F468533

General Info

Members Datasets Scaffolds Average Seq Length
605 347 1210 112

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2879083081|2879085089
Length 133
Sequence VASLSSRSSQGLKPPATTAFQQQETDMRQQIRFLRGASLAAFGAVLVAAPPAWAAGSNMPWEQPLNQILQSVEGPVAKIIAVIIIVVTGLTLAFGDSSGGFRRLIQIVFGLSIAFAASSFFLSFFSFGGGVVI

Samples

Sample ID Description Type Environment
1 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
9 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
10 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
11 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
12 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
13 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
87 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
88 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
90 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
91 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
97 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
100 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
145 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
146 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
147 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
148 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
149 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
150 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
151 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
152 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
153 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
154 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
155 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
156 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
157 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
158 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
159 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
160 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
161 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
162 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
163 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
164 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
165 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
166 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
167 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
168 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
169 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
170 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
171 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
172 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
173 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
174 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
175 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
176 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
177 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
178 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
179 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
180 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
181 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
182 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
183 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
184 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
185 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
186 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
187 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
188 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
189 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
190 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
191 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
192 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
193 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
194 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
195 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
196 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
197 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
198 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
199 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
200 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
201 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
202 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
203 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
204 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
205 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
206 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
207 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
208 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
209 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
210 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
211 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
212 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
213 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
214 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
215 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
216 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
217 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
218 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
219 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
220 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
221 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
222 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
223 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
224 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
225 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
226 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
227 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
228 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
229 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
230 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
231 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
232 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
233 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
234 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
235 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
236 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
237 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
238 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
239 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
240 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
241 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
242 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
243 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
244 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
245 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
246 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
247 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
248 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
249 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
250 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
251 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
252 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
261 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
262 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
263 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
264 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
265 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
266 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
267 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
270 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
271 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
272 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
273 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
274 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
275 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
276 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
277 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
278 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
279 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
280 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
281 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
282 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
283 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
284 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
285 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
286 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
287 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
288 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
289 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
290 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
291 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
292 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
293 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
294 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
295 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
296 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
297 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
298 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
299 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
300 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
301 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
302 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
303 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
304 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
305 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
306 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
307 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
308 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
309 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
310 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
311 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
312 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
313 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
314 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
315 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
316 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
317 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
318 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
319 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
320 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
321 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
322 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
323 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
324 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
325 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
326 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
327 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
328 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
329 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
330 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
331 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere
332 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
333 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
334 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
335 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
336 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
337 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
338 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
339 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
340 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
341 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
342 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
343 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
344 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere
345 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
346 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
347 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.24
Metatranscriptomes 0.66
Isolates 8.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.03
Nodule 2.98
Rhizoplane 2.48
Rhizosphere 67.44
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1022807 3300001915 Bacteria 969
2 JGI24740J21852_10026040 3300001979 Bacteria 1964
3 JGI24740J21852_10076486 3300001979 Bacteria 885
4 JGI24737J22298_10143228 3300001990 Bacteria 706
5 JGI24735J21928_10065339 3300002067 Bacteria 1044
6 JGI24751J29686_10000331 3300002459 Bacteria 17241
7 JGI25165J46597_1000109 3300003214 Bacteria 149484
8 Ga0055526_1000273 3300003771 Bacteria 43650
9 Ga0055526_1000650 3300003771 Bacteria 26887
10 Ga0055537_1001696 3300003773 Bacteria 8163
11 Ga0055537_1002040 3300003773 Bacteria 7136
12 Ga0055537_1002859 3300003773 Bacteria 5533
13 Ga0055524_1000199 3300003775 Bacteria 66009
14 Ga0055536_1000413 3300003781 Bacteria 30808
15 Ga0055536_1033195 3300003781 Bacteria 1322
16 Ga0055528_1055761 3300003790 Bacteria 771
17 Ga0055530_10000033 3300003791 Bacteria 118811
18 Ga0055530_10000153 3300003791 Bacteria 62178
19 Ga0055530_10000644 3300003791 Bacteria 30033
20 Ga0055530_10001582 3300003791 Bacteria 16291
21 Ga0055530_10035754 3300003791 Plasmid 1256
22 Ga0055540_1002217 3300003792 Bacteria 10546
23 Ga0055531_10000228 3300003794 Bacteria 61921
24 Ga0055531_10000297 3300003794 Bacteria 49449
25 Ga0055531_10015326 3300003794 Bacteria 3386
26 Ga0055543_1008008 3300004625 Bacteria 2377
27 Ga0065165_1000213 3300005262 Bacteria 100746
28 Ga0065165_1002134 3300005262 Bacteria 17965
29 Ga0065165_1020935 3300005262 Bacteria 2285
30 Ga0065165_1144712 3300005262 Bacteria 559
31 Ga0065707_10109604 3300005295 Bacteria 2463
32 Ga0070658_10000088 3300005327 Bacteria 85441
33 Ga0070658_10012608 3300005327 Bacteria 6780
34 Ga0070658_10015194 3300005327 Bacteria 6158
35 Ga0070658_10169056 3300005327 Bacteria 1836
36 Ga0070658_10253888 3300005327 Bacteria 1492
37 Ga0070658_10285515 3300005327 Bacteria 1405
38 Ga0070658_11744933 3300005327 Bacteria 539
39 Ga0070683_100001387 3300005329 Bacteria 18596
40 Ga0070683_100161531 3300005329 Bacteria 2126
41 Ga0070670_100000563 3300005331 Bacteria 29384
42 Ga0070670_100101082 3300005331 Bacteria 2482
43 Ga0070680_100019650 3300005336 Bacteria 5358
44 Ga0070680_100028768 3300005336 Bacteria 4459
45 Ga0070682_100271212 3300005337 Bacteria 1233
46 Ga0070660_100021682 3300005339 Bacteria 4742
47 Ga0070660_100168632 3300005339 Bacteria 1767
48 Ga0070660_100172370 3300005339 Bacteria 1748
49 Ga0070660_100904018 3300005339 Bacteria 744
50 Ga0070660_101564768 3300005339 Bacteria 561
51 Ga0070660_101795234 3300005339 Bacteria 522
52 Ga0070691_10810651 3300005341 Bacteria 571
53 Ga0070661_100005714 3300005344 Bacteria 8576
54 Ga0070661_100036879 3300005344 Bacteria 3554
55 Ga0070661_100722502 3300005344 Bacteria 813
56 Ga0070661_101351052 3300005344 Bacteria 599
57 Ga0070692_10041127 3300005345 Bacteria 2367
58 Ga0070692_10071100 3300005345 Bacteria 1854
59 Ga0070668_100079219 3300005347 Bacteria 2572
60 Ga0070668_100263419 3300005347 Bacteria 1434
61 Ga0070659_100339104 3300005366 Bacteria 1259
62 Ga0070659_100539526 3300005366 Bacteria 998
63 Ga0070709_10002689 3300005434 Bacteria 9601
64 Ga0070714_100422554 3300005435 Bacteria 1263
65 Ga0070710_10003785 3300005437 Bacteria 7147
66 Ga0070711_100011707 3300005439 Bacteria 5453
67 Ga0070700_100937337 3300005441 Bacteria 707
68 Ga0070694_100333007 3300005444 Bacteria 1172
69 Ga0070663_100064892 3300005455 Bacteria 2640
70 Ga0070663_100562094 3300005455 Bacteria 955
71 Ga0070663_101103875 3300005455 Bacteria 694
72 Ga0070662_100006427 3300005457 Bacteria 7574
73 Ga0070662_100967909 3300005457 Bacteria 728
74 Ga0070679_100018631 3300005530 Bacteria 6739
75 Ga0070684_100000637 3300005535 Bacteria 24083
76 Ga0070684_100489609 3300005535 Bacteria 1139
77 Ga0070684_101027029 3300005535 Bacteria 774
78 Ga0070684_101398607 3300005535 Bacteria 659
79 Ga0068853_100000373 3300005539 Bacteria 30758
80 Ga0068853_100048994 3300005539 Bacteria 3629
81 Ga0068853_100488997 3300005539 Bacteria 1161
82 Ga0070695_100532056 3300005545 Bacteria 913
83 Ga0070665_100000051 3300005548 Bacteria 249317
84 Ga0068855_100000173 3300005563 Bacteria 82962
85 Ga0068855_100106598 3300005563 Bacteria 3220
86 Ga0068855_100177254 3300005563 Bacteria 2411
87 Ga0068855_100298580 3300005563 Bacteria 1784
88 Ga0068855_100473012 3300005563 Bacteria 1365
89 Ga0068855_101093689 3300005563 Bacteria 834
90 Ga0070664_100005200 3300005564 Bacteria 10430
91 Ga0070664_100009428 3300005564 Bacteria 7914
92 Ga0068857_100004617 3300005577 Bacteria 11667
93 Ga0068857_100008723 3300005577 Bacteria 8778
94 Ga0068857_100011871 3300005577 Bacteria 7580
95 Ga0068857_100040390 3300005577 Bacteria 4137
96 Ga0068857_101242252 3300005577 Bacteria 722
97 Ga0068854_100000295 3300005578 Bacteria 33183
98 Ga0068856_100001545 3300005614 Bacteria 24115
99 Ga0068856_100004674 3300005614 Bacteria 13594
100 Ga0068856_100068997 3300005614 Bacteria 3495
101 Ga0068856_100151339 3300005614 Bacteria 2329
102 Ga0068856_100406664 3300005614 Bacteria 1381
103 Ga0068856_101787016 3300005614 Bacteria 626
104 Ga0068856_102558449 3300005614 Bacteria 517
105 Ga0068852_100000060 3300005616 Bacteria 73764
106 Ga0068852_100020731 3300005616 Bacteria 5230
107 Ga0068864_100000109 3300005618 Bacteria 80156
108 Ga0068861_100064921 3300005719 Bacteria 2810
109 Ga0068851_10019756 3300005834 Bacteria 3256
110 Ga0068863_100000936 3300005841 Bacteria 29333
111 Ga0068858_100000104 3300005842 Bacteria 88260
112 Ga0068858_100931658 3300005842 Bacteria 850
113 Ga0081455_10001276 3300005937 Bacteria 31404
114 Ga0081455_10004016 3300005937 Bacteria 16690
115 Ga0081540_1004908 3300005983 Bacteria 10073
116 Ga0081540_1008180 3300005983 Bacteria 7327
117 Ga0070717_10665079 3300006028 Bacteria 946
118 Ga0075365_10257420 3300006038 Bacteria 1227
119 Ga0075364_10001273 3300006051 Bacteria 13565
120 Ga0070715_10415880 3300006163 Bacteria 751
121 Ga0070716_100092006 3300006173 Bacteria 1838
122 Ga0075367_10203544 3300006178 Bacteria 1237
123 Ga0075369_10188439 3300006186 Bacteria 950
124 Ga0075428_102740660 3300006844 Bacteria 502
125 Ga0075430_100561054 3300006846 Bacteria 942
126 Ga0075433_11158615 3300006852 Bacteria 671
127 Ga0075434_100010364 3300006871 Bacteria 8736
128 Ga0075435_101116230 3300007076 Bacteria 689
129 Ga0105240_11328991 3300009093 Bacteria 757
130 Ga0111539_10031489 3300009094 Bacteria 6442
131 Ga0111539_11381430 3300009094 Bacteria 817
132 Ga0111539_12589982 3300009094 Bacteria 588
133 Ga0105243_11257575 3300009148 Bacteria 756
134 Ga0105242_11674500 3300009176 Bacteria 672
135 Ga0105248_10014799 3300009177 Bacteria 8592
136 Ga0105248_12098351 3300009177 Bacteria 643
137 Ga0105237_10000378 3300009545 Bacteria 63407
138 Ga0105237_11211002 3300009545 Bacteria 762
139 Ga0105238_10000647 3300009551 Bacteria 36611
140 Ga0105238_10000912 3300009551 Bacteria 30323
141 Ga0105238_10276042 3300009551 Bacteria 1661
142 Ga0105249_12464373 3300009553 Bacteria 593
143 Ga0099796_10082881 3300010159 Bacteria 1179
144 Ga0105239_10000232 3300010375 Bacteria 82037
145 Ga0105239_10009359 3300010375 Bacteria 11057
146 Ga0105239_10015700 3300010375 Bacteria 8381
147 Ga0157373_10009709 3300013100 Bacteria 7102
148 Ga0157373_10079472 3300013100 Bacteria 2313
149 Ga0157371_10045652 3300013102 Bacteria 3117
150 Ga0157371_10067636 3300013102 Bacteria 2528
151 Ga0157371_11117241 3300013102 Bacteria 605
152 Ga0157370_10001089 3300013104 Bacteria 34040
153 Ga0157370_10014185 3300013104 Bacteria 8167
154 Ga0157370_10056799 3300013104 Bacteria 3724
155 Ga0157369_10003995 3300013105 Bacteria 17496
156 Ga0157369_10024358 3300013105 Bacteria 6734
157 Ga0157369_10287367 3300013105 Bacteria 1712
158 Ga0157372_10003423 3300013307 Bacteria 17122
159 Ga0157372_11210168 3300013307 Bacteria 873
160 Ga0157372_12100941 3300013307 Bacteria 649
161 Ga0157372_13472457 3300013307 Bacteria 501
162 Ga0157376_11715956 3300014969 Bacteria 663
163 Ga0157376_12029531 3300014969 Bacteria 613
164 Ga0163161_10073110 3300017792 Bacteria 2512
165 Ga0206352_11016838 3300020078 Bacteria 683
166 Ga0206353_10722459 3300020082 Bacteria 1647
167 Ga0214544_1009140 3300021320 Bacteria 15797
168 Ga0213876_10000534 3300021384 Bacteria 28772
169 Ga0213876_10021832 3300021384 Bacteria 3386
170 Ga0209147_100397 3300025229 Bacteria 29730
171 Ga0209147_100482 3300025229 Bacteria 24036
172 Ga0209437_125384 3300025233 Bacteria 658
173 Ga0209233_1000167 3300025261 Bacteria 149536
174 Ga0209565_1000010 3300025263 Bacteria 687724
175 Ga0209565_1000446 3300025263 Bacteria 32698
176 Ga0209673_1003679 3300025273 Bacteria 8838
177 Ga0209673_1065518 3300025273 Bacteria 887
178 Ga0209675_1000082 3300025291 Bacteria 153550
179 Ga0209676_1000119 3300025292 Bacteria 201094
180 Ga0209676_1000251 3300025292 Bacteria 114379
181 Ga0209676_1003359 3300025292 Bacteria 9975
182 Ga0209564_1000069 3300025295 Bacteria 303332
183 Ga0209564_1001310 3300025295 Bacteria 26723
184 Ga0209758_1016091 3300025297 Bacteria 3820
185 Ga0209758_1081545 3300025297 Bacteria 977
186 Ga0209050_1000001 3300025298 Bacteria 3563507
187 Ga0209050_1000017 3300025298 Bacteria 728928
188 Ga0209050_1000263 3300025298 Bacteria 112797
189 Ga0209050_1002306 3300025298 Bacteria 16802
190 Ga0209050_1012915 3300025298 Bacteria 3777
191 Ga0209256_1000034 3300025299 Bacteria 388475
192 Ga0207426_1016465 3300025302 Bacteria 2654
193 Ga0207426_1041349 3300025302 Bacteria 1429
194 Ga0209051_1001006 3300025303 Bacteria 27083
195 Ga0209051_1002421 3300025303 Bacteria 13412
196 Ga0209257_1000111 3300025304 Bacteria 234809
197 Ga0209257_1000485 3300025304 Bacteria 71633
198 Ga0209257_1000841 3300025304 Bacteria 44078
199 Ga0209257_1002342 3300025304 Bacteria 19063
200 Ga0209257_1004582 3300025304 Bacteria 10557
201 Ga0207692_10058373 3300025898 Bacteria 1988
202 Ga0207710_10389778 3300025900 Bacteria 714
203 Ga0207647_10009495 3300025904 Bacteria 6908
204 Ga0207647_10044073 3300025904 Bacteria 2789
205 Ga0207647_10129801 3300025904 Bacteria 1482
206 Ga0207647_10131946 3300025904 Bacteria 1468
207 Ga0207685_10330905 3300025905 Bacteria 762
208 Ga0207699_10002420 3300025906 Bacteria 8817
209 Ga0207705_10000138 3300025909 Bacteria 78969
210 Ga0207705_10000322 3300025909 Bacteria 43502
211 Ga0207705_10007805 3300025909 Bacteria 7857
212 Ga0207705_10025138 3300025909 Bacteria 4251
213 Ga0207705_10046689 3300025909 Bacteria 3113
214 Ga0207705_10097900 3300025909 Bacteria 2155
215 Ga0207705_10110577 3300025909 Bacteria 2030
216 Ga0207705_10529957 3300025909 Bacteria 915
217 Ga0207684_10032142 3300025910 Bacteria 4463
218 Ga0207707_10112574 3300025912 Bacteria 2379
219 Ga0207695_10000525 3300025913 Bacteria 81111
220 Ga0207695_10001920 3300025913 Bacteria 32321
221 Ga0207695_10043364 3300025913 Bacteria 4795
222 Ga0207671_10000222 3300025914 Bacteria 85244
223 Ga0207671_10847714 3300025914 Bacteria 724
224 Ga0207663_10011370 3300025916 Bacteria 4778
225 Ga0207660_10013342 3300025917 Bacteria 5385
226 Ga0207660_10185606 3300025917 Bacteria 1617
227 Ga0207657_10000020 3300025919 Bacteria 157826
228 Ga0207657_10001528 3300025919 Bacteria 24769
229 Ga0207657_10007909 3300025919 Bacteria 10842
230 Ga0207657_10017261 3300025919 Bacteria 6928
231 Ga0207649_10003102 3300025920 Bacteria 9118
232 Ga0207649_10148216 3300025920 Bacteria 1613
233 Ga0207649_10938422 3300025920 Bacteria 679
234 Ga0207652_10295710 3300025921 Bacteria 1461
235 Ga0207652_10384363 3300025921 Bacteria 1267
236 Ga0207694_10000611 3300025924 Bacteria 32401
237 Ga0207694_10010374 3300025924 Bacteria 7023
238 Ga0207694_11351657 3300025924 Bacteria 602
239 Ga0207694_11785709 3300025924 Bacteria 517
240 Ga0207650_10000039 3300025925 Bacteria 204737
241 Ga0207644_10418720 3300025931 Bacteria 1097
242 Ga0207690_10069935 3300025932 Bacteria 2416
243 Ga0207690_10470174 3300025932 Bacteria 1013
244 Ga0207706_10004943 3300025933 Bacteria 12453
245 Ga0207706_10447463 3300025933 Bacteria 1118
246 Ga0207686_10906178 3300025934 Bacteria 712
247 Ga0207665_10056031 3300025939 Bacteria 2661
248 Ga0207711_10017036 3300025941 Bacteria 6035
249 Ga0207661_10002993 3300025944 Bacteria 11688
250 Ga0207661_10534316 3300025944 Bacteria 1073
251 Ga0207679_10007620 3300025945 Bacteria 6874
252 Ga0207679_10353779 3300025945 Bacteria 1281
253 Ga0207667_10000001 3300025949 Bacteria 1178522
254 Ga0207667_10048367 3300025949 Bacteria 4497
255 Ga0207667_10074773 3300025949 Bacteria 3518
256 Ga0207667_10104495 3300025949 Bacteria 2922
257 Ga0207667_10206025 3300025949 Bacteria 2017
258 Ga0207667_11091123 3300025949 Bacteria 782
259 Ga0207668_10005413 3300025972 Bacteria 7520
260 Ga0207668_10010848 3300025972 Bacteria 5520
261 Ga0207668_10848580 3300025972 Bacteria 811
262 Ga0207640_10000041 3300025981 Bacteria 105374
263 Ga0207640_10115352 3300025981 Bacteria 1913
264 Ga0207703_10000136 3300026035 Bacteria 89612
265 Ga0207703_10822600 3300026035 Bacteria 887
266 Ga0207639_10000081 3300026041 Bacteria 82747
267 Ga0207639_10049770 3300026041 Bacteria 3179
268 Ga0207639_10309083 3300026041 Bacteria 1400
269 Ga0207678_10017850 3300026067 Bacteria 6231
270 Ga0207678_10066136 3300026067 Bacteria 3104
271 Ga0207678_10413036 3300026067 Bacteria 1170
272 Ga0207708_10037395 3300026075 Bacteria 3698
273 Ga0207702_10001302 3300026078 Bacteria 24991
274 Ga0207702_10001542 3300026078 Bacteria 22773
275 Ga0207702_10059786 3300026078 Bacteria 3247
276 Ga0207702_10098726 3300026078 Bacteria 2573
277 Ga0207702_10207657 3300026078 Bacteria 1819
278 Ga0207702_12035248 3300026078 Bacteria 564
279 Ga0207702_12497676 3300026078 Bacteria 503
280 Ga0207641_10000504 3300026088 Bacteria 43890
281 Ga0207648_11014172 3300026089 Bacteria 777
282 Ga0207676_10000035 3300026095 Bacteria 204737
283 Ga0207674_10008818 3300026116 Bacteria 11607
284 Ga0207674_10018111 3300026116 Bacteria 7663
285 Ga0207674_10018275 3300026116 Bacteria 7624
286 Ga0207674_10053187 3300026116 Bacteria 4128
287 Ga0207674_10055396 3300026116 Bacteria 4031
288 Ga0207675_100051157 3300026118 Bacteria 3854
289 Ga0207698_10000054 3300026142 Bacteria 82681
290 Ga0207698_10155850 3300026142 Bacteria 1989
291 Ga0207698_10367266 3300026142 Bacteria 1365
292 Ga0209974_10011516 3300027876 Bacteria 2968
293 Ga0209974_10074751 3300027876 Bacteria 1160
294 Ga0207428_10684781 3300027907 Bacteria 734
295 Ga0207428_10962642 3300027907 Bacteria 601
296 Ga0268266_10000002 3300028379 Bacteria 3059047
297 Ga0265337_1010314 3300028556 Bacteria 3280
298 Ga0265326_10000426 3300028558 Bacteria 16642
299 Ga0265319_1003601 3300028563 Bacteria 8018
300 Ga0265334_10000781 3300028573 Bacteria 15903
301 Ga0265323_10000085 3300028653 Bacteria 53185
302 Ga0265322_10107605 3300028654 Bacteria 793
303 Ga0265336_10000603 3300028666 Bacteria 20115
304 Ga0307515_10312238 3300028794 Bacteria 1246
305 Ga0265338_10000799 3300028800 Bacteria 53202
306 Ga0265324_10001911 3300029957 Bacteria 11184
307 Ga0307511_10231122 3300030521 Bacteria 915
308 Ga0265763_1011872 3300030763 Bacteria 824
309 Ga0265760_10143305 3300031090 Bacteria 779
310 Ga0307513_10383326 3300031456 Bacteria 1145
311 Ga0307513_10631956 3300031456 Bacteria 778
312 Ga0307509_10000816 3300031507 Bacteria 53561
313 Ga0307509_10057850 3300031507 Bacteria 4108
314 Ga0307509_10190161 3300031507 Bacteria 1905
315 Ga0307408_100027131 3300031548 Bacteria 3944
316 Ga0307408_100222188 3300031548 Bacteria 1542
317 Ga0307408_100377221 3300031548 Bacteria 1211
318 Ga0307508_10004125 3300031616 Bacteria 14314
319 Ga0307508_10145869 3300031616 Bacteria 1971
320 Ga0265314_10024861 3300031711 Bacteria 4532
321 Ga0265314_10105927 3300031711 Bacteria 1797
322 Ga0307516_10020296 3300031730 Bacteria 6865
323 Ga0307516_10022657 3300031730 Bacteria 6448
324 Ga0307516_10048922 3300031730 Bacteria 4159
325 Ga0307516_10106292 3300031730 Bacteria 2617
326 Ga0307516_10171759 3300031730 Bacteria 1908
327 Ga0307516_10251642 3300031730 Bacteria 1461
328 Ga0307405_10000156 3300031731 Bacteria 26152
329 Ga0307405_10020822 3300031731 Bacteria 3673
330 Ga0307413_10376003 3300031824 Bacteria 1105
331 Ga0307410_10003370 3300031852 Bacteria 8007
332 Ga0307410_10426200 3300031852 Bacteria 1077
333 Ga0307406_10466702 3300031901 Bacteria 1016
334 Ga0307407_10002442 3300031903 Bacteria 7275
335 Ga0307407_10905002 3300031903 Bacteria 677
336 Ga0307412_10008004 3300031911 Bacteria 6028
337 Ga0307412_10079327 3300031911 Bacteria 2264
338 Ga0307412_10147260 3300031911 Bacteria 1733
339 Ga0307412_10328840 3300031911 Bacteria 1219
340 Ga0307409_100121553 3300031995 Bacteria 2212
341 Ga0307409_101623025 3300031995 Bacteria 675
342 Ga0307409_101807146 3300031995 Bacteria 640
343 Ga0307416_100040731 3300032002 Bacteria 3612
344 Ga0307416_100403407 3300032002 Bacteria 1405
345 Ga0307414_10063037 3300032004 Bacteria 2633
346 Ga0307414_10113062 3300032004 Bacteria 2072
347 Ga0307414_10839097 3300032004 Bacteria 840
348 Ga0307411_10022077 3300032005 Bacteria 3739
349 Ga0307411_11300815 3300032005 Bacteria 662
350 Ga0307415_100162756 3300032126 Bacteria 1731
351 Ga0307510_10220671 3300033180 Bacteria 1408
352 Ga0307510_10401588 3300033180 Bacteria 814
353 Ga0373948_0004770 3300034817 Bacteria 2164
354 Ga0373958_0009502 3300034819 Bacteria 1602
355 Ga0373938_0023689 3300034957 Bacteria 1264
356 Ga0373938_0156024 3300034957 Bacteria 610
357 Ga0373949_0073358 3300035090 Bacteria 900
358 Ga0373952_0050039 3300035092 Bacteria 993
359 Ga0373932_0009680 3300035112 Bacteria 2322
360 Ga0373932_0010017 3300035112 Bacteria 2288
361 Ga0373939_0273342 3300035114 Bacteria 665
362 Ga0373941_0084177 3300035115 Bacteria 1079
363 Ga0373961_0081596 3300035241 Bacteria 1018
364 Ga0373962_0017939 3300035242 Bacteria 1838
365 Ga0373962_0044496 3300035242 Bacteria 1261
366 Ga0373962_0156785 3300035242 Bacteria 749
367 Ga0373931_0002832 3300035691 Bacteria 7733
368 Ga0373931_0036549 3300035691 Bacteria 2561
369 Ga0373931_0059274 3300035691 Bacteria 2058
370 Ga0373931_1165503 3300035691 Bacteria 526
371 Ga0373927_0195342 3300035695 Bacteria 1328
372 Ga0395899_0002329 3300037312 Bacteria 15461
373 Ga0395899_0010936 3300037312 Bacteria 6954
374 Ga0395899_0132389 3300037312 Bacteria 1779
375 Ga0395900_0000017 3300037418 Bacteria 369602
376 Ga0395900_0003311 3300037418 Bacteria 17423
377 Ga0395900_0023903 3300037418 Bacteria 6254
378 Ga0395900_0073364 3300037418 Bacteria 3518
379 Ga0395900_0545686 3300037418 Bacteria 1104
380 Ga0395898_0000030 3300037466 Bacteria 369577
381 Ga0395898_0003803 3300037466 Bacteria 16710
382 Ga0395898_0041319 3300037466 Bacteria 4555
383 Ga0395898_0088045 3300037466 Bacteria 2990
384 Ga0395898_0535021 3300037466 Bacteria 1113
385 Ga0395898_0704912 3300037466 Bacteria 951
386 Ga0395905_0000056 3300037471 Bacteria 209230
387 Ga0395905_0004900 3300037471 Bacteria 13789
388 Ga0395905_0028426 3300037471 Bacteria 5272
389 Ga0395905_0118106 3300037471 Bacteria 2493
390 Ga0395905_0331492 3300037471 Bacteria 1412
391 Ga0436364_0437118 3300037853 Bacteria 2104
392 Ga0395901_0000015 3300038443 Bacteria 373388
393 Ga0395901_0005155 3300038443 Bacteria 13187
394 Ga0395901_0015677 3300038443 Bacteria 7719
395 Ga0395901_0054033 3300038443 Bacteria 4174
396 Ga0395901_0195469 3300038443 Bacteria 2121
397 Ga0395901_0570589 3300038443 Bacteria 1144
398 Ga0436365_0331238 3300039437 Bacteria 27938
399 Ga0436365_0461462 3300039437 Bacteria 889
400 Ga0436365_0560439 3300039437 Bacteria 5002
401 Ga0436360_0726733 3300039438 Bacteria 522
402 Ga0436362_1276304 3300039453 Bacteria 6716
403 Ga0451789_0950394 3300041443 Bacteria 667
404 Ga0451807_0060181 3300041486 Bacteria 545
405 Ga0451843_1669296 3300041509 Bacteria 747
406 Ga0451853_0985972 3300041512 Bacteria 1617
407 Ga0439448_0072970 3300042005 Bacteria 1144
408 Ga0439458_0006987 3300042157 Bacteria 2515
409 Ga0439459_0101164 3300042438 Bacteria 705
410 Ga0466972_0131137 3300044658 Bacteria 1181
411 Ga0466972_0169778 3300044658 Bacteria 1024
412 Ga0466966_0001850 3300044684 Bacteria 13717
413 Ga0466966_0004295 3300044684 Bacteria 9398
414 Ga0466959_0000454 3300045049 Bacteria 23827
415 Ga0466959_0438176 3300045049 Bacteria 886
416 Ga0466958_0004871 3300045836 Bacteria 7144
417 Ga0466958_1180124 3300045836 Bacteria 500
418 Ga0466967_0163817 3300045976 Bacteria 2089
419 Ga0495627_000409 3300046453 Bacteria 37928
420 Ga0495603_0117727 3300046455 Bacteria 1549
421 Ga0495629_0254271 3300046459 Bacteria 1208
422 Ga0495638_0000318 3300046460 Bacteria 62139
423 Ga0495638_0323509 3300046460 Bacteria 823
424 Ga0495650_0000160 3300046471 Bacteria 152374
425 Ga0495582_0042663 3300046473 Bacteria 2498
426 Ga0495585_0074514 3300046492 Bacteria 1847
427 Ga0495583_0000120 3300046506 Bacteria 133285
428 Ga0495606_0201213 3300046507 Bacteria 1135
429 Ga0495637_0224700 3300046520 Bacteria 682
430 Ga0495643_0000336 3300046522 Bacteria 64049
431 Ga0495643_0063940 3300046522 Bacteria 1945
432 Ga0495643_0499732 3300046522 Bacteria 523
433 Ga0495652_1027145 3300046529 Bacteria 538
434 Ga0495654_0130598 3300046530 Bacteria 1128
435 Ga0495665_0363729 3300046531 Bacteria 736
436 Ga0495640_0427828 3300046533 Bacteria 811
437 Ga0495633_0003846 3300046558 Bacteria 9814
438 Ga0495625_0000454 3300046660 Bacteria 61335
439 Ga0495625_0005533 3300046660 Bacteria 11480
440 Ga0495625_0829079 3300046660 Bacteria 536
441 Ga0495658_1052621 3300046683 Bacteria 519
442 Ga0495613_0207749 3300046689 Bacteria 1378
443 Ga0495670_0204263 3300046691 Bacteria 1047
444 Ga0495581_0009689 3300047315 Bacteria 5576
445 Ga0495674_0251388 3300047319 Bacteria 1455
446 Ga0495676_0457034 3300047321 Bacteria 842
447 Ga0495686_0000892 3300047472 Bacteria 37606
448 Ga0495593_0076970 3300047673 Bacteria 1728
449 Ga0495615_0234956 3300048090 Bacteria 576
450 Ga0496100_1361731 3300048903 Bacteria 560
451 Ga0496101_0750305 3300048904 Bacteria 770
452 Ga0496101_0761481 3300048904 Bacteria 764
453 Ga0496102_0164853 3300048905 Bacteria 2085
454 Ga0496102_0667926 3300048905 Bacteria 962
455 Ga0496104_0091437 3300048907 Bacteria 2909
456 Ga0496106_0063619 3300048909 Bacteria 2805
457 Ga0496106_1108104 3300048909 Bacteria 620
458 Ga0496107_0000202 3300048910 Bacteria 31262
459 Ga0496107_0273725 3300048910 Bacteria 1256
460 Ga0496107_0468573 3300048910 Bacteria 935
461 Ga0496109_0548930 3300048912 Bacteria 1090
462 Ga0496111_0131173 3300048914 Bacteria 1854
463 Ga0496117_0040646 3300048920 Bacteria 3417
464 Ga0496118_0029330 3300048921 Bacteria 4616
465 Ga0496118_0328627 3300048921 Bacteria 826
466 Ga0496120_0308633 3300048923 Bacteria 722
467 Ga0496121_0000003 3300048924 Bacteria 1191431
468 Ga0496121_0000472 3300048924 Bacteria 78334
469 Ga0496121_0000484 3300048924 Bacteria 77129
470 Ga0496121_0001383 3300048924 Bacteria 41083
471 Ga0496121_0118821 3300048924 Bacteria 2000
472 Ga0496121_0297915 3300048924 Bacteria 1096
473 Ga0496122_0000694 3300048925 Bacteria 67000
474 Ga0496122_0029876 3300048925 Bacteria 4583
475 Ga0496122_0039218 3300048925 Bacteria 3780
476 Ga0496123_0000585 3300048926 Bacteria 62093
477 Ga0496123_0001459 3300048926 Bacteria 32922
478 Ga0496124_0000188 3300048927 Bacteria 122361
479 Ga0496124_0013548 3300048927 Bacteria 7951
480 Ga0496124_0070163 3300048927 Bacteria 2907
481 Ga0496125_0028876 3300048928 Bacteria 4997
482 Ga0496126_0000041 3300048929 Bacteria 340389
483 Ga0496126_0027509 3300048929 Bacteria 5431
484 Ga0496126_0092813 3300048929 Bacteria 2652
485 Ga0496126_0679806 3300048929 Bacteria 802
486 Ga0496126_0897207 3300048929 Bacteria 672
487 Ga0495682_0126374 3300049460 Bacteria 915
488 Ga0501032_0000525 3300049569 Bacteria 31183
489 Ga0501032_0597106 3300049569 Bacteria 702
490 Ga0501033_0001916 3300049570 Bacteria 18110
491 Ga0501033_0505779 3300049570 Bacteria 835
492 Ga0501034_0028252 3300049571 Bacteria 5707
493 Ga0501034_0362069 3300049571 Bacteria 1377
494 Ga0501037_0593797 3300049573 Bacteria 744
495 Ga0501037_1115022 3300049573 Bacteria 511
496 Ga0501038_0074174 3300049574 Bacteria 2879
497 Ga0501038_0250266 3300049574 Bacteria 1404
498 Ga0501039_0532220 3300049575 Bacteria 922
499 Ga0501043_0291494 3300049579 Bacteria 1249
500 Ga0501047_0009550 3300049581 Bacteria 9170
501 Ga0501047_0032519 3300049581 Bacteria 5036
502 Ga0501047_0072290 3300049581 Bacteria 3320
503 Ga0501223_000136 3300049663 Bacteria 20934
504 Ga0501224_000005 3300049664 Bacteria 149922
505 Ga0501233_000008 3300049668 Bacteria 34986
506 Ga0501235_000193 3300049669 Bacteria 10723
507 Ga0501225_0000103 3300049705 Bacteria 26604
508 Ga0501229_083887 3300049706 Bacteria 513
509 Ga0501234_013511 3300049707 Bacteria 1281
510 Ga0501035_0000627 3300049822 Bacteria 38848
511 Ga0501044_0000406 3300049823 Bacteria 53102
512 Ga0501044_0110315 3300049823 Bacteria 2760
513 Ga0501044_0516551 3300049823 Bacteria 1094
514 Ga0501226_000021 3300049853 Bacteria 127141
515 nmdc:mga03n38_416169_c1 3300050490 Bacteria 742
516 nmdc:mga00v17_37009_c1 3300050491 Bacteria 2911
517 nmdc:mga0yw44_36020_c1 3300050492 Bacteria 2913
518 nmdc:mga0yw44_431274_c1 3300050492 Bacteria 893
519 nmdc:mga0yw44_453496_c1 3300050492 Bacteria 869
520 nmdc:mga0k408_821136_c1 3300050493 Bacteria 541
521 nmdc:mga08y16_1095105_c1 3300050511 Bacteria 772
522 nmdc:mga0n895_1404289_c1 3300050512 Bacteria 667
523 nmdc:mga0rr50_1043492_c1 3300050513 Bacteria 696
524 nmdc:mga0sz30_111351_c1 3300050516 Bacteria 1200
525 nmdc:mga0sz30_9581_c2 3300050516 Bacteria 1899
526 Ga0500635_0060744 3300053080 Bacteria 1318
527 Ga0500643_000573 3300053087 Bacteria 25547
528 Ga0500647_0264431 3300053091 Bacteria 750
529 Ga0500651_0233144 3300053093 Bacteria 1076
530 Ga0500651_0360288 3300053093 Bacteria 824
531 Ga0500641_0008669 3300053096 Bacteria 3636
532 Ga0500555_000325 3300053103 Bacteria 20577
533 Ga0500556_0003219 3300053104 Bacteria 4860
534 Ga0500556_0393345 3300053104 Bacteria 532
535 Ga0500572_216499 3300053111 Bacteria 627
536 Ga0500592_003406 3300053116 Bacteria 2540
537 Ga0500595_024977 3300053119 Bacteria 2079
538 Ga0500573_0231215 3300053140 Bacteria 964
539 Ga0500590_014306 3300053148 Bacteria 4087
540 Ga0500590_140551 3300053148 Bacteria 1104
541 Ga0500604_0130650 3300053151 Bacteria 844
542 Ga0500616_0000170 3300053153 Bacteria 108126
543 Ga0500622_0006308 3300053156 Bacteria 6921
544 Ga0500624_000002 3300053157 Bacteria 257900
545 Ga0500624_000335 3300053157 Bacteria 15821
546 Ga0500627_0000020 3300053158 Bacteria 109977
547 Ga0500634_0407864 3300053161 Bacteria 500
548 Ga0500639_000710 3300053163 Bacteria 16832
549 Ga0500639_312624 3300053163 Bacteria 582
550 Ga0500636_0046461 3300053177 Bacteria 2560
551 Ga0500636_0274669 3300053177 Bacteria 845
552 Ga0500637_0023820 3300053178 Bacteria 3351
553 Ga0500637_0512847 3300053178 Bacteria 591
554 Ga0500570_000111 3300053724 Bacteria 23295
555 Ga0500599_034915 3300053736 Bacteria 759
556 Ga0466962_0309150 3300061719 Bacteria 783
557 2879085089 2879083081 Bacteria 8587928
558 2509151417 2508501128 Bacteria 8613869
559 2511124856 2510917020 Bacteria 5657507
560 2512645929 2512564014 Bacteria 4639632
561 2513613028 2513237090 Bacteria 7096802
562 2513643947 2513237094 Bacteria 8789602
563 2513677674 2513237098 Bacteria 9902361
564 2524441921 2524023205 Bacteria 8918781
565 2524470544 2524023210 Bacteria 9029266
566 2537876284 2537561587 Bacteria 5425293
567 2585154381 2582581280 Bacteria 5994497
568 2585197956 2582581293 Bacteria 5907401
569 2617375303 2617270741 Bacteria 8201522
570 2643751306 2643221545 Bacteria 5083237
571 2643950073 2643221588 Bacteria 3692460
572 2644510642 2643221691 Bacteria 5093099
573 2723844722 2721755755 Bacteria 8322773
574 2758642708 2758568016 Bacteria 5645291
575 2778125867 2775507255 Bacteria 3945731
576 2792460085 2791355048 Bacteria 5832535
577 2792462077 2791355048 Bacteria 5832535
578 2819555042 2818991438 Bacteria 5793701
579 2824680119 2824679649 Bacteria 8248951
580 2824755926 2824753945 Bacteria 9787441
581 2824764979 2824763712 Bacteria 9792355
582 2843745982 2843744320 Bacteria 5659202
583 2843748267 2843744320 Bacteria 5659202
584 2856330722 2856328259 Bacteria 6528202
585 2876400192 2876399893 Bacteria 6927900
586 2885388779 2885383462 Bacteria 9473874
587 2885416840 2885409591 Bacteria 9235467
588 2891093066 2891088606 Bacteria 4762464
589 2898331838 2898329390 Bacteria 5168154
590 2903775660 2903768456 Bacteria 9749579
591 2904715978 2904711408 Bacteria 9771557
592 2937852661 2937848649 Bacteria 6983481
593 2961140437 2961136820 Bacteria 6775228
594 2965028475 2965025482 Bacteria 6532201
595 2965104970 2965102966 Bacteria 6800987
596 2970554904 2970547951 Bacteria 6931819
597 2977925219 2977922695 Bacteria 6956781
598 3004212482 3004211236 Bacteria 7417683
599 3004224163 3004218560 Bacteria 7421728
600 3005597982 3005594810 Bacteria 8716512
601 8054305513 8054302542 Bacteria 5698134
602 8056677061 8056673599 Bacteria 7871253
603 8056692319 8056689827 Bacteria 6712655
604 8057104599 8057101203 Bacteria 5034064
605 8057105190 8057101203 Bacteria 5034064
606 JGI24741J21665_1022807
607 JGI24740J21852_10026040
608 JGI24740J21852_10076486
609 JGI24737J22298_10143228
610 JGI24735J21928_10065339
611 JGI24751J29686_10000331
612 JGI25165J46597_1000109
613 Ga0055526_1000273
614 Ga0055526_1000650
615 Ga0055537_1001696
616 Ga0055537_1002040
617 Ga0055537_1002859
618 Ga0055524_1000199
619 Ga0055536_1000413
620 Ga0055536_1033195
621 Ga0055528_1055761
622 Ga0055530_10000033
623 Ga0055530_10000153
624 Ga0055530_10000644
625 Ga0055530_10001582
626 Ga0055530_10035754
627 Ga0055540_1002217
628 Ga0055531_10000228
629 Ga0055531_10000297
630 Ga0055531_10015326
631 Ga0055543_1008008
632 Ga0065165_1000213
633 Ga0065165_1002134
634 Ga0065165_1020935
635 Ga0065165_1144712
636 Ga0065707_10109604
637 Ga0070658_10000088
638 Ga0070658_10012608
639 Ga0070658_10015194
640 Ga0070658_10169056
641 Ga0070658_10253888
642 Ga0070658_10285515
643 Ga0070658_11744933
644 Ga0070683_100001387
645 Ga0070683_100161531
646 Ga0070670_100000563
647 Ga0070670_100101082
648 Ga0070680_100019650
649 Ga0070680_100028768
650 Ga0070682_100271212
651 Ga0070660_100021682
652 Ga0070660_100168632
653 Ga0070660_100172370
654 Ga0070660_100904018
655 Ga0070660_101564768
656 Ga0070660_101795234
657 Ga0070691_10810651
658 Ga0070661_100005714
659 Ga0070661_100036879
660 Ga0070661_100722502
661 Ga0070661_101351052
662 Ga0070692_10041127
663 Ga0070692_10071100
664 Ga0070668_100079219
665 Ga0070668_100263419
666 Ga0070659_100339104
667 Ga0070659_100539526
668 Ga0070709_10002689
669 Ga0070714_100422554
670 Ga0070710_10003785
671 Ga0070711_100011707
672 Ga0070700_100937337
673 Ga0070694_100333007
674 Ga0070663_100064892
675 Ga0070663_100562094
676 Ga0070663_101103875
677 Ga0070662_100006427
678 Ga0070662_100967909
679 Ga0070679_100018631
680 Ga0070684_100000637
681 Ga0070684_100489609
682 Ga0070684_101027029
683 Ga0070684_101398607
684 Ga0068853_100000373
685 Ga0068853_100048994
686 Ga0068853_100488997
687 Ga0070695_100532056
688 Ga0070665_100000051
689 Ga0068855_100000173
690 Ga0068855_100106598
691 Ga0068855_100177254
692 Ga0068855_100298580
693 Ga0068855_100473012
694 Ga0068855_101093689
695 Ga0070664_100005200
696 Ga0070664_100009428
697 Ga0068857_100004617
698 Ga0068857_100008723
699 Ga0068857_100011871
700 Ga0068857_100040390
701 Ga0068857_101242252
702 Ga0068854_100000295
703 Ga0068856_100001545
704 Ga0068856_100004674
705 Ga0068856_100068997
706 Ga0068856_100151339
707 Ga0068856_100406664
708 Ga0068856_101787016
709 Ga0068856_102558449
710 Ga0068852_100000060
711 Ga0068852_100020731
712 Ga0068864_100000109
713 Ga0068861_100064921
714 Ga0068851_10019756
715 Ga0068863_100000936
716 Ga0068858_100000104
717 Ga0068858_100931658
718 Ga0081455_10001276
719 Ga0081455_10004016
720 Ga0081540_1004908
721 Ga0081540_1008180
722 Ga0070717_10665079
723 Ga0075365_10257420
724 Ga0075364_10001273
725 Ga0070715_10415880
726 Ga0070716_100092006
727 Ga0075367_10203544
728 Ga0075369_10188439
729 Ga0075428_102740660
730 Ga0075430_100561054
731 Ga0075433_11158615
732 Ga0075434_100010364
733 Ga0075435_101116230
734 Ga0105240_11328991
735 Ga0111539_10031489
736 Ga0111539_11381430
737 Ga0111539_12589982
738 Ga0105243_11257575
739 Ga0105242_11674500
740 Ga0105248_10014799
741 Ga0105248_12098351
742 Ga0105237_10000378
743 Ga0105237_11211002
744 Ga0105238_10000647
745 Ga0105238_10000912
746 Ga0105238_10276042
747 Ga0105249_12464373
748 Ga0099796_10082881
749 Ga0105239_10000232
750 Ga0105239_10009359
751 Ga0105239_10015700
752 Ga0157373_10009709
753 Ga0157373_10079472
754 Ga0157371_10045652
755 Ga0157371_10067636
756 Ga0157371_11117241
757 Ga0157370_10001089
758 Ga0157370_10014185
759 Ga0157370_10056799
760 Ga0157369_10003995
761 Ga0157369_10024358
762 Ga0157369_10287367
763 Ga0157372_10003423
764 Ga0157372_11210168
765 Ga0157372_12100941
766 Ga0157372_13472457
767 Ga0157376_11715956
768 Ga0157376_12029531
769 Ga0163161_10073110
770 Ga0206352_11016838
771 Ga0206353_10722459
772 Ga0214544_1009140
773 Ga0213876_10000534
774 Ga0213876_10021832
775 Ga0209147_100397
776 Ga0209147_100482
777 Ga0209437_125384
778 Ga0209233_1000167
779 Ga0209565_1000010
780 Ga0209565_1000446
781 Ga0209673_1003679
782 Ga0209673_1065518
783 Ga0209675_1000082
784 Ga0209676_1000119
785 Ga0209676_1000251
786 Ga0209676_1003359
787 Ga0209564_1000069
788 Ga0209564_1001310
789 Ga0209758_1016091
790 Ga0209758_1081545
791 Ga0209050_1000001
792 Ga0209050_1000017
793 Ga0209050_1000263
794 Ga0209050_1002306
795 Ga0209050_1012915
796 Ga0209256_1000034
797 Ga0207426_1016465
798 Ga0207426_1041349
799 Ga0209051_1001006
800 Ga0209051_1002421
801 Ga0209257_1000111
802 Ga0209257_1000485
803 Ga0209257_1000841
804 Ga0209257_1002342
805 Ga0209257_1004582
806 Ga0207692_10058373
807 Ga0207710_10389778
808 Ga0207647_10009495
809 Ga0207647_10044073
810 Ga0207647_10129801
811 Ga0207647_10131946
812 Ga0207685_10330905
813 Ga0207699_10002420
814 Ga0207705_10000138
815 Ga0207705_10000322
816 Ga0207705_10007805
817 Ga0207705_10025138
818 Ga0207705_10046689
819 Ga0207705_10097900
820 Ga0207705_10110577
821 Ga0207705_10529957
822 Ga0207684_10032142
823 Ga0207707_10112574
824 Ga0207695_10000525
825 Ga0207695_10001920
826 Ga0207695_10043364
827 Ga0207671_10000222
828 Ga0207671_10847714
829 Ga0207663_10011370
830 Ga0207660_10013342
831 Ga0207660_10185606
832 Ga0207657_10000020
833 Ga0207657_10001528
834 Ga0207657_10007909
835 Ga0207657_10017261
836 Ga0207649_10003102
837 Ga0207649_10148216
838 Ga0207649_10938422
839 Ga0207652_10295710
840 Ga0207652_10384363
841 Ga0207694_10000611
842 Ga0207694_10010374
843 Ga0207694_11351657
844 Ga0207694_11785709
845 Ga0207650_10000039
846 Ga0207644_10418720
847 Ga0207690_10069935
848 Ga0207690_10470174
849 Ga0207706_10004943
850 Ga0207706_10447463
851 Ga0207686_10906178
852 Ga0207665_10056031
853 Ga0207711_10017036
854 Ga0207661_10002993
855 Ga0207661_10534316
856 Ga0207679_10007620
857 Ga0207679_10353779
858 Ga0207667_10000001
859 Ga0207667_10048367
860 Ga0207667_10074773
861 Ga0207667_10104495
862 Ga0207667_10206025
863 Ga0207667_11091123
864 Ga0207668_10005413
865 Ga0207668_10010848
866 Ga0207668_10848580
867 Ga0207640_10000041
868 Ga0207640_10115352
869 Ga0207703_10000136
870 Ga0207703_10822600
871 Ga0207639_10000081
872 Ga0207639_10049770
873 Ga0207639_10309083
874 Ga0207678_10017850
875 Ga0207678_10066136
876 Ga0207678_10413036
877 Ga0207708_10037395
878 Ga0207702_10001302
879 Ga0207702_10001542
880 Ga0207702_10059786
881 Ga0207702_10098726
882 Ga0207702_10207657
883 Ga0207702_12035248
884 Ga0207702_12497676
885 Ga0207641_10000504
886 Ga0207648_11014172
887 Ga0207676_10000035
888 Ga0207674_10008818
889 Ga0207674_10018111
890 Ga0207674_10018275
891 Ga0207674_10053187
892 Ga0207674_10055396
893 Ga0207675_100051157
894 Ga0207698_10000054
895 Ga0207698_10155850
896 Ga0207698_10367266
897 Ga0209974_10011516
898 Ga0209974_10074751
899 Ga0207428_10684781
900 Ga0207428_10962642
901 Ga0268266_10000002
902 Ga0265337_1010314
903 Ga0265326_10000426
904 Ga0265319_1003601
905 Ga0265334_10000781
906 Ga0265323_10000085
907 Ga0265322_10107605
908 Ga0265336_10000603
909 Ga0307515_10312238
910 Ga0265338_10000799
911 Ga0265324_10001911
912 Ga0307511_10231122
913 Ga0265763_1011872
914 Ga0265760_10143305
915 Ga0307513_10383326
916 Ga0307513_10631956
917 Ga0307509_10000816
918 Ga0307509_10057850
919 Ga0307509_10190161
920 Ga0307408_100027131
921 Ga0307408_100222188
922 Ga0307408_100377221
923 Ga0307508_10004125
924 Ga0307508_10145869
925 Ga0265314_10024861
926 Ga0265314_10105927
927 Ga0307516_10020296
928 Ga0307516_10022657
929 Ga0307516_10048922
930 Ga0307516_10106292
931 Ga0307516_10171759
932 Ga0307516_10251642
933 Ga0307405_10000156
934 Ga0307405_10020822
935 Ga0307413_10376003
936 Ga0307410_10003370
937 Ga0307410_10426200
938 Ga0307406_10466702
939 Ga0307407_10002442
940 Ga0307407_10905002
941 Ga0307412_10008004
942 Ga0307412_10079327
943 Ga0307412_10147260
944 Ga0307412_10328840
945 Ga0307409_100121553
946 Ga0307409_101623025
947 Ga0307409_101807146
948 Ga0307416_100040731
949 Ga0307416_100403407
950 Ga0307414_10063037
951 Ga0307414_10113062
952 Ga0307414_10839097
953 Ga0307411_10022077
954 Ga0307411_11300815
955 Ga0307415_100162756
956 Ga0307510_10220671
957 Ga0307510_10401588
958 Ga0373948_0004770
959 Ga0373958_0009502
960 Ga0373938_0023689
961 Ga0373938_0156024
962 Ga0373949_0073358
963 Ga0373952_0050039
964 Ga0373932_0009680
965 Ga0373932_0010017
966 Ga0373939_0273342
967 Ga0373941_0084177
968 Ga0373961_0081596
969 Ga0373962_0017939
970 Ga0373962_0044496
971 Ga0373962_0156785
972 Ga0373931_0002832
973 Ga0373931_0036549
974 Ga0373931_0059274
975 Ga0373931_1165503
976 Ga0373927_0195342
977 Ga0395899_0002329
978 Ga0395899_0010936
979 Ga0395899_0132389
980 Ga0395900_0000017
981 Ga0395900_0003311
982 Ga0395900_0023903
983 Ga0395900_0073364
984 Ga0395900_0545686
985 Ga0395898_0000030
986 Ga0395898_0003803
987 Ga0395898_0041319
988 Ga0395898_0088045
989 Ga0395898_0535021
990 Ga0395898_0704912
991 Ga0395905_0000056
992 Ga0395905_0004900
993 Ga0395905_0028426
994 Ga0395905_0118106
995 Ga0395905_0331492
996 Ga0436364_0437118
997 Ga0395901_0000015
998 Ga0395901_0005155
999 Ga0395901_0015677
1000 Ga0395901_0054033
1001 Ga0395901_0195469
1002 Ga0395901_0570589
1003 Ga0436365_0331238
1004 Ga0436365_0461462
1005 Ga0436365_0560439
1006 Ga0436360_0726733
1007 Ga0436362_1276304
1008 Ga0451789_0950394
1009 Ga0451807_0060181
1010 Ga0451843_1669296
1011 Ga0451853_0985972
1012 Ga0439448_0072970
1013 Ga0439458_0006987
1014 Ga0439459_0101164
1015 Ga0466972_0131137
1016 Ga0466972_0169778
1017 Ga0466966_0001850
1018 Ga0466966_0004295
1019 Ga0466959_0000454
1020 Ga0466959_0438176
1021 Ga0466958_0004871
1022 Ga0466958_1180124
1023 Ga0466967_0163817
1024 Ga0495627_000409
1025 Ga0495603_0117727
1026 Ga0495629_0254271
1027 Ga0495638_0000318
1028 Ga0495638_0323509
1029 Ga0495650_0000160
1030 Ga0495582_0042663
1031 Ga0495585_0074514
1032 Ga0495583_0000120
1033 Ga0495606_0201213
1034 Ga0495637_0224700
1035 Ga0495643_0000336
1036 Ga0495643_0063940
1037 Ga0495643_0499732
1038 Ga0495652_1027145
1039 Ga0495654_0130598
1040 Ga0495665_0363729
1041 Ga0495640_0427828
1042 Ga0495633_0003846
1043 Ga0495625_0000454
1044 Ga0495625_0005533
1045 Ga0495625_0829079
1046 Ga0495658_1052621
1047 Ga0495613_0207749
1048 Ga0495670_0204263
1049 Ga0495581_0009689
1050 Ga0495674_0251388
1051 Ga0495676_0457034
1052 Ga0495686_0000892
1053 Ga0495593_0076970
1054 Ga0495615_0234956
1055 Ga0496100_1361731
1056 Ga0496101_0750305
1057 Ga0496101_0761481
1058 Ga0496102_0164853
1059 Ga0496102_0667926
1060 Ga0496104_0091437
1061 Ga0496106_0063619
1062 Ga0496106_1108104
1063 Ga0496107_0000202
1064 Ga0496107_0273725
1065 Ga0496107_0468573
1066 Ga0496109_0548930
1067 Ga0496111_0131173
1068 Ga0496117_0040646
1069 Ga0496118_0029330
1070 Ga0496118_0328627
1071 Ga0496120_0308633
1072 Ga0496121_0000003
1073 Ga0496121_0000472
1074 Ga0496121_0000484
1075 Ga0496121_0001383
1076 Ga0496121_0118821
1077 Ga0496121_0297915
1078 Ga0496122_0000694
1079 Ga0496122_0029876
1080 Ga0496122_0039218
1081 Ga0496123_0000585
1082 Ga0496123_0001459
1083 Ga0496124_0000188
1084 Ga0496124_0013548
1085 Ga0496124_0070163
1086 Ga0496125_0028876
1087 Ga0496126_0000041
1088 Ga0496126_0027509
1089 Ga0496126_0092813
1090 Ga0496126_0679806
1091 Ga0496126_0897207
1092 Ga0495682_0126374
1093 Ga0501032_0000525
1094 Ga0501032_0597106
1095 Ga0501033_0001916
1096 Ga0501033_0505779
1097 Ga0501034_0028252
1098 Ga0501034_0362069
1099 Ga0501037_0593797
1100 Ga0501037_1115022
1101 Ga0501038_0074174
1102 Ga0501038_0250266
1103 Ga0501039_0532220
1104 Ga0501043_0291494
1105 Ga0501047_0009550
1106 Ga0501047_0032519
1107 Ga0501047_0072290
1108 Ga0501223_000136
1109 Ga0501224_000005
1110 Ga0501233_000008
1111 Ga0501235_000193
1112 Ga0501225_0000103
1113 Ga0501229_083887
1114 Ga0501234_013511
1115 Ga0501035_0000627
1116 Ga0501044_0000406
1117 Ga0501044_0110315
1118 Ga0501044_0516551
1119 Ga0501226_000021
1120 nmdc:mga03n38_416169_c1
1121 nmdc:mga00v17_37009_c1
1122 nmdc:mga0yw44_36020_c1
1123 nmdc:mga0yw44_431274_c1
1124 nmdc:mga0yw44_453496_c1
1125 nmdc:mga0k408_821136_c1
1126 nmdc:mga08y16_1095105_c1
1127 nmdc:mga0n895_1404289_c1
1128 nmdc:mga0rr50_1043492_c1
1129 nmdc:mga0sz30_111351_c1
1130 nmdc:mga0sz30_9581_c2
1131 Ga0500635_0060744
1132 Ga0500643_000573
1133 Ga0500647_0264431
1134 Ga0500651_0233144
1135 Ga0500651_0360288
1136 Ga0500641_0008669
1137 Ga0500555_000325
1138 Ga0500556_0003219
1139 Ga0500556_0393345
1140 Ga0500572_216499
1141 Ga0500592_003406
1142 Ga0500595_024977
1143 Ga0500573_0231215
1144 Ga0500590_014306
1145 Ga0500590_140551
1146 Ga0500604_0130650
1147 Ga0500616_0000170
1148 Ga0500622_0006308
1149 Ga0500624_000002
1150 Ga0500624_000335
1151 Ga0500627_0000020
1152 Ga0500634_0407864
1153 Ga0500639_000710
1154 Ga0500639_312624
1155 Ga0500636_0046461
1156 Ga0500636_0274669
1157 Ga0500637_0023820
1158 Ga0500637_0512847
1159 Ga0500570_000111
1160 Ga0500599_034915
1161 Ga0466962_0309150
1162 2879085089
1163 2509151417
1164 2511124856
1165 2512645929
1166 2513613028
1167 2513643947
1168 2513677674
1169 2524441921
1170 2524470544
1171 2537876284
1172 2585154381
1173 2585197956
1174 2617375303
1175 2643751306
1176 2643950073
1177 2644510642
1178 2723844722
1179 2758642708
1180 2778125867
1181 2792460085
1182 2792462077
1183 2819555042
1184 2824680119
1185 2824755926
1186 2824764979
1187 2843745982
1188 2843748267
1189 2856330722
1190 2876400192
1191 2885388779
1192 2885416840
1193 2891093066
1194 2898331838
1195 2903775660
1196 2904715978
1197 2937852661
1198 2961140437
1199 2965028475
1200 2965104970
1201 2970554904
1202 2977925219
1203 3004212482
1204 3004224163
1205 3005597982
1206 8054305513
1207 8056677061
1208 8056692319
1209 8057104599
1210 8057105190

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04956

TrbC

TrbC/VIRB2 pilin

21

124

0.93

Map