300006871 | Ga0075434_100000012 | Ga0075434_10000001269 | 319 |
| 124 | 3300006871 | Ga0075434_100028821 | Ga0075434_1000288214 | 319 |
| 125 | 3300006914 | Ga0075436_100000674 | Ga0075436_1000006742 | 319 |
| 126 | 3300006914 | Ga0075436_100107311 | Ga0075436_1001073112 | 319 |
| 127 | 3300007076 | Ga0075435_100008287 | Ga0075435_1000082873 | 319 |
| 128 | 3300007076 | Ga0075435_100020306 | Ga0075435_1000203063 | 319 |
| 129 | 3300009011 | Ga0105251_10012092 | Ga0105251_100120923 | 319 |
| 130 | 3300009094 | Ga0111539_10026281 | Ga0111539_100262813 | 319 |
| 131 | 3300009094 | Ga0111539_10066027 | Ga0111539_100660273 | 319 |
| 132 | 3300009098 | Ga0105245_10024404 | Ga0105245_100244044 | 319 |
| 133 | 3300009147 | Ga0114129_10152316 | Ga0114129_101523162 | 319 |
| 134 | 3300009174 | Ga0105241_10005398 | Ga0105241_100053988 | 319 |
| 135 | 3300009176 | Ga0105242_10226614 | Ga0105242_102266142 | 319 |
| 136 | 3300009177 | Ga0105248_10250841 | Ga0105248_102508412 | 319 |
| 137 | 3300009545 | Ga0105237_10060391 | Ga0105237_100603911 | 319 |
| 138 | 3300010375 | Ga0105239_10120986 | Ga0105239_101209862 | 319 |
| 139 | 3300012506 | Ga0157324_1001452 | Ga0157324_10014521 | 319 |
| 140 | 3300013100 | Ga0157373_10036500 | Ga0157373_100365002 | 319 |
| 141 | 3300013104 | Ga0157370_10235947 | Ga0157370_102359472 | 319 |
| 142 | 3300013306 | Ga0163162_10240941 | Ga0163162_102409412 | 319 |
| 143 | 3300013307 | Ga0157372_10041914 | Ga0157372_100419143 | 319 |
| 144 | 3300014745 | Ga0157377_10125577 | Ga0157377_101255772 | 319 |
| 145 | 3300014968 | Ga0157379_10092133 | Ga0157379_100921332 | 319 |
| 146 | 3300020070 | Ga0206356_10245307 | Ga0206356_102453073 | 319 |
| 147 | 3300020075 | Ga0206349_1510461 | Ga0206349_15104612 | 319 |
| 148 | 3300020078 | Ga0206352_10299992 | Ga0206352_102999922 | 319 |
| 149 | 3300020080 | Ga0206350_10247341 | Ga0206350_102473412 | 319 |
| 150 | 3300020080 | Ga0206350_10426173 | Ga0206350_104261732 | 319 |
| 151 | 3300022467 | Ga0224712_10000335 | Ga0224712_100003356 | 319 |
| 152 | 3300025901 | Ga0207688_10001558 | Ga0207688_1000155810 | 319 |
| 153 | 3300025907 | Ga0207645_10063142 | Ga0207645_100631422 | 319 |
| 154 | 3300025908 | Ga0207643_10000797 | Ga0207643_100007972 | 319 |
| 155 | 3300025910 | Ga0207684_10002195 | Ga0207684_1000219517 | 319 |
| 156 | 3300025912 | Ga0207707_10000668 | Ga0207707_1000066819 | 319 |
| 157 | 3300025917 | Ga0207660_10005180 | Ga0207660_100051802 | 319 |
| 158 | 3300025917 | Ga0207660_10142856 | Ga0207660_101428562 | 319 |
| 159 | 3300025919 | Ga0207657_10080644 | Ga0207657_100806442 | 319 |
| 160 | 3300025920 | Ga0207649_10012024 | Ga0207649_100120242 | 319 |
| 161 | 3300025921 | Ga0207652_10000079 | Ga0207652_1000007989 | 319 |
| 162 | 3300025921 | Ga0207652_10393688 | Ga0207652_103936882 | 319 |
| 163 | 3300025926 | Ga0207659_10017229 | Ga0207659_100172292 | 319 |
| 164 | 3300025927 | Ga0207687_10137146 | Ga0207687_101371462 | 319 |
| 165 | 3300025928 | Ga0207700_10000762 | Ga0207700_1000076213 | 319 |
| 166 | 3300025929 | Ga0207664_10013589 | Ga0207664_100135896 | 319 |
| 167 | 3300025931 | Ga0207644_10129184 | Ga0207644_101291842 | 319 |
| 168 | 3300025932 | Ga0207690_10045438 | Ga0207690_100454383 | 319 |
| 169 | 3300025936 | Ga0207670_10048503 | Ga0207670_100485032 | 319 |
| 170 | 3300025940 | Ga0207691_10060823 | Ga0207691_100608232 | 319 |
| 171 | 3300025941 | Ga0207711_10041980 | Ga0207711_100419802 | 319 |
| 172 | 3300025942 | Ga0207689_10033621 | Ga0207689_100336211 | 319 |
| 173 | 3300025944 | Ga0207661_10000103 | Ga0207661_1000010336 | 319 |
| 174 | 3300025944 | Ga0207661_10007796 | Ga0207661_100077964 | 319 |
| 175 | 3300025944 | Ga0207661_10014150 | Ga0207661_100141505 | 319 |
| 176 | 3300025944 | Ga0207661_10050803 | Ga0207661_100508032 | 319 |
| 177 | 3300025945 | Ga0207679_10078958 | Ga0207679_100789582 | 319 |
| 178 | 3300025986 | Ga0207658_10063754 | Ga0207658_100637542 | 319 |
| 179 | 3300026041 | Ga0207639_10141726 | Ga0207639_101417262 | 319 |
| 180 | 3300026067 | Ga0207678_10004985 | Ga0207678_1000498510 | 319 |
| 181 | 3300026075 | Ga0207708_10084089 | Ga0207708_100840892 | 319 |
| 182 | 3300026078 | Ga0207702_10010356 | Ga0207702_100103567 | 319 |
| 183 | 3300026088 | Ga0207641_10015345 | Ga0207641_100153454 | 319 |
| 184 | 3300026089 | Ga0207648_10225227 | Ga0207648_102252272 | 319 |
| 185 | 3300026095 | Ga0207676_10259744 | Ga0207676_102597442 | 319 |
| 186 | 3300026116 | Ga0207674_10002248 | Ga0207674_1000224810 | 319 |
| 187 | 3300026116 | Ga0207674_10043930 | Ga0207674_100439303 | 319 |
| 188 | 3300026121 | Ga0207683_10001599 | Ga0207683_1000159910 | 319 |
| 189 | 3300027866 | Ga0209813_10005445 | Ga0209813_100054453 | 319 |
| 190 | 3300027907 | Ga0207428_10006574 | Ga0207428_100065743 | 319 |
| 191 | 3300027907 | Ga0207428_10135863 | Ga0207428_101358632 | 319 |
| 192 | 3300028379 | Ga0268266_10036558 | Ga0268266_100365582 | 319 |
| 193 | 3300028381 | Ga0268264_10288204 | Ga0268264_102882041 | 319 |
| 194 | 3300030521 | Ga0307511_10093820 | Ga0307511_100938202 | 319 |
| 195 | 3300031731 | Ga0307405_10039855 | Ga0307405_100398552 | 319 |
| 196 | 3300031852 | Ga0307410_10007513 | Ga0307410_100075132 | 319 |
| 197 | 3300031852 | Ga0307410_10392303 | Ga0307410_103923031 | 319 |
| 198 | 3300031901 | Ga0307406_10000021 | Ga0307406_1000002190 | 319 |
| 199 | 3300031901 | Ga0307406_10002033 | Ga0307406_100020334 | 319 |
| 200 | 3300031903 | Ga0307407_10000926 | Ga0307407_100009263 | 319 |
| 201 | 3300031911 | Ga0307412_10022958 | Ga0307412_100229581 | 319 |
| 202 | 3300031995 | Ga0307409_100001681 | Ga0307409_1000016811 | 319 |
| 203 | 3300031995 | Ga0307409_100138395 | Ga0307409_1001383952 | 319 |
| 204 | 3300032002 | Ga0307416_100000198 | Ga0307416_1000001982 | 319 |
| 205 | 3300032002 | Ga0307416_100097071 | Ga0307416_1000970712 | 319 |
| 206 | 3300032004 | Ga0307414_10142901 | Ga0307414_101429012 | 319 |
| 207 | 3300032005 | Ga0307411_10014192 | Ga0307411_100141922 | 319 |
| 208 | 3300032126 | Ga0307415_100026006 | Ga0307415_1000260062 | 319 |
| 209 | 3300035172 | Ga0373955_0036607 | Ga0373955_0036607_926_1900 | 319 |
| 210 | 3300036401 | Ga0373937_0263722 | Ga0373937_0263722_84_1058 | 319 |
| 211 | 3300038443 | Ga0395901_0321143 | Ga0395901_0321143_184_1158 | 319 |
| 212 | 3300042016 | Ga0439463_008971 | Ga0439463_008971_43_1017 | 319 |
| 213 | 3300044901 | Ga0466960_0158893 | Ga0466960_0158893_213_1187 | 319 |
| 214 | 3300045049 | Ga0466959_0290549 | Ga0466959_0290549_24_998 | 319 |
| 215 | 3300046460 | Ga0495638_0101965 | Ga0495638_0101965_232_1233 | 319 |
| 216 | 3300046674 | Ga0495588_0037265 | Ga0495588_0037265_724_1698 | 319 |
| 217 | 3300047319 | Ga0495674_0135549 | Ga0495674_0135549_394_1368 | 319 |
| 218 | 3300048907 | Ga0496104_0174615 | Ga0496104_0174615_289_1263 | 319 |
| 219 | 3300048907 | Ga0496104_0206200 | Ga0496104_0206200_133_1107 | 319 |
| 220 | 3300048909 | Ga0496106_0013329 | Ga0496106_0013329_4371_5345 | 319 |
| 221 | 3300048910 | Ga0496107_0058803 | Ga0496107_0058803_1631_2605 | 319 |
| 222 | 3300048913 | Ga0496110_0058037 | Ga0496110_0058037_401_1375 | 319 |
| 223 | 3300048913 | Ga0496110_0124760 | Ga0496110_0124760_1199_2173 | 319 |
| 224 | 3300048917 | Ga0496114_0082590 | Ga0496114_0082590_1410_2384 | 319 |
| 225 | 3300048918 | Ga0496115_0086675 | Ga0496115_0086675_751_1725 | 319 |
| 226 | 3300048924 | Ga0496121_0010241 | Ga0496121_0010241_9258_10232 | 319 |
| 227 | 3300049568 | Ga0501031_0000066 | Ga0501031_0000066_13907_14881 | 319 |
| 228 | 3300049568 | Ga0501031_0014985 | Ga0501031_0014985_1356_2330 | 319 |
| 229 | 3300049569 | Ga0501032_0000178 | Ga0501032_0000178_5344_6318 | 319 |
| 230 | 3300049569 | Ga0501032_0056757 | Ga0501032_0056757_712_1686 | 319 |
| 231 | 3300049570 | Ga0501033_0005182 | Ga0501033_0005182_6741_7715 | 319 |
| 232 | 3300049570 | Ga0501033_0062851 | Ga0501033_0062851_818_1792 | 319 |
| 233 | 3300049571 | Ga0501034_0002100 | Ga0501034_0002100_20964_21938 | 319 |
| 234 | 3300049572 | Ga0501036_0000420 | Ga0501036_0000420_12351_13325 | 319 |
| 235 | 3300049572 | Ga0501036_0013760 | Ga0501036_0013760_2711_3685 | 319 |
| 236 | 3300049573 | Ga0501037_0000375 | Ga0501037_0000375_3819_4793 | 319 |
| 237 | 3300049574 | Ga0501038_0000789 | Ga0501038_0000789_6104_7078 | 319 |
| 238 | 3300049575 | Ga0501039_0000255 | Ga0501039_0000255_34419_35393 | 319 |
| 239 | 3300049575 | Ga0501039_0074650 | Ga0501039_0074650_63_1037 | 319 |
| 240 | 3300049576 | Ga0501040_0010022 | Ga0501040_0010022_2576_3550 | 319 |
| 241 | 3300049577 | Ga0501041_0009860 | Ga0501041_0009860_3717_4691 | 319 |
| 242 | 3300049578 | Ga0501042_0065610 | Ga0501042_0065610_576_1550 | 319 |
| 243 | 3300049579 | Ga0501043_0000993 | Ga0501043_0000993_20964_21938 | 319 |
| 244 | 3300049579 | Ga0501043_0060377 | Ga0501043_0060377_1816_2790 | 319 |
| 245 | 3300049580 | Ga0501046_0000864 | Ga0501046_0000864_16588_17562 | 319 |
| 246 | 3300049580 | Ga0501046_0035096 | Ga0501046_0035096_2674_3648 | 319 |
| 247 | 3300049581 | Ga0501047_0002096 | Ga0501047_0002096_11996_12970 | 319 |
| 248 | 3300049582 | Ga0501048_0000058 | Ga0501048_0000058_16127_17101 | 319 |
| 249 | 3300049582 | Ga0501048_0028100 | Ga0501048_0028100_1735_2709 | 319 |
| 250 | 3300049585 | Ga0501069_0000268 | Ga0501069_0000268_15972_16946 | 319 |
| 251 | 3300049586 | Ga0501070_0000892 | Ga0501070_0000892_20964_21938 | 319 |
| 252 | 3300049587 | Ga0501071_0238294 | Ga0501071_0238294_291_1265 | 319 |
| 253 | 3300049588 | Ga0501072_0060563 | Ga0501072_0060563_200_1174 | 319 |
| 254 | 3300049588 | Ga0501072_0097004 | Ga0501072_0097004_761_1735 | 319 |
| 255 | 3300049589 | Ga0501073_0002513 | Ga0501073_0002513_7727_8701 | 319 |
| 256 | 3300049590 | Ga0501074_0000253 | Ga0501074_0000253_10727_11701 | 319 |
| 257 | 3300049591 | Ga0501075_0012217 | Ga0501075_0012217_4038_5012 | 319 |
| 258 | 3300049592 | Ga0501076_0021698 | Ga0501076_0021698_1347_2321 | 319 |
| 259 | 3300049741 | Ga0501079_0039983 | Ga0501079_0039983_1583_2557 | 319 |
| 260 | 3300049742 | Ga0501080_0011694 | Ga0501080_0011694_4108_5082 | 319 |
| 261 | 3300049822 | Ga0501035_0005573 | Ga0501035_0005573_7193_8167 | 319 |
| 262 | 3300049822 | Ga0501035_0038465 | Ga0501035_0038465_3296_4270 | 319 |
| 263 | 3300049823 | Ga0501044_0009897 | Ga0501044_0009897_2646_3620 | 319 |
| 264 | 3300049824 | Ga0501045_0006663 | Ga0501045_0006663_4392_5366 | 319 |
| 265 | 3300050494 | nmdc:mga06z11_19165_c1 | nmdc:mga06z11_19165_c1_250_1224 | 319 |
| 266 | 3300050495 | nmdc:mga04h51_2049_c1 | nmdc:mga04h51_2049_c1_3473_4447 | 319 |
| 267 | 3300050511 | nmdc:mga08y16_214808_c1 | nmdc:mga08y16_214808_c1_260_1234 | 319 |
| 268 | 3300050512 | nmdc:mga0n895_52280_c1 | nmdc:mga0n895_52280_c1_940_1914 | 319 |
| 269 | 3300050512 | nmdc:mga0n895_97374_c1 | nmdc:mga0n895_97374_c1_1592_2566 | 319 |
| 270 | 3300050513 | nmdc:mga0rr50_39932_c1 | nmdc:mga0rr50_39932_c1_1531_2505 | 319 |
| 271 | 3300050513 | nmdc:mga0rr50_75311_c1 | nmdc:mga0rr50_75311_c1_1165_2139 | 319 |
| 272 | 3300050514 | nmdc:mga08x19_17568_c1 | nmdc:mga08x19_17568_c1_2689_3663 | 319 |
| 273 | 3300050514 | nmdc:mga08x19_54580_c1 | nmdc:mga08x19_54580_c1_1246_2220 | 319 |
| 274 | 3300050515 | nmdc:mga0a205_33644_c1 | nmdc:mga0a205_33644_c1_283_1257 | 319 |
| 275 | 3300050515 | nmdc:mga0a205_5588_c1 | nmdc:mga0a205_5588_c1_1602_2576 | 319 |
| 276 | 3300053139 | Ga0500568_0000070 | Ga0500568_0000070_28051_29052 | 319 |
| 277 | 3300054114 | Ga0501084_0006078 | Ga0501084_0006078_3765_4739 | 319 |
| 278 | 3300054114 | Ga0501084_0048611 | Ga0501084_0048611_1191_2165 | 319 |
| 279 | 3300061734 | Ga0530510_0014590 | Ga0530510_0014590_3102_4076 | 319 |
| 280 | 3300005329 | Ga0070683_100016882 | Ga0070683_1000168822 | 320 |
| 281 | 3300005330 | Ga0070690_100006085 | Ga0070690_1000060852 | 320 |
| 282 | 3300005344 | Ga0070661_100225696 | Ga0070661_1002256962 | 320 |
| 283 | 3300005354 | Ga0070675_100020528 | Ga0070675_1000205285 | 320 |
| 284 | 3300005366 | Ga0070659_100029919 | Ga0070659_1000299192 | 320 |
| 285 | 3300005436 | Ga0070713_100467234 | Ga0070713_1004672341 | 320 |
| 286 | 3300005441 | Ga0070700_100003943 | Ga0070700_1000039439 | 320 |
| 287 | 3300005468 | Ga0070707_100329680 | Ga0070707_1003296802 | 320 |
| 288 | 3300005544 | Ga0070686_100117902 | Ga0070686_1001179022 | 320 |
| 289 | 3300005564 | Ga0070664_100007324 | Ga0070664_1000073248 | 320 |
| 290 | 3300005844 | Ga0068862_100177726 | Ga0068862_1001777262 | 320 |
| 291 | 3300009098 | Ga0105245_10032771 | Ga0105245_100327712 | 320 |
| 292 | 3300009147 | Ga0114129_10094436 | Ga0114129_100944363 | 320 |
| 293 | 3300013102 | Ga0157371_10007101 | Ga0157371_100071015 | 320 |
| 294 | 3300025901 | Ga0207688_10073172 | Ga0207688_100731722 | 320 |
| 295 | 3300025919 | Ga0207657_10167727 | Ga0207657_101677271 | 320 |
| 296 | 3300025922 | Ga0207646_10205739 | Ga0207646_102057392 | 320 |
| 297 | 3300025927 | Ga0207687_10141419 | Ga0207687_101414192 | 320 |
| 298 | 3300025932 | Ga0207690_10004301 | Ga0207690_100043015 | 320 |
| 299 | 3300025932 | Ga0207690_10009103 | Ga0207690_100091036 | 320 |
| 300 | 3300025944 | Ga0207661_10102517 | Ga0207661_101025172 | 320 |
| 301 | 3300026035 | Ga0207703_10206175 | Ga0207703_102061752 | 320 |
| 302 | 3300026075 | Ga0207708_10020704 | Ga0207708_100207043 | 320 |
| 303 | 3300026116 | Ga0207674_10218267 | Ga0207674_102182671 | 320 |
| 304 | 3300026118 | Ga0207675_100042195 | Ga0207675_1000421953 | 320 |
| 305 | 3300031711 | Ga0265314_10174810 | Ga0265314_101748102 | 320 |
| 306 | 3300032002 | Ga0307416_100638990 | Ga0307416_1006389902 | 320 |
| 307 | 3300032126 | Ga0307415_100436187 | Ga0307415_1004361871 | 320 |
| 308 | 3300041491 | Ga0451833_0579776 | Ga0451833_0579776_348_1331 | 320 |
| 309 | 3300049582 | Ga0501048_0138801 | Ga0501048_0138801_714_1691 | 320 |
| 310 | 3300049593 | Ga0501077_0016335 | Ga0501077_0016335_74_1051 | 320 |
| 311 | 3300050507 | nmdc:mga05p37_275644_c1 | nmdc:mga05p37_275644_c1_969_1940 | 320 |
| 312 | 3300050511 | nmdc:mga08y16_54742_c1 | nmdc:mga08y16_54742_c1_1029_2006 | 320 |
| 313 | iso_pu_bacteria | 2818991472 | 2819741509 | 320 |
| 314 | 3300003214 | JGI25165J46597_1000034 | JGI25165J46597_100003438 | 321 |
| 315 | 3300005366 | Ga0070659_100397146 | Ga0070659_1003971461 | 321 |
| 316 | 3300005435 | Ga0070714_100024737 | Ga0070714_1000247373 | 321 |
| 317 | 3300005468 | Ga0070707_100001272 | Ga0070707_1000012727 | 321 |
| 318 | 3300005536 | Ga0070697_100088459 | Ga0070697_1000884593 | 321 |
| 319 | 3300006852 | Ga0075433_10101847 | Ga0075433_101018472 | 321 |
| 320 | 3300010375 | Ga0105239_10037599 | Ga0105239_100375998 | 321 |
| 321 | 3300014325 | Ga0163163_10012150 | Ga0163163_100121502 | 321 |
| 322 | 3300025261 | Ga0209233_1000028 | Ga0209233_100002842 | 321 |
| 323 | 3300025910 | Ga0207684_10113154 | Ga0207684_101131542 | 321 |
| 324 | 3300025922 | Ga0207646_10008726 | Ga0207646_100087263 | 321 |
| 325 | 3300025929 | Ga0207664_10014234 | Ga0207664_100142343 | 321 |
| 326 | 3300026088 | Ga0207641_10082857 | Ga0207641_100828572 | 321 |
| 327 | 3300031456 | Ga0307513_10001824 | Ga0307513_1000182415 | 321 |
| 328 | 3300035691 | Ga0373931_0098292 | Ga0373931_0098292_212_1192 | 321 |
| 329 | 3300037471 | Ga0395905_0006562 | Ga0395905_0006562_260_1267 | 321 |
| 330 | 3300037471 | Ga0395905_0009660 | Ga0395905_0009660_6840_7847 | 321 |
| 331 | 3300039438 | Ga0436360_0076518 | Ga0436360_0076518_13_1020 | 321 |
| 332 | 3300039450 | Ga0436363_1719758 | Ga0436363_1719758_564_1571 | 321 |
| 333 | 3300044694 | Ga0466963_0041656 | Ga0466963_0041656_631_1611 | 321 |
| 334 | 3300044842 | Ga0466957_0199275 | Ga0466957_0199275_58_1038 | 321 |
| 335 | 3300045836 | Ga0466958_0052703 | Ga0466958_0052703_1048_2028 | 321 |
| 336 | 3300045976 | Ga0466967_0096331 | Ga0466967_0096331_1407_2387 | 321 |
| 337 | 3300046460 | Ga0495638_0030552 | Ga0495638_0030552_1400_2407 | 321 |
| 338 | 3300048915 | Ga0496112_0002334 | Ga0496112_0002334_14207_15187 | 321 |
| 339 | 3300048915 | Ga0496112_0200554 | Ga0496112_0200554_171_1151 | 321 |
| 340 | 3300048916 | Ga0496113_0340895 | Ga0496113_0340895_47_1027 | 321 |
| 341 | 3300053085 | Ga0495619_0209867 | Ga0495619_0209867_53_1045 | 321 |
| 342 | 3300005548 | Ga0070665_100030769 | Ga0070665_1000307692 | 322 |
| 343 | 3300005549 | Ga0070704_100173916 | Ga0070704_1001739162 | 322 |
| 344 | 3300009094 | Ga0111539_10071083 | Ga0111539_100710832 | 322 |
| 345 | 3300025302 | Ga0207426_1002259 | Ga0207426_10022598 | 322 |
| 346 | 3300046499 | Ga0495594_0073918 | Ga0495594_0073918_648_1631 | 322 |
| 347 | 3300048907 | Ga0496104_0162245 | Ga0496104_0162245_184_1179 | 322 |
| 348 | iso_pu_bacteria | 2751185725 | 2753036692 | 322 |
| 349 | iso_pu_bacteria | 2751185792 | 2753324562 | 322 |
| 350 | 3300005339 | Ga0070660_100470551 | Ga0070660_1004705511 | 323 |
| 351 | 3300009545 | Ga0105237_10003715 | Ga0105237_100037152 | 323 |
| 352 | 3300025914 | Ga0207671_10001958 | Ga0207671_1000195822 | 323 |
| 353 | 3300046462 | Ga0495651_0065185 | Ga0495651_0065185_233_1204 | 323 |
| 354 | 3300046512 | Ga0495610_0001266 | Ga0495610_0001266_8729_9700 | 323 |
| 355 | 3300048904 | Ga0496101_0042132 | Ga0496101_0042132_1349_2368 | 323 |
| 356 | 3300005548 | Ga0070665_100000419 | Ga0070665_10000041922 | 324 |
| 357 | 3300009551 | Ga0105238_10000412 | Ga0105238_1000041229 | 324 |
| 358 | 3300009551 | Ga0105238_10055286 | Ga0105238_100552863 | 324 |
| 359 | 3300025261 | Ga0209233_1020625 | Ga0209233_10206252 | 324 |
| 360 | 3300025924 | Ga0207694_10009212 | Ga0207694_100092126 | 324 |
| 361 | 3300028379 | Ga0268266_10001716 | Ga0268266_100017163 | 324 |
| 362 | 3300028379 | Ga0268266_10218201 | Ga0268266_102182012 | 324 |
| 363 | 3300037312 | Ga0395899_0017676 | Ga0395899_0017676_2192_3166 | 324 |
| 364 | 3300046679 | Ga0495623_0004777 | Ga0495623_0004777_1291_2286 | 324 |
| 365 | 3300047317 | Ga0495604_0003161 | Ga0495604_0003161_5481_6476 | 324 |
| 366 | 3300048929 | Ga0496126_0053450 | Ga0496126_0053450_933_1907 | 324 |
| 367 | iso_pu_bacteria | 2508501039 | 2508675713 | 324 |
| 368 | 3300031649 | Ga0307514_10071690 | Ga0307514_100716902 | 325 |
| 369 | 3300031733 | Ga0316577_10056501 | Ga0316577_100565012 | 325 |
| 370 | 3300032133 | Ga0316583_10013966 | Ga0316583_100139662 | 325 |
| 371 | 3300053091 | Ga0500647_0010299 | Ga0500647_0010299_807_1784 | 325 |
| 372 | 3300025941 | Ga0207711_10000090 | Ga0207711_1000009053 | 328 |
| 373 | iso_pu_bacteria | 2939582691 | 2939586108 | 328 |
| 374 | 3300041512 | Ga0451853_0174754 | Ga0451853_0174754_564_1583 | 329 |
| 375 | 3300044656 | Ga0466969_0000809 | Ga0466969_0000809_5151_6170 | 329 |
| 376 | 3300044684 | Ga0466966_0032687 | Ga0466966_0032687_2294_3313 | 329 |
| 377 | 3300044693 | Ga0466961_0003474 | Ga0466961_0003474_5661_6680 | 329 |
| 378 | 3300044719 | Ga0466971_0000747 | Ga0466971_0000747_10177_11196 | 329 |
| 379 | 3300045049 | Ga0466959_0003399 | Ga0466959_0003399_2059_3078 | 329 |
| 380 | 3300045836 | Ga0466958_0004599 | Ga0466958_0004599_1898_2917 | 329 |
| 381 | 3300046513 | Ga0495616_0000032 | Ga0495616_0000032_89411_90403 | 329 |
| 382 | 3300046616 | Ga0495668_0007996 | Ga0495668_0007996_2438_3430 | 329 |
| 383 | 3300053151 | Ga0500604_0006712 | Ga0500604_0006712_1062_2054 | 329 |
| 384 | 3300061719 | Ga0466962_0001901 | Ga0466962_0001901_4875_5894 | 329 |
| 385 | iso_pu_bacteria | 2879163058 | 2879163873 | 329 |
| 386 | iso_pu_bacteria | 8002775197 | 8002780405 | 329 |
| 387 | 3300005353 | Ga0070669_100362547 | Ga0070669_1003625471 | 330 |
| 388 | 3300009098 | Ga0105245_10034508 | Ga0105245_100345086 | 330 |
| 389 | 3300039447 | Ga0436361_0355012 | Ga0436361_0355012_335_1330 | 330 |
| 390 | 3300049741 | Ga0501079_0133653 | Ga0501079_0133653_877_1884 | 330 |
| 391 | 3300009098 | Ga0105245_10483682 | Ga0105245_104836822 | 331 |
| 392 | iso_pu_bacteria | 2675902999 | 2676200827 | 331 |
| 393 | iso_pu_bacteria | 2773857921 | 2774845405 | 331 |
| 394 | 3300002126 | JGI24035J26624_1000876 | JGI24035J26624_10008762 | 332 |
| 395 | 3300005289 | Ga0065704_10102919 | Ga0065704_101029192 | 332 |
| 396 | 3300005295 | Ga0065707_10169986 | Ga0065707_101699861 | 332 |
| 397 | 3300005327 | Ga0070658_10000350 | Ga0070658_1000035035 | 332 |
| 398 | 3300005335 | Ga0070666_10161404 | Ga0070666_101614041 | 332 |
| 399 | 3300005367 | Ga0070667_100001359 | Ga0070667_10000135916 | 332 |
| 400 | 3300005466 | Ga0070685_10089877 | Ga0070685_100898773 | 332 |
| 401 | 3300005563 | Ga0068855_100006052 | Ga0068855_1000060526 | 332 |
| 402 | 3300005578 | Ga0068854_100001739 | Ga0068854_1000017392 | 332 |
| 403 | 3300005614 | Ga0068856_100019458 | Ga0068856_1000194586 | 332 |
| 404 | 3300005616 | Ga0068852_100000316 | Ga0068852_10000031627 | 332 |
| 405 | 3300005618 | Ga0068864_100022356 | Ga0068864_1000223563 | 332 |
| 406 | 3300005841 | Ga0068863_100000051 | Ga0068863_10000005185 | 332 |
| 407 | 3300005842 | Ga0068858_100113383 | Ga0068858_1001133832 | 332 |
| 408 | 3300005843 | Ga0068860_100000187 | Ga0068860_10000018734 | 332 |
| 409 | 3300005844 | Ga0068862_100011909 | Ga0068862_1000119098 | 332 |
| 410 | 3300009551 | Ga0105238_10105086 | Ga0105238_101050863 | 332 |
| 411 | 3300025904 | Ga0207647_10008851 | Ga0207647_100088515 | 332 |
| 412 | 3300025909 | Ga0207705_10000009 | Ga0207705_10000009118 | 332 |
| 413 | 3300025931 | Ga0207644_10358028 | Ga0207644_103580282 | 332 |
| 414 | 3300025949 | Ga0207667_10068034 | Ga0207667_100680345 | 332 |
| 415 | 3300025986 | Ga0207658_10001130 | Ga0207658_1000113015 | 332 |
| 416 | 3300026035 | Ga0207703_10003805 | Ga0207703_1000380512 | 332 |
| 417 | 3300026078 | Ga0207702_10009748 | Ga0207702_100097486 | 332 |
| 418 | 3300026088 | Ga0207641_10000261 | Ga0207641_1000026114 | 332 |
| 419 | 3300026142 | Ga0207698_10000252 | Ga0207698_1000025227 | 332 |
| 420 | 3300028379 | Ga0268266_10005489 | Ga0268266_1000548910 | 332 |
| 421 | 3300028380 | Ga0268265_10006576 | Ga0268265_100065762 | 332 |
| 422 | 3300028381 | Ga0268264_10000040 | Ga0268264_10000040338 | 332 |
| 423 | 3300039447 | Ga0436361_0231868 | Ga0436361_0231868_19872_20873 | 332 |
| 424 | 3300048907 | Ga0496104_0003197 | Ga0496104_0003197_12723_13721 | 332 |
| 425 | 3300048908 | Ga0496105_0001623 | Ga0496105_0001623_9952_10950 | 332 |
| 426 | 3300048922 | Ga0496119_0141998 | Ga0496119_0141998_129_1127 | 332 |
| 427 | 3300048924 | Ga0496121_0176017 | Ga0496121_0176017_497_1495 | 332 |
| 428 | 3300005331 | Ga0070670_100015890 | Ga0070670_1000158907 | 333 |
| 429 | 3300005347 | Ga0070668_100000015 | Ga0070668_10000001538 | 333 |
| 430 | 3300005355 | Ga0070671_100000247 | Ga0070671_10000024714 | 333 |
| 431 | 3300005367 | Ga0070667_100000017 | Ga0070667_10000001768 | 333 |
| 432 | 3300005616 | Ga0068852_100134351 | Ga0068852_1001343512 | 333 |
| 433 | 3300005618 | Ga0068864_100019246 | Ga0068864_1000192465 | 333 |
| 434 | 3300005841 | Ga0068863_100033255 | Ga0068863_1000332552 | 333 |
| 435 | 3300005842 | Ga0068858_100000303 | Ga0068858_10000030330 | 333 |
| 436 | 3300005843 | Ga0068860_100000056 | Ga0068860_100000056176 | 333 |
| 437 | 3300005844 | Ga0068862_100000108 | Ga0068862_10000010884 | 333 |
| 438 | 3300009553 | Ga0105249_10027494 | Ga0105249_100274941 | 333 |
| 439 | 3300025923 | Ga0207681_10002181 | Ga0207681_100021815 | 333 |
| 440 | 3300025925 | Ga0207650_10003806 | Ga0207650_100038065 | 333 |
| 441 | 3300025931 | Ga0207644_10000139 | Ga0207644_1000013913 | 333 |
| 442 | 3300025972 | Ga0207668_10000012 | Ga0207668_10000012173 | 333 |
| 443 | 3300025986 | Ga0207658_10000011 | Ga0207658_10000011175 | 333 |
| 444 | 3300026035 | Ga0207703_10000529 | Ga0207703_1000052913 | 333 |
| 445 | 3300026088 | Ga0207641_10000115 | Ga0207641_1000011556 | 333 |
| 446 | 3300026088 | Ga0207641_10000906 | Ga0207641_1000090614 | 333 |
| 447 | 3300026095 | Ga0207676_10002586 | Ga0207676_1000258612 | 333 |
| 448 | 3300026118 | Ga0207675_100009290 | Ga0207675_1000092902 | 333 |
| 449 | 3300026142 | Ga0207698_10212989 | Ga0207698_102129892 | 333 |
| 450 | 3300026142 | Ga0207698_10327345 | Ga0207698_103273451 | 333 |
| 451 | 3300028380 | Ga0268265_10000429 | Ga0268265_1000042934 | 333 |
| 452 | 3300028381 | Ga0268264_10000089 | Ga0268264_1000008974 | 333 |
| 453 | 3300031456 | Ga0307513_10093855 | Ga0307513_100938553 | 333 |
| 454 | 3300001989 | JGI24739J22299_10004735 | JGI24739J22299_100047353 | 334 |
| 455 | 3300002075 | JGI24738J21930_10005740 | JGI24738J21930_100057402 | 334 |
| 456 | 3300005295 | Ga0065707_10086988 | Ga0065707_100869886 | 334 |
| 457 | 3300005457 | Ga0070662_100133581 | Ga0070662_1001335813 | 334 |
| 458 | 3300005539 | Ga0068853_100001543 | Ga0068853_1000015435 | 334 |
| 459 | 3300005539 | Ga0068853_100028039 | Ga0068853_1000280395 | 334 |
| 460 | 3300005563 | Ga0068855_100002277 | Ga0068855_1000022774 | 334 |
| 461 | 3300005563 | Ga0068855_100110096 | Ga0068855_1001100964 | 334 |
| 462 | 3300005563 | Ga0068855_100482761 | Ga0068855_1004827612 | 334 |
| 463 | 3300005577 | Ga0068857_100017241 | Ga0068857_1000172414 | 334 |
| 464 | 3300005577 | Ga0068857_100051144 | Ga0068857_1000511444 | 334 |
| 465 | 3300005577 | Ga0068857_100209739 | Ga0068857_1002097391 | 334 |
| 466 | 3300005578 | Ga0068854_100017388 | Ga0068854_1000173883 | 334 |
| 467 | 3300005616 | Ga0068852_100012076 | Ga0068852_1000120764 | 334 |
| 468 | 3300005616 | Ga0068852_100049837 | Ga0068852_1000498375 | 334 |
| 469 | 3300005616 | Ga0068852_100105385 | Ga0068852_1001053852 | 334 |
| 470 | 3300005617 | Ga0068859_100001073 | Ga0068859_1000010731 | 334 |
| 471 | 3300005618 | Ga0068864_100304568 | Ga0068864_1003045682 | 334 |
| 472 | 3300005719 | Ga0068861_100000365 | Ga0068861_10000036510 | 334 |
| 473 | 3300006931 | Ga0097620_100001073 | Ga0097620_1000010731 | 334 |
| 474 | 3300009177 | Ga0105248_10007630 | Ga0105248_1000763010 | 334 |
| 475 | 3300009551 | Ga0105238_10041469 | Ga0105238_100414694 | 334 |
| 476 | 3300014968 | Ga0157379_10183260 | Ga0157379_101832602 | 334 |
| 477 | 3300025924 | Ga0207694_10274034 | Ga0207694_102740342 | 334 |
| 478 | 3300025933 | Ga0207706_10031241 | Ga0207706_100312412 | 334 |
| 479 | 3300025941 | Ga0207711_10002657 | Ga0207711_1000265714 | 334 |
| 480 | 3300025949 | Ga0207667_10011969 | Ga0207667_100119698 | 334 |
| 481 | 3300025949 | Ga0207667_10231671 | Ga0207667_102316712 | 334 |
| 482 | 3300026041 | Ga0207639_10002192 | Ga0207639_100021924 | 334 |
| 483 | 3300026041 | Ga0207639_10023342 | Ga0207639_100233426 | 334 |
| 484 | 3300026095 | Ga0207676_10324656 | Ga0207676_103246562 | 334 |
| 485 | 3300026116 | Ga0207674_10000825 | Ga0207674_1000082513 | 334 |
| 486 | 3300026116 | Ga0207674_10004674 | Ga0207674_100046744 | 334 |
| 487 | 3300026116 | Ga0207674_10131803 | Ga0207674_101318033 | 334 |
| 488 | 3300026118 | Ga0207675_100000380 | Ga0207675_10000038031 | 334 |
| 489 | 3300026142 | Ga0207698_10040208 | Ga0207698_100402083 | 334 |
| 490 | 3300031548 | Ga0307408_100008166 | Ga0307408_1000081669 | 334 |
| 491 | 3300031731 | Ga0307405_10013863 | Ga0307405_100138634 | 334 |
| 492 | 3300031731 | Ga0307405_10077955 | Ga0307405_100779552 | 334 |
| 493 | 3300031824 | Ga0307413_10017580 | Ga0307413_100175805 | 334 |
| 494 | 3300031901 | Ga0307406_10016712 | Ga0307406_100167125 | 334 |
| 495 | 3300031911 | Ga0307412_10001578 | Ga0307412_1000157814 | 334 |
| 496 | 3300031995 | Ga0307409_100144955 | Ga0307409_1001449553 | 334 |
| 497 | 3300032004 | Ga0307414_10213057 | Ga0307414_102130572 | 334 |
| 498 | 3300044659 | Ga0466973_0193982 | Ga0466973_0193982_45_1049 | 334 |
| 499 | 3300049572 | Ga0501036_0348734 | Ga0501036_0348734_86_1090 | 334 |
| 500 | 3300049579 | Ga0501043_0002717 | Ga0501043_0002717_3094_4098 | 334 |
| 501 | 3300049580 | Ga0501046_0110422 | Ga0501046_0110422_106_1110 | 334 |
| 502 | 3300049581 | Ga0501047_0000043 | Ga0501047_0000043_124957_125961 | 334 |
| 503 | 3300049679 | Ga0501249_000024 | Ga0501249_000024_89441_90445 | 334 |
| 504 | 3300049823 | Ga0501044_0015913 | Ga0501044_0015913_905_1909 | 334 |
| 505 | 3300053157 | Ga0500624_000006 | Ga0500624_000006_133001_134008 | 334 |
| 506 | 3300009551 | Ga0105238_10109616 | Ga0105238_101096164 | 335 |
| 507 | 3300025924 | Ga0207694_10059983 | Ga0207694_100599834 | 335 |
| 508 | 3300031911 | Ga0307412_10007651 | Ga0307412_100076514 | 335 |
| 509 | 3300037471 | Ga0395905_0113931 | Ga0395905_0113931_819_1829 | 335 |
| 510 | 3300046524 | Ga0495648_0093730 | Ga0495648_0093730_398_1411 | 335 |
| 511 | 3300049574 | Ga0501038_0062003 | Ga0501038_0062003_1917_2930 | 335 |
| 512 | 3300049663 | Ga0501223_000095 | Ga0501223_000095_3084_4094 | 335 |
| 513 | 3300049664 | Ga0501224_000014 | Ga0501224_000014_30342_31352 | 335 |
| 514 | 3300049668 | Ga0501233_000081 | Ga0501233_000081_3097_4107 | 335 |
| 515 | 3300049669 | Ga0501235_000196 | Ga0501235_000196_2481_3491 | 335 |
| 516 | 3300049705 | Ga0501225_0000023 | Ga0501225_0000023_12137_13147 | 335 |
| 517 | 3300049707 | Ga0501234_000139 | Ga0501234_000139_1829_2839 | 335 |
| 518 | 3300049853 | Ga0501226_000037 | Ga0501226_000037_60493_61503 | 335 |
| 519 | 3300053118 | Ga0500594_0003007 | Ga0500594_0003007_671_1684 | 335 |
| 520 | 3300013100 | Ga0157373_10093793 | Ga0157373_100937932 | 336 |
| 521 | 3300031456 | Ga0307513_10017622 | Ga0307513_100176228 | 336 |
| 522 | 3300005614 | Ga0068856_100001249 | Ga0068856_1000012497 | 337 |
| 523 | 3300009093 | Ga0105240_10002962 | Ga0105240_100029627 | 337 |
| 524 | 3300009545 | Ga0105237_10003902 | Ga0105237_1000390215 | 337 |
| 525 | 3300026078 | Ga0207702_10001729 | Ga0207702_100017294 | 337 |
| 526 | 3300049823 | Ga0501044_0084783 | Ga0501044_0084783_2047_3063 | 338 |
| 527 | 3300006846 | Ga0075430_100014354 | Ga0075430_1000143546 | 339 |
| 528 | 3300001904 | JGI24736J21556_1000320 | JGI24736J21556_10003209 | 340 |
| 529 | 3300001904 | JGI24736J21556_1000835 | JGI24736J21556_10008355 | 340 |
| 530 | 3300001915 | JGI24741J21665_1000003 | JGI24741J21665_100000342 | 340 |
| 531 | 3300001979 | JGI24740J21852_10003002 | JGI24740J21852_100030029 | 340 |
| 532 | 3300001989 | JGI24739J22299_10001560 | JGI24739J22299_100015608 | 340 |
| 533 | 3300001989 | JGI24739J22299_10025391 | JGI24739J22299_100253914 | 340 |
| 534 | 3300001990 | JGI24737J22298_10001968 | JGI24737J22298_100019684 | 340 |
| 535 | 3300001990 | JGI24737J22298_10002768 | JGI24737J22298_100027687 | 340 |
| 536 | 3300002067 | JGI24735J21928_10000770 | JGI24735J21928_100007706 | 340 |
| 537 | 3300002075 | JGI24738J21930_10000689 | JGI24738J21930_100006898 | 340 |
| 538 | 3300002075 | JGI24738J21930_10003624 | JGI24738J21930_100036245 | 340 |
| 539 | 3300002076 | JGI24749J21850_1000044 | JGI24749J21850_100004416 | 340 |
| 540 | 3300002459 | JGI24751J29686_10000022 | JGI24751J29686_10000022112 | 340 |
| 541 | 3300005295 | Ga0065707_10081965 | Ga0065707_1008196510 | 340 |
| 542 | 3300005327 | Ga0070658_10016110 | Ga0070658_100161107 | 340 |
| 543 | 3300005329 | Ga0070683_100332915 | Ga0070683_1003329152 | 340 |
| 544 | 3300005331 | Ga0070670_100000006 | Ga0070670_100000006175 | 340 |
| 545 | 3300005339 | Ga0070660_100083364 | Ga0070660_1000833641 | 340 |
| 546 | 3300005339 | Ga0070660_100196146 | Ga0070660_1001961462 | 340 |
| 547 | 3300005344 | Ga0070661_100087755 | Ga0070661_1000877554 | 340 |
| 548 | 3300005353 | Ga0070669_100000036 | Ga0070669_10000003612 | 340 |
| 549 | 3300005366 | Ga0070659_100248267 | Ga0070659_1002482672 | 340 |
| 550 | 3300005367 | Ga0070667_100003397 | Ga0070667_1000033972 | 340 |
| 551 | 3300005455 | Ga0070663_100007281 | Ga0070663_1000072813 | 340 |
| 552 | 3300005457 | Ga0070662_100020670 | Ga0070662_1000206703 | 340 |
| 553 | 3300005563 | Ga0068855_100127061 | Ga0068855_1001270613 | 340 |
| 554 | 3300005577 | Ga0068857_100048634 | Ga0068857_1000486344 | 340 |
| 555 | 3300005614 | Ga0068856_100020122 | Ga0068856_1000201224 | 340 |
| 556 | 3300005616 | Ga0068852_100169825 | Ga0068852_1001698254 | 340 |
| 557 | 3300005618 | Ga0068864_100000014 | Ga0068864_100000014140 | 340 |
| 558 | 3300005719 | Ga0068861_100003589 | Ga0068861_1000035899 | 340 |
| 559 | 3300005834 | Ga0068851_10051792 | Ga0068851_100517923 | 340 |
| 560 | 3300005844 | Ga0068862_100000007 | Ga0068862_100000007163 | 340 |
| 561 | 3300009093 | Ga0105240_10001747 | Ga0105240_1000174714 | 340 |
| 562 | 3300009093 | Ga0105240_10017212 | Ga0105240_100172126 | 340 |
| 563 | 3300009174 | Ga0105241_10035383 | Ga0105241_100353832 | 340 |
| 564 | 3300009177 | Ga0105248_10000522 | Ga0105248_1000052239 | 340 |
| 565 | 3300009545 | Ga0105237_10003199 | Ga0105237_1000319920 | 340 |
| 566 | 3300009545 | Ga0105237_10027834 | Ga0105237_100278344 | 340 |
| 567 | 3300009551 | Ga0105238_10122517 | Ga0105238_101225174 | 340 |
| 568 | 3300013104 | Ga0157370_10002158 | Ga0157370_1000215822 | 340 |
| 569 | 3300013104 | Ga0157370_10052766 | Ga0157370_100527663 | 340 |
| 570 | 3300013105 | Ga0157369_10012466 | Ga0157369_100124669 | 340 |
| 571 | 3300013105 | Ga0157369_10296475 | Ga0157369_102964752 | 340 |
| 572 | 3300014325 | Ga0163163_10047911 | Ga0163163_100479114 | 340 |
| 573 | 3300014326 | Ga0157380_10000108 | Ga0157380_1000010811 | 340 |
| 574 | 3300025321 | Ga0207656_10001573 | Ga0207656_100015735 | 340 |
| 575 | 3300025321 | Ga0207656_10122849 | Ga0207656_101228492 | 340 |
| 576 | 3300025904 | Ga0207647_10003366 | Ga0207647_100033669 | 340 |
| 577 | 3300025909 | Ga0207705_10013102 | Ga0207705_100131027 | 340 |
| 578 | 3300025911 | Ga0207654_10002589 | Ga0207654_100025896 | 340 |
| 579 | 3300025913 | Ga0207695_10001602 | Ga0207695_1000160214 | 340 |
| 580 | 3300025913 | Ga0207695_10002541 | Ga0207695_100025417 | 340 |
| 581 | 3300025913 | Ga0207695_10009522 | Ga0207695_1000952210 | 340 |
| 582 | 3300025914 | Ga0207671_10002424 | Ga0207671_100024247 | 340 |
| 583 | 3300025914 | Ga0207671_10007412 | Ga0207671_100074124 | 340 |
| 584 | 3300025914 | Ga0207671_10069127 | Ga0207671_100691273 | 340 |
| 585 | 3300025919 | Ga0207657_10020601 | Ga0207657_100206016 | 340 |
| 586 | 3300025919 | Ga0207657_10044562 | Ga0207657_100445626 | 340 |
| 587 | 3300025923 | Ga0207681_10000001 | Ga0207681_10000001134 | 340 |
| 588 | 3300025924 | Ga0207694_10003521 | Ga0207694_100035218 | 340 |
| 589 | 3300025925 | Ga0207650_10000023 | Ga0207650_10000023135 | 340 |
| 590 | 3300025933 | Ga0207706_10024125 | Ga0207706_100241256 | 340 |
| 591 | 3300025941 | Ga0207711_10001173 | Ga0207711_1000117319 | 340 |
| 592 | 3300025949 | Ga0207667_10000812 | Ga0207667_1000081234 | 340 |
| 593 | 3300025949 | Ga0207667_10001775 | Ga0207667_100017758 | 340 |
| 594 | 3300025981 | Ga0207640_10003292 | Ga0207640_100032928 | 340 |
| 595 | 3300025981 | Ga0207640_10005076 | Ga0207640_100050766 | 340 |
| 596 | 3300025986 | Ga0207658_10002434 | Ga0207658_1000243414 | 340 |
| 597 | 3300026041 | Ga0207639_10001324 | Ga0207639_100013248 | 340 |
| 598 | 3300026041 | Ga0207639_10068556 | Ga0207639_100685564 | 340 |
| 599 | 3300026067 | Ga0207678_10000983 | Ga0207678_100009837 | 340 |
| 600 | 3300026067 | Ga0207678_10008746 | Ga0207678_100087466 | 340 |
| 601 | 3300026078 | Ga0207702_10001804 | Ga0207702_100018048 | 340 |
| 602 | 3300026078 | Ga0207702_10001928 | Ga0207702_1000192815 | 340 |
| 603 | 3300026095 | Ga0207676_10000017 | Ga0207676_10000017137 | 340 |
| 604 | 3300026116 | Ga0207674_10024725 | Ga0207674_100247254 | 340 |
| 605 | 3300026116 | Ga0207674_10048279 | Ga0207674_100482794 | 340 |
| 606 | 3300026118 | Ga0207675_100023115 | Ga0207675_1000231152 | 340 |
| 607 | 3300026142 | Ga0207698_10015401 | Ga0207698_100154012 | 340 |
| 608 | 3300026142 | Ga0207698_10066589 | Ga0207698_100665893 | 340 |
| 609 | 3300028380 | Ga0268265_10000002 | Ga0268265_10000002140 | 340 |
| 610 | 3300031548 | Ga0307408_100003036 | Ga0307408_10000303611 | 340 |
| 611 | 3300031852 | Ga0307410_10156768 | Ga0307410_101567683 | 340 |
| 612 | 3300031911 | Ga0307412_10006261 | Ga0307412_100062616 | 340 |
| 613 | 3300032002 | Ga0307416_100017246 | Ga0307416_1000172467 | 340 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1umd-assembly1.cif.gz_D | branched-chain 2-oxo acid dehydrogenase (e1) from thermus thermophilus hb8 with 4-methyl-2-oxopentanoate as an intermediate | 0.9766 | 16 | 339 |
| 1w88-assembly2.cif.gz_F | the crystal structure of pyruvate dehydrogenase e1(d180n,e183q) bound to the peripheral subunit binding domain of e2 | 0.9752 | 16 | 338 |
| 1w88-assembly2.cif.gz_H | the crystal structure of pyruvate dehydrogenase e1(d180n,e183q) bound to the peripheral subunit binding domain of e2 | 0.9746 | 16 | 339 |
| 3duf-assembly2.cif.gz_H | snapshots of catalysis in the e1 subunit of the pyruvate dehydrogenase multi-enzyme complex | 0.9744 | 16 | 338 |
| 6cer-assembly1.cif.gz_D | human pyruvate dehydrogenase complex e1 component v138m mutation | 0.9722 | 16 | 338 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q10G39_79_267_3.40.50.970 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains | 0.9781 | 18 | 206 | 3.40.50.970 |
| af_Q2FY53_193_326_3.40.50.920 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9728 | 208 | 340 | 3.40.50.920 |
| af_E5RPJ6_273_405_3.40.50.920 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9704 | 208 | 340 | 3.40.50.920 |
| af_Q8IL09_280_409_3.40.50.920 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9667 | 208 | 335 | 3.40.50.920 |
| af_E5RPJ6_273_405_3.40.50.920 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9634 | 208 | 340 | 3.40.50.920 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V3YH18-F1-model_v4 | Pyruvate dehydrogenase E1 component subunit alpha (EC 1.2.4.1) | 0.9867 | 16 | 339 |
GO:0004739
GO:0006086 GO:0043231 |
| AF-A0A2M7AD36-F1-model_v4 | Alpha-ketoacid dehydrogenase subunit beta | 0.9859 | 16 | 338 |
GO:0004739
|
| AF-A0A541C5Q7-F1-model_v4 | Alpha-ketoacid dehydrogenase subunit beta | 0.9859 | 16 | 338 |
GO:0003824
|
| AF-A0A4Q5QEV2-F1-model_v4 | Alpha-ketoacid dehydrogenase subunit beta | 0.9858 | 178 | 339 |
GO:0003824
|
| AF-A0A2G9YA15-F1-model_v4 | Dehydrogenase | 0.9856 | 60 | 208 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar