F469212

General Info

Members Datasets Scaffolds Average Seq Length
613 353 587 323

Family's Representative Sequence

Representative Sequence 2162886007|SwRhRL2b_contig_2224728|SwRhRL2b_0434.00009780
Length 345
Sequence MARSARRTADMGVNFDLTVIWAFIIAFGVFAYVVMDGFDLGIGILFPTFQVGEGRNRAMNSIAPVWDGNETWLVLGGGGLFAAFPLAYAIILPATYPLIIAMLLGLVFRGVAFEFRWRDARHRAFWDLAFSGGSFVAALSQGMVLGAILQGIKVSGRAYAGSWWDWLTPYTLLTGLGVVAGYALLGSCWLIWKLDGPAQDHAYKVARRAAVATLALLVAVSLYTPLLAEAYWRRWFEAPGIYFASQVPLLTLILAGTLFYGLAKRWQAAPFWLAQGIFLLGMAGLGVSMWPHVIPASVTIWEAAAPERSQVFMLVGVALTMPLIIGYTGWAYWVFRGKVGHDGYH

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
3 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
4 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
5 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
6 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
7 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
8 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
9 2643221582 Rhizobium sp. Root651 Isolate Unclassified
10 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
11 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
12 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
13 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
14 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
15 2855020534 Paracoccus endophyticus SYSUP0003 Isolate Stem Tuber
16 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
17 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
18 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
19 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
20 2902330777 Methylobacterium sp. 2A Isolate Unclassified
21 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
22 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
23 2928125067 Methylobacterium sp. 1973 Isolate Unclassified
24 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
25 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
26 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
27 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
28 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
29 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
30 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
31 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
32 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
33 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
34 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
35 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
36 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
37 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
38 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
39 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
40 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
41 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
42 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
43 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
44 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
45 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
46 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
47 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
48 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
49 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
50 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
51 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
52 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
53 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
54 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
55 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
56 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
57 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
58 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
59 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
60 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
61 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
62 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
63 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
64 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
65 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
66 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
67 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
68 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
69 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
70 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
71 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
72 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
73 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
74 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
75 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
76 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
77 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
78 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
79 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
80 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
81 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
82 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
83 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
84 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
85 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
86 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
87 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
88 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
89 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
90 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
91 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
92 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
93 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
94 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
95 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
96 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
97 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
98 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
99 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
100 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
102 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
103 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
104 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
105 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
106 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
107 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
109 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
110 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
111 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
112 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
113 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
114 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
115 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
116 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
117 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
118 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
119 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
120 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
121 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
122 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
123 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
124 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
125 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
126 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
127 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
128 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
129 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
130 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
133 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
137 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
139 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
185 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
186 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
187 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
188 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
192 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
193 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
194 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
195 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
196 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
197 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
198 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
199 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
200 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
201 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
202 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
203 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
204 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
205 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
206 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
207 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
208 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
209 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
210 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
211 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
212 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
213 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
214 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
215 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
216 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
217 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
218 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
219 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
220 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
221 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
222 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
223 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
224 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
225 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
226 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
227 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
228 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
229 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
230 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
231 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
232 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
233 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
234 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
235 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
236 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
237 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
238 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
239 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
240 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
241 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
242 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
243 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
244 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
245 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
246 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
247 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
248 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
249 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
250 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
251 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
252 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
253 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
254 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
255 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
256 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
257 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
258 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
259 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
260 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
261 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
262 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
263 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
264 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
265 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
266 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
267 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
268 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
269 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
270 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
271 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
272 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
273 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
274 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
275 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
276 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
277 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
288 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
289 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
290 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
291 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
292 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
293 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
294 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
295 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
298 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
299 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
300 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
301 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
302 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
303 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
304 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
305 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
306 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
307 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
308 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
309 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
310 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
311 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
312 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
313 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
314 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
315 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
316 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
317 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
318 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
319 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
320 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
321 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
322 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
323 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
324 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
325 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
326 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
327 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
328 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
329 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
330 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
331 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
332 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
333 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
334 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
335 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
336 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
337 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
338 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
339 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
340 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
341 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
342 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
343 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
344 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
345 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
346 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
347 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
348 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
349 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
350 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
351 641522639 Methylobacterium sp. 4-46 Isolate Nodule
352 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
353 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.76
Metatranscriptomes 0
Isolates 4.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.99
Nodule 1.79
Rhizoplane 0.33
Rhizosphere 74.71
Stem 0
Stem Tuber 0.16
Unclassified 7.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2224728 2162886007 Bacteria 34906
2 JGI24752J21851_1000407 3300001976 Bacteria 5889
3 JGI24749J21850_1000021 3300002076 Bacteria 30737
4 JGI24742J22300_10000498 3300002244 Bacteria 5842
5 JGI24751J29686_10000778 3300002459 Bacteria 7502
6 JGI25153J46596_10000008 3300003215 Bacteria 376808
7 Ga0055525_1000248 3300003759 Bacteria 54342
8 Ga0055542_1000040 3300003762 Bacteria 214035
9 Ga0055529_1000037 3300003763 Bacteria 237307
10 Ga0055526_1000610 3300003771 Bacteria 27782
11 Ga0055524_1000018 3300003775 Bacteria 234806
12 Ga0065704_10070184 3300005289 Bacteria 119655
13 Ga0065715_10130045 3300005293 Bacteria 2033
14 Ga0065707_10082787 3300005295 Bacteria 12139
15 Ga0070658_10033562 3300005327 Bacteria 4130
16 Ga0070658_10138276 3300005327 Bacteria 2033
17 Ga0070683_100056792 3300005329 Bacteria 3635
18 Ga0070683_100111275 3300005329 Bacteria 2583
19 Ga0070670_100000031 3300005331 Bacteria 159070
20 Ga0070670_100000621 3300005331 Bacteria 27756
21 Ga0070666_10136590 3300005335 Bacteria 1706
22 Ga0070680_100011597 3300005336 Bacteria 6827
23 Ga0070660_100000754 3300005339 Bacteria 21503
24 Ga0070660_100006530 3300005339 Bacteria 8091
25 Ga0070660_100016179 3300005339 Bacteria 5408
26 Ga0070660_100083657 3300005339 Bacteria 2507
27 Ga0070661_100001494 3300005344 Bacteria 16268
28 Ga0070661_100061805 3300005344 Bacteria 2749
29 Ga0070668_100039301 3300005347 Bacteria 3619
30 Ga0070668_100172710 3300005347 Bacteria 1760
31 Ga0070668_100261563 3300005347 Bacteria 1439
32 Ga0070669_100000015 3300005353 Bacteria 197597
33 Ga0070669_100179092 3300005353 Bacteria 1657
34 Ga0070671_100204743 3300005355 Bacteria 1674
35 Ga0070674_100000638 3300005356 Bacteria 17627
36 Ga0070674_100035455 3300005356 Bacteria 3341
37 Ga0070673_100114741 3300005364 Bacteria 2239
38 Ga0070659_100013228 3300005366 Bacteria 6137
39 Ga0070659_100202973 3300005366 Bacteria 1632
40 Ga0070667_100000322 3300005367 Bacteria 53499
41 Ga0070667_100000329 3300005367 Bacteria 52918
42 Ga0070667_100000396 3300005367 Bacteria 47159
43 Ga0070709_10003317 3300005434 Bacteria 8663
44 Ga0070714_100051302 3300005435 Bacteria 3516
45 Ga0070713_100000447 3300005436 Bacteria 26301
46 Ga0070710_10001414 3300005437 Bacteria 11327
47 Ga0070711_100020818 3300005439 Archaea 4233
48 Ga0070678_100000022 3300005456 Bacteria 49544
49 Ga0070662_100004936 3300005457 Bacteria 8477
50 Ga0070662_100025275 3300005457 Bacteria 4099
51 Ga0070662_100036221 3300005457 Bacteria 3489
52 Ga0070707_100316441 3300005468 Bacteria 1517
53 Ga0070698_100049064 3300005471 Bacteria 4311
54 Ga0070698_100262725 3300005471 Bacteria 1658
55 Ga0070699_100046988 3300005518 Bacteria 3735
56 Ga0070679_100012918 3300005530 Bacteria 7997
57 Ga0070679_100052119 3300005530 Bacteria 4077
58 Ga0070684_100016945 3300005535 Bacteria 5970
59 Ga0068853_100051188 3300005539 Bacteria 3555
60 Ga0068853_100103113 3300005539 Bacteria 2525
61 Ga0068853_100110663 3300005539 Bacteria 2440
62 Ga0068853_100194169 3300005539 Bacteria 1845
63 Ga0068853_100287715 3300005539 Bacteria 1516
64 Ga0068853_100338528 3300005539 Bacteria 1397
65 Ga0070686_100298986 3300005544 Bacteria 1193
66 Ga0070696_100002073 3300005546 Bacteria 13154
67 Ga0070693_100227178 3300005547 Bacteria 1226
68 Ga0070665_100000011 3300005548 Bacteria 525539
69 Ga0070665_100000023 3300005548 Bacteria 375278
70 Ga0068855_100031545 3300005563 Bacteria 6329
71 Ga0068855_100047788 3300005563 Bacteria 5054
72 Ga0068855_100061805 3300005563 Bacteria 4375
73 Ga0068855_100265979 3300005563 Bacteria 1909
74 Ga0070664_100048559 3300005564 Bacteria 3586
75 Ga0070664_100074157 3300005564 Bacteria 2921
76 Ga0070664_100105443 3300005564 Bacteria 2455
77 Ga0068857_100121783 3300005577 Bacteria 2349
78 Ga0068857_100186931 3300005577 Bacteria 1886
79 Ga0068854_100010375 3300005578 Bacteria 6039
80 Ga0068856_100003121 3300005614 Bacteria 16914
81 Ga0068856_100009932 3300005614 Bacteria 9245
82 Ga0068856_100012002 3300005614 Bacteria 8392
83 Ga0070702_100060491 3300005615 Bacteria 2202
84 Ga0068852_100001154 3300005616 Bacteria 17486
85 Ga0068859_100015406 3300005617 Bacteria 7682
86 Ga0068859_100015675 3300005617 Bacteria 7616
87 Ga0068864_100000004 3300005618 Bacteria 489341
88 Ga0068864_100000248 3300005618 Bacteria 48142
89 Ga0068864_100001303 3300005618 Bacteria 20754
90 Ga0068864_100003651 3300005618 Bacteria 12723
91 Ga0068861_100019313 3300005719 Bacteria 4869
92 Ga0068863_100000002 3300005841 Bacteria 489510
93 Ga0068863_100005967 3300005841 Bacteria 11947
94 Ga0068863_100020878 3300005841 Bacteria 6255
95 Ga0068858_100001051 3300005842 Bacteria 28526
96 Ga0068858_100007016 3300005842 Bacteria 10947
97 Ga0068858_100214795 3300005842 Bacteria 1821
98 Ga0068860_100005628 3300005843 Bacteria 12658
99 Ga0068860_100008843 3300005843 Bacteria 10032
100 Ga0068860_100071559 3300005843 Bacteria 3295
101 Ga0068862_100000002 3300005844 Bacteria 489341
102 Ga0068862_100000006 3300005844 Bacteria 346828
103 Ga0068862_100000187 3300005844 Bacteria 68303
104 Ga0068862_100147244 3300005844 Bacteria 2094
105 Ga0081455_10047844 3300005937 Bacteria 3700
106 Ga0081538_10073702 3300005981 Bacteria 1863
107 Ga0081540_1000165 3300005983 Bacteria 68435
108 Ga0081540_1004986 3300005983 Bacteria 9979
109 Ga0081540_1024709 3300005983 Bacteria 3480
110 Ga0081540_1065550 3300005983 Bacteria 1707
111 Ga0070717_10020113 3300006028 Bacteria 5246
112 Ga0075365_10009177 3300006038 Bacteria 5668
113 Ga0075365_10075628 3300006038 Bacteria 2273
114 Ga0075368_10016373 3300006042 Bacteria 2763
115 Ga0075368_10064201 3300006042 Bacteria 1474
116 Ga0075364_10025783 3300006051 Bacteria 3745
117 Ga0075364_10077578 3300006051 Bacteria 2193
118 Ga0070715_10000915 3300006163 Bacteria 8201
119 Ga0070716_100007776 3300006173 Bacteria 5292
120 Ga0070712_100005054 3300006175 Bacteria 8169
121 Ga0075362_10009915 3300006177 Bacteria 3701
122 Ga0075362_10023271 3300006177 Bacteria 2619
123 Ga0075362_10047535 3300006177 Bacteria 1912
124 Ga0075367_10001322 3300006178 Bacteria 10508
125 Ga0075367_10010625 3300006178 Bacteria 4842
126 Ga0075369_10017848 3300006186 Bacteria 2883
127 Ga0075369_10031975 3300006186 Bacteria 2224
128 Ga0075369_10095557 3300006186 Bacteria 1329
129 Ga0075370_10003567 3300006353 Bacteria 7439
130 Ga0075430_100048717 3300006846 Bacteria 3578
131 Ga0075430_100088141 3300006846 Bacteria 2597
132 Ga0075434_100001535 3300006871 Bacteria 19534
133 Ga0068865_100021672 3300006881 Bacteria 4183
134 Ga0097620_100015406 3300006931 Bacteria 7682
135 Ga0097620_100015675 3300006931 Bacteria 7616
136 Ga0099824_1001145 3300006942 Bacteria 36195
137 Ga0099822_1000135 3300006943 Bacteria 49135
138 Ga0075435_100055003 3300007076 Bacteria 3213
139 Ga0099795_10063730 3300007788 Bacteria 1375
140 Ga0105251_10002072 3300009011 Bacteria 16178
141 Ga0105240_10025305 3300009093 Bacteria 7802
142 Ga0105240_10071202 3300009093 Bacteria 4301
143 Ga0105240_10462003 3300009093 Bacteria 1418
144 Ga0111539_10020045 3300009094 Bacteria 8237
145 Ga0105245_10039697 3300009098 Bacteria 4189
146 Ga0105245_10277996 3300009098 Bacteria 1635
147 Ga0105243_10000223 3300009148 Bacteria 65335
148 Ga0105248_10000016 3300009177 Bacteria 308151
149 Ga0105248_10000066 3300009177 Bacteria 121254
150 Ga0105248_10182355 3300009177 Bacteria 2365
151 Ga0105237_10134839 3300009545 Bacteria 2464
152 Ga0105238_10024694 3300009551 Bacteria 6127
153 Ga0105238_10437943 3300009551 Bacteria 1303
154 Ga0105249_10000106 3300009553 Bacteria 115526
155 Ga0105249_10000666 3300009553 Bacteria 31174
156 Ga0105249_10029076 3300009553 Bacteria 4990
157 Ga0105249_10119925 3300009553 Bacteria 2498
158 Ga0099796_10033151 3300010159 Bacteria 1698
159 Ga0105239_10033435 3300010375 Bacteria 5647
160 Ga0105239_10060857 3300010375 Bacteria 4144
161 Ga0105239_10359976 3300010375 Bacteria 1643
162 Ga0105246_10000072 3300011119 Bacteria 41904
163 Ga0157326_1000881 3300012513 Bacteria 3454
164 Ga0157373_10010676 3300013100 Bacteria 6755
165 Ga0157371_10011311 3300013102 Bacteria 6888
166 Ga0157371_10038953 3300013102 Bacteria 3400
167 Ga0157371_10049282 3300013102 Bacteria 2992
168 Ga0157371_10067603 3300013102 Bacteria 2529
169 Ga0157371_10169786 3300013102 Bacteria 1558
170 Ga0157370_10032697 3300013104 Bacteria 5078
171 Ga0157370_10133127 3300013104 Bacteria 2318
172 Ga0157369_10000875 3300013105 Bacteria 38443
173 Ga0157369_10054508 3300013105 Bacteria 4318
174 Ga0157369_10065800 3300013105 Bacteria 3901
175 Ga0157369_10300426 3300013105 Bacteria 1670
176 Ga0157369_10385161 3300013105 Bacteria 1455
177 Ga0163162_10009818 3300013306 Bacteria 9313
178 Ga0163162_10255855 3300013306 Bacteria 1883
179 Ga0157372_10032556 3300013307 Bacteria 5718
180 Ga0157372_10325630 3300013307 Bacteria 1789
181 Ga0157375_10271197 3300013308 Bacteria 1859
182 Ga0163163_10011709 3300014325 Bacteria 7967
183 Ga0163163_10024188 3300014325 Bacteria 5778
184 Ga0163163_10610483 3300014325 Bacteria 1154
185 Ga0157380_10000124 3300014326 Bacteria 42926
186 Ga0157380_10026391 3300014326 Bacteria 4410
187 Ga0157379_10002599 3300014968 Bacteria 15174
188 Ga0157379_10133779 3300014968 Bacteria 2233
189 Ga0163161_10198751 3300017792 Bacteria 1544
190 Ga0213872_10018493 3300021361 Bacteria 3214
191 Ga0209563_100066 3300025230 Bacteria 257382
192 Ga0209148_1000011 3300025254 Bacteria 1196503
193 Ga0209233_1002397 3300025261 Bacteria 6922
194 Ga0209233_1004111 3300025261 Bacteria 5015
195 Ga0209233_1022037 3300025261 Bacteria 1637
196 Ga0209455_1000006 3300025272 Bacteria 1196503
197 Ga0209455_1005177 3300025272 Bacteria 4089
198 Ga0209455_1015969 3300025272 Bacteria 1629
199 Ga0209675_1006307 3300025291 Bacteria 4785
200 Ga0209564_1000059 3300025295 Bacteria 328782
201 Ga0209758_1000017 3300025297 Bacteria 754393
202 Ga0209256_1000032 3300025299 Bacteria 395041
203 Ga0207426_1015349 3300025302 Bacteria 2780
204 Ga0207713_1005825 3300025735 Bacteria 7626
205 Ga0207692_10001959 3300025898 Bacteria 7847
206 Ga0207710_10039423 3300025900 Bacteria 2091
207 Ga0207688_10099229 3300025901 Bacteria 1680
208 Ga0207680_10305983 3300025903 Bacteria 1109
209 Ga0207647_10010889 3300025904 Bacteria 6399
210 Ga0207699_10001027 3300025906 Bacteria 13164
211 Ga0207705_10000004 3300025909 Bacteria 705756
212 Ga0207705_10005383 3300025909 Bacteria 9573
213 Ga0207705_10046995 3300025909 Bacteria 3103
214 Ga0207684_10055772 3300025910 Bacteria 3352
215 Ga0207707_10036783 3300025912 Bacteria 4279
216 Ga0207695_10018315 3300025913 Bacteria 8102
217 Ga0207695_10435461 3300025913 Bacteria 1195
218 Ga0207671_10226627 3300025914 Bacteria 1465
219 Ga0207693_10000774 3300025915 Bacteria 28742
220 Ga0207663_10000645 3300025916 Bacteria 15475
221 Ga0207660_10035201 3300025917 Bacteria 3475
222 Ga0207657_10001626 3300025919 Bacteria 24207
223 Ga0207657_10009017 3300025919 Bacteria 10075
224 Ga0207657_10018158 3300025919 Bacteria 6728
225 Ga0207657_10025636 3300025919 Bacteria 5432
226 Ga0207657_10025733 3300025919 Bacteria 5420
227 Ga0207649_10034494 3300025920 Bacteria 3032
228 Ga0207649_10111957 3300025920 Bacteria 1825
229 Ga0207649_10164384 3300025920 Bacteria 1540
230 Ga0207652_10010007 3300025921 Bacteria 7637
231 Ga0207652_10038671 3300025921 Bacteria 4046
232 Ga0207652_10140975 3300025921 Bacteria 2155
233 Ga0207681_10000001 3300025923 Bacteria 1105841
234 Ga0207650_10000055 3300025925 Bacteria 158325
235 Ga0207650_10000643 3300025925 Bacteria 27774
236 Ga0207650_10035633 3300025925 Bacteria 3616
237 Ga0207687_10178115 3300025927 Bacteria 1645
238 Ga0207664_10007783 3300025929 Bacteria 7441
239 Ga0207690_10011749 3300025932 Bacteria 5237
240 Ga0207690_10022480 3300025932 Bacteria 3924
241 Ga0207690_10307225 3300025932 Bacteria 1243
242 Ga0207706_10001953 3300025933 Bacteria 20227
243 Ga0207706_10005288 3300025933 Bacteria 12036
244 Ga0207706_10045905 3300025933 Bacteria 3870
245 Ga0207709_10000078 3300025935 Bacteria 169141
246 Ga0207669_10000105 3300025937 Bacteria 42248
247 Ga0207669_10000393 3300025937 Bacteria 19327
248 Ga0207665_10000289 3300025939 Bacteria 34924
249 Ga0207711_10000022 3300025941 Bacteria 340441
250 Ga0207711_10002672 3300025941 Bacteria 15768
251 Ga0207661_10000082 3300025944 Bacteria 66488
252 Ga0207661_10005344 3300025944 Bacteria 9042
253 Ga0207661_10055952 3300025944 Bacteria 3165
254 Ga0207661_10357200 3300025944 Bacteria 1319
255 Ga0207679_10014287 3300025945 Bacteria 5216
256 Ga0207679_10048575 3300025945 Bacteria 3090
257 Ga0207679_10240391 3300025945 Bacteria 1534
258 Ga0207667_10028799 3300025949 Bacteria 6030
259 Ga0207667_10033197 3300025949 Bacteria 5552
260 Ga0207667_10222443 3300025949 Bacteria 1934
261 Ga0207651_10108306 3300025960 Bacteria 2079
262 Ga0207712_10000048 3300025961 Bacteria 160050
263 Ga0207712_10004350 3300025961 Bacteria 8946
264 Ga0207668_10008869 3300025972 Bacteria 6014
265 Ga0207640_10057376 3300025981 Bacteria 2561
266 Ga0207640_10163045 3300025981 Bacteria 1652
267 Ga0207658_10000274 3300025986 Bacteria 54007
268 Ga0207658_10000589 3300025986 Bacteria 32594
269 Ga0207658_10002544 3300025986 Bacteria 13258
270 Ga0207703_10004829 3300026035 Bacteria 10970
271 Ga0207703_10005193 3300026035 Bacteria 10522
272 Ga0207639_10005058 3300026041 Bacteria 8881
273 Ga0207639_10012677 3300026041 Bacteria 5878
274 Ga0207639_10041887 3300026041 Bacteria 3430
275 Ga0207639_10117282 3300026041 Bacteria 2181
276 Ga0207639_10120358 3300026041 Bacteria 2156
277 Ga0207702_10000621 3300026078 Bacteria 39027
278 Ga0207702_10011567 3300026078 Bacteria 7353
279 Ga0207702_10050448 3300026078 Bacteria 3514
280 Ga0207702_10157780 3300026078 Bacteria 2069
281 Ga0207641_10000002 3300026088 Bacteria 981004
282 Ga0207641_10003066 3300026088 Bacteria 15065
283 Ga0207641_10007467 3300026088 Bacteria 9095
284 Ga0207641_10008795 3300026088 Bacteria 8341
285 Ga0207676_10000004 3300026095 Bacteria 725417
286 Ga0207676_10000040 3300026095 Bacteria 167947
287 Ga0207676_10004881 3300026095 Bacteria 9493
288 Ga0207676_10007036 3300026095 Bacteria 7971
289 Ga0207674_10017135 3300026116 Bacteria 7908
290 Ga0207674_10129644 3300026116 Bacteria 2486
291 Ga0207674_10161421 3300026116 Bacteria 2195
292 Ga0207674_10289561 3300026116 Bacteria 1586
293 Ga0207675_100000818 3300026118 Bacteria 30959
294 Ga0207683_10000156 3300026121 Bacteria 57349
295 Ga0207698_10000134 3300026142 Bacteria 46624
296 Ga0209589_1000017 3300027357 Bacteria 215546
297 Ga0209489_100018 3300027361 Bacteria 215546
298 Ga0209700_100028 3300027363 Bacteria 215546
299 Ga0209813_10000129 3300027866 Bacteria 27547
300 Ga0209813_10044096 3300027866 Bacteria 1369
301 Ga0268266_10000002 3300028379 Bacteria 3059047
302 Ga0268266_10000058 3300028379 Bacteria 277346
303 Ga0268266_10478692 3300028379 Bacteria 1186
304 Ga0268265_10000002 3300028380 Bacteria 1035381
305 Ga0268265_10000003 3300028380 Bacteria 949201
306 Ga0268265_10000209 3300028380 Bacteria 68317
307 Ga0268265_10067046 3300028380 Bacteria 2777
308 Ga0268264_10001688 3300028381 Bacteria 20359
309 Ga0268264_10035651 3300028381 Bacteria 4096
310 Ga0307517_10036833 3300028786 Bacteria 5487
311 Ga0265327_10021786 3300031251 Bacteria 3856
312 Ga0307513_10047707 3300031456 Bacteria 4656
313 Ga0307513_10106203 3300031456 Bacteria 2815
314 Ga0307509_10039174 3300031507 Bacteria 5164
315 Ga0307516_10000124 3300031730 Bacteria 90831
316 Ga0307405_10000984 3300031731 Bacteria 11444
317 Ga0307405_10041062 3300031731 Bacteria 2806
318 Ga0307405_10324102 3300031731 Bacteria 1178
319 Ga0307413_10193592 3300031824 Bacteria 1462
320 Ga0307410_10015940 3300031852 Bacteria 4468
321 Ga0307410_10091326 3300031852 Bacteria 2162
322 Ga0307410_10126182 3300031852 Bacteria 1874
323 Ga0307410_10138649 3300031852 Bacteria 1796
324 Ga0307407_10005830 3300031903 Bacteria 5397
325 Ga0307412_10001325 3300031911 Bacteria 13854
326 Ga0307412_10008903 3300031911 Bacteria 5750
327 Ga0307412_10197301 3300031911 Bacteria 1526
328 Ga0307409_100096041 3300031995 Bacteria 2444
329 Ga0307416_100021503 3300032002 Bacteria 4633
330 Ga0307416_100073907 3300032002 Bacteria 2845
331 Ga0307414_10031471 3300032004 Bacteria 3481
332 Ga0307414_10037321 3300032004 Bacteria 3252
333 Ga0307414_10070521 3300032004 Bacteria 2517
334 Ga0307414_10094390 3300032004 Bacteria 2233
335 Ga0307411_10001833 3300032005 Bacteria 9021
336 Ga0307411_10031770 3300032005 Bacteria 3254
337 Ga0307411_10044970 3300032005 Bacteria 2837
338 Ga0307510_10006886 3300033180 Bacteria 13556
339 Ga0315911_1000020 3300033442 Bacteria 139809
340 Ga0373948_0026470 3300034817 Bacteria 1143
341 Ga0373940_0007926 3300035088 Bacteria 2417
342 Ga0373931_0001118 3300035691 Bacteria 11387
343 Ga0316584_0073348 3300036712 Bacteria 2565
344 Ga0395899_0064186 3300037312 Bacteria 2700
345 Ga0395899_0159416 3300037312 Bacteria 1595
346 Ga0395900_0104269 3300037418 Bacteria 2913
347 Ga0395898_0034354 3300037466 Bacteria 5054
348 Ga0395898_0042842 3300037466 Bacteria 4464
349 Ga0395901_0005160 3300038443 Bacteria 13182
350 Ga0395901_0033293 3300038443 Bacteria 5319
351 Ga0395901_0059344 3300038443 Bacteria 3980
352 Ga0237819_00447 3300038705 Bacteria 14029
353 Ga0436361_0135420 3300039447 Bacteria 6667
354 Ga0436361_0576321 3300039447 Bacteria 12801
355 Ga0439465_0030902 3300041413 Bacteria 1705
356 Ga0439445_0006434 3300042004 Bacteria 2699
357 Ga0439432_014209 3300042006 Bacteria 2696
358 Ga0451576_0000165 3300045051 Bacteria 168085
359 Ga0466967_0154387 3300045976 Bacteria 2149
360 Ga0495617_002500 3300046452 Bacteria 7296
361 Ga0495627_008481 3300046453 Bacteria 3850
362 Ga0495603_0193295 3300046455 Bacteria 1176
363 Ga0495638_0000228 3300046460 Bacteria 76924
364 Ga0495638_0001229 3300046460 Bacteria 24256
365 Ga0495650_0000116 3300046471 Bacteria 189814
366 Ga0495584_0037041 3300046491 Bacteria 2464
367 Ga0495585_0004302 3300046492 Bacteria 9272
368 Ga0495585_0015835 3300046492 Bacteria 4377
369 Ga0495596_0028573 3300046500 Bacteria 2238
370 Ga0495607_0008283 3300046501 Bacteria 7111
371 Ga0495583_0003091 3300046506 Bacteria 13172
372 Ga0495583_0014370 3300046506 Bacteria 4372
373 Ga0495583_0034938 3300046506 Bacteria 2404
374 Ga0495583_0053120 3300046506 Bacteria 1840
375 Ga0495583_0086829 3300046506 Bacteria 1352
376 Ga0495606_0000121 3300046507 Bacteria 132126
377 Ga0495606_0000365 3300046507 Bacteria 77476
378 Ga0495606_0001372 3300046507 Bacteria 32946
379 Ga0495610_0004208 3300046512 Bacteria 10737
380 Ga0495610_0017650 3300046512 Bacteria 4062
381 Ga0495616_0051592 3300046513 Bacteria 2051
382 Ga0495620_0000536 3300046515 Bacteria 24289
383 Ga0495637_0007355 3300046520 Bacteria 5466
384 Ga0495643_0001259 3300046522 Bacteria 24272
385 Ga0495643_0002379 3300046522 Bacteria 15027
386 Ga0495643_0041793 3300046522 Bacteria 2499
387 Ga0495648_0000501 3300046524 Bacteria 42180
388 Ga0495648_0001353 3300046524 Bacteria 24233
389 Ga0495663_0000193 3300046525 Bacteria 24289
390 Ga0495642_0009352 3300046528 Bacteria 3752
391 Ga0495654_0069363 3300046530 Bacteria 1674
392 Ga0495609_0005047 3300046538 Bacteria 7051
393 Ga0495622_0034265 3300046557 Bacteria 2369
394 Ga0495633_0000776 3300046558 Bacteria 28552
395 Ga0495633_0038327 3300046558 Bacteria 2290
396 Ga0495668_0000056 3300046616 Bacteria 197862
397 Ga0495668_0023575 3300046616 Bacteria 3507
398 Ga0495611_0000463 3300046648 Bacteria 24283
399 Ga0495611_0033612 3300046648 Bacteria 2263
400 Ga0495611_0049659 3300046648 Bacteria 1888
401 Ga0495625_0000595 3300046660 Bacteria 52588
402 Ga0495625_0001838 3300046660 Bacteria 24245
403 Ga0495625_0008265 3300046660 Bacteria 8898
404 Ga0495625_0009806 3300046660 Bacteria 7968
405 Ga0495625_0017249 3300046660 Bacteria 5653
406 Ga0495625_0018777 3300046660 Bacteria 5386
407 Ga0495625_0147406 3300046660 Bacteria 1584
408 Ga0495625_0205716 3300046660 Bacteria 1296
409 Ga0495661_0025676 3300046665 Bacteria 3803
410 Ga0495588_0000706 3300046674 Bacteria 15412
411 Ga0495588_0002067 3300046674 Bacteria 8593
412 Ga0495669_0000011 3300046684 Bacteria 158720
413 Ga0495613_0050162 3300046689 Bacteria 3078
414 Ga0495670_0000275 3300046691 Bacteria 24200
415 Ga0495671_0000711 3300046692 Bacteria 24060
416 Ga0495649_0000872 3300046694 Bacteria 24220
417 Ga0495600_0001508 3300046809 Bacteria 12912
418 Ga0495660_0010535 3300046810 Bacteria 5379
419 Ga0495660_0061970 3300046810 Bacteria 2006
420 Ga0495672_0073377 3300047320 Bacteria 1930
421 Ga0495672_0134131 3300047320 Bacteria 1300
422 Ga0495683_0005583 3300047323 Bacteria 6974
423 Ga0495687_000077 3300047443 Bacteria 148889
424 Ga0495687_000082 3300047443 Bacteria 147137
425 Ga0495687_001242 3300047443 Bacteria 24296
426 Ga0495687_008341 3300047443 Bacteria 5944
427 Ga0495677_0003902 3300047445 Bacteria 5768
428 Ga0495673_0024609 3300047469 Bacteria 2905
429 Ga0495673_0040127 3300047469 Bacteria 2118
430 Ga0495681_0000799 3300047470 Bacteria 24223
431 Ga0495681_0006477 3300047470 Bacteria 7690
432 Ga0495681_0008663 3300047470 Bacteria 6351
433 Ga0495681_0030016 3300047470 Bacteria 2775
434 Ga0495686_0000147 3300047472 Bacteria 139008
435 Ga0495686_0001570 3300047472 Bacteria 24278
436 Ga0495686_0001622 3300047472 Bacteria 23546
437 Ga0495686_0003568 3300047472 Bacteria 13364
438 Ga0495686_0067515 3300047472 Bacteria 2207
439 Ga0496113_0105231 3300048916 Bacteria 2191
440 Ga0496115_0039814 3300048918 Bacteria 3734
441 Ga0496116_0103947 3300048919 Bacteria 1689
442 Ga0496117_0003086 3300048920 Bacteria 19943
443 Ga0496117_0051306 3300048920 Bacteria 2917
444 Ga0496117_0099003 3300048920 Bacteria 1852
445 Ga0496118_0002584 3300048921 Bacteria 24182
446 Ga0496118_0017269 3300048921 Bacteria 6580
447 Ga0496118_0062491 3300048921 Bacteria 2749
448 Ga0496118_0299106 3300048921 Bacteria 884
449 Ga0496119_0047406 3300048922 Bacteria 2674
450 Ga0496119_0095532 3300048922 Bacteria 1679
451 Ga0496120_0060834 3300048923 Bacteria 2111
452 Ga0496121_0000190 3300048924 Bacteria 136607
453 Ga0496121_0010582 3300048924 Bacteria 10369
454 Ga0496121_0013290 3300048924 Bacteria 8864
455 Ga0496121_0096304 3300048924 Bacteria 2297
456 Ga0496121_0163275 3300048924 Bacteria 1626
457 Ga0496123_0002334 3300048926 Bacteria 23810
458 Ga0496123_0030968 3300048926 Bacteria 3903
459 Ga0496123_0077351 3300048926 Bacteria 2044
460 Ga0496125_0000463 3300048928 Bacteria 72745
461 Ga0496126_0002972 3300048929 Bacteria 22018
462 Ga0496126_0013440 3300048929 Bacteria 8324
463 Ga0496126_0070344 3300048929 Bacteria 3118
464 Ga0496126_0140159 3300048929 Bacteria 2082
465 Ga0495678_000995 3300049459 Bacteria 24253
466 Ga0495682_0000603 3300049460 Bacteria 24205
467 Ga0495682_0030271 3300049460 Bacteria 2003
468 Ga0501032_0050124 3300049569 Bacteria 2816
469 Ga0501032_0131814 3300049569 Bacteria 1649
470 Ga0501033_0023605 3300049570 Bacteria 4639
471 Ga0501033_0136317 3300049570 Bacteria 1776
472 Ga0501033_0248595 3300049570 Bacteria 1261
473 Ga0501034_0184628 3300049571 Bacteria 2049
474 Ga0501034_0265915 3300049571 Bacteria 1657
475 Ga0501034_0408676 3300049571 Bacteria 1280
476 Ga0501034_0431734 3300049571 Bacteria 1237
477 Ga0501036_0123915 3300049572 Bacteria 2183
478 Ga0501036_0323605 3300049572 Bacteria 1288
479 Ga0501036_0476341 3300049572 Bacteria 1039
480 Ga0501037_0067361 3300049573 Bacteria 2607
481 Ga0501038_0089212 3300049574 Bacteria 2587
482 Ga0501038_0173094 3300049574 Bacteria 1746
483 Ga0501039_0163210 3300049575 Bacteria 1752
484 Ga0501043_0010983 3300049579 Bacteria 7094
485 Ga0501043_0155563 3300049579 Bacteria 1788
486 Ga0501043_0389889 3300049579 Bacteria 1053
487 Ga0501046_0083791 3300049580 Bacteria 2460
488 Ga0501047_0043282 3300049581 Bacteria 4349
489 Ga0501047_0058666 3300049581 Bacteria 3717
490 Ga0501069_0018652 3300049585 Bacteria 3746
491 Ga0501070_0003797 3300049586 Bacteria 13053
492 Ga0501070_0074329 3300049586 Bacteria 2813
493 Ga0501074_0036478 3300049590 Bacteria 3561
494 Ga0501074_0055525 3300049590 Bacteria 2854
495 Ga0501224_000818 3300049664 Bacteria 3947
496 Ga0501249_000074 3300049679 Bacteria 34243
497 Ga0501080_0007654 3300049742 Bacteria 9769
498 Ga0501080_0021221 3300049742 Bacteria 6010
499 Ga0501080_0158891 3300049742 Bacteria 2088
500 Ga0501080_0236135 3300049742 Bacteria 1670
501 Ga0501083_0017964 3300049744 Bacteria 4933
502 Ga0501282_004189 3300049778 Bacteria 1544
503 Ga0501035_0000806 3300049822 Bacteria 33416
504 Ga0501035_0205362 3300049822 Bacteria 1688
505 Ga0501044_0005415 3300049823 Bacteria 14179
506 Ga0501044_0032390 3300049823 Bacteria 5496
507 Ga0501044_0046648 3300049823 Bacteria 4485
508 Ga0501044_0088059 3300049823 Bacteria 3135
509 Ga0501044_0110069 3300049823 Bacteria 2763
510 Ga0501044_0139349 3300049823 Bacteria 2415
511 Ga0501044_0147813 3300049823 Bacteria 2334
512 Ga0501044_0193600 3300049823 Bacteria 1994
513 Ga0501204_000051 3300049850 Bacteria 8444
514 nmdc:mga03683_14158_c1 3300050489 Bacteria 2334
515 nmdc:mga03683_40441_c1 3300050489 Bacteria 1912
516 nmdc:mga03683_517_c1 3300050489 Bacteria 11047
517 nmdc:mga03n38_2113_c1 3300050490 Bacteria 6034
518 nmdc:mga00v17_3230_c1 3300050491 Bacteria 8396
519 nmdc:mga00v17_8426_c1 3300050491 Bacteria 5548
520 nmdc:mga0yw44_8124_c1 3300050492 Bacteria 5211
521 nmdc:mga06z11_149898_c1 3300050494 Bacteria 1325
522 nmdc:mga06z11_5952_c1 3300050494 Bacteria 4929
523 nmdc:mga04h51_27272_c1 3300050495 Bacteria 1773
524 nmdc:mga04h51_281_c1 3300050495 Bacteria 13079
525 nmdc:mga07m45_17_c1 3300050496 Bacteria 140936
526 nmdc:mga07m45_2586_c2 3300050496 Bacteria 7812
527 nmdc:mga0qj67_43047_c1 3300050509 Bacteria 3556
528 nmdc:mga0qj67_58117_c1 3300050509 Bacteria 3066
529 nmdc:mga0qj67_63234_c1 3300050509 Bacteria 2943
530 nmdc:mga06r32_90277_c1 3300050510 Bacteria 2993
531 nmdc:mga08y16_506733_c1 3300050511 Bacteria 1226
532 nmdc:mga0n895_6895_c1 3300050512 Bacteria 9704
533 nmdc:mga0rr50_7271_c1 3300050513 Bacteria 6813
534 nmdc:mga0a205_4365_c1 3300050515 Bacteria 12685
535 nmdc:mga0sz30_16854_c1 3300050516 Bacteria 2906
536 Ga0495612_0025423 3300053078 Bacteria 2377
537 Ga0500610_0000153 3300053079 Bacteria 20661
538 Ga0495619_0255076 3300053085 Bacteria 1215
539 Ga0500578_0001827 3300053086 Bacteria 19865
540 Ga0500643_000837 3300053087 Bacteria 19751
541 Ga0500643_000962 3300053087 Bacteria 17881
542 Ga0500643_039242 3300053087 Bacteria 1399
543 Ga0500583_0000561 3300053092 Bacteria 11264
544 Ga0500651_0098582 3300053093 Bacteria 1794
545 Ga0500566_0000074 3300053094 Bacteria 48359
546 Ga0500566_0066052 3300053094 Bacteria 2039
547 Ga0500640_021171 3300053095 Bacteria 2803
548 Ga0500555_023414 3300053103 Bacteria 1771
549 Ga0500572_000526 3300053111 Bacteria 13074
550 Ga0500572_002714 3300053111 Bacteria 4185
551 Ga0500592_001253 3300053116 Bacteria 4135
552 Ga0500595_003745 3300053119 Bacteria 7007
553 Ga0500607_000240 3300053121 Bacteria 51266
554 Ga0500608_000196 3300053122 Bacteria 24244
555 Ga0500608_000791 3300053122 Bacteria 11531
556 Ga0500608_034797 3300053122 Bacteria 2400
557 Ga0500618_000598 3300053125 Bacteria 22218
558 Ga0500618_030124 3300053125 Bacteria 1278
559 Ga0500658_0001895 3300053134 Bacteria 8205
560 Ga0500559_0001740 3300053136 Bacteria 11945
561 Ga0500559_0051429 3300053136 Bacteria 1819
562 Ga0500564_002564 3300053138 Bacteria 6763
563 Ga0500574_000039 3300053141 Bacteria 16536
564 Ga0500588_0027186 3300053146 Bacteria 1609
565 Ga0500590_081792 3300053148 Bacteria 1585
566 Ga0500603_000030 3300053150 Bacteria 34154
567 Ga0500616_0001447 3300053153 Bacteria 22718
568 Ga0500616_0010848 3300053153 Bacteria 5431
569 Ga0500619_001406 3300053154 Bacteria 4248
570 Ga0500627_0004340 3300053158 Bacteria 4538
571 Ga0500630_003168 3300053159 Bacteria 7958
572 Ga0500638_019537 3300053162 Bacteria 3178
573 Ga0500639_000047 3300053163 Bacteria 57835
574 Ga0500639_029497 3300053163 Bacteria 2900
575 Ga0500636_0000549 3300053177 Bacteria 20436
576 Ga0500636_0060436 3300053177 Bacteria 2212
577 Ga0500567_000952 3300053723 Bacteria 11069
578 Ga0500567_033554 3300053723 Bacteria 2420
579 Ga0500576_073676 3300053725 Bacteria 1461
580 Ga0500625_000009 3300053729 Bacteria 159296
581 Ga0500645_000001 3300053730 Bacteria 455558
582 Ga0500596_002505 3300053735 Bacteria 3621
583 Ga0500596_003353 3300053735 Bacteria 3058
584 Ga0500587_001697 3300053739 Bacteria 3132
585 Ga0501084_0100347 3300054114 Bacteria 2431
586 Ga0500661_016382 3300055283 Bacteria 1326
587 Ga0501082_0062116 3300060353 Bacteria 3215

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048921 Ga0496118_0299106 Ga0496118_0299106_43_858 252
2 3300050511 nmdc:mga08y16_506733_c1 nmdc:mga08y16_506733_c1_42_908 253
3 3300049570 Ga0501033_0136317 Ga0501033_0136317_896_1759 270
4 3300032004 Ga0307414_10031471 Ga0307414_100314714 277
5 3300005983 Ga0081540_1024709 Ga0081540_10247092 285
6 3300049579 Ga0501043_0389889 Ga0501043_0389889_20_889 288
7 3300046455 Ga0495603_0193295 Ga0495603_0193295_80_1006 289
8 3300006881 Ga0068865_100021672 Ga0068865_1000216726 294
9 3300005842 Ga0068858_100214795 Ga0068858_1002147953 296
10 3300025900 Ga0207710_10039423 Ga0207710_100394233 296
11 3300005983 Ga0081540_1000165 Ga0081540_100016527 298
12 3300006871 Ga0075434_100001535 Ga0075434_1000015354 298
13 3300007076 Ga0075435_100055003 Ga0075435_1000550031 298
14 3300009094 Ga0111539_10020045 Ga0111539_100200458 298
15 3300035088 Ga0373940_0007926 Ga0373940_0007926_1151_2152 298
16 3300035691 Ga0373931_0001118 Ga0373931_0001118_8598_9599 298
17 3300050512 nmdc:mga0n895_6895_c1 nmdc:mga0n895_6895_c1_924_1925 298
18 3300050513 nmdc:mga0rr50_7271_c1 nmdc:mga0rr50_7271_c1_3250_4251 298
19 3300050515 nmdc:mga0a205_4365_c1 nmdc:mga0a205_4365_c1_3702_4703 298
20 3300046660 Ga0495625_0147406 Ga0495625_0147406_632_1570 299
21 3300003759 Ga0055525_1000248 Ga0055525_100024820 300
22 3300025230 Ga0209563_100066 Ga0209563_10006647 300
23 3300034817 Ga0373948_0026470 Ga0373948_0026470_72_1079 300
24 3300003762 Ga0055542_1000040 Ga0055542_100004052 302
25 3300003763 Ga0055529_1000037 Ga0055529_1000037169 302
26 3300025254 Ga0209148_1000011 Ga0209148_1000011949 302
27 3300025272 Ga0209455_1000006 Ga0209455_1000006243 302
28 3300049571 Ga0501034_0265915 Ga0501034_0265915_734_1645 302
29 3300048921 Ga0496118_0062491 Ga0496118_0062491_279_1280 304
30 3300048924 Ga0496121_0096304 Ga0496121_0096304_889_1890 304
31 3300049572 Ga0501036_0323605 Ga0501036_0323605_319_1269 304
32 3300049580 Ga0501046_0083791 Ga0501046_0083791_899_1912 304
33 3300049581 Ga0501047_0043282 Ga0501047_0043282_2249_3262 304
34 3300049586 Ga0501070_0074329 Ga0501070_0074329_253_1266 304
35 3300049590 Ga0501074_0055525 Ga0501074_0055525_1564_2577 304
36 3300049742 Ga0501080_0021221 Ga0501080_0021221_1580_2593 304
37 3300046492 Ga0495585_0004302 Ga0495585_0004302_3867_4877 305
38 3300046522 Ga0495643_0041793 Ga0495643_0041793_788_1798 305
39 3300046660 Ga0495625_0000595 Ga0495625_0000595_46152_47162 305
40 3300046528 Ga0495642_0009352 Ga0495642_0009352_279_1289 306
41 3300047445 Ga0495677_0003902 Ga0495677_0003902_3483_4493 306
42 3300047470 Ga0495681_0006477 Ga0495681_0006477_543_1553 306
43 3300006186 Ga0075369_10017848 Ga0075369_100178482 307
44 3300006942 Ga0099824_1001145 Ga0099824_100114529 307
45 3300006943 Ga0099822_1000135 Ga0099822_100013530 307
46 3300025272 Ga0209455_1015969 Ga0209455_10159692 307
47 3300027357 Ga0209589_1000017 Ga0209589_1000017122 307
48 3300027361 Ga0209489_100018 Ga0209489_100018122 307
49 3300027363 Ga0209700_100028 Ga0209700_100028122 307
50 3300050516 nmdc:mga0sz30_16854_c1 nmdc:mga0sz30_16854_c1_695_1699 307
51 3300002244 JGI24742J22300_10000498 JGI24742J22300_100004989 308
52 3300005356 Ga0070674_100000638 Ga0070674_1000006386 308
53 3300005364 Ga0070673_100114741 Ga0070673_1001147412 308
54 3300005456 Ga0070678_100000022 Ga0070678_10000002239 308
55 3300009148 Ga0105243_10000223 Ga0105243_1000022357 308
56 3300025935 Ga0207709_10000078 Ga0207709_1000007857 308
57 3300025937 Ga0207669_10000105 Ga0207669_1000010526 308
58 3300025960 Ga0207651_10108306 Ga0207651_101083064 308
59 3300026121 Ga0207683_10000156 Ga0207683_1000015622 308
60 3300025933 Ga0207706_10045905 Ga0207706_100459052 309
61 3300046558 Ga0495633_0000776 Ga0495633_0000776_4568_5578 309
62 3300046648 Ga0495611_0049659 Ga0495611_0049659_243_1253 309
63 3300047323 Ga0495683_0005583 Ga0495683_0005583_739_1749 309
64 3300048916 Ga0496113_0105231 Ga0496113_0105231_704_1714 309
65 3300048926 Ga0496123_0077351 Ga0496123_0077351_393_1403 309
66 3300048928 Ga0496125_0000463 Ga0496125_0000463_26471_27481 309
67 3300009093 Ga0105240_10071202 Ga0105240_100712024 310
68 3300048918 Ga0496115_0039814 Ga0496115_0039814_1929_2912 310
69 3300005339 Ga0070660_100083657 Ga0070660_1000836571 311
70 3300005355 Ga0070671_100204743 Ga0070671_1002047432 311
71 3300005366 Ga0070659_100202973 Ga0070659_1002029731 311
72 3300005539 Ga0068853_100287715 Ga0068853_1002877151 311
73 3300005563 Ga0068855_100047788 Ga0068855_1000477882 311
74 3300005577 Ga0068857_100186931 Ga0068857_1001869312 311
75 3300005937 Ga0081455_10047844 Ga0081455_100478442 311
76 3300005983 Ga0081540_1004986 Ga0081540_10049869 311
77 3300010375 Ga0105239_10359976 Ga0105239_103599762 311
78 3300013105 Ga0157369_10065800 Ga0157369_100658006 311
79 3300017792 Ga0163161_10198751 Ga0163161_101987512 311
80 3300025919 Ga0207657_10025733 Ga0207657_100257332 311
81 3300025925 Ga0207650_10035633 Ga0207650_100356335 311
82 3300025932 Ga0207690_10011749 Ga0207690_100117492 311
83 3300025981 Ga0207640_10163045 Ga0207640_101630452 311
84 3300026041 Ga0207639_10117282 Ga0207639_101172822 311
85 3300026116 Ga0207674_10289561 Ga0207674_102895612 311
86 3300046506 Ga0495583_0034938 Ga0495583_0034938_756_1766 311
87 3300046524 Ga0495648_0000501 Ga0495648_0000501_26537_27547 311
88 3300046660 Ga0495625_0018777 Ga0495625_0018777_1548_2558 311
89 3300047470 Ga0495681_0030016 Ga0495681_0030016_1512_2522 311
90 3300049571 Ga0501034_0431734 Ga0501034_0431734_75_1076 311
91 3300053094 Ga0500566_0000074 Ga0500566_0000074_18068_19051 311
92 3300053095 Ga0500640_021171 Ga0500640_021171_816_1799 311
93 3300053111 Ga0500572_002714 Ga0500572_002714_176_1159 311
94 3300053150 Ga0500603_000030 Ga0500603_000030_2440_3423 311
95 3300053159 Ga0500630_003168 Ga0500630_003168_4659_5642 311
96 3300053162 Ga0500638_019537 Ga0500638_019537_734_1717 311
97 3300053163 Ga0500639_000047 Ga0500639_000047_47513_48496 311
98 3300053739 Ga0500587_001697 Ga0500587_001697_11_946 311
99 3300055283 Ga0500661_016382 Ga0500661_016382_11_994 311
100 3300046500 Ga0495596_0028573 Ga0495596_0028573_251_1261 312
101 3300046660 Ga0495625_0017249 Ga0495625_0017249_4614_5624 312
102 3300053153 Ga0500616_0001447 Ga0500616_0001447_8125_9120 312
103 3300037466 Ga0395898_0042842 Ga0395898_0042842_886_1887 313
104 3300005356 Ga0070674_100035455 Ga0070674_1000354552 314
105 3300025901 Ga0207688_10099229 Ga0207688_100992292 314
106 3300025937 Ga0207669_10000393 Ga0207669_1000039320 314
107 3300046507 Ga0495606_0000365 Ga0495606_0000365_5118_6128 314
108 3300049823 Ga0501044_0110069 Ga0501044_0110069_1186_2196 314
109 3300053111 Ga0500572_000526 Ga0500572_000526_7278_8288 314
110 3300053136 Ga0500559_0001740 Ga0500559_0001740_1116_2126 314
111 3300053163 Ga0500639_029497 Ga0500639_029497_581_1591 314
112 3300053725 Ga0500576_073676 Ga0500576_073676_406_1416 314
113 3300053735 Ga0500596_002505 Ga0500596_002505_677_1687 314
114 3300005293 Ga0065715_10130045 Ga0065715_101300452 315
115 3300005327 Ga0070658_10138276 Ga0070658_101382763 315
116 3300005457 Ga0070662_100036221 Ga0070662_1000362213 315
117 3300005539 Ga0068853_100110663 Ga0068853_1001106633 315
118 3300005564 Ga0070664_100048559 Ga0070664_1000485593 315
119 3300009098 Ga0105245_10277996 Ga0105245_102779961 315
120 3300009177 Ga0105248_10182355 Ga0105248_101823552 315
121 3300048920 Ga0496117_0051306 Ga0496117_0051306_1560_2564 315
122 3300048922 Ga0496119_0047406 Ga0496119_0047406_325_1329 315
123 3300048924 Ga0496121_0000190 Ga0496121_0000190_67052_68056 315
124 3300048929 Ga0496126_0013440 Ga0496126_0013440_4962_5966 315
125 3300005335 Ga0070666_10136590 Ga0070666_101365902 316
126 3300005617 Ga0068859_100015406 Ga0068859_1000154064 316
127 3300005842 Ga0068858_100001051 Ga0068858_1000010518 316
128 3300006931 Ga0097620_100015406 Ga0097620_1000154064 316
129 3300009551 Ga0105238_10024694 Ga0105238_100246943 316
130 3300025903 Ga0207680_10305983 Ga0207680_103059831 316
131 3300026035 Ga0207703_10005193 Ga0207703_100051934 316
132 3300031852 Ga0307410_10015940 Ga0307410_100159404 316
133 3300032005 Ga0307411_10001833 Ga0307411_100018334 316
134 3300039447 Ga0436361_0576321 Ga0436361_0576321_11533_12540 316
135 3300046616 Ga0495668_0000056 Ga0495668_0000056_13470_14480 316
136 3300047469 Ga0495673_0024609 Ga0495673_0024609_301_1311 316
137 3300047472 Ga0495686_0000147 Ga0495686_0000147_105122_106132 316
138 3300049572 Ga0501036_0476341 Ga0501036_0476341_77_1027 316
139 3300005329 Ga0070683_100056792 Ga0070683_1000567923 317
140 3300005344 Ga0070661_100061805 Ga0070661_1000618052 317
141 3300005535 Ga0070684_100016945 Ga0070684_1000169455 317
142 3300005564 Ga0070664_100074157 Ga0070664_1000741574 317
143 3300005578 Ga0068854_100010375 Ga0068854_1000103758 317
144 3300005614 Ga0068856_100012002 Ga0068856_1000120025 317
145 3300006178 Ga0075367_10010625 Ga0075367_100106253 317
146 3300010375 Ga0105239_10060857 Ga0105239_100608575 317
147 3300013100 Ga0157373_10010676 Ga0157373_100106766 317
148 3300013102 Ga0157371_10038953 Ga0157371_100389534 317
149 3300013105 Ga0157369_10054508 Ga0157369_100545084 317
150 3300013105 Ga0157369_10300426 Ga0157369_103004263 317
151 3300025920 Ga0207649_10034494 Ga0207649_100344945 317
152 3300025944 Ga0207661_10055952 Ga0207661_100559524 317
153 3300025945 Ga0207679_10014287 Ga0207679_100142873 317
154 3300025945 Ga0207679_10048575 Ga0207679_100485754 317
155 3300025981 Ga0207640_10057376 Ga0207640_100573763 317
156 3300026041 Ga0207639_10120358 Ga0207639_101203582 317
157 3300026078 Ga0207702_10011567 Ga0207702_100115676 317
158 3300037418 Ga0395900_0104269 Ga0395900_0104269_179_1180 317
159 3300037466 Ga0395898_0034354 Ga0395898_0034354_3318_4325 317
160 3300038443 Ga0395901_0059344 Ga0395901_0059344_2781_3788 317
161 3300038705 Ga0237819_00447 Ga0237819_00447_3166_4170 317
162 3300048924 Ga0496121_0013290 Ga0496121_0013290_5581_6588 317
163 3300048926 Ga0496123_0030968 Ga0496123_0030968_1576_2583 317
164 3300049823 Ga0501044_0046648 Ga0501044_0046648_2610_3614 317
165 3300050494 nmdc:mga06z11_149898_c1 nmdc:mga06z11_149898_c1_35_1045 317
166 3300002076 JGI24749J21850_1000021 JGI24749J21850_100002117 318
167 3300002459 JGI24751J29686_10000778 JGI24751J29686_100007784 318
168 3300005295 Ga0065707_10082787 Ga0065707_1008278711 318
169 3300005331 Ga0070670_100000031 Ga0070670_10000003134 318
170 3300005347 Ga0070668_100261563 Ga0070668_1002615632 318
171 3300005353 Ga0070669_100000015 Ga0070669_100000015141 318
172 3300005367 Ga0070667_100000396 Ga0070667_10000039643 318
173 3300005548 Ga0070665_100000023 Ga0070665_100000023194 318
174 3300005617 Ga0068859_100015675 Ga0068859_1000156754 318
175 3300005618 Ga0068864_100000248 Ga0068864_10000024834 318
176 3300005719 Ga0068861_100019313 Ga0068861_1000193132 318
177 3300005844 Ga0068862_100000006 Ga0068862_100000006188 318
178 3300005983 Ga0081540_1065550 Ga0081540_10655502 318
179 3300006931 Ga0097620_100015675 Ga0097620_1000156754 318
180 3300009093 Ga0105240_10462003 Ga0105240_104620032 318
181 3300009177 Ga0105248_10000066 Ga0105248_10000066101 318
182 3300009553 Ga0105249_10119925 Ga0105249_101199252 318
183 3300014325 Ga0163163_10024188 Ga0163163_100241882 318
184 3300014326 Ga0157380_10000124 Ga0157380_1000012410 318
185 3300025302 Ga0207426_1015349 Ga0207426_10153494 318
186 3300025923 Ga0207681_10000001 Ga0207681_10000001863 318
187 3300025925 Ga0207650_10000055 Ga0207650_1000005534 318
188 3300025941 Ga0207711_10002672 Ga0207711_100026729 318
189 3300025986 Ga0207658_10002544 Ga0207658_1000254411 318
190 3300026095 Ga0207676_10000004 Ga0207676_10000004133 318
191 3300026116 Ga0207674_10161421 Ga0207674_101614213 318
192 3300026118 Ga0207675_100000818 Ga0207675_10000081813 318
193 3300028379 Ga0268266_10000002 Ga0268266_100000021284 318
194 3300028380 Ga0268265_10000002 Ga0268265_10000002913 318
195 3300031852 Ga0307410_10126182 Ga0307410_101261822 318
196 3300032004 Ga0307414_10070521 Ga0307414_100705212 318
197 3300046471 Ga0495650_0000116 Ga0495650_0000116_11046_12059 318
198 3300046506 Ga0495583_0003091 Ga0495583_0003091_1079_2092 318
199 3300046522 Ga0495643_0002379 Ga0495643_0002379_9050_10060 318
200 3300046809 Ga0495600_0001508 Ga0495600_0001508_8425_9438 318
201 3300047443 Ga0495687_000082 Ga0495687_000082_53126_54139 318
202 3300053085 Ga0495619_0255076 Ga0495619_0255076_168_1190 318
203 3300053119 Ga0500595_003745 Ga0500595_003745_4956_5969 318
204 3300053154 Ga0500619_001406 Ga0500619_001406_3075_4088 318
205 3300053177 Ga0500636_0000549 Ga0500636_0000549_14048_15061 318
206 3300053735 Ga0500596_003353 Ga0500596_003353_964_1977 318
207 3300005618 Ga0068864_100001303 Ga0068864_10000130312 319
208 3300005841 Ga0068863_100005967 Ga0068863_1000059676 319
209 3300005843 Ga0068860_100008843 Ga0068860_1000088434 319
210 3300006038 Ga0075365_10009177 Ga0075365_100091776 319
211 3300006042 Ga0075368_10064201 Ga0075368_100642011 319
212 3300006051 Ga0075364_10025783 Ga0075364_100257833 319
213 3300006177 Ga0075362_10047535 Ga0075362_100475352 319
214 3300012513 Ga0157326_1000881 Ga0157326_10008815 319
215 3300014325 Ga0163163_10011709 Ga0163163_100117093 319
216 3300014968 Ga0157379_10002599 Ga0157379_100025998 319
217 3300026088 Ga0207641_10007467 Ga0207641_100074673 319
218 3300026095 Ga0207676_10007036 Ga0207676_100070362 319
219 3300027866 Ga0209813_10044096 Ga0209813_100440961 319
220 3300031251 Ga0265327_10021786 Ga0265327_100217863 319
221 3300031456 Ga0307513_10047707 Ga0307513_100477073 319
222 3300031995 Ga0307409_100096041 Ga0307409_1000960412 319
223 3300032004 Ga0307414_10094390 Ga0307414_100943902 319
224 3300032005 Ga0307411_10031770 Ga0307411_100317704 319
225 3300038443 Ga0395901_0033293 Ga0395901_0033293_3649_4662 319
226 3300047320 Ga0495672_0134131 Ga0495672_0134131_115_1116 319
227 3300048929 Ga0496126_0002972 Ga0496126_0002972_3901_4908 319
228 3300049572 Ga0501036_0123915 Ga0501036_0123915_901_1905 319
229 3300049823 Ga0501044_0088059 Ga0501044_0088059_260_1264 319
230 3300050489 nmdc:mga03683_40441_c1 nmdc:mga03683_40441_c1_329_1342 319
231 3300050491 nmdc:mga00v17_8426_c1 nmdc:mga00v17_8426_c1_4106_5119 319
232 3300050492 nmdc:mga0yw44_8124_c1 nmdc:mga0yw44_8124_c1_2222_3235 319
233 3300050495 nmdc:mga04h51_27272_c1 nmdc:mga04h51_27272_c1_288_1301 319
234 3300053078 Ga0495612_0025423 Ga0495612_0025423_644_1654 319
235 3300053087 Ga0500643_039242 Ga0500643_039242_218_1222 319
236 3300005327 Ga0070658_10033562 Ga0070658_100335622 320
237 3300005336 Ga0070680_100011597 Ga0070680_1000115975 320
238 3300005339 Ga0070660_100006530 Ga0070660_1000065307 320
239 3300005344 Ga0070661_100001494 Ga0070661_1000014943 320
240 3300005366 Ga0070659_100013228 Ga0070659_1000132284 320
241 3300005434 Ga0070709_10003317 Ga0070709_100033176 320
242 3300005435 Ga0070714_100051302 Ga0070714_1000513021 320
243 3300005436 Ga0070713_100000447 Ga0070713_10000044718 320
244 3300005437 Ga0070710_10001414 Ga0070710_100014149 320
245 3300005439 Ga0070711_100020818 Ga0070711_1000208183 320
246 3300005457 Ga0070662_100025275 Ga0070662_1000252752 320
247 3300005530 Ga0070679_100012918 Ga0070679_1000129187 320
248 3300005539 Ga0068853_100194169 Ga0068853_1001941692 320
249 3300005563 Ga0068855_100061805 Ga0068855_1000618054 320
250 3300005614 Ga0068856_100009932 Ga0068856_10000993211 320
251 3300006028 Ga0070717_10020113 Ga0070717_100201131 320
252 3300006163 Ga0070715_10000915 Ga0070715_100009155 320
253 3300006173 Ga0070716_100007776 Ga0070716_1000077762 320
254 3300006175 Ga0070712_100005054 Ga0070712_1000050547 320
255 3300013102 Ga0157371_10011311 Ga0157371_100113116 320
256 3300013104 Ga0157370_10032697 Ga0157370_100326972 320
257 3300013307 Ga0157372_10032556 Ga0157372_100325565 320
258 3300025261 Ga0209233_1022037 Ga0209233_10220373 320
259 3300025898 Ga0207692_10001959 Ga0207692_100019597 320
260 3300025906 Ga0207699_10001027 Ga0207699_100010274 320
261 3300025909 Ga0207705_10046995 Ga0207705_100469952 320
262 3300025912 Ga0207707_10036783 Ga0207707_100367832 320
263 3300025915 Ga0207693_10000774 Ga0207693_1000077418 320
264 3300025916 Ga0207663_10000645 Ga0207663_1000064512 320
265 3300025917 Ga0207660_10035201 Ga0207660_100352014 320
266 3300025919 Ga0207657_10018158 Ga0207657_100181586 320
267 3300025920 Ga0207649_10111957 Ga0207649_101119572 320
268 3300025921 Ga0207652_10010007 Ga0207652_100100078 320
269 3300025921 Ga0207652_10140975 Ga0207652_101409752 320
270 3300025929 Ga0207664_10007783 Ga0207664_100077837 320
271 3300025932 Ga0207690_10022480 Ga0207690_100224805 320
272 3300025933 Ga0207706_10001953 Ga0207706_100019532 320
273 3300025939 Ga0207665_10000289 Ga0207665_1000028918 320
274 3300025944 Ga0207661_10005344 Ga0207661_100053442 320
275 3300025949 Ga0207667_10028799 Ga0207667_100287994 320
276 3300026041 Ga0207639_10005058 Ga0207639_100050583 320
277 3300026078 Ga0207702_10157780 Ga0207702_101577802 320
278 3300026116 Ga0207674_10017135 Ga0207674_100171358 320
279 3300046507 Ga0495606_0000121 Ga0495606_0000121_81783_82790 320
280 3300046507 Ga0495606_0001372 Ga0495606_0001372_24152_25159 320
281 3300046616 Ga0495668_0023575 Ga0495668_0023575_755_1765 320
282 3300047472 Ga0495686_0001622 Ga0495686_0001622_2987_3994 320
283 3300049742 Ga0501080_0236135 Ga0501080_0236135_252_1259 320
284 3300049744 Ga0501083_0017964 Ga0501083_0017964_2734_3741 320
285 3300060353 Ga0501082_0062116 Ga0501082_0062116_1122_2129 320
286 3300003215 JGI25153J46596_10000008 JGI25153J46596_10000008214 321
287 3300005347 Ga0070668_100039301 Ga0070668_1000393015 321
288 3300006177 Ga0075362_10023271 Ga0075362_100232712 321
289 3300013102 Ga0157371_10067603 Ga0157371_100676035 321
290 3300025297 Ga0209758_1000017 Ga0209758_1000017572 321
291 3300025972 Ga0207668_10008869 Ga0207668_1000886912 321
292 3300041413 Ga0439465_0030902 Ga0439465_0030902_288_1298 321
293 3300050489 nmdc:mga03683_14158_c1 nmdc:mga03683_14158_c1_681_1679 321
294 3300050491 nmdc:mga00v17_3230_c1 nmdc:mga00v17_3230_c1_6859_7857 321
295 3300005347 Ga0070668_100172710 Ga0070668_1001727102 322
296 3300005530 Ga0070679_100052119 Ga0070679_1000521192 322
297 3300025921 Ga0207652_10038671 Ga0207652_100386712 322
298 3300037312 Ga0395899_0064186 Ga0395899_0064186_1182_2192 322
299 3300046453 Ga0495627_008481 Ga0495627_008481_977_1984 322
300 3300046460 Ga0495638_0000228 Ga0495638_0000228_43271_44278 322
301 3300046501 Ga0495607_0008283 Ga0495607_0008283_434_1441 322
302 3300046506 Ga0495583_0086829 Ga0495583_0086829_30_1037 322
303 3300046512 Ga0495610_0017650 Ga0495610_0017650_2551_3558 322
304 3300046520 Ga0495637_0007355 Ga0495637_0007355_3209_4216 322
305 3300046538 Ga0495609_0005047 Ga0495609_0005047_5847_6854 322
306 3300046557 Ga0495622_0034265 Ga0495622_0034265_148_1155 322
307 3300046558 Ga0495633_0038327 Ga0495633_0038327_473_1480 322
308 3300046660 Ga0495625_0008265 Ga0495625_0008265_5875_6882 322
309 3300046674 Ga0495588_0000706 Ga0495588_0000706_5371_6378 322
310 3300047443 Ga0495687_008341 Ga0495687_008341_3341_4348 322
311 3300047469 Ga0495673_0040127 Ga0495673_0040127_490_1497 322
312 3300047470 Ga0495681_0008663 Ga0495681_0008663_3212_4219 322
313 3300049460 Ga0495682_0030271 Ga0495682_0030271_251_1258 322
314 3300049569 Ga0501032_0050124 Ga0501032_0050124_535_1539 322
315 3300049570 Ga0501033_0023605 Ga0501033_0023605_2874_3878 322
316 3300049570 Ga0501033_0248595 Ga0501033_0248595_236_1246 322
317 3300049573 Ga0501037_0067361 Ga0501037_0067361_1142_2152 322
318 3300049574 Ga0501038_0089212 Ga0501038_0089212_545_1549 322
319 3300049574 Ga0501038_0173094 Ga0501038_0173094_553_1563 322
320 3300049575 Ga0501039_0163210 Ga0501039_0163210_325_1335 322
321 3300049579 Ga0501043_0010983 Ga0501043_0010983_1906_2910 322
322 3300049822 Ga0501035_0205362 Ga0501035_0205362_221_1231 322
323 3300053079 Ga0500610_0000153 Ga0500610_0000153_865_1875 322
324 3300053134 Ga0500658_0001895 Ga0500658_0001895_985_1992 322
325 3300014325 Ga0163163_10610483 Ga0163163_106104831 323
326 3300037312 Ga0395899_0159416 Ga0395899_0159416_473_1480 323
327 3300046491 Ga0495584_0037041 Ga0495584_0037041_712_1722 323
328 3300046506 Ga0495583_0014370 Ga0495583_0014370_294_1304 323
329 3300046648 Ga0495611_0033612 Ga0495611_0033612_168_1178 323
330 3300046660 Ga0495625_0205716 Ga0495625_0205716_274_1284 323
331 3300046684 Ga0495669_0000011 Ga0495669_0000011_53940_54950 323
332 3300046810 Ga0495660_0061970 Ga0495660_0061970_604_1614 323
333 3300047443 Ga0495687_000077 Ga0495687_000077_90479_91489 323
334 3300053730 Ga0500645_000001 Ga0500645_000001_167622_168632 323
335 3300003771 Ga0055526_1000610 Ga0055526_100061015 324
336 3300003775 Ga0055524_1000018 Ga0055524_100001814 324
337 3300006846 Ga0075430_100048717 Ga0075430_1000487173 324
338 3300025291 Ga0209675_1006307 Ga0209675_10063071 324
339 3300025295 Ga0209564_1000059 Ga0209564_1000059171 324
340 3300025299 Ga0209256_1000032 Ga0209256_100003216 324
341 3300031731 Ga0307405_10324102 Ga0307405_103241021 324
342 3300031911 Ga0307412_10001325 Ga0307412_100013253 324
343 3300047320 Ga0495672_0073377 Ga0495672_0073377_20_1030 324
344 3300050509 nmdc:mga0qj67_58117_c1 nmdc:mga0qj67_58117_c1_1133_2128 324
345 3300053122 Ga0500608_000791 Ga0500608_000791_10389_11393 324
346 3300053723 Ga0500567_000952 Ga0500567_000952_6251_7255 324
347 3300053729 Ga0500625_000009 Ga0500625_000009_120311_121315 324
348 3300031731 Ga0307405_10041062 Ga0307405_100410622 325
349 3300031852 Ga0307410_10138649 Ga0307410_101386492 325
350 3300005844 Ga0068862_100147244 Ga0068862_1001472443 326
351 3300021361 Ga0213872_10018493 Ga0213872_100184932 326
352 3300028380 Ga0268265_10067046 Ga0268265_100670463 326
353 3300031507 Ga0307509_10039174 Ga0307509_100391741 326
354 3300039447 Ga0436361_0135420 Ga0436361_0135420_1110_2105 326
355 3300053148 Ga0500590_081792 Ga0500590_081792_451_1458 326
356 3300048919 Ga0496116_0103947 Ga0496116_0103947_95_1102 327
357 3300048920 Ga0496117_0099003 Ga0496117_0099003_600_1607 327
358 3300048921 Ga0496118_0017269 Ga0496118_0017269_510_1517 327
359 3300048924 Ga0496121_0010582 Ga0496121_0010582_5250_6257 327
360 3300053093 Ga0500651_0098582 Ga0500651_0098582_447_1454 327
361 3300053146 Ga0500588_0027186 Ga0500588_0027186_538_1539 327
362 3300025261 Ga0209233_1002397 Ga0209233_10023973 328
363 3300028379 Ga0268266_10478692 Ga0268266_104786922 328
364 3300033442 Ga0315911_1000020 Ga0315911_100002078 328
365 3300054114 Ga0501084_0100347 Ga0501084_0100347_659_1666 328
366 iso_pu_bacteria 2882806704 2882806872 328
367 3300005563 Ga0068855_100265979 Ga0068855_1002659792 329
368 3300009545 Ga0105237_10134839 Ga0105237_101348393 329
369 3300009551 Ga0105238_10437943 Ga0105238_104379432 329
370 3300010375 Ga0105239_10033435 Ga0105239_100334352 329
371 3300025914 Ga0207671_10226627 Ga0207671_102266271 329
372 3300025949 Ga0207667_10222443 Ga0207667_102224432 329
373 3300031824 Ga0307413_10193592 Ga0307413_101935921 329
374 3300032002 Ga0307416_100073907 Ga0307416_1000739073 329
375 iso_pu_bacteria 2896253425 2896254354 329
376 3300031456 Ga0307513_10106203 Ga0307513_101062032 330
377 3300033180 Ga0307510_10006886 Ga0307510_1000688612 330
378 3300053087 Ga0500643_000837 Ga0500643_000837_10472_11479 330
379 iso_pu_bacteria 2513237137 2513857360 330
380 iso_pu_bacteria 2585427531 2585561941 330
381 iso_pu_bacteria 2585427609 2585907681 330
382 iso_pu_bacteria 2585428125 2587983102 330
383 iso_pu_bacteria 2643221541 2643730266 330
384 iso_pu_bacteria 2643221606 2644043435 330
385 iso_pu_bacteria 2643221671 2644393595 330
386 iso_pu_bacteria 2739367664 2739649304 330
387 iso_pu_bacteria 2739367865 2740027777 330
388 iso_pu_bacteria 2906635258 2906637539 330
389 iso_pu_bacteria 2906660503 2906661155 330
390 iso_pu_bacteria 641522639 641644463 330
391 3300005548 Ga0070665_100000011 Ga0070665_100000011308 331
392 3300006038 Ga0075365_10075628 Ga0075365_100756282 331
393 3300006042 Ga0075368_10016373 Ga0075368_100163733 331
394 3300006051 Ga0075364_10077578 Ga0075364_100775782 331
395 3300006177 Ga0075362_10009915 Ga0075362_100099152 331
396 3300006178 Ga0075367_10001322 Ga0075367_100013229 331
397 3300006186 Ga0075369_10031975 Ga0075369_100319752 331
398 3300025919 Ga0207657_10009017 Ga0207657_100090176 331
399 3300025927 Ga0207687_10178115 Ga0207687_101781152 331
400 3300026088 Ga0207641_10008795 Ga0207641_100087953 331
401 3300027866 Ga0209813_10000129 Ga0209813_1000012927 331
402 3300028379 Ga0268266_10000058 Ga0268266_10000058220 331
403 3300042004 Ga0439445_0006434 Ga0439445_0006434_1079_2074 331
404 3300042006 Ga0439432_014209 Ga0439432_014209_1067_2062 331
405 3300045051 Ga0451576_0000165 Ga0451576_0000165_81884_82879 331
406 3300048929 Ga0496126_0140159 Ga0496126_0140159_167_1162 331
407 3300049571 Ga0501034_0184628 Ga0501034_0184628_887_1882 331
408 3300049585 Ga0501069_0018652 Ga0501069_0018652_2125_3120 331
409 3300049778 Ga0501282_004189 Ga0501282_004189_369_1364 331
410 3300050489 nmdc:mga03683_517_c1 nmdc:mga03683_517_c1_2197_3192 331
411 3300050490 nmdc:mga03n38_2113_c1 nmdc:mga03n38_2113_c1_881_1876 331
412 3300050494 nmdc:mga06z11_5952_c1 nmdc:mga06z11_5952_c1_1567_2562 331
413 3300050495 nmdc:mga04h51_281_c1 nmdc:mga04h51_281_c1_11877_12872 331
414 3300050496 nmdc:mga07m45_17_c1 nmdc:mga07m45_17_c1_34990_35985 331
415 3300053121 Ga0500607_000240 Ga0500607_000240_38577_39572 331
416 3300053136 Ga0500559_0051429 Ga0500559_0051429_171_1208 331
417 3300053153 Ga0500616_0010848 Ga0500616_0010848_988_1995 331
418 iso_pu_bacteria 2545555834 2545672395 331
419 iso_pu_bacteria 2585427608 2585899716 331
420 iso_pu_bacteria 2842698319 2842698534 331
421 iso_pu_bacteria 2855020534 2855021478 331
422 iso_pu_bacteria 2883354860 2883358028 331
423 iso_pu_bacteria 2896184354 2896185004 331
424 iso_pu_bacteria 2902330777 2902330934 331
425 iso_pu_bacteria 2928125067 2928125472 331
426 iso_pu_bacteria 643348564 643601013 331
427 iso_pu_bacteria 8056673599 8056677747 331
428 3300001976 JGI24752J21851_1000407 JGI24752J21851_10004076 332
429 3300005331 Ga0070670_100000621 Ga0070670_10000062127 332
430 3300005367 Ga0070667_100000322 Ga0070667_10000032231 332
431 3300005539 Ga0068853_100051188 Ga0068853_1000511883 332
432 3300005544 Ga0070686_100298986 Ga0070686_1002989861 332
433 3300005616 Ga0068852_100001154 Ga0068852_1000011548 332
434 3300005618 Ga0068864_100000004 Ga0068864_100000004380 332
435 3300005841 Ga0068863_100000002 Ga0068863_100000002381 332
436 3300005841 Ga0068863_100020878 Ga0068863_1000208782 332
437 3300005843 Ga0068860_100005628 Ga0068860_10000562812 332
438 3300005844 Ga0068862_100000002 Ga0068862_100000002121 332
439 3300005844 Ga0068862_100000187 Ga0068862_10000018738 332
440 3300009011 Ga0105251_10002072 Ga0105251_100020729 332
441 3300009093 Ga0105240_10025305 Ga0105240_100253054 332
442 3300009098 Ga0105245_10039697 Ga0105245_100396973 332
443 3300009177 Ga0105248_10000016 Ga0105248_1000001638 332
444 3300009553 Ga0105249_10000106 Ga0105249_100001063 332
445 3300009553 Ga0105249_10000666 Ga0105249_1000066614 332
446 3300014968 Ga0157379_10133779 Ga0157379_101337794 332
447 3300025272 Ga0209455_1005177 Ga0209455_10051774 332
448 3300025735 Ga0207713_1005825 Ga0207713_10058256 332
449 3300025904 Ga0207647_10010889 Ga0207647_100108892 332
450 3300025909 Ga0207705_10000004 Ga0207705_10000004417 332
451 3300025913 Ga0207695_10018315 Ga0207695_100183155 332
452 3300025925 Ga0207650_10000643 Ga0207650_1000064327 332
453 3300025941 Ga0207711_10000022 Ga0207711_1000002238 332
454 3300025961 Ga0207712_10000048 Ga0207712_10000048114 332
455 3300025961 Ga0207712_10004350 Ga0207712_100043501 332
456 3300025986 Ga0207658_10000589 Ga0207658_100005899 332
457 3300026078 Ga0207702_10050448 Ga0207702_100504483 332
458 3300026088 Ga0207641_10000002 Ga0207641_10000002861 332
459 3300026088 Ga0207641_10003066 Ga0207641_100030667 332
460 3300026095 Ga0207676_10000040 Ga0207676_1000004056 332
461 3300026142 Ga0207698_10000134 Ga0207698_1000013418 332
462 3300028380 Ga0268265_10000003 Ga0268265_10000003129 332
463 3300028380 Ga0268265_10000209 Ga0268265_1000020937 332
464 3300028381 Ga0268264_10001688 Ga0268264_1000168817 332
465 3300031731 Ga0307405_10000984 Ga0307405_1000098410 332
466 3300031911 Ga0307412_10197301 Ga0307412_101973012 332
467 3300032004 Ga0307414_10037321 Ga0307414_100373212 332
468 3300046530 Ga0495654_0069363 Ga0495654_0069363_14_1012 332
469 3300048920 Ga0496117_0003086 Ga0496117_0003086_13357_14355 332
470 3300048921 Ga0496118_0002584 Ga0496118_0002584_1063_2061 332
471 3300048923 Ga0496120_0060834 Ga0496120_0060834_852_1862 332
472 3300049571 Ga0501034_0408676 Ga0501034_0408676_155_1168 332
473 3300049664 Ga0501224_000818 Ga0501224_000818_2167_3192 332
474 3300049679 Ga0501249_000074 Ga0501249_000074_3656_4681 332
475 3300049742 Ga0501080_0158891 Ga0501080_0158891_409_1422 332
476 3300049823 Ga0501044_0032390 Ga0501044_0032390_383_1396 332
477 3300049850 Ga0501204_000051 Ga0501204_000051_3786_4811 332
478 3300053087 Ga0500643_000962 Ga0500643_000962_11369_12367 332
479 3300053094 Ga0500566_0066052 Ga0500566_0066052_315_1325 332
480 3300053116 Ga0500592_001253 Ga0500592_001253_1572_2570 332
481 3300053122 Ga0500608_034797 Ga0500608_034797_679_1689 332
482 3300053158 Ga0500627_0004340 Ga0500627_0004340_1871_2869 332
483 iso_pu_bacteria 2643221582 2643919861 332
484 iso_pu_bacteria 2968117919 2968120792 332
485 3300005353 Ga0070669_100179092 Ga0070669_1001790922 333
486 3300005471 Ga0070698_100262725 Ga0070698_1002627252 333
487 3300005546 Ga0070696_100002073 Ga0070696_1000020736 333
488 3300005547 Ga0070693_100227178 Ga0070693_1002271781 333
489 3300025910 Ga0207684_10055772 Ga0207684_100557725 333
490 3300025913 Ga0207695_10435461 Ga0207695_104354611 333
491 3300047472 Ga0495686_0067515 Ga0495686_0067515_867_1868 333
492 3300049569 Ga0501032_0131814 Ga0501032_0131814_62_1066 333
493 3300049581 Ga0501047_0058666 Ga0501047_0058666_700_1704 333
494 3300049586 Ga0501070_0003797 Ga0501070_0003797_1747_2751 333
495 3300049590 Ga0501074_0036478 Ga0501074_0036478_447_1451 333
496 3300049742 Ga0501080_0007654 Ga0501080_0007654_2798_3802 333
497 3300049822 Ga0501035_0000806 Ga0501035_0000806_5619_6623 333
498 3300049823 Ga0501044_0005415 Ga0501044_0005415_5207_6211 333
499 3300049823 Ga0501044_0139349 Ga0501044_0139349_1220_2221 333
500 3300050509 nmdc:mga0qj67_63234_c1 nmdc:mga0qj67_63234_c1_27_1028 333
501 3300005329 Ga0070683_100111275 Ga0070683_1001112751 334
502 3300005339 Ga0070660_100000754 Ga0070660_10000075412 334
503 3300005339 Ga0070660_100016179 Ga0070660_1000161794 334
504 3300005457 Ga0070662_100004936 Ga0070662_1000049364 334
505 3300005539 Ga0068853_100103113 Ga0068853_1001031132 334
506 3300005539 Ga0068853_100338528 Ga0068853_1003385282 334
507 3300005563 Ga0068855_100031545 Ga0068855_1000315458 334
508 3300005564 Ga0070664_100105443 Ga0070664_1001054433 334
509 3300005577 Ga0068857_100121783 Ga0068857_1001217832 334
510 3300005614 Ga0068856_100003121 Ga0068856_10000312111 334
511 3300005615 Ga0070702_100060491 Ga0070702_1000604912 334
512 3300005981 Ga0081538_10073702 Ga0081538_100737022 334
513 3300006186 Ga0075369_10095557 Ga0075369_100955572 334
514 3300006353 Ga0075370_10003567 Ga0075370_100035672 334
515 3300006846 Ga0075430_100088141 Ga0075430_1000881412 334
516 3300007788 Ga0099795_10063730 Ga0099795_100637301 334
517 3300009553 Ga0105249_10029076 Ga0105249_100290766 334
518 3300010159 Ga0099796_10033151 Ga0099796_100331512 334
519 3300011119 Ga0105246_10000072 Ga0105246_1000007211 334
520 3300013102 Ga0157371_10049282 Ga0157371_100492824 334
521 3300013105 Ga0157369_10000875 Ga0157369_100008759 334
522 3300013105 Ga0157369_10385161 Ga0157369_103851611 334
523 3300013307 Ga0157372_10325630 Ga0157372_103256301 334
524 3300013308 Ga0157375_10271197 Ga0157375_102711973 334
525 3300025909 Ga0207705_10005383 Ga0207705_1000538311 334
526 3300025919 Ga0207657_10001626 Ga0207657_1000162613 334
527 3300025919 Ga0207657_10025636 Ga0207657_100256364 334
528 3300025920 Ga0207649_10164384 Ga0207649_101643842 334
529 3300025932 Ga0207690_10307225 Ga0207690_103072251 334
530 3300025933 Ga0207706_10005288 Ga0207706_100052884 334
531 3300025944 Ga0207661_10000082 Ga0207661_1000008231 334
532 3300025944 Ga0207661_10357200 Ga0207661_103572001 334
533 3300025945 Ga0207679_10240391 Ga0207679_102403911 334
534 3300025949 Ga0207667_10033197 Ga0207667_100331978 334
535 3300026041 Ga0207639_10012677 Ga0207639_100126772 334
536 3300026041 Ga0207639_10041887 Ga0207639_100418872 334
537 3300026078 Ga0207702_10000621 Ga0207702_1000062112 334
538 3300026116 Ga0207674_10129644 Ga0207674_101296442 334
539 3300031730 Ga0307516_10000124 Ga0307516_1000012412 334
540 3300036712 Ga0316584_0073348 Ga0316584_0073348_1009_2013 334
541 3300045976 Ga0466967_0154387 Ga0466967_0154387_878_1882 334
542 3300046452 Ga0495617_002500 Ga0495617_002500_2382_3386 334
543 3300046460 Ga0495638_0001229 Ga0495638_0001229_5524_6528 334
544 3300046492 Ga0495585_0015835 Ga0495585_0015835_764_1768 334
545 3300046506 Ga0495583_0053120 Ga0495583_0053120_210_1214 334
546 3300046512 Ga0495610_0004208 Ga0495610_0004208_4916_5920 334
547 3300046513 Ga0495616_0051592 Ga0495616_0051592_720_1724 334
548 3300046515 Ga0495620_0000536 Ga0495620_0000536_5553_6557 334
549 3300046522 Ga0495643_0001259 Ga0495643_0001259_5556_6560 334
550 3300046524 Ga0495648_0001353 Ga0495648_0001353_17715_18719 334
551 3300046525 Ga0495663_0000193 Ga0495663_0000193_5554_6558 334
552 3300046648 Ga0495611_0000463 Ga0495611_0000463_17738_18742 334
553 3300046660 Ga0495625_0001838 Ga0495625_0001838_5533_6537 334
554 3300046665 Ga0495661_0025676 Ga0495661_0025676_185_1189 334
555 3300046674 Ga0495588_0002067 Ga0495588_0002067_5271_6275 334
556 3300046689 Ga0495613_0050162 Ga0495613_0050162_1831_2835 334
557 3300046691 Ga0495670_0000275 Ga0495670_0000275_17739_18743 334
558 3300046692 Ga0495671_0000711 Ga0495671_0000711_17699_18703 334
559 3300046694 Ga0495649_0000872 Ga0495649_0000872_17699_18703 334
560 3300046810 Ga0495660_0010535 Ga0495660_0010535_3352_4356 334
561 3300047443 Ga0495687_001242 Ga0495687_001242_5556_6560 334
562 3300047470 Ga0495681_0000799 Ga0495681_0000799_17666_18670 334
563 3300047472 Ga0495686_0001570 Ga0495686_0001570_17739_18743 334
564 3300048926 Ga0496123_0002334 Ga0496123_0002334_17325_18329 334
565 3300049459 Ga0495678_000995 Ga0495678_000995_17711_18715 334
566 3300049460 Ga0495682_0000603 Ga0495682_0000603_5490_6494 334
567 3300049823 Ga0501044_0147813 Ga0501044_0147813_597_1601 334
568 3300049823 Ga0501044_0193600 Ga0501044_0193600_180_1184 334
569 3300050496 nmdc:mga07m45_2586_c2 nmdc:mga07m45_2586_c2_6317_7321 334
570 3300050509 nmdc:mga0qj67_43047_c1 nmdc:mga0qj67_43047_c1_820_1827 334
571 3300050510 nmdc:mga06r32_90277_c1 nmdc:mga06r32_90277_c1_941_1948 334
572 3300053086 Ga0500578_0001827 Ga0500578_0001827_5538_6542 334
573 3300053092 Ga0500583_0000561 Ga0500583_0000561_2400_3404 334
574 3300053103 Ga0500555_023414 Ga0500555_023414_189_1193 334
575 3300053122 Ga0500608_000196 Ga0500608_000196_5555_6559 334
576 3300053125 Ga0500618_000598 Ga0500618_000598_5418_6422 334
577 3300053138 Ga0500564_002564 Ga0500564_002564_406_1410 334
578 3300053141 Ga0500574_000039 Ga0500574_000039_10035_11039 334
579 3300053177 Ga0500636_0060436 Ga0500636_0060436_829_1833 334
580 3300053723 Ga0500567_033554 Ga0500567_033554_324_1328 334
581 3300005289 Ga0065704_10070184 Ga0065704_1007018453 335
582 3300005367 Ga0070667_100000329 Ga0070667_10000032918 335
583 3300005468 Ga0070707_100316441 Ga0070707_1003164412 335
584 3300005471 Ga0070698_100049064 Ga0070698_1000490643 335
585 3300005518 Ga0070699_100046988 Ga0070699_1000469882 335
586 3300005618 Ga0068864_100003651 Ga0068864_1000036515 335
587 3300005842 Ga0068858_100007016 Ga0068858_10000701610 335
588 3300005843 Ga0068860_100071559 Ga0068860_1000715597 335
589 3300013102 Ga0157371_10169786 Ga0157371_101697863 335
590 3300013104 Ga0157370_10133127 Ga0157370_101331272 335
591 3300013306 Ga0163162_10009818 Ga0163162_100098186 335
592 3300013306 Ga0163162_10255855 Ga0163162_102558553 335
593 3300014326 Ga0157380_10026391 Ga0157380_100263915 335
594 3300025261 Ga0209233_1004111 Ga0209233_10041115 335
595 3300025986 Ga0207658_10000274 Ga0207658_1000027418 335
596 3300026035 Ga0207703_10004829 Ga0207703_100048296 335
597 3300026095 Ga0207676_10004881 Ga0207676_100048819 335
598 3300028381 Ga0268264_10035651 Ga0268264_100356517 335
599 3300028786 Ga0307517_10036833 Ga0307517_100368331 335
600 3300031852 Ga0307410_10091326 Ga0307410_100913261 335
601 3300031903 Ga0307407_10005830 Ga0307407_100058306 335
602 3300031911 Ga0307412_10008903 Ga0307412_100089032 335
603 3300032002 Ga0307416_100021503 Ga0307416_1000215033 335
604 3300032005 Ga0307411_10044970 Ga0307411_100449702 335
605 3300046660 Ga0495625_0009806 Ga0495625_0009806_6127_7134 335
606 3300047472 Ga0495686_0003568 Ga0495686_0003568_5799_6806 335
607 3300048922 Ga0496119_0095532 Ga0496119_0095532_447_1454 335
608 3300048924 Ga0496121_0163275 Ga0496121_0163275_419_1426 335
609 3300048929 Ga0496126_0070344 Ga0496126_0070344_114_1121 335
610 3300049579 Ga0501043_0155563 Ga0501043_0155563_623_1630 335
611 3300053125 Ga0500618_030124 Ga0500618_030124_12_1019 335
612 3300038443 Ga0395901_0005160 Ga0395901_0005160_3593_4603 336
613 2162886007 SwRhRL2b_contig_2224728 SwRhRL2b_0434.00009780 345

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02322

Cyt_bd_oxida_II

Cytochrome bd terminal oxidase subunit II

17

335

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6rko-assembly1.cif.gz_B cryo-em structure of the e. coli cytochrome bd-i oxidase at 2.68 a resolution 0.8997 16 341
7nkz-assembly1.cif.gz_B cryo-em structure of the cytochrome bd oxidase from m. tuberculosis at 2.5 a resolution 0.8996 16 341
8b4o-assembly1.cif.gz_B cryo-em structure of cytochrome bd oxidase from c. glutamicum 0.898 16 338
7ose-assembly1.cif.gz_B cytochrome bd-ii type oxidase with bound aurachin d 0.8948 16 341
7d5i-assembly1.cif.gz_B structure of mycobacterium smegmatis bd complex in the apo-form. 0.8904 17 342
ID Description Score Start End Superfamily
af_B6U466_3_118_1.20.120.290 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Oxygen-evolving enhancer protein 3 (PsbQ), four-helix up-down bundle 0.6982 170 287 1.20.120.290
af_B6U466_3_118_1.20.120.290 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Oxygen-evolving enhancer protein 3 (PsbQ), four-helix up-down bundle 0.6522 170 287 1.20.120.290
3qw1C00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c/b562 0.6517 181 286 1.20.120.10
af_I1KJL7_87_236_1.20.120.290 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Oxygen-evolving enhancer protein 3 (PsbQ), four-helix up-down bundle 0.6383 167 288 1.20.120.290
3qw1C00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c/b562 0.6088 181 286 1.20.120.10
ID Description Score Start End GO Terms
AF-A0A7W9RER6-F1-model_v4 deleted 0.99 16 345
AF-A0A7X8NQV8-F1-model_v4 Cytochrome d ubiquinol oxidase subunit II 0.9896 16 345 GO:0005886
GO:0009055
GO:0016682
GO:0019646
GO:0070069
AF-A0A7W5ZXS8-F1-model_v4 Cytochrome d ubiquinol oxidase subunit II (EC 1.10.3.-) 0.9878 16 345 GO:0005886
GO:0009055
GO:0016682
GO:0019646
GO:0070069
AF-A0A844YWT1-F1-model_v4 Cytochrome d ubiquinol oxidase subunit II 0.9871 16 345 GO:0005886
GO:0009055
GO:0016682
GO:0019646
GO:0070069
AF-A0A3C1HQL7-F1-model_v4 deleted 0.9849 16 343

Feature Viewer

pLDDT pTM Quality
87.67 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map