F469212
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 613 | 353 | 587 | 323 |
Family's Representative Sequence
| Representative Sequence | 2162886007|SwRhRL2b_contig_2224728|SwRhRL2b_0434.00009780 |
| Length | 345 |
| Sequence | MARSARRTADMGVNFDLTVIWAFIIAFGVFAYVVMDGFDLGIGILFPTFQVGEGRNRAMNSIAPVWDGNETWLVLGGGGLFAAFPLAYAIILPATYPLIIAMLLGLVFRGVAFEFRWRDARHRAFWDLAFSGGSFVAALSQGMVLGAILQGIKVSGRAYAGSWWDWLTPYTLLTGLGVVAGYALLGSCWLIWKLDGPAQDHAYKVARRAAVATLALLVAVSLYTPLLAEAYWRRWFEAPGIYFASQVPLLTLILAGTLFYGLAKRWQAAPFWLAQGIFLLGMAGLGVSMWPHVIPASVTIWEAAAPERSQVFMLVGVALTMPLIIGYTGWAYWVFRGKVGHDGYH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 3 | 2545555834 | Methylobacterium sp. WSM2598 | Isolate | Nodule |
| 4 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 5 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 6 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 7 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 8 | 2643221541 | Sphingomonas sp. Root50 | Isolate | Unclassified |
| 9 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 10 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 11 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
| 12 | 2739367664 | Novosphingobium sp. GV002 | Isolate | Unclassified |
| 13 | 2739367865 | Novosphingobium sp. GV013 | Isolate | Unclassified |
| 14 | 2842698319 | Methylobacterium sp. R-72139 | Isolate | Unclassified |
| 15 | 2855020534 | Paracoccus endophyticus SYSUP0003 | Isolate | Stem Tuber |
| 16 | 2882806704 | Pelagerythrobacter rhizovicinus AY-3R | Isolate | Rhizosphere |
| 17 | 2883354860 | Hypericibacter adhaerens R5959 | Isolate | Rhizosphere |
| 18 | 2896184354 | Aurantiacibacter suaedae GH3-15 | Isolate | Rhizosphere |
| 19 | 2896253425 | Aurantiacibacter rhizosphaerae GH3-10 | Isolate | Rhizosphere |
| 20 | 2902330777 | Methylobacterium sp. 2A | Isolate | Unclassified |
| 21 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 22 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 23 | 2928125067 | Methylobacterium sp. 1973 | Isolate | Unclassified |
| 24 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 25 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 26 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 27 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 28 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 29 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 30 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 31 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 32 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 33 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 34 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 35 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 36 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 37 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 38 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 63 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 65 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 70 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 72 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 73 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 74 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 76 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 77 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 78 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 79 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 80 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 81 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 82 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 83 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 84 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 85 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 86 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 88 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 89 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 90 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 91 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 92 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 93 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 94 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 95 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 96 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 97 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 98 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 99 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 100 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 102 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 103 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 104 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 105 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 115 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 118 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 130 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 135 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 136 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 138 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 185 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 186 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 187 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 188 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 192 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 193 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 194 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 195 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 196 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 197 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 198 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 199 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 200 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 201 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 202 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 203 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 204 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 205 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 206 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 207 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 208 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 209 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 210 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 211 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 212 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 213 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 214 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 215 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 216 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 217 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 218 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 219 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 220 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 221 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 222 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 265 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 266 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 267 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 268 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 269 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 270 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 271 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 272 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 273 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 274 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 275 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 291 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 292 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 295 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 298 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 299 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 300 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 301 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 302 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 303 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 304 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 305 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 312 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 314 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 316 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 317 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 318 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 319 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 320 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 321 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 322 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 323 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 324 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 325 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 326 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 327 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 328 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 329 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 330 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 331 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 332 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 333 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 334 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 335 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 336 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 337 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 338 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 339 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 340 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 341 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 342 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 343 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 344 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 345 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 346 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 347 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 348 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 350 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 351 | 641522639 | Methylobacterium sp. 4-46 | Isolate | Nodule |
| 352 | 643348564 | Methylobacterium nodulans ORS 2060 | Isolate | Nodule |
| 353 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.76 |
| Metatranscriptomes | 0 |
| Isolates | 4.24 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 15.99 |
| Nodule | 1.79 |
| Rhizoplane | 0.33 |
| Rhizosphere | 74.71 |
| Stem | 0 |
| Stem Tuber | 0.16 |
| Unclassified | 7.01 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_2224728 | 2162886007 | Bacteria | 34906 |
| 2 | JGI24752J21851_1000407 | 3300001976 | Bacteria | 5889 |
| 3 | JGI24749J21850_1000021 | 3300002076 | Bacteria | 30737 |
| 4 | JGI24742J22300_10000498 | 3300002244 | Bacteria | 5842 |
| 5 | JGI24751J29686_10000778 | 3300002459 | Bacteria | 7502 |
| 6 | JGI25153J46596_10000008 | 3300003215 | Bacteria | 376808 |
| 7 | Ga0055525_1000248 | 3300003759 | Bacteria | 54342 |
| 8 | Ga0055542_1000040 | 3300003762 | Bacteria | 214035 |
| 9 | Ga0055529_1000037 | 3300003763 | Bacteria | 237307 |
| 10 | Ga0055526_1000610 | 3300003771 | Bacteria | 27782 |
| 11 | Ga0055524_1000018 | 3300003775 | Bacteria | 234806 |
| 12 | Ga0065704_10070184 | 3300005289 | Bacteria | 119655 |
| 13 | Ga0065715_10130045 | 3300005293 | Bacteria | 2033 |
| 14 | Ga0065707_10082787 | 3300005295 | Bacteria | 12139 |
| 15 | Ga0070658_10033562 | 3300005327 | Bacteria | 4130 |
| 16 | Ga0070658_10138276 | 3300005327 | Bacteria | 2033 |
| 17 | Ga0070683_100056792 | 3300005329 | Bacteria | 3635 |
| 18 | Ga0070683_100111275 | 3300005329 | Bacteria | 2583 |
| 19 | Ga0070670_100000031 | 3300005331 | Bacteria | 159070 |
| 20 | Ga0070670_100000621 | 3300005331 | Bacteria | 27756 |
| 21 | Ga0070666_10136590 | 3300005335 | Bacteria | 1706 |
| 22 | Ga0070680_100011597 | 3300005336 | Bacteria | 6827 |
| 23 | Ga0070660_100000754 | 3300005339 | Bacteria | 21503 |
| 24 | Ga0070660_100006530 | 3300005339 | Bacteria | 8091 |
| 25 | Ga0070660_100016179 | 3300005339 | Bacteria | 5408 |
| 26 | Ga0070660_100083657 | 3300005339 | Bacteria | 2507 |
| 27 | Ga0070661_100001494 | 3300005344 | Bacteria | 16268 |
| 28 | Ga0070661_100061805 | 3300005344 | Bacteria | 2749 |
| 29 | Ga0070668_100039301 | 3300005347 | Bacteria | 3619 |
| 30 | Ga0070668_100172710 | 3300005347 | Bacteria | 1760 |
| 31 | Ga0070668_100261563 | 3300005347 | Bacteria | 1439 |
| 32 | Ga0070669_100000015 | 3300005353 | Bacteria | 197597 |
| 33 | Ga0070669_100179092 | 3300005353 | Bacteria | 1657 |
| 34 | Ga0070671_100204743 | 3300005355 | Bacteria | 1674 |
| 35 | Ga0070674_100000638 | 3300005356 | Bacteria | 17627 |
| 36 | Ga0070674_100035455 | 3300005356 | Bacteria | 3341 |
| 37 | Ga0070673_100114741 | 3300005364 | Bacteria | 2239 |
| 38 | Ga0070659_100013228 | 3300005366 | Bacteria | 6137 |
| 39 | Ga0070659_100202973 | 3300005366 | Bacteria | 1632 |
| 40 | Ga0070667_100000322 | 3300005367 | Bacteria | 53499 |
| 41 | Ga0070667_100000329 | 3300005367 | Bacteria | 52918 |
| 42 | Ga0070667_100000396 | 3300005367 | Bacteria | 47159 |
| 43 | Ga0070709_10003317 | 3300005434 | Bacteria | 8663 |
| 44 | Ga0070714_100051302 | 3300005435 | Bacteria | 3516 |
| 45 | Ga0070713_100000447 | 3300005436 | Bacteria | 26301 |
| 46 | Ga0070710_10001414 | 3300005437 | Bacteria | 11327 |
| 47 | Ga0070711_100020818 | 3300005439 | Archaea | 4233 |
| 48 | Ga0070678_100000022 | 3300005456 | Bacteria | 49544 |
| 49 | Ga0070662_100004936 | 3300005457 | Bacteria | 8477 |
| 50 | Ga0070662_100025275 | 3300005457 | Bacteria | 4099 |
| 51 | Ga0070662_100036221 | 3300005457 | Bacteria | 3489 |
| 52 | Ga0070707_100316441 | 3300005468 | Bacteria | 1517 |
| 53 | Ga0070698_100049064 | 3300005471 | Bacteria | 4311 |
| 54 | Ga0070698_100262725 | 3300005471 | Bacteria | 1658 |
| 55 | Ga0070699_100046988 | 3300005518 | Bacteria | 3735 |
| 56 | Ga0070679_100012918 | 3300005530 | Bacteria | 7997 |
| 57 | Ga0070679_100052119 | 3300005530 | Bacteria | 4077 |
| 58 | Ga0070684_100016945 | 3300005535 | Bacteria | 5970 |
| 59 | Ga0068853_100051188 | 3300005539 | Bacteria | 3555 |
| 60 | Ga0068853_100103113 | 3300005539 | Bacteria | 2525 |
| 61 | Ga0068853_100110663 | 3300005539 | Bacteria | 2440 |
| 62 | Ga0068853_100194169 | 3300005539 | Bacteria | 1845 |
| 63 | Ga0068853_100287715 | 3300005539 | Bacteria | 1516 |
| 64 | Ga0068853_100338528 | 3300005539 | Bacteria | 1397 |
| 65 | Ga0070686_100298986 | 3300005544 | Bacteria | 1193 |
| 66 | Ga0070696_100002073 | 3300005546 | Bacteria | 13154 |
| 67 | Ga0070693_100227178 | 3300005547 | Bacteria | 1226 |
| 68 | Ga0070665_100000011 | 3300005548 | Bacteria | 525539 |
| 69 | Ga0070665_100000023 | 3300005548 | Bacteria | 375278 |
| 70 | Ga0068855_100031545 | 3300005563 | Bacteria | 6329 |
| 71 | Ga0068855_100047788 | 3300005563 | Bacteria | 5054 |
| 72 | Ga0068855_100061805 | 3300005563 | Bacteria | 4375 |
| 73 | Ga0068855_100265979 | 3300005563 | Bacteria | 1909 |
| 74 | Ga0070664_100048559 | 3300005564 | Bacteria | 3586 |
| 75 | Ga0070664_100074157 | 3300005564 | Bacteria | 2921 |
| 76 | Ga0070664_100105443 | 3300005564 | Bacteria | 2455 |
| 77 | Ga0068857_100121783 | 3300005577 | Bacteria | 2349 |
| 78 | Ga0068857_100186931 | 3300005577 | Bacteria | 1886 |
| 79 | Ga0068854_100010375 | 3300005578 | Bacteria | 6039 |
| 80 | Ga0068856_100003121 | 3300005614 | Bacteria | 16914 |
| 81 | Ga0068856_100009932 | 3300005614 | Bacteria | 9245 |
| 82 | Ga0068856_100012002 | 3300005614 | Bacteria | 8392 |
| 83 | Ga0070702_100060491 | 3300005615 | Bacteria | 2202 |
| 84 | Ga0068852_100001154 | 3300005616 | Bacteria | 17486 |
| 85 | Ga0068859_100015406 | 3300005617 | Bacteria | 7682 |
| 86 | Ga0068859_100015675 | 3300005617 | Bacteria | 7616 |
| 87 | Ga0068864_100000004 | 3300005618 | Bacteria | 489341 |
| 88 | Ga0068864_100000248 | 3300005618 | Bacteria | 48142 |
| 89 | Ga0068864_100001303 | 3300005618 | Bacteria | 20754 |
| 90 | Ga0068864_100003651 | 3300005618 | Bacteria | 12723 |
| 91 | Ga0068861_100019313 | 3300005719 | Bacteria | 4869 |
| 92 | Ga0068863_100000002 | 3300005841 | Bacteria | 489510 |
| 93 | Ga0068863_100005967 | 3300005841 | Bacteria | 11947 |
| 94 | Ga0068863_100020878 | 3300005841 | Bacteria | 6255 |
| 95 | Ga0068858_100001051 | 3300005842 | Bacteria | 28526 |
| 96 | Ga0068858_100007016 | 3300005842 | Bacteria | 10947 |
| 97 | Ga0068858_100214795 | 3300005842 | Bacteria | 1821 |
| 98 | Ga0068860_100005628 | 3300005843 | Bacteria | 12658 |
| 99 | Ga0068860_100008843 | 3300005843 | Bacteria | 10032 |
| 100 | Ga0068860_100071559 | 3300005843 | Bacteria | 3295 |
| 101 | Ga0068862_100000002 | 3300005844 | Bacteria | 489341 |
| 102 | Ga0068862_100000006 | 3300005844 | Bacteria | 346828 |
| 103 | Ga0068862_100000187 | 3300005844 | Bacteria | 68303 |
| 104 | Ga0068862_100147244 | 3300005844 | Bacteria | 2094 |
| 105 | Ga0081455_10047844 | 3300005937 | Bacteria | 3700 |
| 106 | Ga0081538_10073702 | 3300005981 | Bacteria | 1863 |
| 107 | Ga0081540_1000165 | 3300005983 | Bacteria | 68435 |
| 108 | Ga0081540_1004986 | 3300005983 | Bacteria | 9979 |
| 109 | Ga0081540_1024709 | 3300005983 | Bacteria | 3480 |
| 110 | Ga0081540_1065550 | 3300005983 | Bacteria | 1707 |
| 111 | Ga0070717_10020113 | 3300006028 | Bacteria | 5246 |
| 112 | Ga0075365_10009177 | 3300006038 | Bacteria | 5668 |
| 113 | Ga0075365_10075628 | 3300006038 | Bacteria | 2273 |
| 114 | Ga0075368_10016373 | 3300006042 | Bacteria | 2763 |
| 115 | Ga0075368_10064201 | 3300006042 | Bacteria | 1474 |
| 116 | Ga0075364_10025783 | 3300006051 | Bacteria | 3745 |
| 117 | Ga0075364_10077578 | 3300006051 | Bacteria | 2193 |
| 118 | Ga0070715_10000915 | 3300006163 | Bacteria | 8201 |
| 119 | Ga0070716_100007776 | 3300006173 | Bacteria | 5292 |
| 120 | Ga0070712_100005054 | 3300006175 | Bacteria | 8169 |
| 121 | Ga0075362_10009915 | 3300006177 | Bacteria | 3701 |
| 122 | Ga0075362_10023271 | 3300006177 | Bacteria | 2619 |
| 123 | Ga0075362_10047535 | 3300006177 | Bacteria | 1912 |
| 124 | Ga0075367_10001322 | 3300006178 | Bacteria | 10508 |
| 125 | Ga0075367_10010625 | 3300006178 | Bacteria | 4842 |
| 126 | Ga0075369_10017848 | 3300006186 | Bacteria | 2883 |
| 127 | Ga0075369_10031975 | 3300006186 | Bacteria | 2224 |
| 128 | Ga0075369_10095557 | 3300006186 | Bacteria | 1329 |
| 129 | Ga0075370_10003567 | 3300006353 | Bacteria | 7439 |
| 130 | Ga0075430_100048717 | 3300006846 | Bacteria | 3578 |
| 131 | Ga0075430_100088141 | 3300006846 | Bacteria | 2597 |
| 132 | Ga0075434_100001535 | 3300006871 | Bacteria | 19534 |
| 133 | Ga0068865_100021672 | 3300006881 | Bacteria | 4183 |
| 134 | Ga0097620_100015406 | 3300006931 | Bacteria | 7682 |
| 135 | Ga0097620_100015675 | 3300006931 | Bacteria | 7616 |
| 136 | Ga0099824_1001145 | 3300006942 | Bacteria | 36195 |
| 137 | Ga0099822_1000135 | 3300006943 | Bacteria | 49135 |
| 138 | Ga0075435_100055003 | 3300007076 | Bacteria | 3213 |
| 139 | Ga0099795_10063730 | 3300007788 | Bacteria | 1375 |
| 140 | Ga0105251_10002072 | 3300009011 | Bacteria | 16178 |
| 141 | Ga0105240_10025305 | 3300009093 | Bacteria | 7802 |
| 142 | Ga0105240_10071202 | 3300009093 | Bacteria | 4301 |
| 143 | Ga0105240_10462003 | 3300009093 | Bacteria | 1418 |
| 144 | Ga0111539_10020045 | 3300009094 | Bacteria | 8237 |
| 145 | Ga0105245_10039697 | 3300009098 | Bacteria | 4189 |
| 146 | Ga0105245_10277996 | 3300009098 | Bacteria | 1635 |
| 147 | Ga0105243_10000223 | 3300009148 | Bacteria | 65335 |
| 148 | Ga0105248_10000016 | 3300009177 | Bacteria | 308151 |
| 149 | Ga0105248_10000066 | 3300009177 | Bacteria | 121254 |
| 150 | Ga0105248_10182355 | 3300009177 | Bacteria | 2365 |
| 151 | Ga0105237_10134839 | 3300009545 | Bacteria | 2464 |
| 152 | Ga0105238_10024694 | 3300009551 | Bacteria | 6127 |
| 153 | Ga0105238_10437943 | 3300009551 | Bacteria | 1303 |
| 154 | Ga0105249_10000106 | 3300009553 | Bacteria | 115526 |
| 155 | Ga0105249_10000666 | 3300009553 | Bacteria | 31174 |
| 156 | Ga0105249_10029076 | 3300009553 | Bacteria | 4990 |
| 157 | Ga0105249_10119925 | 3300009553 | Bacteria | 2498 |
| 158 | Ga0099796_10033151 | 3300010159 | Bacteria | 1698 |
| 159 | Ga0105239_10033435 | 3300010375 | Bacteria | 5647 |
| 160 | Ga0105239_10060857 | 3300010375 | Bacteria | 4144 |
| 161 | Ga0105239_10359976 | 3300010375 | Bacteria | 1643 |
| 162 | Ga0105246_10000072 | 3300011119 | Bacteria | 41904 |
| 163 | Ga0157326_1000881 | 3300012513 | Bacteria | 3454 |
| 164 | Ga0157373_10010676 | 3300013100 | Bacteria | 6755 |
| 165 | Ga0157371_10011311 | 3300013102 | Bacteria | 6888 |
| 166 | Ga0157371_10038953 | 3300013102 | Bacteria | 3400 |
| 167 | Ga0157371_10049282 | 3300013102 | Bacteria | 2992 |
| 168 | Ga0157371_10067603 | 3300013102 | Bacteria | 2529 |
| 169 | Ga0157371_10169786 | 3300013102 | Bacteria | 1558 |
| 170 | Ga0157370_10032697 | 3300013104 | Bacteria | 5078 |
| 171 | Ga0157370_10133127 | 3300013104 | Bacteria | 2318 |
| 172 | Ga0157369_10000875 | 3300013105 | Bacteria | 38443 |
| 173 | Ga0157369_10054508 | 3300013105 | Bacteria | 4318 |
| 174 | Ga0157369_10065800 | 3300013105 | Bacteria | 3901 |
| 175 | Ga0157369_10300426 | 3300013105 | Bacteria | 1670 |
| 176 | Ga0157369_10385161 | 3300013105 | Bacteria | 1455 |
| 177 | Ga0163162_10009818 | 3300013306 | Bacteria | 9313 |
| 178 | Ga0163162_10255855 | 3300013306 | Bacteria | 1883 |
| 179 | Ga0157372_10032556 | 3300013307 | Bacteria | 5718 |
| 180 | Ga0157372_10325630 | 3300013307 | Bacteria | 1789 |
| 181 | Ga0157375_10271197 | 3300013308 | Bacteria | 1859 |
| 182 | Ga0163163_10011709 | 3300014325 | Bacteria | 7967 |
| 183 | Ga0163163_10024188 | 3300014325 | Bacteria | 5778 |
| 184 | Ga0163163_10610483 | 3300014325 | Bacteria | 1154 |
| 185 | Ga0157380_10000124 | 3300014326 | Bacteria | 42926 |
| 186 | Ga0157380_10026391 | 3300014326 | Bacteria | 4410 |
| 187 | Ga0157379_10002599 | 3300014968 | Bacteria | 15174 |
| 188 | Ga0157379_10133779 | 3300014968 | Bacteria | 2233 |
| 189 | Ga0163161_10198751 | 3300017792 | Bacteria | 1544 |
| 190 | Ga0213872_10018493 | 3300021361 | Bacteria | 3214 |
| 191 | Ga0209563_100066 | 3300025230 | Bacteria | 257382 |
| 192 | Ga0209148_1000011 | 3300025254 | Bacteria | 1196503 |
| 193 | Ga0209233_1002397 | 3300025261 | Bacteria | 6922 |
| 194 | Ga0209233_1004111 | 3300025261 | Bacteria | 5015 |
| 195 | Ga0209233_1022037 | 3300025261 | Bacteria | 1637 |
| 196 | Ga0209455_1000006 | 3300025272 | Bacteria | 1196503 |
| 197 | Ga0209455_1005177 | 3300025272 | Bacteria | 4089 |
| 198 | Ga0209455_1015969 | 3300025272 | Bacteria | 1629 |
| 199 | Ga0209675_1006307 | 3300025291 | Bacteria | 4785 |
| 200 | Ga0209564_1000059 | 3300025295 | Bacteria | 328782 |
| 201 | Ga0209758_1000017 | 3300025297 | Bacteria | 754393 |
| 202 | Ga0209256_1000032 | 3300025299 | Bacteria | 395041 |
| 203 | Ga0207426_1015349 | 3300025302 | Bacteria | 2780 |
| 204 | Ga0207713_1005825 | 3300025735 | Bacteria | 7626 |
| 205 | Ga0207692_10001959 | 3300025898 | Bacteria | 7847 |
| 206 | Ga0207710_10039423 | 3300025900 | Bacteria | 2091 |
| 207 | Ga0207688_10099229 | 3300025901 | Bacteria | 1680 |
| 208 | Ga0207680_10305983 | 3300025903 | Bacteria | 1109 |
| 209 | Ga0207647_10010889 | 3300025904 | Bacteria | 6399 |
| 210 | Ga0207699_10001027 | 3300025906 | Bacteria | 13164 |
| 211 | Ga0207705_10000004 | 3300025909 | Bacteria | 705756 |
| 212 | Ga0207705_10005383 | 3300025909 | Bacteria | 9573 |
| 213 | Ga0207705_10046995 | 3300025909 | Bacteria | 3103 |
| 214 | Ga0207684_10055772 | 3300025910 | Bacteria | 3352 |
| 215 | Ga0207707_10036783 | 3300025912 | Bacteria | 4279 |
| 216 | Ga0207695_10018315 | 3300025913 | Bacteria | 8102 |
| 217 | Ga0207695_10435461 | 3300025913 | Bacteria | 1195 |
| 218 | Ga0207671_10226627 | 3300025914 | Bacteria | 1465 |
| 219 | Ga0207693_10000774 | 3300025915 | Bacteria | 28742 |
| 220 | Ga0207663_10000645 | 3300025916 | Bacteria | 15475 |
| 221 | Ga0207660_10035201 | 3300025917 | Bacteria | 3475 |
| 222 | Ga0207657_10001626 | 3300025919 | Bacteria | 24207 |
| 223 | Ga0207657_10009017 | 3300025919 | Bacteria | 10075 |
| 224 | Ga0207657_10018158 | 3300025919 | Bacteria | 6728 |
| 225 | Ga0207657_10025636 | 3300025919 | Bacteria | 5432 |
| 226 | Ga0207657_10025733 | 3300025919 | Bacteria | 5420 |
| 227 | Ga0207649_10034494 | 3300025920 | Bacteria | 3032 |
| 228 | Ga0207649_10111957 | 3300025920 | Bacteria | 1825 |
| 229 | Ga0207649_10164384 | 3300025920 | Bacteria | 1540 |
| 230 | Ga0207652_10010007 | 3300025921 | Bacteria | 7637 |
| 231 | Ga0207652_10038671 | 3300025921 | Bacteria | 4046 |
| 232 | Ga0207652_10140975 | 3300025921 | Bacteria | 2155 |
| 233 | Ga0207681_10000001 | 3300025923 | Bacteria | 1105841 |
| 234 | Ga0207650_10000055 | 3300025925 | Bacteria | 158325 |
| 235 | Ga0207650_10000643 | 3300025925 | Bacteria | 27774 |
| 236 | Ga0207650_10035633 | 3300025925 | Bacteria | 3616 |
| 237 | Ga0207687_10178115 | 3300025927 | Bacteria | 1645 |
| 238 | Ga0207664_10007783 | 3300025929 | Bacteria | 7441 |
| 239 | Ga0207690_10011749 | 3300025932 | Bacteria | 5237 |
| 240 | Ga0207690_10022480 | 3300025932 | Bacteria | 3924 |
| 241 | Ga0207690_10307225 | 3300025932 | Bacteria | 1243 |
| 242 | Ga0207706_10001953 | 3300025933 | Bacteria | 20227 |
| 243 | Ga0207706_10005288 | 3300025933 | Bacteria | 12036 |
| 244 | Ga0207706_10045905 | 3300025933 | Bacteria | 3870 |
| 245 | Ga0207709_10000078 | 3300025935 | Bacteria | 169141 |
| 246 | Ga0207669_10000105 | 3300025937 | Bacteria | 42248 |
| 247 | Ga0207669_10000393 | 3300025937 | Bacteria | 19327 |
| 248 | Ga0207665_10000289 | 3300025939 | Bacteria | 34924 |
| 249 | Ga0207711_10000022 | 3300025941 | Bacteria | 340441 |
| 250 | Ga0207711_10002672 | 3300025941 | Bacteria | 15768 |
| 251 | Ga0207661_10000082 | 3300025944 | Bacteria | 66488 |
| 252 | Ga0207661_10005344 | 3300025944 | Bacteria | 9042 |
| 253 | Ga0207661_10055952 | 3300025944 | Bacteria | 3165 |
| 254 | Ga0207661_10357200 | 3300025944 | Bacteria | 1319 |
| 255 | Ga0207679_10014287 | 3300025945 | Bacteria | 5216 |
| 256 | Ga0207679_10048575 | 3300025945 | Bacteria | 3090 |
| 257 | Ga0207679_10240391 | 3300025945 | Bacteria | 1534 |
| 258 | Ga0207667_10028799 | 3300025949 | Bacteria | 6030 |
| 259 | Ga0207667_10033197 | 3300025949 | Bacteria | 5552 |
| 260 | Ga0207667_10222443 | 3300025949 | Bacteria | 1934 |
| 261 | Ga0207651_10108306 | 3300025960 | Bacteria | 2079 |
| 262 | Ga0207712_10000048 | 3300025961 | Bacteria | 160050 |
| 263 | Ga0207712_10004350 | 3300025961 | Bacteria | 8946 |
| 264 | Ga0207668_10008869 | 3300025972 | Bacteria | 6014 |
| 265 | Ga0207640_10057376 | 3300025981 | Bacteria | 2561 |
| 266 | Ga0207640_10163045 | 3300025981 | Bacteria | 1652 |
| 267 | Ga0207658_10000274 | 3300025986 | Bacteria | 54007 |
| 268 | Ga0207658_10000589 | 3300025986 | Bacteria | 32594 |
| 269 | Ga0207658_10002544 | 3300025986 | Bacteria | 13258 |
| 270 | Ga0207703_10004829 | 3300026035 | Bacteria | 10970 |
| 271 | Ga0207703_10005193 | 3300026035 | Bacteria | 10522 |
| 272 | Ga0207639_10005058 | 3300026041 | Bacteria | 8881 |
| 273 | Ga0207639_10012677 | 3300026041 | Bacteria | 5878 |
| 274 | Ga0207639_10041887 | 3300026041 | Bacteria | 3430 |
| 275 | Ga0207639_10117282 | 3300026041 | Bacteria | 2181 |
| 276 | Ga0207639_10120358 | 3300026041 | Bacteria | 2156 |
| 277 | Ga0207702_10000621 | 3300026078 | Bacteria | 39027 |
| 278 | Ga0207702_10011567 | 3300026078 | Bacteria | 7353 |
| 279 | Ga0207702_10050448 | 3300026078 | Bacteria | 3514 |
| 280 | Ga0207702_10157780 | 3300026078 | Bacteria | 2069 |
| 281 | Ga0207641_10000002 | 3300026088 | Bacteria | 981004 |
| 282 | Ga0207641_10003066 | 3300026088 | Bacteria | 15065 |
| 283 | Ga0207641_10007467 | 3300026088 | Bacteria | 9095 |
| 284 | Ga0207641_10008795 | 3300026088 | Bacteria | 8341 |
| 285 | Ga0207676_10000004 | 3300026095 | Bacteria | 725417 |
| 286 | Ga0207676_10000040 | 3300026095 | Bacteria | 167947 |
| 287 | Ga0207676_10004881 | 3300026095 | Bacteria | 9493 |
| 288 | Ga0207676_10007036 | 3300026095 | Bacteria | 7971 |
| 289 | Ga0207674_10017135 | 3300026116 | Bacteria | 7908 |
| 290 | Ga0207674_10129644 | 3300026116 | Bacteria | 2486 |
| 291 | Ga0207674_10161421 | 3300026116 | Bacteria | 2195 |
| 292 | Ga0207674_10289561 | 3300026116 | Bacteria | 1586 |
| 293 | Ga0207675_100000818 | 3300026118 | Bacteria | 30959 |
| 294 | Ga0207683_10000156 | 3300026121 | Bacteria | 57349 |
| 295 | Ga0207698_10000134 | 3300026142 | Bacteria | 46624 |
| 296 | Ga0209589_1000017 | 3300027357 | Bacteria | 215546 |
| 297 | Ga0209489_100018 | 3300027361 | Bacteria | 215546 |
| 298 | Ga0209700_100028 | 3300027363 | Bacteria | 215546 |
| 299 | Ga0209813_10000129 | 3300027866 | Bacteria | 27547 |
| 300 | Ga0209813_10044096 | 3300027866 | Bacteria | 1369 |
| 301 | Ga0268266_10000002 | 3300028379 | Bacteria | 3059047 |
| 302 | Ga0268266_10000058 | 3300028379 | Bacteria | 277346 |
| 303 | Ga0268266_10478692 | 3300028379 | Bacteria | 1186 |
| 304 | Ga0268265_10000002 | 3300028380 | Bacteria | 1035381 |
| 305 | Ga0268265_10000003 | 3300028380 | Bacteria | 949201 |
| 306 | Ga0268265_10000209 | 3300028380 | Bacteria | 68317 |
| 307 | Ga0268265_10067046 | 3300028380 | Bacteria | 2777 |
| 308 | Ga0268264_10001688 | 3300028381 | Bacteria | 20359 |
| 309 | Ga0268264_10035651 | 3300028381 | Bacteria | 4096 |
| 310 | Ga0307517_10036833 | 3300028786 | Bacteria | 5487 |
| 311 | Ga0265327_10021786 | 3300031251 | Bacteria | 3856 |
| 312 | Ga0307513_10047707 | 3300031456 | Bacteria | 4656 |
| 313 | Ga0307513_10106203 | 3300031456 | Bacteria | 2815 |
| 314 | Ga0307509_10039174 | 3300031507 | Bacteria | 5164 |
| 315 | Ga0307516_10000124 | 3300031730 | Bacteria | 90831 |
| 316 | Ga0307405_10000984 | 3300031731 | Bacteria | 11444 |
| 317 | Ga0307405_10041062 | 3300031731 | Bacteria | 2806 |
| 318 | Ga0307405_10324102 | 3300031731 | Bacteria | 1178 |
| 319 | Ga0307413_10193592 | 3300031824 | Bacteria | 1462 |
| 320 | Ga0307410_10015940 | 3300031852 | Bacteria | 4468 |
| 321 | Ga0307410_10091326 | 3300031852 | Bacteria | 2162 |
| 322 | Ga0307410_10126182 | 3300031852 | Bacteria | 1874 |
| 323 | Ga0307410_10138649 | 3300031852 | Bacteria | 1796 |
| 324 | Ga0307407_10005830 | 3300031903 | Bacteria | 5397 |
| 325 | Ga0307412_10001325 | 3300031911 | Bacteria | 13854 |
| 326 | Ga0307412_10008903 | 3300031911 | Bacteria | 5750 |
| 327 | Ga0307412_10197301 | 3300031911 | Bacteria | 1526 |
| 328 | Ga0307409_100096041 | 3300031995 | Bacteria | 2444 |
| 329 | Ga0307416_100021503 | 3300032002 | Bacteria | 4633 |
| 330 | Ga0307416_100073907 | 3300032002 | Bacteria | 2845 |
| 331 | Ga0307414_10031471 | 3300032004 | Bacteria | 3481 |
| 332 | Ga0307414_10037321 | 3300032004 | Bacteria | 3252 |
| 333 | Ga0307414_10070521 | 3300032004 | Bacteria | 2517 |
| 334 | Ga0307414_10094390 | 3300032004 | Bacteria | 2233 |
| 335 | Ga0307411_10001833 | 3300032005 | Bacteria | 9021 |
| 336 | Ga0307411_10031770 | 3300032005 | Bacteria | 3254 |
| 337 | Ga0307411_10044970 | 3300032005 | Bacteria | 2837 |
| 338 | Ga0307510_10006886 | 3300033180 | Bacteria | 13556 |
| 339 | Ga0315911_1000020 | 3300033442 | Bacteria | 139809 |
| 340 | Ga0373948_0026470 | 3300034817 | Bacteria | 1143 |
| 341 | Ga0373940_0007926 | 3300035088 | Bacteria | 2417 |
| 342 | Ga0373931_0001118 | 3300035691 | Bacteria | 11387 |
| 343 | Ga0316584_0073348 | 3300036712 | Bacteria | 2565 |
| 344 | Ga0395899_0064186 | 3300037312 | Bacteria | 2700 |
| 345 | Ga0395899_0159416 | 3300037312 | Bacteria | 1595 |
| 346 | Ga0395900_0104269 | 3300037418 | Bacteria | 2913 |
| 347 | Ga0395898_0034354 | 3300037466 | Bacteria | 5054 |
| 348 | Ga0395898_0042842 | 3300037466 | Bacteria | 4464 |
| 349 | Ga0395901_0005160 | 3300038443 | Bacteria | 13182 |
| 350 | Ga0395901_0033293 | 3300038443 | Bacteria | 5319 |
| 351 | Ga0395901_0059344 | 3300038443 | Bacteria | 3980 |
| 352 | Ga0237819_00447 | 3300038705 | Bacteria | 14029 |
| 353 | Ga0436361_0135420 | 3300039447 | Bacteria | 6667 |
| 354 | Ga0436361_0576321 | 3300039447 | Bacteria | 12801 |
| 355 | Ga0439465_0030902 | 3300041413 | Bacteria | 1705 |
| 356 | Ga0439445_0006434 | 3300042004 | Bacteria | 2699 |
| 357 | Ga0439432_014209 | 3300042006 | Bacteria | 2696 |
| 358 | Ga0451576_0000165 | 3300045051 | Bacteria | 168085 |
| 359 | Ga0466967_0154387 | 3300045976 | Bacteria | 2149 |
| 360 | Ga0495617_002500 | 3300046452 | Bacteria | 7296 |
| 361 | Ga0495627_008481 | 3300046453 | Bacteria | 3850 |
| 362 | Ga0495603_0193295 | 3300046455 | Bacteria | 1176 |
| 363 | Ga0495638_0000228 | 3300046460 | Bacteria | 76924 |
| 364 | Ga0495638_0001229 | 3300046460 | Bacteria | 24256 |
| 365 | Ga0495650_0000116 | 3300046471 | Bacteria | 189814 |
| 366 | Ga0495584_0037041 | 3300046491 | Bacteria | 2464 |
| 367 | Ga0495585_0004302 | 3300046492 | Bacteria | 9272 |
| 368 | Ga0495585_0015835 | 3300046492 | Bacteria | 4377 |
| 369 | Ga0495596_0028573 | 3300046500 | Bacteria | 2238 |
| 370 | Ga0495607_0008283 | 3300046501 | Bacteria | 7111 |
| 371 | Ga0495583_0003091 | 3300046506 | Bacteria | 13172 |
| 372 | Ga0495583_0014370 | 3300046506 | Bacteria | 4372 |
| 373 | Ga0495583_0034938 | 3300046506 | Bacteria | 2404 |
| 374 | Ga0495583_0053120 | 3300046506 | Bacteria | 1840 |
| 375 | Ga0495583_0086829 | 3300046506 | Bacteria | 1352 |
| 376 | Ga0495606_0000121 | 3300046507 | Bacteria | 132126 |
| 377 | Ga0495606_0000365 | 3300046507 | Bacteria | 77476 |
| 378 | Ga0495606_0001372 | 3300046507 | Bacteria | 32946 |
| 379 | Ga0495610_0004208 | 3300046512 | Bacteria | 10737 |
| 380 | Ga0495610_0017650 | 3300046512 | Bacteria | 4062 |
| 381 | Ga0495616_0051592 | 3300046513 | Bacteria | 2051 |
| 382 | Ga0495620_0000536 | 3300046515 | Bacteria | 24289 |
| 383 | Ga0495637_0007355 | 3300046520 | Bacteria | 5466 |
| 384 | Ga0495643_0001259 | 3300046522 | Bacteria | 24272 |
| 385 | Ga0495643_0002379 | 3300046522 | Bacteria | 15027 |
| 386 | Ga0495643_0041793 | 3300046522 | Bacteria | 2499 |
| 387 | Ga0495648_0000501 | 3300046524 | Bacteria | 42180 |
| 388 | Ga0495648_0001353 | 3300046524 | Bacteria | 24233 |
| 389 | Ga0495663_0000193 | 3300046525 | Bacteria | 24289 |
| 390 | Ga0495642_0009352 | 3300046528 | Bacteria | 3752 |
| 391 | Ga0495654_0069363 | 3300046530 | Bacteria | 1674 |
| 392 | Ga0495609_0005047 | 3300046538 | Bacteria | 7051 |
| 393 | Ga0495622_0034265 | 3300046557 | Bacteria | 2369 |
| 394 | Ga0495633_0000776 | 3300046558 | Bacteria | 28552 |
| 395 | Ga0495633_0038327 | 3300046558 | Bacteria | 2290 |
| 396 | Ga0495668_0000056 | 3300046616 | Bacteria | 197862 |
| 397 | Ga0495668_0023575 | 3300046616 | Bacteria | 3507 |
| 398 | Ga0495611_0000463 | 3300046648 | Bacteria | 24283 |
| 399 | Ga0495611_0033612 | 3300046648 | Bacteria | 2263 |
| 400 | Ga0495611_0049659 | 3300046648 | Bacteria | 1888 |
| 401 | Ga0495625_0000595 | 3300046660 | Bacteria | 52588 |
| 402 | Ga0495625_0001838 | 3300046660 | Bacteria | 24245 |
| 403 | Ga0495625_0008265 | 3300046660 | Bacteria | 8898 |
| 404 | Ga0495625_0009806 | 3300046660 | Bacteria | 7968 |
| 405 | Ga0495625_0017249 | 3300046660 | Bacteria | 5653 |
| 406 | Ga0495625_0018777 | 3300046660 | Bacteria | 5386 |
| 407 | Ga0495625_0147406 | 3300046660 | Bacteria | 1584 |
| 408 | Ga0495625_0205716 | 3300046660 | Bacteria | 1296 |
| 409 | Ga0495661_0025676 | 3300046665 | Bacteria | 3803 |
| 410 | Ga0495588_0000706 | 3300046674 | Bacteria | 15412 |
| 411 | Ga0495588_0002067 | 3300046674 | Bacteria | 8593 |
| 412 | Ga0495669_0000011 | 3300046684 | Bacteria | 158720 |
| 413 | Ga0495613_0050162 | 3300046689 | Bacteria | 3078 |
| 414 | Ga0495670_0000275 | 3300046691 | Bacteria | 24200 |
| 415 | Ga0495671_0000711 | 3300046692 | Bacteria | 24060 |
| 416 | Ga0495649_0000872 | 3300046694 | Bacteria | 24220 |
| 417 | Ga0495600_0001508 | 3300046809 | Bacteria | 12912 |
| 418 | Ga0495660_0010535 | 3300046810 | Bacteria | 5379 |
| 419 | Ga0495660_0061970 | 3300046810 | Bacteria | 2006 |
| 420 | Ga0495672_0073377 | 3300047320 | Bacteria | 1930 |
| 421 | Ga0495672_0134131 | 3300047320 | Bacteria | 1300 |
| 422 | Ga0495683_0005583 | 3300047323 | Bacteria | 6974 |
| 423 | Ga0495687_000077 | 3300047443 | Bacteria | 148889 |
| 424 | Ga0495687_000082 | 3300047443 | Bacteria | 147137 |
| 425 | Ga0495687_001242 | 3300047443 | Bacteria | 24296 |
| 426 | Ga0495687_008341 | 3300047443 | Bacteria | 5944 |
| 427 | Ga0495677_0003902 | 3300047445 | Bacteria | 5768 |
| 428 | Ga0495673_0024609 | 3300047469 | Bacteria | 2905 |
| 429 | Ga0495673_0040127 | 3300047469 | Bacteria | 2118 |
| 430 | Ga0495681_0000799 | 3300047470 | Bacteria | 24223 |
| 431 | Ga0495681_0006477 | 3300047470 | Bacteria | 7690 |
| 432 | Ga0495681_0008663 | 3300047470 | Bacteria | 6351 |
| 433 | Ga0495681_0030016 | 3300047470 | Bacteria | 2775 |
| 434 | Ga0495686_0000147 | 3300047472 | Bacteria | 139008 |
| 435 | Ga0495686_0001570 | 3300047472 | Bacteria | 24278 |
| 436 | Ga0495686_0001622 | 3300047472 | Bacteria | 23546 |
| 437 | Ga0495686_0003568 | 3300047472 | Bacteria | 13364 |
| 438 | Ga0495686_0067515 | 3300047472 | Bacteria | 2207 |
| 439 | Ga0496113_0105231 | 3300048916 | Bacteria | 2191 |
| 440 | Ga0496115_0039814 | 3300048918 | Bacteria | 3734 |
| 441 | Ga0496116_0103947 | 3300048919 | Bacteria | 1689 |
| 442 | Ga0496117_0003086 | 3300048920 | Bacteria | 19943 |
| 443 | Ga0496117_0051306 | 3300048920 | Bacteria | 2917 |
| 444 | Ga0496117_0099003 | 3300048920 | Bacteria | 1852 |
| 445 | Ga0496118_0002584 | 3300048921 | Bacteria | 24182 |
| 446 | Ga0496118_0017269 | 3300048921 | Bacteria | 6580 |
| 447 | Ga0496118_0062491 | 3300048921 | Bacteria | 2749 |
| 448 | Ga0496118_0299106 | 3300048921 | Bacteria | 884 |
| 449 | Ga0496119_0047406 | 3300048922 | Bacteria | 2674 |
| 450 | Ga0496119_0095532 | 3300048922 | Bacteria | 1679 |
| 451 | Ga0496120_0060834 | 3300048923 | Bacteria | 2111 |
| 452 | Ga0496121_0000190 | 3300048924 | Bacteria | 136607 |
| 453 | Ga0496121_0010582 | 3300048924 | Bacteria | 10369 |
| 454 | Ga0496121_0013290 | 3300048924 | Bacteria | 8864 |
| 455 | Ga0496121_0096304 | 3300048924 | Bacteria | 2297 |
| 456 | Ga0496121_0163275 | 3300048924 | Bacteria | 1626 |
| 457 | Ga0496123_0002334 | 3300048926 | Bacteria | 23810 |
| 458 | Ga0496123_0030968 | 3300048926 | Bacteria | 3903 |
| 459 | Ga0496123_0077351 | 3300048926 | Bacteria | 2044 |
| 460 | Ga0496125_0000463 | 3300048928 | Bacteria | 72745 |
| 461 | Ga0496126_0002972 | 3300048929 | Bacteria | 22018 |
| 462 | Ga0496126_0013440 | 3300048929 | Bacteria | 8324 |
| 463 | Ga0496126_0070344 | 3300048929 | Bacteria | 3118 |
| 464 | Ga0496126_0140159 | 3300048929 | Bacteria | 2082 |
| 465 | Ga0495678_000995 | 3300049459 | Bacteria | 24253 |
| 466 | Ga0495682_0000603 | 3300049460 | Bacteria | 24205 |
| 467 | Ga0495682_0030271 | 3300049460 | Bacteria | 2003 |
| 468 | Ga0501032_0050124 | 3300049569 | Bacteria | 2816 |
| 469 | Ga0501032_0131814 | 3300049569 | Bacteria | 1649 |
| 470 | Ga0501033_0023605 | 3300049570 | Bacteria | 4639 |
| 471 | Ga0501033_0136317 | 3300049570 | Bacteria | 1776 |
| 472 | Ga0501033_0248595 | 3300049570 | Bacteria | 1261 |
| 473 | Ga0501034_0184628 | 3300049571 | Bacteria | 2049 |
| 474 | Ga0501034_0265915 | 3300049571 | Bacteria | 1657 |
| 475 | Ga0501034_0408676 | 3300049571 | Bacteria | 1280 |
| 476 | Ga0501034_0431734 | 3300049571 | Bacteria | 1237 |
| 477 | Ga0501036_0123915 | 3300049572 | Bacteria | 2183 |
| 478 | Ga0501036_0323605 | 3300049572 | Bacteria | 1288 |
| 479 | Ga0501036_0476341 | 3300049572 | Bacteria | 1039 |
| 480 | Ga0501037_0067361 | 3300049573 | Bacteria | 2607 |
| 481 | Ga0501038_0089212 | 3300049574 | Bacteria | 2587 |
| 482 | Ga0501038_0173094 | 3300049574 | Bacteria | 1746 |
| 483 | Ga0501039_0163210 | 3300049575 | Bacteria | 1752 |
| 484 | Ga0501043_0010983 | 3300049579 | Bacteria | 7094 |
| 485 | Ga0501043_0155563 | 3300049579 | Bacteria | 1788 |
| 486 | Ga0501043_0389889 | 3300049579 | Bacteria | 1053 |
| 487 | Ga0501046_0083791 | 3300049580 | Bacteria | 2460 |
| 488 | Ga0501047_0043282 | 3300049581 | Bacteria | 4349 |
| 489 | Ga0501047_0058666 | 3300049581 | Bacteria | 3717 |
| 490 | Ga0501069_0018652 | 3300049585 | Bacteria | 3746 |
| 491 | Ga0501070_0003797 | 3300049586 | Bacteria | 13053 |
| 492 | Ga0501070_0074329 | 3300049586 | Bacteria | 2813 |
| 493 | Ga0501074_0036478 | 3300049590 | Bacteria | 3561 |
| 494 | Ga0501074_0055525 | 3300049590 | Bacteria | 2854 |
| 495 | Ga0501224_000818 | 3300049664 | Bacteria | 3947 |
| 496 | Ga0501249_000074 | 3300049679 | Bacteria | 34243 |
| 497 | Ga0501080_0007654 | 3300049742 | Bacteria | 9769 |
| 498 | Ga0501080_0021221 | 3300049742 | Bacteria | 6010 |
| 499 | Ga0501080_0158891 | 3300049742 | Bacteria | 2088 |
| 500 | Ga0501080_0236135 | 3300049742 | Bacteria | 1670 |
| 501 | Ga0501083_0017964 | 3300049744 | Bacteria | 4933 |
| 502 | Ga0501282_004189 | 3300049778 | Bacteria | 1544 |
| 503 | Ga0501035_0000806 | 3300049822 | Bacteria | 33416 |
| 504 | Ga0501035_0205362 | 3300049822 | Bacteria | 1688 |
| 505 | Ga0501044_0005415 | 3300049823 | Bacteria | 14179 |
| 506 | Ga0501044_0032390 | 3300049823 | Bacteria | 5496 |
| 507 | Ga0501044_0046648 | 3300049823 | Bacteria | 4485 |
| 508 | Ga0501044_0088059 | 3300049823 | Bacteria | 3135 |
| 509 | Ga0501044_0110069 | 3300049823 | Bacteria | 2763 |
| 510 | Ga0501044_0139349 | 3300049823 | Bacteria | 2415 |
| 511 | Ga0501044_0147813 | 3300049823 | Bacteria | 2334 |
| 512 | Ga0501044_0193600 | 3300049823 | Bacteria | 1994 |
| 513 | Ga0501204_000051 | 3300049850 | Bacteria | 8444 |
| 514 | nmdc:mga03683_14158_c1 | 3300050489 | Bacteria | 2334 |
| 515 | nmdc:mga03683_40441_c1 | 3300050489 | Bacteria | 1912 |
| 516 | nmdc:mga03683_517_c1 | 3300050489 | Bacteria | 11047 |
| 517 | nmdc:mga03n38_2113_c1 | 3300050490 | Bacteria | 6034 |
| 518 | nmdc:mga00v17_3230_c1 | 3300050491 | Bacteria | 8396 |
| 519 | nmdc:mga00v17_8426_c1 | 3300050491 | Bacteria | 5548 |
| 520 | nmdc:mga0yw44_8124_c1 | 3300050492 | Bacteria | 5211 |
| 521 | nmdc:mga06z11_149898_c1 | 3300050494 | Bacteria | 1325 |
| 522 | nmdc:mga06z11_5952_c1 | 3300050494 | Bacteria | 4929 |
| 523 | nmdc:mga04h51_27272_c1 | 3300050495 | Bacteria | 1773 |
| 524 | nmdc:mga04h51_281_c1 | 3300050495 | Bacteria | 13079 |
| 525 | nmdc:mga07m45_17_c1 | 3300050496 | Bacteria | 140936 |
| 526 | nmdc:mga07m45_2586_c2 | 3300050496 | Bacteria | 7812 |
| 527 | nmdc:mga0qj67_43047_c1 | 3300050509 | Bacteria | 3556 |
| 528 | nmdc:mga0qj67_58117_c1 | 3300050509 | Bacteria | 3066 |
| 529 | nmdc:mga0qj67_63234_c1 | 3300050509 | Bacteria | 2943 |
| 530 | nmdc:mga06r32_90277_c1 | 3300050510 | Bacteria | 2993 |
| 531 | nmdc:mga08y16_506733_c1 | 3300050511 | Bacteria | 1226 |
| 532 | nmdc:mga0n895_6895_c1 | 3300050512 | Bacteria | 9704 |
| 533 | nmdc:mga0rr50_7271_c1 | 3300050513 | Bacteria | 6813 |
| 534 | nmdc:mga0a205_4365_c1 | 3300050515 | Bacteria | 12685 |
| 535 | nmdc:mga0sz30_16854_c1 | 3300050516 | Bacteria | 2906 |
| 536 | Ga0495612_0025423 | 3300053078 | Bacteria | 2377 |
| 537 | Ga0500610_0000153 | 3300053079 | Bacteria | 20661 |
| 538 | Ga0495619_0255076 | 3300053085 | Bacteria | 1215 |
| 539 | Ga0500578_0001827 | 3300053086 | Bacteria | 19865 |
| 540 | Ga0500643_000837 | 3300053087 | Bacteria | 19751 |
| 541 | Ga0500643_000962 | 3300053087 | Bacteria | 17881 |
| 542 | Ga0500643_039242 | 3300053087 | Bacteria | 1399 |
| 543 | Ga0500583_0000561 | 3300053092 | Bacteria | 11264 |
| 544 | Ga0500651_0098582 | 3300053093 | Bacteria | 1794 |
| 545 | Ga0500566_0000074 | 3300053094 | Bacteria | 48359 |
| 546 | Ga0500566_0066052 | 3300053094 | Bacteria | 2039 |
| 547 | Ga0500640_021171 | 3300053095 | Bacteria | 2803 |
| 548 | Ga0500555_023414 | 3300053103 | Bacteria | 1771 |
| 549 | Ga0500572_000526 | 3300053111 | Bacteria | 13074 |
| 550 | Ga0500572_002714 | 3300053111 | Bacteria | 4185 |
| 551 | Ga0500592_001253 | 3300053116 | Bacteria | 4135 |
| 552 | Ga0500595_003745 | 3300053119 | Bacteria | 7007 |
| 553 | Ga0500607_000240 | 3300053121 | Bacteria | 51266 |
| 554 | Ga0500608_000196 | 3300053122 | Bacteria | 24244 |
| 555 | Ga0500608_000791 | 3300053122 | Bacteria | 11531 |
| 556 | Ga0500608_034797 | 3300053122 | Bacteria | 2400 |
| 557 | Ga0500618_000598 | 3300053125 | Bacteria | 22218 |
| 558 | Ga0500618_030124 | 3300053125 | Bacteria | 1278 |
| 559 | Ga0500658_0001895 | 3300053134 | Bacteria | 8205 |
| 560 | Ga0500559_0001740 | 3300053136 | Bacteria | 11945 |
| 561 | Ga0500559_0051429 | 3300053136 | Bacteria | 1819 |
| 562 | Ga0500564_002564 | 3300053138 | Bacteria | 6763 |
| 563 | Ga0500574_000039 | 3300053141 | Bacteria | 16536 |
| 564 | Ga0500588_0027186 | 3300053146 | Bacteria | 1609 |
| 565 | Ga0500590_081792 | 3300053148 | Bacteria | 1585 |
| 566 | Ga0500603_000030 | 3300053150 | Bacteria | 34154 |
| 567 | Ga0500616_0001447 | 3300053153 | Bacteria | 22718 |
| 568 | Ga0500616_0010848 | 3300053153 | Bacteria | 5431 |
| 569 | Ga0500619_001406 | 3300053154 | Bacteria | 4248 |
| 570 | Ga0500627_0004340 | 3300053158 | Bacteria | 4538 |
| 571 | Ga0500630_003168 | 3300053159 | Bacteria | 7958 |
| 572 | Ga0500638_019537 | 3300053162 | Bacteria | 3178 |
| 573 | Ga0500639_000047 | 3300053163 | Bacteria | 57835 |
| 574 | Ga0500639_029497 | 3300053163 | Bacteria | 2900 |
| 575 | Ga0500636_0000549 | 3300053177 | Bacteria | 20436 |
| 576 | Ga0500636_0060436 | 3300053177 | Bacteria | 2212 |
| 577 | Ga0500567_000952 | 3300053723 | Bacteria | 11069 |
| 578 | Ga0500567_033554 | 3300053723 | Bacteria | 2420 |
| 579 | Ga0500576_073676 | 3300053725 | Bacteria | 1461 |
| 580 | Ga0500625_000009 | 3300053729 | Bacteria | 159296 |
| 581 | Ga0500645_000001 | 3300053730 | Bacteria | 455558 |
| 582 | Ga0500596_002505 | 3300053735 | Bacteria | 3621 |
| 583 | Ga0500596_003353 | 3300053735 | Bacteria | 3058 |
| 584 | Ga0500587_001697 | 3300053739 | Bacteria | 3132 |
| 585 | Ga0501084_0100347 | 3300054114 | Bacteria | 2431 |
| 586 | Ga0500661_016382 | 3300055283 | Bacteria | 1326 |
| 587 | Ga0501082_0062116 | 3300060353 | Bacteria | 3215 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048921 | Ga0496118_0299106 | Ga0496118_0299106_43_858 | 252 |
| 2 | 3300050511 | nmdc:mga08y16_506733_c1 | nmdc:mga08y16_506733_c1_42_908 | 253 |
| 3 | 3300049570 | Ga0501033_0136317 | Ga0501033_0136317_896_1759 | 270 |
| 4 | 3300032004 | Ga0307414_10031471 | Ga0307414_100314714 | 277 |
| 5 | 3300005983 | Ga0081540_1024709 | Ga0081540_10247092 | 285 |
| 6 | 3300049579 | Ga0501043_0389889 | Ga0501043_0389889_20_889 | 288 |
| 7 | 3300046455 | Ga0495603_0193295 | Ga0495603_0193295_80_1006 | 289 |
| 8 | 3300006881 | Ga0068865_100021672 | Ga0068865_1000216726 | 294 |
| 9 | 3300005842 | Ga0068858_100214795 | Ga0068858_1002147953 | 296 |
| 10 | 3300025900 | Ga0207710_10039423 | Ga0207710_100394233 | 296 |
| 11 | 3300005983 | Ga0081540_1000165 | Ga0081540_100016527 | 298 |
| 12 | 3300006871 | Ga0075434_100001535 | Ga0075434_1000015354 | 298 |
| 13 | 3300007076 | Ga0075435_100055003 | Ga0075435_1000550031 | 298 |
| 14 | 3300009094 | Ga0111539_10020045 | Ga0111539_100200458 | 298 |
| 15 | 3300035088 | Ga0373940_0007926 | Ga0373940_0007926_1151_2152 | 298 |
| 16 | 3300035691 | Ga0373931_0001118 | Ga0373931_0001118_8598_9599 | 298 |
| 17 | 3300050512 | nmdc:mga0n895_6895_c1 | nmdc:mga0n895_6895_c1_924_1925 | 298 |
| 18 | 3300050513 | nmdc:mga0rr50_7271_c1 | nmdc:mga0rr50_7271_c1_3250_4251 | 298 |
| 19 | 3300050515 | nmdc:mga0a205_4365_c1 | nmdc:mga0a205_4365_c1_3702_4703 | 298 |
| 20 | 3300046660 | Ga0495625_0147406 | Ga0495625_0147406_632_1570 | 299 |
| 21 | 3300003759 | Ga0055525_1000248 | Ga0055525_100024820 | 300 |
| 22 | 3300025230 | Ga0209563_100066 | Ga0209563_10006647 | 300 |
| 23 | 3300034817 | Ga0373948_0026470 | Ga0373948_0026470_72_1079 | 300 |
| 24 | 3300003762 | Ga0055542_1000040 | Ga0055542_100004052 | 302 |
| 25 | 3300003763 | Ga0055529_1000037 | Ga0055529_1000037169 | 302 |
| 26 | 3300025254 | Ga0209148_1000011 | Ga0209148_1000011949 | 302 |
| 27 | 3300025272 | Ga0209455_1000006 | Ga0209455_1000006243 | 302 |
| 28 | 3300049571 | Ga0501034_0265915 | Ga0501034_0265915_734_1645 | 302 |
| 29 | 3300048921 | Ga0496118_0062491 | Ga0496118_0062491_279_1280 | 304 |
| 30 | 3300048924 | Ga0496121_0096304 | Ga0496121_0096304_889_1890 | 304 |
| 31 | 3300049572 | Ga0501036_0323605 | Ga0501036_0323605_319_1269 | 304 |
| 32 | 3300049580 | Ga0501046_0083791 | Ga0501046_0083791_899_1912 | 304 |
| 33 | 3300049581 | Ga0501047_0043282 | Ga0501047_0043282_2249_3262 | 304 |
| 34 | 3300049586 | Ga0501070_0074329 | Ga0501070_0074329_253_1266 | 304 |
| 35 | 3300049590 | Ga0501074_0055525 | Ga0501074_0055525_1564_2577 | 304 |
| 36 | 3300049742 | Ga0501080_0021221 | Ga0501080_0021221_1580_2593 | 304 |
| 37 | 3300046492 | Ga0495585_0004302 | Ga0495585_0004302_3867_4877 | 305 |
| 38 | 3300046522 | Ga0495643_0041793 | Ga0495643_0041793_788_1798 | 305 |
| 39 | 3300046660 | Ga0495625_0000595 | Ga0495625_0000595_46152_47162 | 305 |
| 40 | 3300046528 | Ga0495642_0009352 | Ga0495642_0009352_279_1289 | 306 |
| 41 | 3300047445 | Ga0495677_0003902 | Ga0495677_0003902_3483_4493 | 306 |
| 42 | 3300047470 | Ga0495681_0006477 | Ga0495681_0006477_543_1553 | 306 |
| 43 | 3300006186 | Ga0075369_10017848 | Ga0075369_100178482 | 307 |
| 44 | 3300006942 | Ga0099824_1001145 | Ga0099824_100114529 | 307 |
| 45 | 3300006943 | Ga0099822_1000135 | Ga0099822_100013530 | 307 |
| 46 | 3300025272 | Ga0209455_1015969 | Ga0209455_10159692 | 307 |
| 47 | 3300027357 | Ga0209589_1000017 | Ga0209589_1000017122 | 307 |
| 48 | 3300027361 | Ga0209489_100018 | Ga0209489_100018122 | 307 |
| 49 | 3300027363 | Ga0209700_100028 | Ga0209700_100028122 | 307 |
| 50 | 3300050516 | nmdc:mga0sz30_16854_c1 | nmdc:mga0sz30_16854_c1_695_1699 | 307 |
| 51 | 3300002244 | JGI24742J22300_10000498 | JGI24742J22300_100004989 | 308 |
| 52 | 3300005356 | Ga0070674_100000638 | Ga0070674_1000006386 | 308 |
| 53 | 3300005364 | Ga0070673_100114741 | Ga0070673_1001147412 | 308 |
| 54 | 3300005456 | Ga0070678_100000022 | Ga0070678_10000002239 | 308 |
| 55 | 3300009148 | Ga0105243_10000223 | Ga0105243_1000022357 | 308 |
| 56 | 3300025935 | Ga0207709_10000078 | Ga0207709_1000007857 | 308 |
| 57 | 3300025937 | Ga0207669_10000105 | Ga0207669_1000010526 | 308 |
| 58 | 3300025960 | Ga0207651_10108306 | Ga0207651_101083064 | 308 |
| 59 | 3300026121 | Ga0207683_10000156 | Ga0207683_1000015622 | 308 |
| 60 | 3300025933 | Ga0207706_10045905 | Ga0207706_100459052 | 309 |
| 61 | 3300046558 | Ga0495633_0000776 | Ga0495633_0000776_4568_5578 | 309 |
| 62 | 3300046648 | Ga0495611_0049659 | Ga0495611_0049659_243_1253 | 309 |
| 63 | 3300047323 | Ga0495683_0005583 | Ga0495683_0005583_739_1749 | 309 |
| 64 | 3300048916 | Ga0496113_0105231 | Ga0496113_0105231_704_1714 | 309 |
| 65 | 3300048926 | Ga0496123_0077351 | Ga0496123_0077351_393_1403 | 309 |
| 66 | 3300048928 | Ga0496125_0000463 | Ga0496125_0000463_26471_27481 | 309 |
| 67 | 3300009093 | Ga0105240_10071202 | Ga0105240_100712024 | 310 |
| 68 | 3300048918 | Ga0496115_0039814 | Ga0496115_0039814_1929_2912 | 310 |
| 69 | 3300005339 | Ga0070660_100083657 | Ga0070660_1000836571 | 311 |
| 70 | 3300005355 | Ga0070671_100204743 | Ga0070671_1002047432 | 311 |
| 71 | 3300005366 | Ga0070659_100202973 | Ga0070659_1002029731 | 311 |
| 72 | 3300005539 | Ga0068853_100287715 | Ga0068853_1002877151 | 311 |
| 73 | 3300005563 | Ga0068855_100047788 | Ga0068855_1000477882 | 311 |
| 74 | 3300005577 | Ga0068857_100186931 | Ga0068857_1001869312 | 311 |
| 75 | 3300005937 | Ga0081455_10047844 | Ga0081455_100478442 | 311 |
| 76 | 3300005983 | Ga0081540_1004986 | Ga0081540_10049869 | 311 |
| 77 | 3300010375 | Ga0105239_10359976 | Ga0105239_103599762 | 311 |
| 78 | 3300013105 | Ga0157369_10065800 | Ga0157369_100658006 | 311 |
| 79 | 3300017792 | Ga0163161_10198751 | Ga0163161_101987512 | 311 |
| 80 | 3300025919 | Ga0207657_10025733 | Ga0207657_100257332 | 311 |
| 81 | 3300025925 | Ga0207650_10035633 | Ga0207650_100356335 | 311 |
| 82 | 3300025932 | Ga0207690_10011749 | Ga0207690_100117492 | 311 |
| 83 | 3300025981 | Ga0207640_10163045 | Ga0207640_101630452 | 311 |
| 84 | 3300026041 | Ga0207639_10117282 | Ga0207639_101172822 | 311 |
| 85 | 3300026116 | Ga0207674_10289561 | Ga0207674_102895612 | 311 |
| 86 | 3300046506 | Ga0495583_0034938 | Ga0495583_0034938_756_1766 | 311 |
| 87 | 3300046524 | Ga0495648_0000501 | Ga0495648_0000501_26537_27547 | 311 |
| 88 | 3300046660 | Ga0495625_0018777 | Ga0495625_0018777_1548_2558 | 311 |
| 89 | 3300047470 | Ga0495681_0030016 | Ga0495681_0030016_1512_2522 | 311 |
| 90 | 3300049571 | Ga0501034_0431734 | Ga0501034_0431734_75_1076 | 311 |
| 91 | 3300053094 | Ga0500566_0000074 | Ga0500566_0000074_18068_19051 | 311 |
| 92 | 3300053095 | Ga0500640_021171 | Ga0500640_021171_816_1799 | 311 |
| 93 | 3300053111 | Ga0500572_002714 | Ga0500572_002714_176_1159 | 311 |
| 94 | 3300053150 | Ga0500603_000030 | Ga0500603_000030_2440_3423 | 311 |
| 95 | 3300053159 | Ga0500630_003168 | Ga0500630_003168_4659_5642 | 311 |
| 96 | 3300053162 | Ga0500638_019537 | Ga0500638_019537_734_1717 | 311 |
| 97 | 3300053163 | Ga0500639_000047 | Ga0500639_000047_47513_48496 | 311 |
| 98 | 3300053739 | Ga0500587_001697 | Ga0500587_001697_11_946 | 311 |
| 99 | 3300055283 | Ga0500661_016382 | Ga0500661_016382_11_994 | 311 |
| 100 | 3300046500 | Ga0495596_0028573 | Ga0495596_0028573_251_1261 | 312 |
| 101 | 3300046660 | Ga0495625_0017249 | Ga0495625_0017249_4614_5624 | 312 |
| 102 | 3300053153 | Ga0500616_0001447 | Ga0500616_0001447_8125_9120 | 312 |
| 103 | 3300037466 | Ga0395898_0042842 | Ga0395898_0042842_886_1887 | 313 |
| 104 | 3300005356 | Ga0070674_100035455 | Ga0070674_1000354552 | 314 |
| 105 | 3300025901 | Ga0207688_10099229 | Ga0207688_100992292 | 314 |
| 106 | 3300025937 | Ga0207669_10000393 | Ga0207669_1000039320 | 314 |
| 107 | 3300046507 | Ga0495606_0000365 | Ga0495606_0000365_5118_6128 | 314 |
| 108 | 3300049823 | Ga0501044_0110069 | Ga0501044_0110069_1186_2196 | 314 |
| 109 | 3300053111 | Ga0500572_000526 | Ga0500572_000526_7278_8288 | 314 |
| 110 | 3300053136 | Ga0500559_0001740 | Ga0500559_0001740_1116_2126 | 314 |
| 111 | 3300053163 | Ga0500639_029497 | Ga0500639_029497_581_1591 | 314 |
| 112 | 3300053725 | Ga0500576_073676 | Ga0500576_073676_406_1416 | 314 |
| 113 | 3300053735 | Ga0500596_002505 | Ga0500596_002505_677_1687 | 314 |
| 114 | 3300005293 | Ga0065715_10130045 | Ga0065715_101300452 | 315 |
| 115 | 3300005327 | Ga0070658_10138276 | Ga0070658_101382763 | 315 |
| 116 | 3300005457 | Ga0070662_100036221 | Ga0070662_1000362213 | 315 |
| 117 | 3300005539 | Ga0068853_100110663 | Ga0068853_1001106633 | 315 |
| 118 | 3300005564 | Ga0070664_100048559 | Ga0070664_1000485593 | 315 |
| 119 | 3300009098 | Ga0105245_10277996 | Ga0105245_102779961 | 315 |
| 120 | 3300009177 | Ga0105248_10182355 | Ga0105248_101823552 | 315 |
| 121 | 3300048920 | Ga0496117_0051306 | Ga0496117_0051306_1560_2564 | 315 |
| 122 | 3300048922 | Ga0496119_0047406 | Ga0496119_0047406_325_1329 | 315 |
| 123 | 3300048924 | Ga0496121_0000190 | Ga0496121_0000190_67052_68056 | 315 |
| 124 | 3300048929 | Ga0496126_0013440 | Ga0496126_0013440_4962_5966 | 315 |
| 125 | 3300005335 | Ga0070666_10136590 | Ga0070666_101365902 | 316 |
| 126 | 3300005617 | Ga0068859_100015406 | Ga0068859_1000154064 | 316 |
| 127 | 3300005842 | Ga0068858_100001051 | Ga0068858_1000010518 | 316 |
| 128 | 3300006931 | Ga0097620_100015406 | Ga0097620_1000154064 | 316 |
| 129 | 3300009551 | Ga0105238_10024694 | Ga0105238_100246943 | 316 |
| 130 | 3300025903 | Ga0207680_10305983 | Ga0207680_103059831 | 316 |
| 131 | 3300026035 | Ga0207703_10005193 | Ga0207703_100051934 | 316 |
| 132 | 3300031852 | Ga0307410_10015940 | Ga0307410_100159404 | 316 |
| 133 | 3300032005 | Ga0307411_10001833 | Ga0307411_100018334 | 316 |
| 134 | 3300039447 | Ga0436361_0576321 | Ga0436361_0576321_11533_12540 | 316 |
| 135 | 3300046616 | Ga0495668_0000056 | Ga0495668_0000056_13470_14480 | 316 |
| 136 | 3300047469 | Ga0495673_0024609 | Ga0495673_0024609_301_1311 | 316 |
| 137 | 3300047472 | Ga0495686_0000147 | Ga0495686_0000147_105122_106132 | 316 |
| 138 | 3300049572 | Ga0501036_0476341 | Ga0501036_0476341_77_1027 | 316 |
| 139 | 3300005329 | Ga0070683_100056792 | Ga0070683_1000567923 | 317 |
| 140 | 3300005344 | Ga0070661_100061805 | Ga0070661_1000618052 | 317 |
| 141 | 3300005535 | Ga0070684_100016945 | Ga0070684_1000169455 | 317 |
| 142 | 3300005564 | Ga0070664_100074157 | Ga0070664_1000741574 | 317 |
| 143 | 3300005578 | Ga0068854_100010375 | Ga0068854_1000103758 | 317 |
| 144 | 3300005614 | Ga0068856_100012002 | Ga0068856_1000120025 | 317 |
| 145 | 3300006178 | Ga0075367_10010625 | Ga0075367_100106253 | 317 |
| 146 | 3300010375 | Ga0105239_10060857 | Ga0105239_100608575 | 317 |
| 147 | 3300013100 | Ga0157373_10010676 | Ga0157373_100106766 | 317 |
| 148 | 3300013102 | Ga0157371_10038953 | Ga0157371_100389534 | 317 |
| 149 | 3300013105 | Ga0157369_10054508 | Ga0157369_100545084 | 317 |
| 150 | 3300013105 | Ga0157369_10300426 | Ga0157369_103004263 | 317 |
| 151 | 3300025920 | Ga0207649_10034494 | Ga0207649_100344945 | 317 |
| 152 | 3300025944 | Ga0207661_10055952 | Ga0207661_100559524 | 317 |
| 153 | 3300025945 | Ga0207679_10014287 | Ga0207679_100142873 | 317 |
| 154 | 3300025945 | Ga0207679_10048575 | Ga0207679_100485754 | 317 |
| 155 | 3300025981 | Ga0207640_10057376 | Ga0207640_100573763 | 317 |
| 156 | 3300026041 | Ga0207639_10120358 | Ga0207639_101203582 | 317 |
| 157 | 3300026078 | Ga0207702_10011567 | Ga0207702_100115676 | 317 |
| 158 | 3300037418 | Ga0395900_0104269 | Ga0395900_0104269_179_1180 | 317 |
| 159 | 3300037466 | Ga0395898_0034354 | Ga0395898_0034354_3318_4325 | 317 |
| 160 | 3300038443 | Ga0395901_0059344 | Ga0395901_0059344_2781_3788 | 317 |
| 161 | 3300038705 | Ga0237819_00447 | Ga0237819_00447_3166_4170 | 317 |
| 162 | 3300048924 | Ga0496121_0013290 | Ga0496121_0013290_5581_6588 | 317 |
| 163 | 3300048926 | Ga0496123_0030968 | Ga0496123_0030968_1576_2583 | 317 |
| 164 | 3300049823 | Ga0501044_0046648 | Ga0501044_0046648_2610_3614 | 317 |
| 165 | 3300050494 | nmdc:mga06z11_149898_c1 | nmdc:mga06z11_149898_c1_35_1045 | 317 |
| 166 | 3300002076 | JGI24749J21850_1000021 | JGI24749J21850_100002117 | 318 |
| 167 | 3300002459 | JGI24751J29686_10000778 | JGI24751J29686_100007784 | 318 |
| 168 | 3300005295 | Ga0065707_10082787 | Ga0065707_1008278711 | 318 |
| 169 | 3300005331 | Ga0070670_100000031 | Ga0070670_10000003134 | 318 |
| 170 | 3300005347 | Ga0070668_100261563 | Ga0070668_1002615632 | 318 |
| 171 | 3300005353 | Ga0070669_100000015 | Ga0070669_100000015141 | 318 |
| 172 | 3300005367 | Ga0070667_100000396 | Ga0070667_10000039643 | 318 |
| 173 | 3300005548 | Ga0070665_100000023 | Ga0070665_100000023194 | 318 |
| 174 | 3300005617 | Ga0068859_100015675 | Ga0068859_1000156754 | 318 |
| 175 | 3300005618 | Ga0068864_100000248 | Ga0068864_10000024834 | 318 |
| 176 | 3300005719 | Ga0068861_100019313 | Ga0068861_1000193132 | 318 |
| 177 | 3300005844 | Ga0068862_100000006 | Ga0068862_100000006188 | 318 |
| 178 | 3300005983 | Ga0081540_1065550 | Ga0081540_10655502 | 318 |
| 179 | 3300006931 | Ga0097620_100015675 | Ga0097620_1000156754 | 318 |
| 180 | 3300009093 | Ga0105240_10462003 | Ga0105240_104620032 | 318 |
| 181 | 3300009177 | Ga0105248_10000066 | Ga0105248_10000066101 | 318 |
| 182 | 3300009553 | Ga0105249_10119925 | Ga0105249_101199252 | 318 |
| 183 | 3300014325 | Ga0163163_10024188 | Ga0163163_100241882 | 318 |
| 184 | 3300014326 | Ga0157380_10000124 | Ga0157380_1000012410 | 318 |
| 185 | 3300025302 | Ga0207426_1015349 | Ga0207426_10153494 | 318 |
| 186 | 3300025923 | Ga0207681_10000001 | Ga0207681_10000001863 | 318 |
| 187 | 3300025925 | Ga0207650_10000055 | Ga0207650_1000005534 | 318 |
| 188 | 3300025941 | Ga0207711_10002672 | Ga0207711_100026729 | 318 |
| 189 | 3300025986 | Ga0207658_10002544 | Ga0207658_1000254411 | 318 |
| 190 | 3300026095 | Ga0207676_10000004 | Ga0207676_10000004133 | 318 |
| 191 | 3300026116 | Ga0207674_10161421 | Ga0207674_101614213 | 318 |
| 192 | 3300026118 | Ga0207675_100000818 | Ga0207675_10000081813 | 318 |
| 193 | 3300028379 | Ga0268266_10000002 | Ga0268266_100000021284 | 318 |
| 194 | 3300028380 | Ga0268265_10000002 | Ga0268265_10000002913 | 318 |
| 195 | 3300031852 | Ga0307410_10126182 | Ga0307410_101261822 | 318 |
| 196 | 3300032004 | Ga0307414_10070521 | Ga0307414_100705212 | 318 |
| 197 | 3300046471 | Ga0495650_0000116 | Ga0495650_0000116_11046_12059 | 318 |
| 198 | 3300046506 | Ga0495583_0003091 | Ga0495583_0003091_1079_2092 | 318 |
| 199 | 3300046522 | Ga0495643_0002379 | Ga0495643_0002379_9050_10060 | 318 |
| 200 | 3300046809 | Ga0495600_0001508 | Ga0495600_0001508_8425_9438 | 318 |
| 201 | 3300047443 | Ga0495687_000082 | Ga0495687_000082_53126_54139 | 318 |
| 202 | 3300053085 | Ga0495619_0255076 | Ga0495619_0255076_168_1190 | 318 |
| 203 | 3300053119 | Ga0500595_003745 | Ga0500595_003745_4956_5969 | 318 |
| 204 | 3300053154 | Ga0500619_001406 | Ga0500619_001406_3075_4088 | 318 |
| 205 | 3300053177 | Ga0500636_0000549 | Ga0500636_0000549_14048_15061 | 318 |
| 206 | 3300053735 | Ga0500596_003353 | Ga0500596_003353_964_1977 | 318 |
| 207 | 3300005618 | Ga0068864_100001303 | Ga0068864_10000130312 | 319 |
| 208 | 3300005841 | Ga0068863_100005967 | Ga0068863_1000059676 | 319 |
| 209 | 3300005843 | Ga0068860_100008843 | Ga0068860_1000088434 | 319 |
| 210 | 3300006038 | Ga0075365_10009177 | Ga0075365_100091776 | 319 |
| 211 | 3300006042 | Ga0075368_10064201 | Ga0075368_100642011 | 319 |
| 212 | 3300006051 | Ga0075364_10025783 | Ga0075364_100257833 | 319 |
| 213 | 3300006177 | Ga0075362_10047535 | Ga0075362_100475352 | 319 |
| 214 | 3300012513 | Ga0157326_1000881 | Ga0157326_10008815 | 319 |
| 215 | 3300014325 | Ga0163163_10011709 | Ga0163163_100117093 | 319 |
| 216 | 3300014968 | Ga0157379_10002599 | Ga0157379_100025998 | 319 |
| 217 | 3300026088 | Ga0207641_10007467 | Ga0207641_100074673 | 319 |
| 218 | 3300026095 | Ga0207676_10007036 | Ga0207676_100070362 | 319 |
| 219 | 3300027866 | Ga0209813_10044096 | Ga0209813_100440961 | 319 |
| 220 | 3300031251 | Ga0265327_10021786 | Ga0265327_100217863 | 319 |
| 221 | 3300031456 | Ga0307513_10047707 | Ga0307513_100477073 | 319 |
| 222 | 3300031995 | Ga0307409_100096041 | Ga0307409_1000960412 | 319 |
| 223 | 3300032004 | Ga0307414_10094390 | Ga0307414_100943902 | 319 |
| 224 | 3300032005 | Ga0307411_10031770 | Ga0307411_100317704 | 319 |
| 225 | 3300038443 | Ga0395901_0033293 | Ga0395901_0033293_3649_4662 | 319 |
| 226 | 3300047320 | Ga0495672_0134131 | Ga0495672_0134131_115_1116 | 319 |
| 227 | 3300048929 | Ga0496126_0002972 | Ga0496126_0002972_3901_4908 | 319 |
| 228 | 3300049572 | Ga0501036_0123915 | Ga0501036_0123915_901_1905 | 319 |
| 229 | 3300049823 | Ga0501044_0088059 | Ga0501044_0088059_260_1264 | 319 |
| 230 | 3300050489 | nmdc:mga03683_40441_c1 | nmdc:mga03683_40441_c1_329_1342 | 319 |
| 231 | 3300050491 | nmdc:mga00v17_8426_c1 | nmdc:mga00v17_8426_c1_4106_5119 | 319 |
| 232 | 3300050492 | nmdc:mga0yw44_8124_c1 | nmdc:mga0yw44_8124_c1_2222_3235 | 319 |
| 233 | 3300050495 | nmdc:mga04h51_27272_c1 | nmdc:mga04h51_27272_c1_288_1301 | 319 |
| 234 | 3300053078 | Ga0495612_0025423 | Ga0495612_0025423_644_1654 | 319 |
| 235 | 3300053087 | Ga0500643_039242 | Ga0500643_039242_218_1222 | 319 |
| 236 | 3300005327 | Ga0070658_10033562 | Ga0070658_100335622 | 320 |
| 237 | 3300005336 | Ga0070680_100011597 | Ga0070680_1000115975 | 320 |
| 238 | 3300005339 | Ga0070660_100006530 | Ga0070660_1000065307 | 320 |
| 239 | 3300005344 | Ga0070661_100001494 | Ga0070661_1000014943 | 320 |
| 240 | 3300005366 | Ga0070659_100013228 | Ga0070659_1000132284 | 320 |
| 241 | 3300005434 | Ga0070709_10003317 | Ga0070709_100033176 | 320 |
| 242 | 3300005435 | Ga0070714_100051302 | Ga0070714_1000513021 | 320 |
| 243 | 3300005436 | Ga0070713_100000447 | Ga0070713_10000044718 | 320 |
| 244 | 3300005437 | Ga0070710_10001414 | Ga0070710_100014149 | 320 |
| 245 | 3300005439 | Ga0070711_100020818 | Ga0070711_1000208183 | 320 |
| 246 | 3300005457 | Ga0070662_100025275 | Ga0070662_1000252752 | 320 |
| 247 | 3300005530 | Ga0070679_100012918 | Ga0070679_1000129187 | 320 |
| 248 | 3300005539 | Ga0068853_100194169 | Ga0068853_1001941692 | 320 |
| 249 | 3300005563 | Ga0068855_100061805 | Ga0068855_1000618054 | 320 |
| 250 | 3300005614 | Ga0068856_100009932 | Ga0068856_10000993211 | 320 |
| 251 | 3300006028 | Ga0070717_10020113 | Ga0070717_100201131 | 320 |
| 252 | 3300006163 | Ga0070715_10000915 | Ga0070715_100009155 | 320 |
| 253 | 3300006173 | Ga0070716_100007776 | Ga0070716_1000077762 | 320 |
| 254 | 3300006175 | Ga0070712_100005054 | Ga0070712_1000050547 | 320 |
| 255 | 3300013102 | Ga0157371_10011311 | Ga0157371_100113116 | 320 |
| 256 | 3300013104 | Ga0157370_10032697 | Ga0157370_100326972 | 320 |
| 257 | 3300013307 | Ga0157372_10032556 | Ga0157372_100325565 | 320 |
| 258 | 3300025261 | Ga0209233_1022037 | Ga0209233_10220373 | 320 |
| 259 | 3300025898 | Ga0207692_10001959 | Ga0207692_100019597 | 320 |
| 260 | 3300025906 | Ga0207699_10001027 | Ga0207699_100010274 | 320 |
| 261 | 3300025909 | Ga0207705_10046995 | Ga0207705_100469952 | 320 |
| 262 | 3300025912 | Ga0207707_10036783 | Ga0207707_100367832 | 320 |
| 263 | 3300025915 | Ga0207693_10000774 | Ga0207693_1000077418 | 320 |
| 264 | 3300025916 | Ga0207663_10000645 | Ga0207663_1000064512 | 320 |
| 265 | 3300025917 | Ga0207660_10035201 | Ga0207660_100352014 | 320 |
| 266 | 3300025919 | Ga0207657_10018158 | Ga0207657_100181586 | 320 |
| 267 | 3300025920 | Ga0207649_10111957 | Ga0207649_101119572 | 320 |
| 268 | 3300025921 | Ga0207652_10010007 | Ga0207652_100100078 | 320 |
| 269 | 3300025921 | Ga0207652_10140975 | Ga0207652_101409752 | 320 |
| 270 | 3300025929 | Ga0207664_10007783 | Ga0207664_100077837 | 320 |
| 271 | 3300025932 | Ga0207690_10022480 | Ga0207690_100224805 | 320 |
| 272 | 3300025933 | Ga0207706_10001953 | Ga0207706_100019532 | 320 |
| 273 | 3300025939 | Ga0207665_10000289 | Ga0207665_1000028918 | 320 |
| 274 | 3300025944 | Ga0207661_10005344 | Ga0207661_100053442 | 320 |
| 275 | 3300025949 | Ga0207667_10028799 | Ga0207667_100287994 | 320 |
| 276 | 3300026041 | Ga0207639_10005058 | Ga0207639_100050583 | 320 |
| 277 | 3300026078 | Ga0207702_10157780 | Ga0207702_101577802 | 320 |
| 278 | 3300026116 | Ga0207674_10017135 | Ga0207674_100171358 | 320 |
| 279 | 3300046507 | Ga0495606_0000121 | Ga0495606_0000121_81783_82790 | 320 |
| 280 | 3300046507 | Ga0495606_0001372 | Ga0495606_0001372_24152_25159 | 320 |
| 281 | 3300046616 | Ga0495668_0023575 | Ga0495668_0023575_755_1765 | 320 |
| 282 | 3300047472 | Ga0495686_0001622 | Ga0495686_0001622_2987_3994 | 320 |
| 283 | 3300049742 | Ga0501080_0236135 | Ga0501080_0236135_252_1259 | 320 |
| 284 | 3300049744 | Ga0501083_0017964 | Ga0501083_0017964_2734_3741 | 320 |
| 285 | 3300060353 | Ga0501082_0062116 | Ga0501082_0062116_1122_2129 | 320 |
| 286 | 3300003215 | JGI25153J46596_10000008 | JGI25153J46596_10000008214 | 321 |
| 287 | 3300005347 | Ga0070668_100039301 | Ga0070668_1000393015 | 321 |
| 288 | 3300006177 | Ga0075362_10023271 | Ga0075362_100232712 | 321 |
| 289 | 3300013102 | Ga0157371_10067603 | Ga0157371_100676035 | 321 |
| 290 | 3300025297 | Ga0209758_1000017 | Ga0209758_1000017572 | 321 |
| 291 | 3300025972 | Ga0207668_10008869 | Ga0207668_1000886912 | 321 |
| 292 | 3300041413 | Ga0439465_0030902 | Ga0439465_0030902_288_1298 | 321 |
| 293 | 3300050489 | nmdc:mga03683_14158_c1 | nmdc:mga03683_14158_c1_681_1679 | 321 |
| 294 | 3300050491 | nmdc:mga00v17_3230_c1 | nmdc:mga00v17_3230_c1_6859_7857 | 321 |
| 295 | 3300005347 | Ga0070668_100172710 | Ga0070668_1001727102 | 322 |
| 296 | 3300005530 | Ga0070679_100052119 | Ga0070679_1000521192 | 322 |
| 297 | 3300025921 | Ga0207652_10038671 | Ga0207652_100386712 | 322 |
| 298 | 3300037312 | Ga0395899_0064186 | Ga0395899_0064186_1182_2192 | 322 |
| 299 | 3300046453 | Ga0495627_008481 | Ga0495627_008481_977_1984 | 322 |
| 300 | 3300046460 | Ga0495638_0000228 | Ga0495638_0000228_43271_44278 | 322 |
| 301 | 3300046501 | Ga0495607_0008283 | Ga0495607_0008283_434_1441 | 322 |
| 302 | 3300046506 | Ga0495583_0086829 | Ga0495583_0086829_30_1037 | 322 |
| 303 | 3300046512 | Ga0495610_0017650 | Ga0495610_0017650_2551_3558 | 322 |
| 304 | 3300046520 | Ga0495637_0007355 | Ga0495637_0007355_3209_4216 | 322 |
| 305 | 3300046538 | Ga0495609_0005047 | Ga0495609_0005047_5847_6854 | 322 |
| 306 | 3300046557 | Ga0495622_0034265 | Ga0495622_0034265_148_1155 | 322 |
| 307 | 3300046558 | Ga0495633_0038327 | Ga0495633_0038327_473_1480 | 322 |
| 308 | 3300046660 | Ga0495625_0008265 | Ga0495625_0008265_5875_6882 | 322 |
| 309 | 3300046674 | Ga0495588_0000706 | Ga0495588_0000706_5371_6378 | 322 |
| 310 | 3300047443 | Ga0495687_008341 | Ga0495687_008341_3341_4348 | 322 |
| 311 | 3300047469 | Ga0495673_0040127 | Ga0495673_0040127_490_1497 | 322 |
| 312 | 3300047470 | Ga0495681_0008663 | Ga0495681_0008663_3212_4219 | 322 |
| 313 | 3300049460 | Ga0495682_0030271 | Ga0495682_0030271_251_1258 | 322 |
| 314 | 3300049569 | Ga0501032_0050124 | Ga0501032_0050124_535_1539 | 322 |
| 315 | 3300049570 | Ga0501033_0023605 | Ga0501033_0023605_2874_3878 | 322 |
| 316 | 3300049570 | Ga0501033_0248595 | Ga0501033_0248595_236_1246 | 322 |
| 317 | 3300049573 | Ga0501037_0067361 | Ga0501037_0067361_1142_2152 | 322 |
| 318 | 3300049574 | Ga0501038_0089212 | Ga0501038_0089212_545_1549 | 322 |
| 319 | 3300049574 | Ga0501038_0173094 | Ga0501038_0173094_553_1563 | 322 |
| 320 | 3300049575 | Ga0501039_0163210 | Ga0501039_0163210_325_1335 | 322 |
| 321 | 3300049579 | Ga0501043_0010983 | Ga0501043_0010983_1906_2910 | 322 |
| 322 | 3300049822 | Ga0501035_0205362 | Ga0501035_0205362_221_1231 | 322 |
| 323 | 3300053079 | Ga0500610_0000153 | Ga0500610_0000153_865_1875 | 322 |
| 324 | 3300053134 | Ga0500658_0001895 | Ga0500658_0001895_985_1992 | 322 |
| 325 | 3300014325 | Ga0163163_10610483 | Ga0163163_106104831 | 323 |
| 326 | 3300037312 | Ga0395899_0159416 | Ga0395899_0159416_473_1480 | 323 |
| 327 | 3300046491 | Ga0495584_0037041 | Ga0495584_0037041_712_1722 | 323 |
| 328 | 3300046506 | Ga0495583_0014370 | Ga0495583_0014370_294_1304 | 323 |
| 329 | 3300046648 | Ga0495611_0033612 | Ga0495611_0033612_168_1178 | 323 |
| 330 | 3300046660 | Ga0495625_0205716 | Ga0495625_0205716_274_1284 | 323 |
| 331 | 3300046684 | Ga0495669_0000011 | Ga0495669_0000011_53940_54950 | 323 |
| 332 | 3300046810 | Ga0495660_0061970 | Ga0495660_0061970_604_1614 | 323 |
| 333 | 3300047443 | Ga0495687_000077 | Ga0495687_000077_90479_91489 | 323 |
| 334 | 3300053730 | Ga0500645_000001 | Ga0500645_000001_167622_168632 | 323 |
| 335 | 3300003771 | Ga0055526_1000610 | Ga0055526_100061015 | 324 |
| 336 | 3300003775 | Ga0055524_1000018 | Ga0055524_100001814 | 324 |
| 337 | 3300006846 | Ga0075430_100048717 | Ga0075430_1000487173 | 324 |
| 338 | 3300025291 | Ga0209675_1006307 | Ga0209675_10063071 | 324 |
| 339 | 3300025295 | Ga0209564_1000059 | Ga0209564_1000059171 | 324 |
| 340 | 3300025299 | Ga0209256_1000032 | Ga0209256_100003216 | 324 |
| 341 | 3300031731 | Ga0307405_10324102 | Ga0307405_103241021 | 324 |
| 342 | 3300031911 | Ga0307412_10001325 | Ga0307412_100013253 | 324 |
| 343 | 3300047320 | Ga0495672_0073377 | Ga0495672_0073377_20_1030 | 324 |
| 344 | 3300050509 | nmdc:mga0qj67_58117_c1 | nmdc:mga0qj67_58117_c1_1133_2128 | 324 |
| 345 | 3300053122 | Ga0500608_000791 | Ga0500608_000791_10389_11393 | 324 |
| 346 | 3300053723 | Ga0500567_000952 | Ga0500567_000952_6251_7255 | 324 |
| 347 | 3300053729 | Ga0500625_000009 | Ga0500625_000009_120311_121315 | 324 |
| 348 | 3300031731 | Ga0307405_10041062 | Ga0307405_100410622 | 325 |
| 349 | 3300031852 | Ga0307410_10138649 | Ga0307410_101386492 | 325 |
| 350 | 3300005844 | Ga0068862_100147244 | Ga0068862_1001472443 | 326 |
| 351 | 3300021361 | Ga0213872_10018493 | Ga0213872_100184932 | 326 |
| 352 | 3300028380 | Ga0268265_10067046 | Ga0268265_100670463 | 326 |
| 353 | 3300031507 | Ga0307509_10039174 | Ga0307509_100391741 | 326 |
| 354 | 3300039447 | Ga0436361_0135420 | Ga0436361_0135420_1110_2105 | 326 |
| 355 | 3300053148 | Ga0500590_081792 | Ga0500590_081792_451_1458 | 326 |
| 356 | 3300048919 | Ga0496116_0103947 | Ga0496116_0103947_95_1102 | 327 |
| 357 | 3300048920 | Ga0496117_0099003 | Ga0496117_0099003_600_1607 | 327 |
| 358 | 3300048921 | Ga0496118_0017269 | Ga0496118_0017269_510_1517 | 327 |
| 359 | 3300048924 | Ga0496121_0010582 | Ga0496121_0010582_5250_6257 | 327 |
| 360 | 3300053093 | Ga0500651_0098582 | Ga0500651_0098582_447_1454 | 327 |
| 361 | 3300053146 | Ga0500588_0027186 | Ga0500588_0027186_538_1539 | 327 |
| 362 | 3300025261 | Ga0209233_1002397 | Ga0209233_10023973 | 328 |
| 363 | 3300028379 | Ga0268266_10478692 | Ga0268266_104786922 | 328 |
| 364 | 3300033442 | Ga0315911_1000020 | Ga0315911_100002078 | 328 |
| 365 | 3300054114 | Ga0501084_0100347 | Ga0501084_0100347_659_1666 | 328 |
| 366 | iso_pu_bacteria | 2882806704 | 2882806872 | 328 |
| 367 | 3300005563 | Ga0068855_100265979 | Ga0068855_1002659792 | 329 |
| 368 | 3300009545 | Ga0105237_10134839 | Ga0105237_101348393 | 329 |
| 369 | 3300009551 | Ga0105238_10437943 | Ga0105238_104379432 | 329 |
| 370 | 3300010375 | Ga0105239_10033435 | Ga0105239_100334352 | 329 |
| 371 | 3300025914 | Ga0207671_10226627 | Ga0207671_102266271 | 329 |
| 372 | 3300025949 | Ga0207667_10222443 | Ga0207667_102224432 | 329 |
| 373 | 3300031824 | Ga0307413_10193592 | Ga0307413_101935921 | 329 |
| 374 | 3300032002 | Ga0307416_100073907 | Ga0307416_1000739073 | 329 |
| 375 | iso_pu_bacteria | 2896253425 | 2896254354 | 329 |
| 376 | 3300031456 | Ga0307513_10106203 | Ga0307513_101062032 | 330 |
| 377 | 3300033180 | Ga0307510_10006886 | Ga0307510_1000688612 | 330 |
| 378 | 3300053087 | Ga0500643_000837 | Ga0500643_000837_10472_11479 | 330 |
| 379 | iso_pu_bacteria | 2513237137 | 2513857360 | 330 |
| 380 | iso_pu_bacteria | 2585427531 | 2585561941 | 330 |
| 381 | iso_pu_bacteria | 2585427609 | 2585907681 | 330 |
| 382 | iso_pu_bacteria | 2585428125 | 2587983102 | 330 |
| 383 | iso_pu_bacteria | 2643221541 | 2643730266 | 330 |
| 384 | iso_pu_bacteria | 2643221606 | 2644043435 | 330 |
| 385 | iso_pu_bacteria | 2643221671 | 2644393595 | 330 |
| 386 | iso_pu_bacteria | 2739367664 | 2739649304 | 330 |
| 387 | iso_pu_bacteria | 2739367865 | 2740027777 | 330 |
| 388 | iso_pu_bacteria | 2906635258 | 2906637539 | 330 |
| 389 | iso_pu_bacteria | 2906660503 | 2906661155 | 330 |
| 390 | iso_pu_bacteria | 641522639 | 641644463 | 330 |
| 391 | 3300005548 | Ga0070665_100000011 | Ga0070665_100000011308 | 331 |
| 392 | 3300006038 | Ga0075365_10075628 | Ga0075365_100756282 | 331 |
| 393 | 3300006042 | Ga0075368_10016373 | Ga0075368_100163733 | 331 |
| 394 | 3300006051 | Ga0075364_10077578 | Ga0075364_100775782 | 331 |
| 395 | 3300006177 | Ga0075362_10009915 | Ga0075362_100099152 | 331 |
| 396 | 3300006178 | Ga0075367_10001322 | Ga0075367_100013229 | 331 |
| 397 | 3300006186 | Ga0075369_10031975 | Ga0075369_100319752 | 331 |
| 398 | 3300025919 | Ga0207657_10009017 | Ga0207657_100090176 | 331 |
| 399 | 3300025927 | Ga0207687_10178115 | Ga0207687_101781152 | 331 |
| 400 | 3300026088 | Ga0207641_10008795 | Ga0207641_100087953 | 331 |
| 401 | 3300027866 | Ga0209813_10000129 | Ga0209813_1000012927 | 331 |
| 402 | 3300028379 | Ga0268266_10000058 | Ga0268266_10000058220 | 331 |
| 403 | 3300042004 | Ga0439445_0006434 | Ga0439445_0006434_1079_2074 | 331 |
| 404 | 3300042006 | Ga0439432_014209 | Ga0439432_014209_1067_2062 | 331 |
| 405 | 3300045051 | Ga0451576_0000165 | Ga0451576_0000165_81884_82879 | 331 |
| 406 | 3300048929 | Ga0496126_0140159 | Ga0496126_0140159_167_1162 | 331 |
| 407 | 3300049571 | Ga0501034_0184628 | Ga0501034_0184628_887_1882 | 331 |
| 408 | 3300049585 | Ga0501069_0018652 | Ga0501069_0018652_2125_3120 | 331 |
| 409 | 3300049778 | Ga0501282_004189 | Ga0501282_004189_369_1364 | 331 |
| 410 | 3300050489 | nmdc:mga03683_517_c1 | nmdc:mga03683_517_c1_2197_3192 | 331 |
| 411 | 3300050490 | nmdc:mga03n38_2113_c1 | nmdc:mga03n38_2113_c1_881_1876 | 331 |
| 412 | 3300050494 | nmdc:mga06z11_5952_c1 | nmdc:mga06z11_5952_c1_1567_2562 | 331 |
| 413 | 3300050495 | nmdc:mga04h51_281_c1 | nmdc:mga04h51_281_c1_11877_12872 | 331 |
| 414 | 3300050496 | nmdc:mga07m45_17_c1 | nmdc:mga07m45_17_c1_34990_35985 | 331 |
| 415 | 3300053121 | Ga0500607_000240 | Ga0500607_000240_38577_39572 | 331 |
| 416 | 3300053136 | Ga0500559_0051429 | Ga0500559_0051429_171_1208 | 331 |
| 417 | 3300053153 | Ga0500616_0010848 | Ga0500616_0010848_988_1995 | 331 |
| 418 | iso_pu_bacteria | 2545555834 | 2545672395 | 331 |
| 419 | iso_pu_bacteria | 2585427608 | 2585899716 | 331 |
| 420 | iso_pu_bacteria | 2842698319 | 2842698534 | 331 |
| 421 | iso_pu_bacteria | 2855020534 | 2855021478 | 331 |
| 422 | iso_pu_bacteria | 2883354860 | 2883358028 | 331 |
| 423 | iso_pu_bacteria | 2896184354 | 2896185004 | 331 |
| 424 | iso_pu_bacteria | 2902330777 | 2902330934 | 331 |
| 425 | iso_pu_bacteria | 2928125067 | 2928125472 | 331 |
| 426 | iso_pu_bacteria | 643348564 | 643601013 | 331 |
| 427 | iso_pu_bacteria | 8056673599 | 8056677747 | 331 |
| 428 | 3300001976 | JGI24752J21851_1000407 | JGI24752J21851_10004076 | 332 |
| 429 | 3300005331 | Ga0070670_100000621 | Ga0070670_10000062127 | 332 |
| 430 | 3300005367 | Ga0070667_100000322 | Ga0070667_10000032231 | 332 |
| 431 | 3300005539 | Ga0068853_100051188 | Ga0068853_1000511883 | 332 |
| 432 | 3300005544 | Ga0070686_100298986 | Ga0070686_1002989861 | 332 |
| 433 | 3300005616 | Ga0068852_100001154 | Ga0068852_1000011548 | 332 |
| 434 | 3300005618 | Ga0068864_100000004 | Ga0068864_100000004380 | 332 |
| 435 | 3300005841 | Ga0068863_100000002 | Ga0068863_100000002381 | 332 |
| 436 | 3300005841 | Ga0068863_100020878 | Ga0068863_1000208782 | 332 |
| 437 | 3300005843 | Ga0068860_100005628 | Ga0068860_10000562812 | 332 |
| 438 | 3300005844 | Ga0068862_100000002 | Ga0068862_100000002121 | 332 |
| 439 | 3300005844 | Ga0068862_100000187 | Ga0068862_10000018738 | 332 |
| 440 | 3300009011 | Ga0105251_10002072 | Ga0105251_100020729 | 332 |
| 441 | 3300009093 | Ga0105240_10025305 | Ga0105240_100253054 | 332 |
| 442 | 3300009098 | Ga0105245_10039697 | Ga0105245_100396973 | 332 |
| 443 | 3300009177 | Ga0105248_10000016 | Ga0105248_1000001638 | 332 |
| 444 | 3300009553 | Ga0105249_10000106 | Ga0105249_100001063 | 332 |
| 445 | 3300009553 | Ga0105249_10000666 | Ga0105249_1000066614 | 332 |
| 446 | 3300014968 | Ga0157379_10133779 | Ga0157379_101337794 | 332 |
| 447 | 3300025272 | Ga0209455_1005177 | Ga0209455_10051774 | 332 |
| 448 | 3300025735 | Ga0207713_1005825 | Ga0207713_10058256 | 332 |
| 449 | 3300025904 | Ga0207647_10010889 | Ga0207647_100108892 | 332 |
| 450 | 3300025909 | Ga0207705_10000004 | Ga0207705_10000004417 | 332 |
| 451 | 3300025913 | Ga0207695_10018315 | Ga0207695_100183155 | 332 |
| 452 | 3300025925 | Ga0207650_10000643 | Ga0207650_1000064327 | 332 |
| 453 | 3300025941 | Ga0207711_10000022 | Ga0207711_1000002238 | 332 |
| 454 | 3300025961 | Ga0207712_10000048 | Ga0207712_10000048114 | 332 |
| 455 | 3300025961 | Ga0207712_10004350 | Ga0207712_100043501 | 332 |
| 456 | 3300025986 | Ga0207658_10000589 | Ga0207658_100005899 | 332 |
| 457 | 3300026078 | Ga0207702_10050448 | Ga0207702_100504483 | 332 |
| 458 | 3300026088 | Ga0207641_10000002 | Ga0207641_10000002861 | 332 |
| 459 | 3300026088 | Ga0207641_10003066 | Ga0207641_100030667 | 332 |
| 460 | 3300026095 | Ga0207676_10000040 | Ga0207676_1000004056 | 332 |
| 461 | 3300026142 | Ga0207698_10000134 | Ga0207698_1000013418 | 332 |
| 462 | 3300028380 | Ga0268265_10000003 | Ga0268265_10000003129 | 332 |
| 463 | 3300028380 | Ga0268265_10000209 | Ga0268265_1000020937 | 332 |
| 464 | 3300028381 | Ga0268264_10001688 | Ga0268264_1000168817 | 332 |
| 465 | 3300031731 | Ga0307405_10000984 | Ga0307405_1000098410 | 332 |
| 466 | 3300031911 | Ga0307412_10197301 | Ga0307412_101973012 | 332 |
| 467 | 3300032004 | Ga0307414_10037321 | Ga0307414_100373212 | 332 |
| 468 | 3300046530 | Ga0495654_0069363 | Ga0495654_0069363_14_1012 | 332 |
| 469 | 3300048920 | Ga0496117_0003086 | Ga0496117_0003086_13357_14355 | 332 |
| 470 | 3300048921 | Ga0496118_0002584 | Ga0496118_0002584_1063_2061 | 332 |
| 471 | 3300048923 | Ga0496120_0060834 | Ga0496120_0060834_852_1862 | 332 |
| 472 | 3300049571 | Ga0501034_0408676 | Ga0501034_0408676_155_1168 | 332 |
| 473 | 3300049664 | Ga0501224_000818 | Ga0501224_000818_2167_3192 | 332 |
| 474 | 3300049679 | Ga0501249_000074 | Ga0501249_000074_3656_4681 | 332 |
| 475 | 3300049742 | Ga0501080_0158891 | Ga0501080_0158891_409_1422 | 332 |
| 476 | 3300049823 | Ga0501044_0032390 | Ga0501044_0032390_383_1396 | 332 |
| 477 | 3300049850 | Ga0501204_000051 | Ga0501204_000051_3786_4811 | 332 |
| 478 | 3300053087 | Ga0500643_000962 | Ga0500643_000962_11369_12367 | 332 |
| 479 | 3300053094 | Ga0500566_0066052 | Ga0500566_0066052_315_1325 | 332 |
| 480 | 3300053116 | Ga0500592_001253 | Ga0500592_001253_1572_2570 | 332 |
| 481 | 3300053122 | Ga0500608_034797 | Ga0500608_034797_679_1689 | 332 |
| 482 | 3300053158 | Ga0500627_0004340 | Ga0500627_0004340_1871_2869 | 332 |
| 483 | iso_pu_bacteria | 2643221582 | 2643919861 | 332 |
| 484 | iso_pu_bacteria | 2968117919 | 2968120792 | 332 |
| 485 | 3300005353 | Ga0070669_100179092 | Ga0070669_1001790922 | 333 |
| 486 | 3300005471 | Ga0070698_100262725 | Ga0070698_1002627252 | 333 |
| 487 | 3300005546 | Ga0070696_100002073 | Ga0070696_1000020736 | 333 |
| 488 | 3300005547 | Ga0070693_100227178 | Ga0070693_1002271781 | 333 |
| 489 | 3300025910 | Ga0207684_10055772 | Ga0207684_100557725 | 333 |
| 490 | 3300025913 | Ga0207695_10435461 | Ga0207695_104354611 | 333 |
| 491 | 3300047472 | Ga0495686_0067515 | Ga0495686_0067515_867_1868 | 333 |
| 492 | 3300049569 | Ga0501032_0131814 | Ga0501032_0131814_62_1066 | 333 |
| 493 | 3300049581 | Ga0501047_0058666 | Ga0501047_0058666_700_1704 | 333 |
| 494 | 3300049586 | Ga0501070_0003797 | Ga0501070_0003797_1747_2751 | 333 |
| 495 | 3300049590 | Ga0501074_0036478 | Ga0501074_0036478_447_1451 | 333 |
| 496 | 3300049742 | Ga0501080_0007654 | Ga0501080_0007654_2798_3802 | 333 |
| 497 | 3300049822 | Ga0501035_0000806 | Ga0501035_0000806_5619_6623 | 333 |
| 498 | 3300049823 | Ga0501044_0005415 | Ga0501044_0005415_5207_6211 | 333 |
| 499 | 3300049823 | Ga0501044_0139349 | Ga0501044_0139349_1220_2221 | 333 |
| 500 | 3300050509 | nmdc:mga0qj67_63234_c1 | nmdc:mga0qj67_63234_c1_27_1028 | 333 |
| 501 | 3300005329 | Ga0070683_100111275 | Ga0070683_1001112751 | 334 |
| 502 | 3300005339 | Ga0070660_100000754 | Ga0070660_10000075412 | 334 |
| 503 | 3300005339 | Ga0070660_100016179 | Ga0070660_1000161794 | 334 |
| 504 | 3300005457 | Ga0070662_100004936 | Ga0070662_1000049364 | 334 |
| 505 | 3300005539 | Ga0068853_100103113 | Ga0068853_1001031132 | 334 |
| 506 | 3300005539 | Ga0068853_100338528 | Ga0068853_1003385282 | 334 |
| 507 | 3300005563 | Ga0068855_100031545 | Ga0068855_1000315458 | 334 |
| 508 | 3300005564 | Ga0070664_100105443 | Ga0070664_1001054433 | 334 |
| 509 | 3300005577 | Ga0068857_100121783 | Ga0068857_1001217832 | 334 |
| 510 | 3300005614 | Ga0068856_100003121 | Ga0068856_10000312111 | 334 |
| 511 | 3300005615 | Ga0070702_100060491 | Ga0070702_1000604912 | 334 |
| 512 | 3300005981 | Ga0081538_10073702 | Ga0081538_100737022 | 334 |
| 513 | 3300006186 | Ga0075369_10095557 | Ga0075369_100955572 | 334 |
| 514 | 3300006353 | Ga0075370_10003567 | Ga0075370_100035672 | 334 |
| 515 | 3300006846 | Ga0075430_100088141 | Ga0075430_1000881412 | 334 |
| 516 | 3300007788 | Ga0099795_10063730 | Ga0099795_100637301 | 334 |
| 517 | 3300009553 | Ga0105249_10029076 | Ga0105249_100290766 | 334 |
| 518 | 3300010159 | Ga0099796_10033151 | Ga0099796_100331512 | 334 |
| 519 | 3300011119 | Ga0105246_10000072 | Ga0105246_1000007211 | 334 |
| 520 | 3300013102 | Ga0157371_10049282 | Ga0157371_100492824 | 334 |
| 521 | 3300013105 | Ga0157369_10000875 | Ga0157369_100008759 | 334 |
| 522 | 3300013105 | Ga0157369_10385161 | Ga0157369_103851611 | 334 |
| 523 | 3300013307 | Ga0157372_10325630 | Ga0157372_103256301 | 334 |
| 524 | 3300013308 | Ga0157375_10271197 | Ga0157375_102711973 | 334 |
| 525 | 3300025909 | Ga0207705_10005383 | Ga0207705_1000538311 | 334 |
| 526 | 3300025919 | Ga0207657_10001626 | Ga0207657_1000162613 | 334 |
| 527 | 3300025919 | Ga0207657_10025636 | Ga0207657_100256364 | 334 |
| 528 | 3300025920 | Ga0207649_10164384 | Ga0207649_101643842 | 334 |
| 529 | 3300025932 | Ga0207690_10307225 | Ga0207690_103072251 | 334 |
| 530 | 3300025933 | Ga0207706_10005288 | Ga0207706_100052884 | 334 |
| 531 | 3300025944 | Ga0207661_10000082 | Ga0207661_1000008231 | 334 |
| 532 | 3300025944 | Ga0207661_10357200 | Ga0207661_103572001 | 334 |
| 533 | 3300025945 | Ga0207679_10240391 | Ga0207679_102403911 | 334 |
| 534 | 3300025949 | Ga0207667_10033197 | Ga0207667_100331978 | 334 |
| 535 | 3300026041 | Ga0207639_10012677 | Ga0207639_100126772 | 334 |
| 536 | 3300026041 | Ga0207639_10041887 | Ga0207639_100418872 | 334 |
| 537 | 3300026078 | Ga0207702_10000621 | Ga0207702_1000062112 | 334 |
| 538 | 3300026116 | Ga0207674_10129644 | Ga0207674_101296442 | 334 |
| 539 | 3300031730 | Ga0307516_10000124 | Ga0307516_1000012412 | 334 |
| 540 | 3300036712 | Ga0316584_0073348 | Ga0316584_0073348_1009_2013 | 334 |
| 541 | 3300045976 | Ga0466967_0154387 | Ga0466967_0154387_878_1882 | 334 |
| 542 | 3300046452 | Ga0495617_002500 | Ga0495617_002500_2382_3386 | 334 |
| 543 | 3300046460 | Ga0495638_0001229 | Ga0495638_0001229_5524_6528 | 334 |
| 544 | 3300046492 | Ga0495585_0015835 | Ga0495585_0015835_764_1768 | 334 |
| 545 | 3300046506 | Ga0495583_0053120 | Ga0495583_0053120_210_1214 | 334 |
| 546 | 3300046512 | Ga0495610_0004208 | Ga0495610_0004208_4916_5920 | 334 |
| 547 | 3300046513 | Ga0495616_0051592 | Ga0495616_0051592_720_1724 | 334 |
| 548 | 3300046515 | Ga0495620_0000536 | Ga0495620_0000536_5553_6557 | 334 |
| 549 | 3300046522 | Ga0495643_0001259 | Ga0495643_0001259_5556_6560 | 334 |
| 550 | 3300046524 | Ga0495648_0001353 | Ga0495648_0001353_17715_18719 | 334 |
| 551 | 3300046525 | Ga0495663_0000193 | Ga0495663_0000193_5554_6558 | 334 |
| 552 | 3300046648 | Ga0495611_0000463 | Ga0495611_0000463_17738_18742 | 334 |
| 553 | 3300046660 | Ga0495625_0001838 | Ga0495625_0001838_5533_6537 | 334 |
| 554 | 3300046665 | Ga0495661_0025676 | Ga0495661_0025676_185_1189 | 334 |
| 555 | 3300046674 | Ga0495588_0002067 | Ga0495588_0002067_5271_6275 | 334 |
| 556 | 3300046689 | Ga0495613_0050162 | Ga0495613_0050162_1831_2835 | 334 |
| 557 | 3300046691 | Ga0495670_0000275 | Ga0495670_0000275_17739_18743 | 334 |
| 558 | 3300046692 | Ga0495671_0000711 | Ga0495671_0000711_17699_18703 | 334 |
| 559 | 3300046694 | Ga0495649_0000872 | Ga0495649_0000872_17699_18703 | 334 |
| 560 | 3300046810 | Ga0495660_0010535 | Ga0495660_0010535_3352_4356 | 334 |
| 561 | 3300047443 | Ga0495687_001242 | Ga0495687_001242_5556_6560 | 334 |
| 562 | 3300047470 | Ga0495681_0000799 | Ga0495681_0000799_17666_18670 | 334 |
| 563 | 3300047472 | Ga0495686_0001570 | Ga0495686_0001570_17739_18743 | 334 |
| 564 | 3300048926 | Ga0496123_0002334 | Ga0496123_0002334_17325_18329 | 334 |
| 565 | 3300049459 | Ga0495678_000995 | Ga0495678_000995_17711_18715 | 334 |
| 566 | 3300049460 | Ga0495682_0000603 | Ga0495682_0000603_5490_6494 | 334 |
| 567 | 3300049823 | Ga0501044_0147813 | Ga0501044_0147813_597_1601 | 334 |
| 568 | 3300049823 | Ga0501044_0193600 | Ga0501044_0193600_180_1184 | 334 |
| 569 | 3300050496 | nmdc:mga07m45_2586_c2 | nmdc:mga07m45_2586_c2_6317_7321 | 334 |
| 570 | 3300050509 | nmdc:mga0qj67_43047_c1 | nmdc:mga0qj67_43047_c1_820_1827 | 334 |
| 571 | 3300050510 | nmdc:mga06r32_90277_c1 | nmdc:mga06r32_90277_c1_941_1948 | 334 |
| 572 | 3300053086 | Ga0500578_0001827 | Ga0500578_0001827_5538_6542 | 334 |
| 573 | 3300053092 | Ga0500583_0000561 | Ga0500583_0000561_2400_3404 | 334 |
| 574 | 3300053103 | Ga0500555_023414 | Ga0500555_023414_189_1193 | 334 |
| 575 | 3300053122 | Ga0500608_000196 | Ga0500608_000196_5555_6559 | 334 |
| 576 | 3300053125 | Ga0500618_000598 | Ga0500618_000598_5418_6422 | 334 |
| 577 | 3300053138 | Ga0500564_002564 | Ga0500564_002564_406_1410 | 334 |
| 578 | 3300053141 | Ga0500574_000039 | Ga0500574_000039_10035_11039 | 334 |
| 579 | 3300053177 | Ga0500636_0060436 | Ga0500636_0060436_829_1833 | 334 |
| 580 | 3300053723 | Ga0500567_033554 | Ga0500567_033554_324_1328 | 334 |
| 581 | 3300005289 | Ga0065704_10070184 | Ga0065704_1007018453 | 335 |
| 582 | 3300005367 | Ga0070667_100000329 | Ga0070667_10000032918 | 335 |
| 583 | 3300005468 | Ga0070707_100316441 | Ga0070707_1003164412 | 335 |
| 584 | 3300005471 | Ga0070698_100049064 | Ga0070698_1000490643 | 335 |
| 585 | 3300005518 | Ga0070699_100046988 | Ga0070699_1000469882 | 335 |
| 586 | 3300005618 | Ga0068864_100003651 | Ga0068864_1000036515 | 335 |
| 587 | 3300005842 | Ga0068858_100007016 | Ga0068858_10000701610 | 335 |
| 588 | 3300005843 | Ga0068860_100071559 | Ga0068860_1000715597 | 335 |
| 589 | 3300013102 | Ga0157371_10169786 | Ga0157371_101697863 | 335 |
| 590 | 3300013104 | Ga0157370_10133127 | Ga0157370_101331272 | 335 |
| 591 | 3300013306 | Ga0163162_10009818 | Ga0163162_100098186 | 335 |
| 592 | 3300013306 | Ga0163162_10255855 | Ga0163162_102558553 | 335 |
| 593 | 3300014326 | Ga0157380_10026391 | Ga0157380_100263915 | 335 |
| 594 | 3300025261 | Ga0209233_1004111 | Ga0209233_10041115 | 335 |
| 595 | 3300025986 | Ga0207658_10000274 | Ga0207658_1000027418 | 335 |
| 596 | 3300026035 | Ga0207703_10004829 | Ga0207703_100048296 | 335 |
| 597 | 3300026095 | Ga0207676_10004881 | Ga0207676_100048819 | 335 |
| 598 | 3300028381 | Ga0268264_10035651 | Ga0268264_100356517 | 335 |
| 599 | 3300028786 | Ga0307517_10036833 | Ga0307517_100368331 | 335 |
| 600 | 3300031852 | Ga0307410_10091326 | Ga0307410_100913261 | 335 |
| 601 | 3300031903 | Ga0307407_10005830 | Ga0307407_100058306 | 335 |
| 602 | 3300031911 | Ga0307412_10008903 | Ga0307412_100089032 | 335 |
| 603 | 3300032002 | Ga0307416_100021503 | Ga0307416_1000215033 | 335 |
| 604 | 3300032005 | Ga0307411_10044970 | Ga0307411_100449702 | 335 |
| 605 | 3300046660 | Ga0495625_0009806 | Ga0495625_0009806_6127_7134 | 335 |
| 606 | 3300047472 | Ga0495686_0003568 | Ga0495686_0003568_5799_6806 | 335 |
| 607 | 3300048922 | Ga0496119_0095532 | Ga0496119_0095532_447_1454 | 335 |
| 608 | 3300048924 | Ga0496121_0163275 | Ga0496121_0163275_419_1426 | 335 |
| 609 | 3300048929 | Ga0496126_0070344 | Ga0496126_0070344_114_1121 | 335 |
| 610 | 3300049579 | Ga0501043_0155563 | Ga0501043_0155563_623_1630 | 335 |
| 611 | 3300053125 | Ga0500618_030124 | Ga0500618_030124_12_1019 | 335 |
| 612 | 3300038443 | Ga0395901_0005160 | Ga0395901_0005160_3593_4603 | 336 |
| 613 | 2162886007 | SwRhRL2b_contig_2224728 | SwRhRL2b_0434.00009780 | 345 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6rko-assembly1.cif.gz_B | cryo-em structure of the e. coli cytochrome bd-i oxidase at 2.68 a resolution | 0.8997 | 16 | 341 |
| 7nkz-assembly1.cif.gz_B | cryo-em structure of the cytochrome bd oxidase from m. tuberculosis at 2.5 a resolution | 0.8996 | 16 | 341 |
| 8b4o-assembly1.cif.gz_B | cryo-em structure of cytochrome bd oxidase from c. glutamicum | 0.898 | 16 | 338 |
| 7ose-assembly1.cif.gz_B | cytochrome bd-ii type oxidase with bound aurachin d | 0.8948 | 16 | 341 |
| 7d5i-assembly1.cif.gz_B | structure of mycobacterium smegmatis bd complex in the apo-form. | 0.8904 | 17 | 342 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_B6U466_3_118_1.20.120.290 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Oxygen-evolving enhancer protein 3 (PsbQ), four-helix up-down bundle | 0.6982 | 170 | 287 | 1.20.120.290 |
| af_B6U466_3_118_1.20.120.290 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Oxygen-evolving enhancer protein 3 (PsbQ), four-helix up-down bundle | 0.6522 | 170 | 287 | 1.20.120.290 |
| 3qw1C00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c/b562 | 0.6517 | 181 | 286 | 1.20.120.10 |
| af_I1KJL7_87_236_1.20.120.290 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Oxygen-evolving enhancer protein 3 (PsbQ), four-helix up-down bundle | 0.6383 | 167 | 288 | 1.20.120.290 |
| 3qw1C00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c/b562 | 0.6088 | 181 | 286 | 1.20.120.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W9RER6-F1-model_v4 | deleted | 0.99 | 16 | 345 |
|
| AF-A0A7X8NQV8-F1-model_v4 | Cytochrome d ubiquinol oxidase subunit II | 0.9896 | 16 | 345 |
GO:0005886
GO:0009055 GO:0016682 GO:0019646 GO:0070069 |
| AF-A0A7W5ZXS8-F1-model_v4 | Cytochrome d ubiquinol oxidase subunit II (EC 1.10.3.-) | 0.9878 | 16 | 345 |
GO:0005886
GO:0009055 GO:0016682 GO:0019646 GO:0070069 |
| AF-A0A844YWT1-F1-model_v4 | Cytochrome d ubiquinol oxidase subunit II | 0.9871 | 16 | 345 |
GO:0005886
GO:0009055 GO:0016682 GO:0019646 GO:0070069 |
| AF-A0A3C1HQL7-F1-model_v4 | deleted | 0.9849 | 16 | 343 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar