F468438
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 605 | 392 | 599 | 102 |
Family's Representative Sequence
| Representative Sequence | 3300005335|Ga0070666_11144327|Ga0070666_111443272 |
| Length | 117 |
| Sequence | MSAAPKKRRFGFGRKAVEQADIDPRHYDIITAPVITEKATMGSEFGQVTFRVPLTATKPQIKAAVEALFKVNVKAVNTLIAKGKTKRFKGLPGRRSDVKKAIVTLAAGQSIDVTTGV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231221 | Azospirillum lipoferum 4B | Isolate | Rhizosphere |
| 2 | 2597490356 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 3 | 2844533157 | Inquilinus sp. R-72501 v. 2 | Isolate | Unclassified |
| 4 | 2846952575 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 5 | 2848858292 | Azospirillum brasilense Az39 | Isolate | Unclassified |
| 6 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 7 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 8 | 3300003158 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_3 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 9 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 10 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 11 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 12 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 13 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 14 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 15 | 3300003559 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 16 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 17 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 18 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 19 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 20 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 22 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 23 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 24 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 25 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 26 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 27 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 32 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 36 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 55 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 57 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 59 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 60 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 61 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 62 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 63 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 64 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 65 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 66 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 67 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 68 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 70 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 71 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 72 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 75 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 76 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 77 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 78 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 80 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 81 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009986 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG | Metagenome | Rhizosphere |
| 89 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 91 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 92 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 101 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 102 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 103 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 104 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 105 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 106 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 108 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 109 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 111 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 114 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 117 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 162 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 163 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 164 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 165 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 166 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 167 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 168 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 169 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 170 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 171 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 172 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 173 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 174 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 175 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 176 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 177 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 178 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 179 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 180 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 181 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 182 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 183 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 184 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 185 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 186 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 187 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 188 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 189 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 190 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 191 | 3300039145 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 | Metagenome | Unclassified |
| 192 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 193 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 194 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 195 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 196 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 197 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 198 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 199 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 200 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 201 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 202 | 3300041502 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT | Metatranscriptome | Unclassified |
| 203 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 204 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 205 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 206 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 207 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 208 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 209 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 210 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 211 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 212 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 213 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 214 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 215 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 216 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 217 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 218 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 219 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 220 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 221 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 222 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 223 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 224 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 262 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 263 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 264 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 265 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 266 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 267 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 268 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 269 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 270 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 271 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 272 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 273 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 274 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 275 | 3300049131 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 276 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 277 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 279 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 280 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 281 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 282 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 283 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 284 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 285 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 286 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 287 | 3300049540 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 288 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 289 | 3300049545 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 290 | 3300049553 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 291 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 304 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 306 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 307 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 308 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 309 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 310 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 311 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 312 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 314 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 315 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 316 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 317 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 318 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 319 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 320 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 321 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 322 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 323 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 324 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 325 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 326 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 327 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 328 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 329 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 330 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 331 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 332 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 333 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 334 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 335 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 336 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 337 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 338 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 339 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 340 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 341 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 342 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 343 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 344 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 345 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 346 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 347 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 348 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 349 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 350 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 351 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 352 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 353 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 354 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 355 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 356 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 357 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 358 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 359 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 360 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 361 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 362 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 363 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 364 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 365 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 366 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 367 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 368 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 369 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 370 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 371 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 372 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 373 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 374 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 375 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 376 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 377 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 378 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 379 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 380 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 381 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 382 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 383 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 384 | 3300059648 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 385 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 386 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 387 | 3300059654 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 388 | 3300059660 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 389 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 390 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 391 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 392 | 8054002106 | Azospirillum lipoferum 59b | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 84.3 |
| Metatranscriptomes | 14.71 |
| Isolates | 0.99 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 19.5 |
| Nodule | 0 |
| Rhizoplane | 3.14 |
| Rhizosphere | 69.26 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.1 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24751J29686_10031233 | 3300002459 | Bacteria | 1105 |
| 2 | JGI25159J45721_1005639 | 3300002987 | Bacteria | 3897 |
| 3 | Ga0006760J45825_104920 | 3300003158 | Bacteria | 644 |
| 4 | Ga0006759J45824_1069825 | 3300003163 | Bacteria | 736 |
| 5 | Ga0006759J45824_1093412 | 3300003163 | Bacteria | 972 |
| 6 | JGI25151J46595_10000624 | 3300003187 | Bacteria | 30772 |
| 7 | JGI25153J46596_10020623 | 3300003215 | Bacteria | 2486 |
| 8 | rootL2_10069702 | 3300003322 | Bacteria | 1371 |
| 9 | rootL2_10134251 | 3300003322 | Bacteria | 1105 |
| 10 | rootH1_10228499 | 3300003323 | Bacteria | 1411 |
| 11 | JGI25160J50197_1004313 | 3300003354 | Bacteria | 6163 |
| 12 | Ga0007427J51700_108029 | 3300003559 | Bacteria | 831 |
| 13 | Ga0007429J51699_1025305 | 3300003579 | Bacteria | 934 |
| 14 | Ga0032354_1009883 | 3300003693 | Bacteria | 2257 |
| 15 | Ga0032354_1036765 | 3300003693 | Bacteria | 2457 |
| 16 | Ga0055526_1026248 | 3300003771 | Bacteria | 1843 |
| 17 | Ga0055537_1004503 | 3300003773 | Bacteria | 3972 |
| 18 | Ga0055524_1037192 | 3300003775 | Bacteria | 1295 |
| 19 | Ga0055524_1052374 | 3300003775 | Bacteria | 912 |
| 20 | Ga0055534_1043029 | 3300003784 | Bacteria | 659 |
| 21 | Ga0055528_1007701 | 3300003790 | Bacteria | 4722 |
| 22 | Ga0055530_10053500 | 3300003791 | Bacteria | 927 |
| 23 | Ga0055531_10023544 | 3300003794 | Bacteria | 2303 |
| 24 | Ga0055531_10068005 | 3300003794 | Bacteria | 835 |
| 25 | Ga0055543_1043964 | 3300004625 | Bacteria | 747 |
| 26 | Ga0065165_1002762 | 3300005262 | Bacteria | 13954 |
| 27 | Ga0065704_10007805 | 3300005289 | Bacteria | 2508 |
| 28 | Ga0070658_10503281 | 3300005327 | Bacteria | 1046 |
| 29 | Ga0070658_10737474 | 3300005327 | Bacteria | 855 |
| 30 | Ga0070683_100461961 | 3300005329 | Bacteria | 1212 |
| 31 | Ga0070670_100461539 | 3300005331 | Bacteria | 1126 |
| 32 | Ga0068869_101085680 | 3300005334 | Bacteria | 700 |
| 33 | Ga0070666_11144327 | 3300005335 | Bacteria | 579 |
| 34 | Ga0070680_101335264 | 3300005336 | Bacteria | 621 |
| 35 | Ga0070682_101299911 | 3300005337 | Bacteria | 618 |
| 36 | Ga0068868_101014902 | 3300005338 | Bacteria | 760 |
| 37 | Ga0070660_100775744 | 3300005339 | Bacteria | 806 |
| 38 | Ga0070661_100418722 | 3300005344 | Bacteria | 1062 |
| 39 | Ga0070668_100001882 | 3300005347 | Bacteria | 15339 |
| 40 | Ga0070669_100050591 | 3300005353 | Bacteria | 3035 |
| 41 | Ga0070671_100011171 | 3300005355 | Bacteria | 7211 |
| 42 | Ga0070673_101556241 | 3300005364 | Bacteria | 624 |
| 43 | Ga0070659_101321666 | 3300005366 | Bacteria | 640 |
| 44 | Ga0070667_100021170 | 3300005367 | Bacteria | 5403 |
| 45 | Ga0070667_100594634 | 3300005367 | Bacteria | 1019 |
| 46 | Ga0070709_10402063 | 3300005434 | Bacteria | 1023 |
| 47 | Ga0070714_100285187 | 3300005435 | Bacteria | 1535 |
| 48 | Ga0070714_101687603 | 3300005435 | Bacteria | 619 |
| 49 | Ga0070713_100107963 | 3300005436 | Bacteria | 2422 |
| 50 | Ga0070710_10136161 | 3300005437 | Bacteria | 1502 |
| 51 | Ga0070711_100557170 | 3300005439 | Bacteria | 952 |
| 52 | Ga0070663_101215590 | 3300005455 | Bacteria | 663 |
| 53 | Ga0070663_101589573 | 3300005455 | Bacteria | 583 |
| 54 | Ga0070678_100463708 | 3300005456 | Bacteria | 1112 |
| 55 | Ga0070685_10005750 | 3300005466 | Bacteria | 6302 |
| 56 | Ga0070684_102023121 | 3300005535 | Bacteria | 544 |
| 57 | Ga0070672_101379419 | 3300005543 | Bacteria | 630 |
| 58 | Ga0070686_100505957 | 3300005544 | Bacteria | 938 |
| 59 | Ga0070686_101397684 | 3300005544 | Bacteria | 587 |
| 60 | Ga0070665_100349684 | 3300005548 | Bacteria | 1483 |
| 61 | Ga0068855_100575861 | 3300005563 | Bacteria | 1216 |
| 62 | Ga0068855_101677522 | 3300005563 | Bacteria | 648 |
| 63 | Ga0070664_101039164 | 3300005564 | Bacteria | 771 |
| 64 | Ga0070664_102350384 | 3300005564 | Bacteria | 506 |
| 65 | Ga0068856_100134295 | 3300005614 | Bacteria | 2480 |
| 66 | Ga0068856_100694970 | 3300005614 | Bacteria | 1037 |
| 67 | Ga0068852_101458078 | 3300005616 | Bacteria | 707 |
| 68 | Ga0068864_100030863 | 3300005618 | Bacteria | 4544 |
| 69 | Ga0068861_102704965 | 3300005719 | Bacteria | 500 |
| 70 | Ga0068863_100080807 | 3300005841 | Bacteria | 3079 |
| 71 | Ga0068863_100182679 | 3300005841 | Bacteria | 2013 |
| 72 | Ga0068858_100000261 | 3300005842 | Bacteria | 56197 |
| 73 | Ga0068860_100000042 | 3300005843 | Bacteria | 227404 |
| 74 | Ga0068862_100003686 | 3300005844 | Bacteria | 13105 |
| 75 | Ga0068862_102162301 | 3300005844 | Bacteria | 568 |
| 76 | Ga0081455_10058498 | 3300005937 | Bacteria | 3261 |
| 77 | Ga0081540_1017843 | 3300005983 | Bacteria | 4377 |
| 78 | Ga0070717_10294886 | 3300006028 | Bacteria | 1441 |
| 79 | Ga0075365_10444201 | 3300006038 | Bacteria | 916 |
| 80 | Ga0075363_100292289 | 3300006048 | Bacteria | 944 |
| 81 | Ga0075364_10327156 | 3300006051 | Bacteria | 1044 |
| 82 | Ga0070716_100158507 | 3300006173 | Bacteria | 1464 |
| 83 | Ga0070712_100227825 | 3300006175 | Bacteria | 1479 |
| 84 | Ga0075362_10306772 | 3300006177 | Bacteria | 788 |
| 85 | Ga0075362_10559589 | 3300006177 | Bacteria | 588 |
| 86 | Ga0075367_10767659 | 3300006178 | Bacteria | 614 |
| 87 | Ga0075369_10010071 | 3300006186 | Bacteria | 3692 |
| 88 | Ga0075366_10031500 | 3300006195 | Bacteria | 3121 |
| 89 | Ga0097621_100328028 | 3300006237 | Bacteria | 1357 |
| 90 | Ga0075370_10363622 | 3300006353 | Bacteria | 865 |
| 91 | Ga0075370_10855728 | 3300006353 | Bacteria | 555 |
| 92 | Ga0075430_100652120 | 3300006846 | Bacteria | 868 |
| 93 | Ga0105240_10022560 | 3300009093 | Bacteria | 8342 |
| 94 | Ga0105240_10058879 | 3300009093 | Bacteria | 4795 |
| 95 | Ga0105240_10255649 | 3300009093 | Bacteria | 2023 |
| 96 | Ga0105240_10413825 | 3300009093 | Bacteria | 1516 |
| 97 | Ga0105240_12393746 | 3300009093 | Bacteria | 547 |
| 98 | Ga0105245_11808632 | 3300009098 | Bacteria | 664 |
| 99 | Ga0105241_10326042 | 3300009174 | Bacteria | 1326 |
| 100 | Ga0105241_11546966 | 3300009174 | Bacteria | 640 |
| 101 | Ga0105242_10461280 | 3300009176 | Bacteria | 1200 |
| 102 | Ga0105248_10440021 | 3300009177 | Bacteria | 1469 |
| 103 | Ga0105248_12360574 | 3300009177 | Bacteria | 606 |
| 104 | Ga0105237_10224191 | 3300009545 | Bacteria | 1880 |
| 105 | Ga0105237_10433354 | 3300009545 | Bacteria | 1320 |
| 106 | Ga0105237_12630793 | 3300009545 | Bacteria | 514 |
| 107 | Ga0105238_10196243 | 3300009551 | Bacteria | 1994 |
| 108 | Ga0105238_10326749 | 3300009551 | Bacteria | 1520 |
| 109 | Ga0105238_10724768 | 3300009551 | Bacteria | 1007 |
| 110 | Ga0105238_10829427 | 3300009551 | Bacteria | 941 |
| 111 | Ga0105238_10859111 | 3300009551 | Bacteria | 925 |
| 112 | Ga0105033_104982 | 3300009986 | Bacteria | 1137 |
| 113 | Ga0105239_10905051 | 3300010375 | Bacteria | 1013 |
| 114 | Ga0105239_11856159 | 3300010375 | Bacteria | 699 |
| 115 | Ga0157347_1011264 | 3300012502 | Bacteria | 948 |
| 116 | Ga0157327_1004697 | 3300012512 | Bacteria | 1072 |
| 117 | Ga0157373_10348597 | 3300013100 | Bacteria | 1056 |
| 118 | Ga0157370_10483229 | 3300013104 | Bacteria | 1138 |
| 119 | Ga0157378_12825693 | 3300013297 | Bacteria | 538 |
| 120 | Ga0163162_11460712 | 3300013306 | Bacteria | 778 |
| 121 | Ga0157372_10364270 | 3300013307 | Bacteria | 1684 |
| 122 | Ga0163163_10269543 | 3300014325 | Bacteria | 1754 |
| 123 | Ga0163163_11528902 | 3300014325 | Bacteria | 729 |
| 124 | Ga0157379_10238620 | 3300014968 | Bacteria | 1649 |
| 125 | Ga0163161_10878043 | 3300017792 | Bacteria | 758 |
| 126 | Ga0213873_10031217 | 3300021358 | Bacteria | 1324 |
| 127 | Ga0213872_10039932 | 3300021361 | Bacteria | 2142 |
| 128 | Ga0213874_10161379 | 3300021377 | Bacteria | 788 |
| 129 | Ga0213876_10008440 | 3300021384 | Bacteria | 5577 |
| 130 | Ga0213875_10058981 | 3300021388 | Bacteria | 1796 |
| 131 | Ga0213871_10012207 | 3300021441 | Bacteria | 1990 |
| 132 | Ga0213871_10111587 | 3300021441 | Bacteria | 809 |
| 133 | Ga0209233_1017172 | 3300025261 | Bacteria | 1977 |
| 134 | Ga0209565_1000925 | 3300025263 | Bacteria | 15538 |
| 135 | Ga0209673_1001876 | 3300025273 | Bacteria | 16959 |
| 136 | Ga0209130_1000706 | 3300025284 | Bacteria | 29893 |
| 137 | Ga0209675_1002644 | 3300025291 | Bacteria | 9054 |
| 138 | Ga0209675_1038255 | 3300025291 | Bacteria | 1070 |
| 139 | Ga0209676_1022325 | 3300025292 | Bacteria | 2100 |
| 140 | Ga0209025_1000750 | 3300025294 | Bacteria | 54523 |
| 141 | Ga0209564_1007568 | 3300025295 | Bacteria | 5584 |
| 142 | Ga0209564_1015779 | 3300025295 | Bacteria | 3053 |
| 143 | Ga0209758_1023594 | 3300025297 | Bacteria | 2776 |
| 144 | Ga0209050_1019693 | 3300025298 | Bacteria | 2548 |
| 145 | Ga0209256_1003893 | 3300025299 | Bacteria | 9891 |
| 146 | Ga0209256_1020366 | 3300025299 | Bacteria | 2072 |
| 147 | Ga0207426_1000336 | 3300025302 | Bacteria | 88370 |
| 148 | Ga0209051_1000877 | 3300025303 | Bacteria | 30359 |
| 149 | Ga0209257_1000976 | 3300025304 | Bacteria | 38920 |
| 150 | Ga0209257_1008377 | 3300025304 | Bacteria | 5898 |
| 151 | Ga0207692_10089803 | 3300025898 | Bacteria | 1664 |
| 152 | Ga0207647_10645457 | 3300025904 | Bacteria | 581 |
| 153 | Ga0207645_10029047 | 3300025907 | Bacteria | 3565 |
| 154 | Ga0207705_10672397 | 3300025909 | Bacteria | 805 |
| 155 | Ga0207707_11353605 | 3300025912 | Bacteria | 570 |
| 156 | Ga0207695_10049522 | 3300025913 | Bacteria | 4427 |
| 157 | Ga0207695_10076710 | 3300025913 | Bacteria | 3397 |
| 158 | Ga0207671_10258019 | 3300025914 | Bacteria | 1371 |
| 159 | Ga0207671_10790721 | 3300025914 | Bacteria | 753 |
| 160 | Ga0207657_10493531 | 3300025919 | Bacteria | 959 |
| 161 | Ga0207649_10214678 | 3300025920 | Bacteria | 1367 |
| 162 | Ga0207652_10439885 | 3300025921 | Bacteria | 1176 |
| 163 | Ga0207681_10452633 | 3300025923 | Bacteria | 1045 |
| 164 | Ga0207694_10027541 | 3300025924 | Bacteria | 4329 |
| 165 | Ga0207694_10211628 | 3300025924 | Bacteria | 1579 |
| 166 | Ga0207694_10677710 | 3300025924 | Bacteria | 869 |
| 167 | Ga0207694_10748388 | 3300025924 | Bacteria | 825 |
| 168 | Ga0207650_11485020 | 3300025925 | Bacteria | 576 |
| 169 | Ga0207659_11811051 | 3300025926 | Bacteria | 518 |
| 170 | Ga0207700_10111800 | 3300025928 | Bacteria | 2199 |
| 171 | Ga0207664_10019250 | 3300025929 | Bacteria | 5041 |
| 172 | Ga0207664_11891233 | 3300025929 | Bacteria | 519 |
| 173 | Ga0207644_10018207 | 3300025931 | Bacteria | 4749 |
| 174 | Ga0207690_10870636 | 3300025932 | Bacteria | 746 |
| 175 | Ga0207706_11091972 | 3300025933 | Bacteria | 667 |
| 176 | Ga0207686_11529165 | 3300025934 | Bacteria | 550 |
| 177 | Ga0207665_10064425 | 3300025939 | Bacteria | 2490 |
| 178 | Ga0207691_11556722 | 3300025940 | Bacteria | 539 |
| 179 | Ga0207711_11898226 | 3300025941 | Bacteria | 538 |
| 180 | Ga0207711_12094047 | 3300025941 | Bacteria | 508 |
| 181 | Ga0207661_11079713 | 3300025944 | Bacteria | 739 |
| 182 | Ga0207679_11297557 | 3300025945 | Bacteria | 668 |
| 183 | Ga0207667_10014133 | 3300025949 | Bacteria | 9112 |
| 184 | Ga0207667_10434857 | 3300025949 | Bacteria | 1334 |
| 185 | Ga0207667_12015332 | 3300025949 | Bacteria | 537 |
| 186 | Ga0207651_11387531 | 3300025960 | Bacteria | 632 |
| 187 | Ga0207658_10000002 | 3300025986 | Bacteria | 1364188 |
| 188 | Ga0207703_10000253 | 3300026035 | Bacteria | 60255 |
| 189 | Ga0207703_11582981 | 3300026035 | Bacteria | 630 |
| 190 | Ga0207678_11114722 | 3300026067 | Bacteria | 699 |
| 191 | Ga0207678_11369025 | 3300026067 | Bacteria | 626 |
| 192 | Ga0207702_10683874 | 3300026078 | Bacteria | 1010 |
| 193 | Ga0207702_11087444 | 3300026078 | Bacteria | 793 |
| 194 | Ga0207641_10001025 | 3300026088 | Bacteria | 28336 |
| 195 | Ga0207641_10101679 | 3300026088 | Bacteria | 2533 |
| 196 | Ga0207648_11040737 | 3300026089 | Bacteria | 767 |
| 197 | Ga0207676_10173154 | 3300026095 | Bacteria | 1882 |
| 198 | Ga0207674_10434651 | 3300026116 | Bacteria | 1268 |
| 199 | Ga0207698_11282310 | 3300026142 | Bacteria | 747 |
| 200 | Ga0209970_1062345 | 3300027614 | Bacteria | 685 |
| 201 | Ga0209974_10065831 | 3300027876 | Bacteria | 1231 |
| 202 | Ga0268266_10005155 | 3300028379 | Bacteria | 12306 |
| 203 | Ga0268266_12119386 | 3300028379 | Bacteria | 535 |
| 204 | Ga0268265_10000582 | 3300028380 | Bacteria | 36910 |
| 205 | Ga0268264_10000001 | 3300028381 | Bacteria | 1221000 |
| 206 | Ga0268264_11979525 | 3300028381 | Bacteria | 592 |
| 207 | Ga0307517_10130623 | 3300028786 | Bacteria | 1810 |
| 208 | Ga0307515_10072026 | 3300028794 | Bacteria | 4673 |
| 209 | Ga0307515_10486084 | 3300028794 | Bacteria | 846 |
| 210 | Ga0307512_10169625 | 3300030522 | Bacteria | 1255 |
| 211 | Ga0265332_10232294 | 3300031238 | Bacteria | 764 |
| 212 | Ga0265331_10156725 | 3300031250 | Bacteria | 1033 |
| 213 | Ga0265331_10463231 | 3300031250 | Bacteria | 570 |
| 214 | Ga0265327_10007046 | 3300031251 | Bacteria | 8808 |
| 215 | Ga0265327_10042561 | 3300031251 | Bacteria | 2437 |
| 216 | Ga0307513_10010515 | 3300031456 | Bacteria | 11583 |
| 217 | Ga0265314_10053314 | 3300031711 | Bacteria | 2806 |
| 218 | Ga0265314_10083091 | 3300031711 | Bacteria | 2106 |
| 219 | Ga0265342_10180916 | 3300031712 | Bacteria | 1155 |
| 220 | Ga0316578_10158531 | 3300031728 | Bacteria | 1364 |
| 221 | Ga0307405_10467527 | 3300031731 | Bacteria | 1004 |
| 222 | Ga0307413_10177034 | 3300031824 | Bacteria | 1516 |
| 223 | Ga0316593_10007944 | 3300032168 | Bacteria | 2937 |
| 224 | Ga0316593_10008633 | 3300032168 | Bacteria | 2848 |
| 225 | Ga0316593_10020888 | 3300032168 | Bacteria | 2042 |
| 226 | Ga0316593_10078785 | 3300032168 | Bacteria | 1148 |
| 227 | Ga0316593_10176011 | 3300032168 | Bacteria | 785 |
| 228 | Ga0316586_1081233 | 3300033527 | Bacteria | 605 |
| 229 | Ga0316596_1008470 | 3300033541 | Bacteria | 2451 |
| 230 | Ga0373944_0256524 | 3300035089 | Bacteria | 647 |
| 231 | Ga0373935_0019032 | 3300035692 | Bacteria | 4187 |
| 232 | Ga0373927_1030299 | 3300035695 | Bacteria | 543 |
| 233 | Ga0373933_0445506 | 3300035724 | Bacteria | 847 |
| 234 | Ga0373933_0498110 | 3300035724 | Bacteria | 798 |
| 235 | Ga0373947_0044569 | 3300035725 | Bacteria | 2652 |
| 236 | Ga0373937_0125512 | 3300036401 | Bacteria | 2394 |
| 237 | Ga0373937_0257814 | 3300036401 | Bacteria | 1644 |
| 238 | Ga0316584_0571924 | 3300036712 | Bacteria | 787 |
| 239 | Ga0373925_0543580 | 3300037068 | Bacteria | 955 |
| 240 | Ga0395899_0000105 | 3300037312 | Bacteria | 146163 |
| 241 | Ga0395899_0128160 | 3300037312 | Bacteria | 1814 |
| 242 | Ga0395900_0060003 | 3300037418 | Bacteria | 3915 |
| 243 | Ga0395900_0776233 | 3300037418 | Bacteria | 887 |
| 244 | Ga0395898_0320867 | 3300037466 | Bacteria | 1478 |
| 245 | Ga0395898_0361499 | 3300037466 | Bacteria | 1384 |
| 246 | Ga0395905_0015820 | 3300037471 | Bacteria | 7166 |
| 247 | Ga0395905_0096583 | 3300037471 | Bacteria | 2774 |
| 248 | Ga0436364_0743164 | 3300037853 | Bacteria | 9802 |
| 249 | Ga0436364_0866406 | 3300037853 | Bacteria | 4069 |
| 250 | Ga0436364_1037710 | 3300037853 | Bacteria | 1007 |
| 251 | Ga0395901_0058183 | 3300038443 | Bacteria | 4021 |
| 252 | Ga0395901_0140376 | 3300038443 | Bacteria | 2539 |
| 253 | Ga0400483_014056 | 3300039062 | Bacteria | 3378 |
| 254 | Ga0400483_046766 | 3300039062 | Bacteria | 1297 |
| 255 | Ga0400483_154328 | 3300039062 | Bacteria | 1159 |
| 256 | Ga0400483_154910 | 3300039062 | Bacteria | 1953 |
| 257 | Ga0400483_187305 | 3300039062 | Bacteria | 5029 |
| 258 | Ga0237816_01805 | 3300039145 | Bacteria | 1710 |
| 259 | Ga0436365_0637755 | 3300039437 | Bacteria | 882 |
| 260 | Ga0436365_1136540 | 3300039437 | Bacteria | 40433 |
| 261 | Ga0436365_1763809 | 3300039437 | Bacteria | 1750 |
| 262 | Ga0436360_0452772 | 3300039438 | Bacteria | 2288 |
| 263 | Ga0436360_1093457 | 3300039438 | Bacteria | 642 |
| 264 | Ga0436361_0328563 | 3300039447 | Bacteria | 616 |
| 265 | Ga0436361_0464948 | 3300039447 | Bacteria | 1268 |
| 266 | Ga0436361_0479485 | 3300039447 | Bacteria | 1534 |
| 267 | Ga0436361_0491418 | 3300039447 | Bacteria | 1175 |
| 268 | Ga0436361_0533438 | 3300039447 | Bacteria | 1363 |
| 269 | Ga0436361_1159961 | 3300039447 | Bacteria | 634 |
| 270 | Ga0436363_0154863 | 3300039450 | Bacteria | 868 |
| 271 | Ga0436363_0409180 | 3300039450 | Bacteria | 1522 |
| 272 | Ga0436363_0899406 | 3300039450 | Bacteria | 4002 |
| 273 | Ga0436362_0010396 | 3300039453 | Bacteria | 795 |
| 274 | Ga0436362_0941954 | 3300039453 | Bacteria | 553 |
| 275 | Ga0436362_0976116 | 3300039453 | Bacteria | 8152 |
| 276 | Ga0436362_1086879 | 3300039453 | Bacteria | 807 |
| 277 | Ga0439465_0225540 | 3300041413 | Bacteria | 688 |
| 278 | Ga0451789_0212428 | 3300041443 | Bacteria | 779 |
| 279 | Ga0451789_1030109 | 3300041443 | Bacteria | 593 |
| 280 | Ga0451793_0901979 | 3300041452 | Bacteria | 542 |
| 281 | Ga0451797_0917049 | 3300041453 | Bacteria | 599 |
| 282 | Ga0451841_1373453 | 3300041498 | Bacteria | 777 |
| 283 | Ga0451846_09700 | 3300041502 | Bacteria | 708 |
| 284 | Ga0451843_0711516 | 3300041509 | Bacteria | 508 |
| 285 | Ga0451853_1947268 | 3300041512 | Bacteria | 523 |
| 286 | Ga0451853_3695048 | 3300041512 | Bacteria | 639 |
| 287 | Ga0439437_004749 | 3300042000 | Bacteria | 1487 |
| 288 | Ga0439441_036985 | 3300042001 | Bacteria | 966 |
| 289 | Ga0439445_0007571 | 3300042004 | Bacteria | 2523 |
| 290 | Ga0439445_0092836 | 3300042004 | Bacteria | 851 |
| 291 | Ga0450891_015951 | 3300042129 | Bacteria | 715 |
| 292 | Ga0450907_028084 | 3300042146 | Bacteria | 954 |
| 293 | Ga0439435_0256023 | 3300042436 | Bacteria | 590 |
| 294 | Ga0439459_0000576 | 3300042438 | Bacteria | 4885 |
| 295 | Ga0450916_000234 | 3300042530 | Bacteria | 4330 |
| 296 | Ga0466969_0016678 | 3300044656 | Bacteria | 3841 |
| 297 | Ga0466969_0096092 | 3300044656 | Bacteria | 1399 |
| 298 | Ga0466966_0001452 | 3300044684 | Bacteria | 15233 |
| 299 | Ga0466966_0116263 | 3300044684 | Bacteria | 1646 |
| 300 | Ga0466961_0000659 | 3300044693 | Bacteria | 21720 |
| 301 | Ga0466961_0237441 | 3300044693 | Bacteria | 1121 |
| 302 | Ga0466963_0248354 | 3300044694 | Bacteria | 1248 |
| 303 | Ga0466971_0010445 | 3300044719 | Bacteria | 4057 |
| 304 | Ga0466970_0024323 | 3300044765 | Bacteria | 3166 |
| 305 | Ga0466957_0095470 | 3300044842 | Bacteria | 1867 |
| 306 | Ga0466957_0642690 | 3300044842 | Bacteria | 745 |
| 307 | Ga0466959_0000162 | 3300045049 | Bacteria | 44052 |
| 308 | Ga0466959_0093014 | 3300045049 | Bacteria | 2164 |
| 309 | Ga0451576_0003979 | 3300045051 | Bacteria | 19673 |
| 310 | Ga0451576_0043660 | 3300045051 | Bacteria | 4729 |
| 311 | Ga0466958_0004660 | 3300045836 | Bacteria | 7274 |
| 312 | Ga0466958_0739905 | 3300045836 | Bacteria | 641 |
| 313 | Ga0466967_0468759 | 3300045976 | Bacteria | 1233 |
| 314 | Ga0495627_000399 | 3300046453 | Bacteria | 38947 |
| 315 | Ga0495590_0000851 | 3300046457 | Bacteria | 13774 |
| 316 | Ga0495590_0253139 | 3300046457 | Bacteria | 656 |
| 317 | Ga0495590_0322944 | 3300046457 | Bacteria | 583 |
| 318 | Ga0495638_0087536 | 3300046460 | Bacteria | 1881 |
| 319 | Ga0495638_0149164 | 3300046460 | Bacteria | 1357 |
| 320 | Ga0495638_0603644 | 3300046460 | Bacteria | 538 |
| 321 | Ga0495650_0001571 | 3300046471 | Bacteria | 21474 |
| 322 | Ga0495585_0057569 | 3300046492 | Bacteria | 2145 |
| 323 | Ga0495583_0000650 | 3300046506 | Bacteria | 45814 |
| 324 | Ga0495606_0013477 | 3300046507 | Bacteria | 6451 |
| 325 | Ga0495606_0151705 | 3300046507 | Bacteria | 1359 |
| 326 | Ga0495610_0026700 | 3300046512 | Bacteria | 3079 |
| 327 | Ga0495610_0059087 | 3300046512 | Bacteria | 1831 |
| 328 | Ga0495616_0069112 | 3300046513 | Bacteria | 1713 |
| 329 | Ga0495620_0125080 | 3300046515 | Bacteria | 1011 |
| 330 | Ga0495631_0019391 | 3300046518 | Bacteria | 3189 |
| 331 | Ga0495632_0004552 | 3300046519 | Bacteria | 9398 |
| 332 | Ga0495632_0140724 | 3300046519 | Bacteria | 1119 |
| 333 | Ga0495637_0016956 | 3300046520 | Bacteria | 3401 |
| 334 | Ga0495637_0091939 | 3300046520 | Bacteria | 1195 |
| 335 | Ga0495643_0094121 | 3300046522 | Bacteria | 1542 |
| 336 | Ga0495643_0167407 | 3300046522 | Bacteria | 1077 |
| 337 | Ga0495648_0002288 | 3300046524 | Bacteria | 17871 |
| 338 | Ga0495648_0445616 | 3300046524 | Bacteria | 567 |
| 339 | Ga0495652_0464478 | 3300046529 | Bacteria | 884 |
| 340 | Ga0495654_0006712 | 3300046530 | Bacteria | 6511 |
| 341 | Ga0495609_0030354 | 3300046538 | Bacteria | 2460 |
| 342 | Ga0495597_0033708 | 3300046542 | Bacteria | 2317 |
| 343 | Ga0495597_0043806 | 3300046542 | Bacteria | 1991 |
| 344 | Ga0495633_0080184 | 3300046558 | Bacteria | 1519 |
| 345 | Ga0495668_0001818 | 3300046616 | Bacteria | 19364 |
| 346 | Ga0495668_0019185 | 3300046616 | Bacteria | 3945 |
| 347 | Ga0495668_0421880 | 3300046616 | Bacteria | 733 |
| 348 | Ga0495625_0001925 | 3300046660 | Bacteria | 23466 |
| 349 | Ga0495625_0058314 | 3300046660 | Bacteria | 2743 |
| 350 | Ga0495625_0232434 | 3300046660 | Bacteria | 1203 |
| 351 | Ga0495625_0430583 | 3300046660 | Bacteria | 818 |
| 352 | Ga0495659_0002869 | 3300046664 | Bacteria | 5535 |
| 353 | Ga0495661_0138934 | 3300046665 | Bacteria | 1324 |
| 354 | Ga0495669_0358366 | 3300046684 | Bacteria | 705 |
| 355 | Ga0495613_0000576 | 3300046689 | Bacteria | 29823 |
| 356 | Ga0495670_0168018 | 3300046691 | Bacteria | 1154 |
| 357 | Ga0495670_0516710 | 3300046691 | Bacteria | 649 |
| 358 | Ga0495671_0285026 | 3300046692 | Bacteria | 795 |
| 359 | Ga0495649_0000981 | 3300046694 | Bacteria | 22495 |
| 360 | Ga0495649_0131040 | 3300046694 | Bacteria | 1323 |
| 361 | Ga0495589_0034715 | 3300046794 | Bacteria | 2530 |
| 362 | Ga0495589_0454372 | 3300046794 | Bacteria | 586 |
| 363 | Ga0495660_0214314 | 3300046810 | Bacteria | 911 |
| 364 | Ga0495660_0338009 | 3300046810 | Bacteria | 672 |
| 365 | Ga0495672_0000439 | 3300047320 | Bacteria | 49666 |
| 366 | Ga0495672_0079376 | 3300047320 | Bacteria | 1833 |
| 367 | Ga0495672_0140450 | 3300047320 | Bacteria | 1262 |
| 368 | Ga0495683_0011199 | 3300047323 | Bacteria | 4727 |
| 369 | Ga0495679_006048 | 3300047446 | Bacteria | 5288 |
| 370 | Ga0495673_0000189 | 3300047469 | Bacteria | 99018 |
| 371 | Ga0495673_0017740 | 3300047469 | Bacteria | 3604 |
| 372 | Ga0495673_0132665 | 3300047469 | Bacteria | 978 |
| 373 | Ga0495681_0064653 | 3300047470 | Bacteria | 1674 |
| 374 | Ga0495686_0026646 | 3300047472 | Bacteria | 3781 |
| 375 | Ga0495686_0072995 | 3300047472 | Bacteria | 2108 |
| 376 | Ga0495686_0079603 | 3300047472 | Bacteria | 2003 |
| 377 | Ga0495686_0117797 | 3300047472 | Bacteria | 1586 |
| 378 | Ga0496100_0545255 | 3300048903 | Bacteria | 897 |
| 379 | Ga0496106_0006912 | 3300048909 | Bacteria | 8394 |
| 380 | Ga0496106_0180175 | 3300048909 | Bacteria | 1677 |
| 381 | Ga0496107_0000073 | 3300048910 | Bacteria | 48489 |
| 382 | Ga0496107_0146752 | 3300048910 | Bacteria | 1745 |
| 383 | Ga0496108_0694872 | 3300048911 | Bacteria | 882 |
| 384 | Ga0496111_0272869 | 3300048914 | Bacteria | 1255 |
| 385 | Ga0496113_0258424 | 3300048916 | Bacteria | 1391 |
| 386 | Ga0496113_0699668 | 3300048916 | Bacteria | 809 |
| 387 | Ga0496114_0000033 | 3300048917 | Bacteria | 166897 |
| 388 | Ga0496114_0245251 | 3300048917 | Bacteria | 1576 |
| 389 | Ga0496114_1642310 | 3300048917 | Bacteria | 531 |
| 390 | Ga0496115_0021048 | 3300048918 | Bacteria | 5033 |
| 391 | Ga0496115_0028924 | 3300048918 | Bacteria | 4347 |
| 392 | Ga0496115_1264471 | 3300048918 | Bacteria | 551 |
| 393 | Ga0496121_0025980 | 3300048924 | Bacteria | 5537 |
| 394 | Ga0496121_0242092 | 3300048924 | Bacteria | 1256 |
| 395 | Ga0496121_0246123 | 3300048924 | Bacteria | 1243 |
| 396 | Ga0496122_0077737 | 3300048925 | Bacteria | 2328 |
| 397 | Ga0496122_0258233 | 3300048925 | Bacteria | 969 |
| 398 | Ga0496122_0549897 | 3300048925 | Bacteria | 550 |
| 399 | Ga0496123_0088232 | 3300048926 | Bacteria | 1853 |
| 400 | Ga0496123_0211923 | 3300048926 | Bacteria | 984 |
| 401 | Ga0496124_0158136 | 3300048927 | Bacteria | 1770 |
| 402 | Ga0496124_0346068 | 3300048927 | Bacteria | 1053 |
| 403 | Ga0496124_0775296 | 3300048927 | Bacteria | 597 |
| 404 | Ga0496125_0153392 | 3300048928 | Bacteria | 1578 |
| 405 | Ga0496126_0049088 | 3300048929 | Bacteria | 3854 |
| 406 | Ga0501341_02239 | 3300049131 | Bacteria | 1031 |
| 407 | Ga0501304_018737 | 3300049160 | Bacteria | 671 |
| 408 | Ga0495678_001705 | 3300049459 | Bacteria | 16503 |
| 409 | Ga0501311_009757 | 3300049527 | Bacteria | 1152 |
| 410 | Ga0501312_032631 | 3300049528 | Bacteria | 823 |
| 411 | Ga0501314_000774 | 3300049530 | Bacteria | 2110 |
| 412 | Ga0501315_004075 | 3300049531 | Bacteria | 1505 |
| 413 | Ga0501315_031740 | 3300049531 | Bacteria | 764 |
| 414 | Ga0501317_006835 | 3300049533 | Bacteria | 1269 |
| 415 | Ga0501317_009026 | 3300049533 | Bacteria | 1162 |
| 416 | Ga0501318_029083 | 3300049534 | Bacteria | 743 |
| 417 | Ga0501319_000756 | 3300049535 | Bacteria | 1660 |
| 418 | Ga0501320_038537 | 3300049536 | Bacteria | 619 |
| 419 | Ga0501323_002237 | 3300049539 | Bacteria | 1852 |
| 420 | Ga0501323_085480 | 3300049539 | Bacteria | 520 |
| 421 | Ga0501324_002768 | 3300049540 | Bacteria | 1297 |
| 422 | Ga0501325_052579 | 3300049541 | Bacteria | 521 |
| 423 | Ga0501329_05361 | 3300049545 | Bacteria | 708 |
| 424 | Ga0501337_019681 | 3300049553 | Bacteria | 544 |
| 425 | Ga0501031_0017521 | 3300049568 | Bacteria | 4656 |
| 426 | Ga0501033_0247888 | 3300049570 | Bacteria | 1263 |
| 427 | Ga0501033_0401378 | 3300049570 | Unclassified | 956 |
| 428 | Ga0501033_0439003 | 3300049570 | Bacteria | 908 |
| 429 | Ga0501033_0648912 | 3300049570 | Bacteria | 721 |
| 430 | Ga0501034_0000482 | 3300049571 | Bacteria | 65380 |
| 431 | Ga0501034_0050358 | 3300049571 | Bacteria | 4201 |
| 432 | Ga0501034_0084731 | 3300049571 | Bacteria | 3171 |
| 433 | Ga0501034_0114101 | 3300049571 | Bacteria | 2691 |
| 434 | Ga0501034_0169117 | 3300049571 | Bacteria | 2154 |
| 435 | Ga0501034_0496951 | 3300049571 | Bacteria | 1134 |
| 436 | Ga0501034_0553111 | 3300049571 | Bacteria | 1060 |
| 437 | Ga0501034_0699995 | 3300049571 | Bacteria | 912 |
| 438 | Ga0501034_0853449 | 3300049571 | Bacteria | 801 |
| 439 | Ga0501034_1568104 | 3300049571 | Bacteria | 532 |
| 440 | Ga0501036_1137566 | 3300049572 | Bacteria | 637 |
| 441 | Ga0501037_0008751 | 3300049573 | Bacteria | 7418 |
| 442 | Ga0501037_0614373 | 3300049573 | Bacteria | 729 |
| 443 | Ga0501038_0001299 | 3300049574 | Bacteria | 22755 |
| 444 | Ga0501038_0277617 | 3300049574 | Bacteria | 1320 |
| 445 | Ga0501039_0241277 | 3300049575 | Bacteria | 1421 |
| 446 | Ga0501039_1180565 | 3300049575 | Unclassified | 592 |
| 447 | Ga0501043_0201620 | 3300049579 | Bacteria | 1544 |
| 448 | Ga0501043_1193160 | 3300049579 | Bacteria | 535 |
| 449 | Ga0501047_0026121 | 3300049581 | Bacteria | 5617 |
| 450 | Ga0501047_0176818 | 3300049581 | Bacteria | 2002 |
| 451 | Ga0501047_0199368 | 3300049581 | Bacteria | 1863 |
| 452 | Ga0501047_0419998 | 3300049581 | Bacteria | 1169 |
| 453 | Ga0501047_0481136 | 3300049581 | Bacteria | 1069 |
| 454 | Ga0501047_0575858 | 3300049581 | Bacteria | 949 |
| 455 | Ga0501068_0922849 | 3300049584 | Bacteria | 575 |
| 456 | Ga0501069_0543334 | 3300049585 | Bacteria | 695 |
| 457 | Ga0501072_1376532 | 3300049588 | Bacteria | 546 |
| 458 | Ga0501238_000524 | 3300049671 | Bacteria | 4389 |
| 459 | Ga0501238_038222 | 3300049671 | Bacteria | 703 |
| 460 | Ga0501035_0281576 | 3300049822 | Bacteria | 1405 |
| 461 | Ga0501035_0430157 | 3300049822 | Bacteria | 1095 |
| 462 | Ga0501035_1518929 | 3300049822 | Bacteria | 510 |
| 463 | Ga0501044_0038551 | 3300049823 | Bacteria | 4990 |
| 464 | Ga0501044_0306578 | 3300049823 | Bacteria | 1515 |
| 465 | Ga0501044_0622533 | 3300049823 | Bacteria | 971 |
| 466 | Ga0501044_0659725 | 3300049823 | Bacteria | 934 |
| 467 | nmdc:mga03683_381207_c1 | 3300050489 | Bacteria | 671 |
| 468 | nmdc:mga03n38_445242_c1 | 3300050490 | Bacteria | 720 |
| 469 | nmdc:mga00v17_937061_c1 | 3300050491 | Bacteria | 547 |
| 470 | nmdc:mga0yw44_618422_c1 | 3300050492 | Bacteria | 736 |
| 471 | nmdc:mga0k408_364897_c1 | 3300050493 | Bacteria | 861 |
| 472 | nmdc:mga07m45_45178_c1 | 3300050496 | Bacteria | 2473 |
| 473 | nmdc:mga0qj67_738371_c1 | 3300050509 | Bacteria | 782 |
| 474 | nmdc:mga0sz30_61499_c1 | 3300050516 | Bacteria | 1605 |
| 475 | Ga0500578_0000459 | 3300053086 | Bacteria | 49572 |
| 476 | Ga0500578_0333499 | 3300053086 | Bacteria | 891 |
| 477 | Ga0500578_0443331 | 3300053086 | Bacteria | 740 |
| 478 | Ga0500643_013573 | 3300053087 | Bacteria | 2871 |
| 479 | Ga0500643_013812 | 3300053087 | Bacteria | 2832 |
| 480 | Ga0500644_0000193 | 3300053088 | Bacteria | 37831 |
| 481 | Ga0500646_0385284 | 3300053090 | Bacteria | 516 |
| 482 | Ga0500647_0049633 | 3300053091 | Bacteria | 2018 |
| 483 | Ga0500647_0107844 | 3300053091 | Bacteria | 1326 |
| 484 | Ga0500651_0346445 | 3300053093 | Bacteria | 844 |
| 485 | Ga0500566_0249094 | 3300053094 | Bacteria | 865 |
| 486 | Ga0500641_0002284 | 3300053096 | Bacteria | 6803 |
| 487 | Ga0500641_0046486 | 3300053096 | Bacteria | 1772 |
| 488 | Ga0500650_0035877 | 3300053098 | Bacteria | 2274 |
| 489 | Ga0500650_0171820 | 3300053098 | Bacteria | 996 |
| 490 | Ga0500554_000324 | 3300053102 | Bacteria | 10286 |
| 491 | Ga0500556_0001068 | 3300053104 | Bacteria | 14047 |
| 492 | Ga0500556_0044275 | 3300053104 | Bacteria | 1583 |
| 493 | Ga0500556_0083999 | 3300053104 | Bacteria | 1207 |
| 494 | Ga0500562_003596 | 3300053108 | Bacteria | 3890 |
| 495 | Ga0500562_004084 | 3300053108 | Bacteria | 3679 |
| 496 | Ga0500572_028551 | 3300053111 | Bacteria | 1536 |
| 497 | Ga0500594_0000153 | 3300053118 | Bacteria | 18197 |
| 498 | Ga0500595_016759 | 3300053119 | Bacteria | 2723 |
| 499 | Ga0500595_184394 | 3300053119 | Bacteria | 578 |
| 500 | Ga0500597_224954 | 3300053120 | Bacteria | 778 |
| 501 | Ga0500608_000165 | 3300053122 | Bacteria | 27378 |
| 502 | Ga0500608_117892 | 3300053122 | Bacteria | 1208 |
| 503 | Ga0500614_054013 | 3300053123 | Bacteria | 1063 |
| 504 | Ga0500614_061429 | 3300053123 | Bacteria | 1011 |
| 505 | Ga0500618_000703 | 3300053125 | Bacteria | 19670 |
| 506 | Ga0500642_0239264 | 3300053130 | Bacteria | 837 |
| 507 | Ga0500655_015206 | 3300053133 | Bacteria | 1411 |
| 508 | Ga0500658_0001787 | 3300053134 | Bacteria | 8487 |
| 509 | Ga0500559_0000113 | 3300053136 | Bacteria | 63512 |
| 510 | Ga0500559_0001398 | 3300053136 | Bacteria | 13721 |
| 511 | Ga0500559_0016148 | 3300053136 | Bacteria | 3152 |
| 512 | Ga0500559_0365135 | 3300053136 | Bacteria | 674 |
| 513 | Ga0500564_000145 | 3300053138 | Bacteria | 18335 |
| 514 | Ga0500568_0044246 | 3300053139 | Bacteria | 1777 |
| 515 | Ga0500568_0080837 | 3300053139 | Bacteria | 1234 |
| 516 | Ga0500573_0144994 | 3300053140 | Bacteria | 1304 |
| 517 | Ga0500577_0027599 | 3300053142 | Bacteria | 1946 |
| 518 | Ga0500588_0023345 | 3300053146 | Bacteria | 1694 |
| 519 | Ga0500589_208111 | 3300053147 | Bacteria | 746 |
| 520 | Ga0500590_172269 | 3300053148 | Bacteria | 950 |
| 521 | Ga0500616_0088560 | 3300053153 | Bacteria | 1538 |
| 522 | Ga0500616_0163696 | 3300053153 | Bacteria | 1017 |
| 523 | Ga0500619_053637 | 3300053154 | Bacteria | 1311 |
| 524 | Ga0500622_0000771 | 3300053156 | Bacteria | 27846 |
| 525 | Ga0500622_0003985 | 3300053156 | Bacteria | 9528 |
| 526 | Ga0500622_0036800 | 3300053156 | Bacteria | 2557 |
| 527 | Ga0500622_0314243 | 3300053156 | Bacteria | 662 |
| 528 | Ga0500622_0350024 | 3300053156 | Bacteria | 613 |
| 529 | Ga0500627_0046520 | 3300053158 | Bacteria | 1880 |
| 530 | Ga0500633_0042334 | 3300053160 | Bacteria | 1536 |
| 531 | Ga0500634_0171596 | 3300053161 | Bacteria | 987 |
| 532 | Ga0500638_179831 | 3300053162 | Bacteria | 914 |
| 533 | Ga0500639_129768 | 3300053163 | Bacteria | 1196 |
| 534 | Ga0500636_0106904 | 3300053177 | Bacteria | 1585 |
| 535 | Ga0500570_140607 | 3300053724 | Bacteria | 889 |
| 536 | Ga0500611_011461 | 3300053727 | Bacteria | 1467 |
| 537 | Ga0500645_009863 | 3300053730 | Bacteria | 3189 |
| 538 | Ga0500645_030083 | 3300053730 | Bacteria | 1636 |
| 539 | Ga0500645_038787 | 3300053730 | Bacteria | 1412 |
| 540 | Ga0500609_000093 | 3300053731 | Bacteria | 11592 |
| 541 | Ga0500609_014359 | 3300053731 | Bacteria | 1073 |
| 542 | Ga0500661_055671 | 3300055283 | Bacteria | 710 |
| 543 | Ga0587084_001790 | 3300059477 | Bacteria | 2107 |
| 544 | Ga0587084_041670 | 3300059477 | Bacteria | 782 |
| 545 | Ga0587084_049791 | 3300059477 | Bacteria | 738 |
| 546 | Ga0587093_018561 | 3300059478 | Bacteria | 907 |
| 547 | Ga0587093_040621 | 3300059478 | Bacteria | 704 |
| 548 | Ga0587093_060739 | 3300059478 | Bacteria | 616 |
| 549 | Ga0587066_021865 | 3300059490 | Bacteria | 1065 |
| 550 | Ga0587066_086518 | 3300059490 | Bacteria | 688 |
| 551 | Ga0587070_023885 | 3300059491 | Bacteria | 1054 |
| 552 | Ga0587073_0095231 | 3300059492 | Bacteria | 764 |
| 553 | Ga0587073_0190089 | 3300059492 | Bacteria | 609 |
| 554 | Ga0587077_000161 | 3300059493 | Bacteria | 4481 |
| 555 | Ga0587077_007264 | 3300059493 | Bacteria | 1606 |
| 556 | Ga0587080_135711 | 3300059503 | Bacteria | 558 |
| 557 | Ga0587083_0138225 | 3300059505 | Bacteria | 646 |
| 558 | Ga0587085_105957 | 3300059506 | Bacteria | 600 |
| 559 | Ga0587086_014512 | 3300059507 | Bacteria | 1006 |
| 560 | Ga0587086_014966 | 3300059507 | Bacteria | 996 |
| 561 | Ga0587086_016563 | 3300059507 | Bacteria | 964 |
| 562 | Ga0587086_028377 | 3300059507 | Bacteria | 809 |
| 563 | Ga0587088_031808 | 3300059508 | Bacteria | 947 |
| 564 | Ga0587088_063117 | 3300059508 | Bacteria | 755 |
| 565 | Ga0587089_050042 | 3300059509 | Bacteria | 668 |
| 566 | Ga0587090_001474 | 3300059510 | Bacteria | 2393 |
| 567 | Ga0587090_007980 | 3300059510 | Bacteria | 1407 |
| 568 | Ga0587091_236636 | 3300059511 | Bacteria | 506 |
| 569 | Ga0587092_032868 | 3300059512 | Bacteria | 867 |
| 570 | Ga0587094_009396 | 3300059513 | Bacteria | 1247 |
| 571 | Ga0587101_001189 | 3300059623 | Bacteria | 2164 |
| 572 | Ga0587109_036454 | 3300059624 | Bacteria | 957 |
| 573 | Ga0587109_197567 | 3300059624 | Bacteria | 522 |
| 574 | Ga0587117_012260 | 3300059627 | Bacteria | 1079 |
| 575 | Ga0587117_072891 | 3300059627 | Bacteria | 612 |
| 576 | Ga0587117_083346 | 3300059627 | Bacteria | 586 |
| 577 | Ga0587062_006587 | 3300059639 | Bacteria | 1326 |
| 578 | Ga0587062_048719 | 3300059639 | Bacteria | 711 |
| 579 | Ga0587068_004838 | 3300059641 | Bacteria | 1804 |
| 580 | Ga0587068_016860 | 3300059641 | Bacteria | 1161 |
| 581 | Ga0587069_041394 | 3300059642 | Bacteria | 787 |
| 582 | Ga0587072_096434 | 3300059643 | Bacteria | 658 |
| 583 | Ga0587075_015780 | 3300059644 | Bacteria | 1066 |
| 584 | Ga0587076_000787 | 3300059645 | Bacteria | 2870 |
| 585 | Ga0587078_000144 | 3300059646 | Bacteria | 4156 |
| 586 | Ga0587078_028975 | 3300059646 | Bacteria | 738 |
| 587 | Ga0587100_008302 | 3300059648 | Bacteria | 837 |
| 588 | Ga0587102_030071 | 3300059649 | Bacteria | 659 |
| 589 | Ga0587107_084058 | 3300059652 | Bacteria | 603 |
| 590 | Ga0587110_003821 | 3300059654 | Bacteria | 1280 |
| 591 | Ga0587124_009577 | 3300059660 | Bacteria | 851 |
| 592 | Ga0587124_016159 | 3300059660 | Bacteria | 724 |
| 593 | Ga0587071_063564 | 3300060344 | Bacteria | 789 |
| 594 | Ga0587111_0000079 | 3300060346 | Bacteria | 5946 |
| 595 | Ga0587111_0000967 | 3300060346 | Bacteria | 3179 |
| 596 | Ga0587111_0037802 | 3300060346 | Bacteria | 1016 |
| 597 | Ga0587111_0126633 | 3300060346 | Bacteria | 663 |
| 598 | Ga0587111_0135908 | 3300060346 | Bacteria | 647 |
| 599 | Ga0466962_0003721 | 3300061719 | Bacteria | 7277 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300031251 | Ga0265327_10042561 | Ga0265327_100425614 | 96 |
| 2 | 3300003784 | Ga0055534_1043029 | Ga0055534_10430291 | 97 |
| 3 | 3300005327 | Ga0070658_10503281 | Ga0070658_105032811 | 97 |
| 4 | 3300005327 | Ga0070658_10737474 | Ga0070658_107374741 | 97 |
| 5 | 3300005329 | Ga0070683_100461961 | Ga0070683_1004619612 | 97 |
| 6 | 3300005336 | Ga0070680_101335264 | Ga0070680_1013352641 | 97 |
| 7 | 3300005337 | Ga0070682_101299911 | Ga0070682_1012999112 | 97 |
| 8 | 3300005338 | Ga0068868_101014902 | Ga0068868_1010149022 | 97 |
| 9 | 3300005339 | Ga0070660_100775744 | Ga0070660_1007757442 | 97 |
| 10 | 3300005344 | Ga0070661_100418722 | Ga0070661_1004187222 | 97 |
| 11 | 3300005364 | Ga0070673_101556241 | Ga0070673_1015562411 | 97 |
| 12 | 3300005366 | Ga0070659_101321666 | Ga0070659_1013216662 | 97 |
| 13 | 3300005435 | Ga0070714_101687603 | Ga0070714_1016876031 | 97 |
| 14 | 3300005456 | Ga0070678_100463708 | Ga0070678_1004637082 | 97 |
| 15 | 3300005535 | Ga0070684_102023121 | Ga0070684_1020231211 | 97 |
| 16 | 3300005616 | Ga0068852_101458078 | Ga0068852_1014580782 | 97 |
| 17 | 3300009098 | Ga0105245_11808632 | Ga0105245_118086322 | 97 |
| 18 | 3300009174 | Ga0105241_11546966 | Ga0105241_115469661 | 97 |
| 19 | 3300009176 | Ga0105242_10461280 | Ga0105242_104612802 | 97 |
| 20 | 3300009177 | Ga0105248_12360574 | Ga0105248_123605742 | 97 |
| 21 | 3300009545 | Ga0105237_12630793 | Ga0105237_126307931 | 97 |
| 22 | 3300009551 | Ga0105238_10829427 | Ga0105238_108294272 | 97 |
| 23 | 3300009551 | Ga0105238_10859111 | Ga0105238_108591112 | 97 |
| 24 | 3300010375 | Ga0105239_11856159 | Ga0105239_118561592 | 97 |
| 25 | 3300013100 | Ga0157373_10348597 | Ga0157373_103485972 | 97 |
| 26 | 3300013104 | Ga0157370_10483229 | Ga0157370_104832292 | 97 |
| 27 | 3300013297 | Ga0157378_12825693 | Ga0157378_128256932 | 97 |
| 28 | 3300013307 | Ga0157372_10364270 | Ga0157372_103642703 | 97 |
| 29 | 3300021441 | Ga0213871_10111587 | Ga0213871_101115872 | 97 |
| 30 | 3300025261 | Ga0209233_1017172 | Ga0209233_10171723 | 97 |
| 31 | 3300025291 | Ga0209675_1002644 | Ga0209675_10026442 | 97 |
| 32 | 3300025904 | Ga0207647_10645457 | Ga0207647_106454572 | 97 |
| 33 | 3300025907 | Ga0207645_10029047 | Ga0207645_100290474 | 97 |
| 34 | 3300025909 | Ga0207705_10672397 | Ga0207705_106723972 | 97 |
| 35 | 3300025919 | Ga0207657_10493531 | Ga0207657_104935312 | 97 |
| 36 | 3300025920 | Ga0207649_10214678 | Ga0207649_102146782 | 97 |
| 37 | 3300025921 | Ga0207652_10439885 | Ga0207652_104398852 | 97 |
| 38 | 3300025924 | Ga0207694_10211628 | Ga0207694_102116283 | 97 |
| 39 | 3300025926 | Ga0207659_11811051 | Ga0207659_118110512 | 97 |
| 40 | 3300025929 | Ga0207664_11891233 | Ga0207664_118912331 | 97 |
| 41 | 3300025932 | Ga0207690_10870636 | Ga0207690_108706362 | 97 |
| 42 | 3300025933 | Ga0207706_11091972 | Ga0207706_110919722 | 97 |
| 43 | 3300025934 | Ga0207686_11529165 | Ga0207686_115291652 | 97 |
| 44 | 3300025941 | Ga0207711_12094047 | Ga0207711_120940472 | 97 |
| 45 | 3300025944 | Ga0207661_11079713 | Ga0207661_110797132 | 97 |
| 46 | 3300025945 | Ga0207679_11297557 | Ga0207679_112975572 | 97 |
| 47 | 3300025949 | Ga0207667_12015332 | Ga0207667_120153322 | 97 |
| 48 | 3300025960 | Ga0207651_11387531 | Ga0207651_113875312 | 97 |
| 49 | 3300026035 | Ga0207703_11582981 | Ga0207703_115829812 | 97 |
| 50 | 3300026067 | Ga0207678_11114722 | Ga0207678_111147222 | 97 |
| 51 | 3300026078 | Ga0207702_10683874 | Ga0207702_106838742 | 97 |
| 52 | 3300026089 | Ga0207648_11040737 | Ga0207648_110407372 | 97 |
| 53 | 3300026116 | Ga0207674_10434651 | Ga0207674_104346512 | 97 |
| 54 | 3300026142 | Ga0207698_11282310 | Ga0207698_112823102 | 97 |
| 55 | 3300027614 | Ga0209970_1062345 | Ga0209970_10623452 | 97 |
| 56 | 3300031238 | Ga0265332_10232294 | Ga0265332_102322942 | 97 |
| 57 | 3300031250 | Ga0265331_10156725 | Ga0265331_101567252 | 97 |
| 58 | 3300031250 | Ga0265331_10463231 | Ga0265331_104632312 | 97 |
| 59 | 3300031251 | Ga0265327_10007046 | Ga0265327_100070465 | 97 |
| 60 | 3300031711 | Ga0265314_10053314 | Ga0265314_100533145 | 97 |
| 61 | 3300031711 | Ga0265314_10083091 | Ga0265314_100830912 | 97 |
| 62 | 3300031712 | Ga0265342_10180916 | Ga0265342_101809162 | 97 |
| 63 | 3300035695 | Ga0373927_1030299 | Ga0373927_1030299_128_421 | 97 |
| 64 | 3300035724 | Ga0373933_0445506 | Ga0373933_0445506_398_691 | 97 |
| 65 | 3300035724 | Ga0373933_0498110 | Ga0373933_0498110_74_367 | 97 |
| 66 | 3300036401 | Ga0373937_0257814 | Ga0373937_0257814_146_439 | 97 |
| 67 | 3300037418 | Ga0395900_0776233 | Ga0395900_0776233_459_752 | 97 |
| 68 | 3300037466 | Ga0395898_0361499 | Ga0395898_0361499_798_1091 | 97 |
| 69 | 3300037471 | Ga0395905_0096583 | Ga0395905_0096583_1032_1325 | 97 |
| 70 | 3300038443 | Ga0395901_0140376 | Ga0395901_0140376_791_1084 | 97 |
| 71 | 3300039447 | Ga0436361_0328563 | Ga0436361_0328563_30_323 | 97 |
| 72 | 3300039453 | Ga0436362_0941954 | Ga0436362_0941954_197_490 | 97 |
| 73 | 3300046529 | Ga0495652_0464478 | Ga0495652_0464478_110_403 | 97 |
| 74 | 3300046689 | Ga0495613_0000576 | Ga0495613_0000576_27497_27790 | 97 |
| 75 | 3300048903 | Ga0496100_0545255 | Ga0496100_0545255_161_454 | 97 |
| 76 | 3300048909 | Ga0496106_0180175 | Ga0496106_0180175_435_728 | 97 |
| 77 | 3300048910 | Ga0496107_0146752 | Ga0496107_0146752_783_1076 | 97 |
| 78 | 3300048917 | Ga0496114_1642310 | Ga0496114_1642310_64_357 | 97 |
| 79 | 3300048918 | Ga0496115_1264471 | Ga0496115_1264471_49_342 | 97 |
| 80 | 3300048924 | Ga0496121_0246123 | Ga0496121_0246123_822_1115 | 97 |
| 81 | 3300049528 | Ga0501312_032631 | Ga0501312_032631_419_712 | 97 |
| 82 | 3300049533 | Ga0501317_009026 | Ga0501317_009026_296_589 | 97 |
| 83 | 3300049534 | Ga0501318_029083 | Ga0501318_029083_32_325 | 97 |
| 84 | 3300049570 | Ga0501033_0439003 | Ga0501033_0439003_342_635 | 97 |
| 85 | 3300049581 | Ga0501047_0419998 | Ga0501047_0419998_41_334 | 97 |
| 86 | 3300049581 | Ga0501047_0481136 | Ga0501047_0481136_344_637 | 97 |
| 87 | 3300049822 | Ga0501035_0430157 | Ga0501035_0430157_450_743 | 97 |
| 88 | 3300049823 | Ga0501044_0306578 | Ga0501044_0306578_532_825 | 97 |
| 89 | 3300049823 | Ga0501044_0659725 | Ga0501044_0659725_472_765 | 97 |
| 90 | 3300053091 | Ga0500647_0049633 | Ga0500647_0049633_814_1107 | 97 |
| 91 | 3300053111 | Ga0500572_028551 | Ga0500572_028551_476_769 | 97 |
| 92 | 3300053119 | Ga0500595_184394 | Ga0500595_184394_49_342 | 97 |
| 93 | 3300053120 | Ga0500597_224954 | Ga0500597_224954_139_432 | 97 |
| 94 | 3300053123 | Ga0500614_061429 | Ga0500614_061429_556_849 | 97 |
| 95 | 3300053136 | Ga0500559_0000113 | Ga0500559_0000113_57798_58091 | 97 |
| 96 | 3300053136 | Ga0500559_0365135 | Ga0500559_0365135_234_527 | 97 |
| 97 | 3300053148 | Ga0500590_172269 | Ga0500590_172269_536_829 | 97 |
| 98 | 3300053154 | Ga0500619_053637 | Ga0500619_053637_523_816 | 97 |
| 99 | 3300053162 | Ga0500638_179831 | Ga0500638_179831_559_852 | 97 |
| 100 | 3300053163 | Ga0500639_129768 | Ga0500639_129768_432_725 | 97 |
| 101 | 3300053177 | Ga0500636_0106904 | Ga0500636_0106904_865_1158 | 97 |
| 102 | 3300003163 | Ga0006759J45824_1069825 | Ga0006759J45824_10698252 | 98 |
| 103 | 3300003163 | Ga0006759J45824_1093412 | Ga0006759J45824_10934121 | 98 |
| 104 | 3300003215 | JGI25153J46596_10020623 | JGI25153J46596_100206232 | 98 |
| 105 | 3300003322 | rootL2_10134251 | rootL2_101342512 | 98 |
| 106 | 3300003559 | Ga0007427J51700_108029 | Ga0007427J51700_1080292 | 98 |
| 107 | 3300003693 | Ga0032354_1009883 | Ga0032354_10098834 | 98 |
| 108 | 3300003693 | Ga0032354_1036765 | Ga0032354_10367654 | 98 |
| 109 | 3300003771 | Ga0055526_1026248 | Ga0055526_10262482 | 98 |
| 110 | 3300003773 | Ga0055537_1004503 | Ga0055537_10045031 | 98 |
| 111 | 3300003775 | Ga0055524_1037192 | Ga0055524_10371923 | 98 |
| 112 | 3300003775 | Ga0055524_1052374 | Ga0055524_10523742 | 98 |
| 113 | 3300003790 | Ga0055528_1007701 | Ga0055528_10077018 | 98 |
| 114 | 3300003791 | Ga0055530_10053500 | Ga0055530_100535002 | 98 |
| 115 | 3300003794 | Ga0055531_10023544 | Ga0055531_100235444 | 98 |
| 116 | 3300003794 | Ga0055531_10068005 | Ga0055531_100680052 | 98 |
| 117 | 3300004625 | Ga0055543_1043964 | Ga0055543_10439642 | 98 |
| 118 | 3300005262 | Ga0065165_1002762 | Ga0065165_10027628 | 98 |
| 119 | 3300005455 | Ga0070663_101589573 | Ga0070663_1015895732 | 98 |
| 120 | 3300005543 | Ga0070672_101379419 | Ga0070672_1013794191 | 98 |
| 121 | 3300005544 | Ga0070686_100505957 | Ga0070686_1005059572 | 98 |
| 122 | 3300005564 | Ga0070664_102350384 | Ga0070664_1023503842 | 98 |
| 123 | 3300006038 | Ga0075365_10444201 | Ga0075365_104442012 | 98 |
| 124 | 3300006048 | Ga0075363_100292289 | Ga0075363_1002922892 | 98 |
| 125 | 3300006051 | Ga0075364_10327156 | Ga0075364_103271562 | 98 |
| 126 | 3300006177 | Ga0075362_10306772 | Ga0075362_103067721 | 98 |
| 127 | 3300006177 | Ga0075362_10559589 | Ga0075362_105595892 | 98 |
| 128 | 3300006178 | Ga0075367_10767659 | Ga0075367_107676592 | 98 |
| 129 | 3300006186 | Ga0075369_10010071 | Ga0075369_100100712 | 98 |
| 130 | 3300006195 | Ga0075366_10031500 | Ga0075366_100315007 | 98 |
| 131 | 3300006237 | Ga0097621_100328028 | Ga0097621_1003280282 | 98 |
| 132 | 3300006353 | Ga0075370_10363622 | Ga0075370_103636222 | 98 |
| 133 | 3300012502 | Ga0157347_1011264 | Ga0157347_10112642 | 98 |
| 134 | 3300012512 | Ga0157327_1004697 | Ga0157327_10046971 | 98 |
| 135 | 3300017792 | Ga0163161_10878043 | Ga0163161_108780432 | 98 |
| 136 | 3300021358 | Ga0213873_10031217 | Ga0213873_100312173 | 98 |
| 137 | 3300021377 | Ga0213874_10161379 | Ga0213874_101613791 | 98 |
| 138 | 3300021384 | Ga0213876_10008440 | Ga0213876_1000844010 | 98 |
| 139 | 3300021388 | Ga0213875_10058981 | Ga0213875_100589812 | 98 |
| 140 | 3300025263 | Ga0209565_1000925 | Ga0209565_10009252 | 98 |
| 141 | 3300025273 | Ga0209673_1001876 | Ga0209673_10018767 | 98 |
| 142 | 3300025291 | Ga0209675_1038255 | Ga0209675_10382551 | 98 |
| 143 | 3300025292 | Ga0209676_1022325 | Ga0209676_10223254 | 98 |
| 144 | 3300025295 | Ga0209564_1007568 | Ga0209564_100756811 | 98 |
| 145 | 3300025295 | Ga0209564_1015779 | Ga0209564_10157792 | 98 |
| 146 | 3300025297 | Ga0209758_1023594 | Ga0209758_10235943 | 98 |
| 147 | 3300025298 | Ga0209050_1019693 | Ga0209050_10196934 | 98 |
| 148 | 3300025299 | Ga0209256_1003893 | Ga0209256_10038935 | 98 |
| 149 | 3300025299 | Ga0209256_1020366 | Ga0209256_10203664 | 98 |
| 150 | 3300025303 | Ga0209051_1000877 | Ga0209051_100087723 | 98 |
| 151 | 3300025304 | Ga0209257_1000976 | Ga0209257_100097649 | 98 |
| 152 | 3300025304 | Ga0209257_1008377 | Ga0209257_100837710 | 98 |
| 153 | 3300025940 | Ga0207691_11556722 | Ga0207691_115567222 | 98 |
| 154 | 3300026067 | Ga0207678_11369025 | Ga0207678_113690252 | 98 |
| 155 | 3300028786 | Ga0307517_10130623 | Ga0307517_101306232 | 98 |
| 156 | 3300028794 | Ga0307515_10072026 | Ga0307515_100720262 | 98 |
| 157 | 3300028794 | Ga0307515_10486084 | Ga0307515_104860842 | 98 |
| 158 | 3300030522 | Ga0307512_10169625 | Ga0307512_101696252 | 98 |
| 159 | 3300031731 | Ga0307405_10467527 | Ga0307405_104675272 | 98 |
| 160 | 3300032168 | Ga0316593_10007944 | Ga0316593_100079442 | 98 |
| 161 | 3300032168 | Ga0316593_10020888 | Ga0316593_100208884 | 98 |
| 162 | 3300032168 | Ga0316593_10078785 | Ga0316593_100787852 | 98 |
| 163 | 3300032168 | Ga0316593_10176011 | Ga0316593_101760112 | 98 |
| 164 | 3300033541 | Ga0316596_1008470 | Ga0316596_10084704 | 98 |
| 165 | 3300036712 | Ga0316584_0571924 | Ga0316584_0571924_44_340 | 98 |
| 166 | 3300037471 | Ga0395905_0015820 | Ga0395905_0015820_3283_3579 | 98 |
| 167 | 3300037853 | Ga0436364_0743164 | Ga0436364_0743164_6220_6516 | 98 |
| 168 | 3300037853 | Ga0436364_1037710 | Ga0436364_1037710_679_975 | 98 |
| 169 | 3300039062 | Ga0400483_014056 | Ga0400483_014056_105_401 | 98 |
| 170 | 3300039062 | Ga0400483_046766 | Ga0400483_046766_831_1127 | 98 |
| 171 | 3300039062 | Ga0400483_154328 | Ga0400483_154328_303_599 | 98 |
| 172 | 3300039062 | Ga0400483_154910 | Ga0400483_154910_1266_1562 | 98 |
| 173 | 3300039062 | Ga0400483_187305 | Ga0400483_187305_2888_3184 | 98 |
| 174 | 3300039437 | Ga0436365_1136540 | Ga0436365_1136540_8829_9125 | 98 |
| 175 | 3300039437 | Ga0436365_1763809 | Ga0436365_1763809_1370_1666 | 98 |
| 176 | 3300039450 | Ga0436363_0154863 | Ga0436363_0154863_542_838 | 98 |
| 177 | 3300039450 | Ga0436363_0409180 | Ga0436363_0409180_181_477 | 98 |
| 178 | 3300039450 | Ga0436363_0899406 | Ga0436363_0899406_1783_2079 | 98 |
| 179 | 3300039453 | Ga0436362_0976116 | Ga0436362_0976116_2356_2652 | 98 |
| 180 | 3300041443 | Ga0451789_0212428 | Ga0451789_0212428_337_633 | 98 |
| 181 | 3300041443 | Ga0451789_1030109 | Ga0451789_1030109_40_336 | 98 |
| 182 | 3300041452 | Ga0451793_0901979 | Ga0451793_0901979_67_363 | 98 |
| 183 | 3300041453 | Ga0451797_0917049 | Ga0451797_0917049_261_557 | 98 |
| 184 | 3300041498 | Ga0451841_1373453 | Ga0451841_1373453_381_677 | 98 |
| 185 | 3300041502 | Ga0451846_09700 | Ga0451846_09700_87_383 | 98 |
| 186 | 3300041509 | Ga0451843_0711516 | Ga0451843_0711516_53_373 | 98 |
| 187 | 3300041512 | Ga0451853_1947268 | Ga0451853_1947268_87_383 | 98 |
| 188 | 3300042000 | Ga0439437_004749 | Ga0439437_004749_1092_1388 | 98 |
| 189 | 3300042001 | Ga0439441_036985 | Ga0439441_036985_274_570 | 98 |
| 190 | 3300042004 | Ga0439445_0007571 | Ga0439445_0007571_862_1158 | 98 |
| 191 | 3300042129 | Ga0450891_015951 | Ga0450891_015951_390_686 | 98 |
| 192 | 3300042436 | Ga0439435_0256023 | Ga0439435_0256023_69_365 | 98 |
| 193 | 3300042438 | Ga0439459_0000576 | Ga0439459_0000576_2668_2964 | 98 |
| 194 | 3300042530 | Ga0450916_000234 | Ga0450916_000234_3858_4154 | 98 |
| 195 | 3300044656 | Ga0466969_0016678 | Ga0466969_0016678_298_594 | 98 |
| 196 | 3300044684 | Ga0466966_0001452 | Ga0466966_0001452_4987_5283 | 98 |
| 197 | 3300044693 | Ga0466961_0000659 | Ga0466961_0000659_8389_8685 | 98 |
| 198 | 3300044694 | Ga0466963_0248354 | Ga0466963_0248354_881_1177 | 98 |
| 199 | 3300044719 | Ga0466971_0010445 | Ga0466971_0010445_40_336 | 98 |
| 200 | 3300044765 | Ga0466970_0024323 | Ga0466970_0024323_46_342 | 98 |
| 201 | 3300044842 | Ga0466957_0095470 | Ga0466957_0095470_1288_1584 | 98 |
| 202 | 3300045049 | Ga0466959_0000162 | Ga0466959_0000162_3532_3828 | 98 |
| 203 | 3300045051 | Ga0451576_0043660 | Ga0451576_0043660_2136_2456 | 98 |
| 204 | 3300045836 | Ga0466958_0004660 | Ga0466958_0004660_3262_3558 | 98 |
| 205 | 3300045976 | Ga0466967_0468759 | Ga0466967_0468759_232_528 | 98 |
| 206 | 3300046453 | Ga0495627_000399 | Ga0495627_000399_3883_4179 | 98 |
| 207 | 3300046457 | Ga0495590_0000851 | Ga0495590_0000851_11764_12060 | 98 |
| 208 | 3300046457 | Ga0495590_0322944 | Ga0495590_0322944_164_460 | 98 |
| 209 | 3300046460 | Ga0495638_0087536 | Ga0495638_0087536_182_478 | 98 |
| 210 | 3300046460 | Ga0495638_0149164 | Ga0495638_0149164_877_1173 | 98 |
| 211 | 3300046460 | Ga0495638_0603644 | Ga0495638_0603644_197_493 | 98 |
| 212 | 3300046471 | Ga0495650_0001571 | Ga0495650_0001571_16029_16325 | 98 |
| 213 | 3300046492 | Ga0495585_0057569 | Ga0495585_0057569_833_1129 | 98 |
| 214 | 3300046506 | Ga0495583_0000650 | Ga0495583_0000650_12842_13138 | 98 |
| 215 | 3300046507 | Ga0495606_0013477 | Ga0495606_0013477_4305_4601 | 98 |
| 216 | 3300046507 | Ga0495606_0151705 | Ga0495606_0151705_832_1128 | 98 |
| 217 | 3300046512 | Ga0495610_0026700 | Ga0495610_0026700_661_957 | 98 |
| 218 | 3300046512 | Ga0495610_0059087 | Ga0495610_0059087_938_1234 | 98 |
| 219 | 3300046513 | Ga0495616_0069112 | Ga0495616_0069112_725_1021 | 98 |
| 220 | 3300046515 | Ga0495620_0125080 | Ga0495620_0125080_139_435 | 98 |
| 221 | 3300046518 | Ga0495631_0019391 | Ga0495631_0019391_1389_1685 | 98 |
| 222 | 3300046519 | Ga0495632_0004552 | Ga0495632_0004552_452_748 | 98 |
| 223 | 3300046519 | Ga0495632_0140724 | Ga0495632_0140724_75_371 | 98 |
| 224 | 3300046520 | Ga0495637_0016956 | Ga0495637_0016956_3070_3366 | 98 |
| 225 | 3300046520 | Ga0495637_0091939 | Ga0495637_0091939_347_643 | 98 |
| 226 | 3300046522 | Ga0495643_0094121 | Ga0495643_0094121_39_335 | 98 |
| 227 | 3300046522 | Ga0495643_0167407 | Ga0495643_0167407_367_663 | 98 |
| 228 | 3300046524 | Ga0495648_0002288 | Ga0495648_0002288_15921_16217 | 98 |
| 229 | 3300046524 | Ga0495648_0445616 | Ga0495648_0445616_39_335 | 98 |
| 230 | 3300046530 | Ga0495654_0006712 | Ga0495654_0006712_5491_5787 | 98 |
| 231 | 3300046538 | Ga0495609_0030354 | Ga0495609_0030354_1998_2294 | 98 |
| 232 | 3300046542 | Ga0495597_0033708 | Ga0495597_0033708_245_541 | 98 |
| 233 | 3300046542 | Ga0495597_0043806 | Ga0495597_0043806_1503_1799 | 98 |
| 234 | 3300046558 | Ga0495633_0080184 | Ga0495633_0080184_358_654 | 98 |
| 235 | 3300046616 | Ga0495668_0001818 | Ga0495668_0001818_13941_14237 | 98 |
| 236 | 3300046616 | Ga0495668_0019185 | Ga0495668_0019185_2582_2878 | 98 |
| 237 | 3300046616 | Ga0495668_0421880 | Ga0495668_0421880_15_311 | 98 |
| 238 | 3300046660 | Ga0495625_0001925 | Ga0495625_0001925_10610_10906 | 98 |
| 239 | 3300046660 | Ga0495625_0058314 | Ga0495625_0058314_943_1239 | 98 |
| 240 | 3300046660 | Ga0495625_0232434 | Ga0495625_0232434_29_325 | 98 |
| 241 | 3300046660 | Ga0495625_0430583 | Ga0495625_0430583_112_408 | 98 |
| 242 | 3300046664 | Ga0495659_0002869 | Ga0495659_0002869_4899_5195 | 98 |
| 243 | 3300046665 | Ga0495661_0138934 | Ga0495661_0138934_834_1130 | 98 |
| 244 | 3300046691 | Ga0495670_0168018 | Ga0495670_0168018_811_1107 | 98 |
| 245 | 3300046691 | Ga0495670_0516710 | Ga0495670_0516710_14_310 | 98 |
| 246 | 3300046692 | Ga0495671_0285026 | Ga0495671_0285026_303_599 | 98 |
| 247 | 3300046694 | Ga0495649_0131040 | Ga0495649_0131040_214_510 | 98 |
| 248 | 3300046794 | Ga0495589_0034715 | Ga0495589_0034715_427_723 | 98 |
| 249 | 3300046810 | Ga0495660_0214314 | Ga0495660_0214314_313_609 | 98 |
| 250 | 3300046810 | Ga0495660_0338009 | Ga0495660_0338009_66_362 | 98 |
| 251 | 3300047320 | Ga0495672_0000439 | Ga0495672_0000439_44523_44819 | 98 |
| 252 | 3300047323 | Ga0495683_0011199 | Ga0495683_0011199_3325_3621 | 98 |
| 253 | 3300047446 | Ga0495679_006048 | Ga0495679_006048_1813_2109 | 98 |
| 254 | 3300047469 | Ga0495673_0000189 | Ga0495673_0000189_98062_98358 | 98 |
| 255 | 3300047469 | Ga0495673_0017740 | Ga0495673_0017740_2980_3276 | 98 |
| 256 | 3300047470 | Ga0495681_0064653 | Ga0495681_0064653_671_967 | 98 |
| 257 | 3300047472 | Ga0495686_0026646 | Ga0495686_0026646_3126_3422 | 98 |
| 258 | 3300047472 | Ga0495686_0072995 | Ga0495686_0072995_264_560 | 98 |
| 259 | 3300047472 | Ga0495686_0079603 | Ga0495686_0079603_1183_1479 | 98 |
| 260 | 3300048909 | Ga0496106_0006912 | Ga0496106_0006912_619_915 | 98 |
| 261 | 3300048910 | Ga0496107_0000073 | Ga0496107_0000073_47466_47762 | 98 |
| 262 | 3300048911 | Ga0496108_0694872 | Ga0496108_0694872_455_751 | 98 |
| 263 | 3300048914 | Ga0496111_0272869 | Ga0496111_0272869_484_780 | 98 |
| 264 | 3300048916 | Ga0496113_0258424 | Ga0496113_0258424_176_472 | 98 |
| 265 | 3300048917 | Ga0496114_0245251 | Ga0496114_0245251_1143_1439 | 98 |
| 266 | 3300048918 | Ga0496115_0021048 | Ga0496115_0021048_707_1003 | 98 |
| 267 | 3300048918 | Ga0496115_0028924 | Ga0496115_0028924_3845_4141 | 98 |
| 268 | 3300048924 | Ga0496121_0025980 | Ga0496121_0025980_4165_4461 | 98 |
| 269 | 3300048924 | Ga0496121_0242092 | Ga0496121_0242092_244_540 | 98 |
| 270 | 3300048925 | Ga0496122_0549897 | Ga0496122_0549897_228_524 | 98 |
| 271 | 3300048926 | Ga0496123_0088232 | Ga0496123_0088232_1078_1374 | 98 |
| 272 | 3300048926 | Ga0496123_0211923 | Ga0496123_0211923_201_497 | 98 |
| 273 | 3300048927 | Ga0496124_0346068 | Ga0496124_0346068_273_569 | 98 |
| 274 | 3300048927 | Ga0496124_0775296 | Ga0496124_0775296_27_323 | 98 |
| 275 | 3300048928 | Ga0496125_0153392 | Ga0496125_0153392_1229_1525 | 98 |
| 276 | 3300048929 | Ga0496126_0049088 | Ga0496126_0049088_548_844 | 98 |
| 277 | 3300049131 | Ga0501341_02239 | Ga0501341_02239_39_335 | 98 |
| 278 | 3300049160 | Ga0501304_018737 | Ga0501304_018737_30_326 | 98 |
| 279 | 3300049459 | Ga0495678_001705 | Ga0495678_001705_1630_1926 | 98 |
| 280 | 3300049527 | Ga0501311_009757 | Ga0501311_009757_421_717 | 98 |
| 281 | 3300049531 | Ga0501315_004075 | Ga0501315_004075_972_1271 | 98 |
| 282 | 3300049531 | Ga0501315_031740 | Ga0501315_031740_358_654 | 98 |
| 283 | 3300049533 | Ga0501317_006835 | Ga0501317_006835_621_917 | 98 |
| 284 | 3300049535 | Ga0501319_000756 | Ga0501319_000756_593_889 | 98 |
| 285 | 3300049536 | Ga0501320_038537 | Ga0501320_038537_138_437 | 98 |
| 286 | 3300049539 | Ga0501323_002237 | Ga0501323_002237_775_1071 | 98 |
| 287 | 3300049539 | Ga0501323_085480 | Ga0501323_085480_87_386 | 98 |
| 288 | 3300049540 | Ga0501324_002768 | Ga0501324_002768_983_1279 | 98 |
| 289 | 3300049541 | Ga0501325_052579 | Ga0501325_052579_159_455 | 98 |
| 290 | 3300049545 | Ga0501329_05361 | Ga0501329_05361_79_375 | 98 |
| 291 | 3300049553 | Ga0501337_019681 | Ga0501337_019681_170_466 | 98 |
| 292 | 3300049570 | Ga0501033_0247888 | Ga0501033_0247888_172_468 | 98 |
| 293 | 3300049571 | Ga0501034_0000482 | Ga0501034_0000482_46387_46683 | 98 |
| 294 | 3300049571 | Ga0501034_0699995 | Ga0501034_0699995_52_348 | 98 |
| 295 | 3300049572 | Ga0501036_1137566 | Ga0501036_1137566_216_512 | 98 |
| 296 | 3300049581 | Ga0501047_0176818 | Ga0501047_0176818_777_1073 | 98 |
| 297 | 3300049581 | Ga0501047_0199368 | Ga0501047_0199368_1506_1802 | 98 |
| 298 | 3300049581 | Ga0501047_0575858 | Ga0501047_0575858_209_532 | 98 |
| 299 | 3300049671 | Ga0501238_000524 | Ga0501238_000524_615_911 | 98 |
| 300 | 3300049671 | Ga0501238_038222 | Ga0501238_038222_117_413 | 98 |
| 301 | 3300050490 | nmdc:mga03n38_445242_c1 | nmdc:mga03n38_445242_c1_235_531 | 98 |
| 302 | 3300050491 | nmdc:mga00v17_937061_c1 | nmdc:mga00v17_937061_c1_238_534 | 98 |
| 303 | 3300050492 | nmdc:mga0yw44_618422_c1 | nmdc:mga0yw44_618422_c1_298_594 | 98 |
| 304 | 3300050493 | nmdc:mga0k408_364897_c1 | nmdc:mga0k408_364897_c1_131_427 | 98 |
| 305 | 3300050496 | nmdc:mga07m45_45178_c1 | nmdc:mga07m45_45178_c1_1619_1915 | 98 |
| 306 | 3300050516 | nmdc:mga0sz30_61499_c1 | nmdc:mga0sz30_61499_c1_588_884 | 98 |
| 307 | 3300053086 | Ga0500578_0000459 | Ga0500578_0000459_35167_35463 | 98 |
| 308 | 3300053086 | Ga0500578_0333499 | Ga0500578_0333499_117_413 | 98 |
| 309 | 3300053086 | Ga0500578_0443331 | Ga0500578_0443331_283_579 | 98 |
| 310 | 3300053087 | Ga0500643_013573 | Ga0500643_013573_315_611 | 98 |
| 311 | 3300053087 | Ga0500643_013812 | Ga0500643_013812_1048_1344 | 98 |
| 312 | 3300053088 | Ga0500644_0000193 | Ga0500644_0000193_13910_14206 | 98 |
| 313 | 3300053090 | Ga0500646_0385284 | Ga0500646_0385284_94_390 | 98 |
| 314 | 3300053093 | Ga0500651_0346445 | Ga0500651_0346445_380_676 | 98 |
| 315 | 3300053094 | Ga0500566_0249094 | Ga0500566_0249094_256_552 | 98 |
| 316 | 3300053096 | Ga0500641_0002284 | Ga0500641_0002284_2406_2702 | 98 |
| 317 | 3300053096 | Ga0500641_0046486 | Ga0500641_0046486_55_351 | 98 |
| 318 | 3300053098 | Ga0500650_0035877 | Ga0500650_0035877_330_626 | 98 |
| 319 | 3300053102 | Ga0500554_000324 | Ga0500554_000324_9376_9672 | 98 |
| 320 | 3300053104 | Ga0500556_0001068 | Ga0500556_0001068_12566_12862 | 98 |
| 321 | 3300053104 | Ga0500556_0044275 | Ga0500556_0044275_605_901 | 98 |
| 322 | 3300053104 | Ga0500556_0083999 | Ga0500556_0083999_16_312 | 98 |
| 323 | 3300053108 | Ga0500562_003596 | Ga0500562_003596_628_924 | 98 |
| 324 | 3300053108 | Ga0500562_004084 | Ga0500562_004084_1434_1730 | 98 |
| 325 | 3300053118 | Ga0500594_0000153 | Ga0500594_0000153_3810_4106 | 98 |
| 326 | 3300053122 | Ga0500608_000165 | Ga0500608_000165_844_1140 | 98 |
| 327 | 3300053122 | Ga0500608_117892 | Ga0500608_117892_164_460 | 98 |
| 328 | 3300053123 | Ga0500614_054013 | Ga0500614_054013_726_1022 | 98 |
| 329 | 3300053125 | Ga0500618_000703 | Ga0500618_000703_6019_6315 | 98 |
| 330 | 3300053130 | Ga0500642_0239264 | Ga0500642_0239264_479_775 | 98 |
| 331 | 3300053133 | Ga0500655_015206 | Ga0500655_015206_1083_1379 | 98 |
| 332 | 3300053134 | Ga0500658_0001787 | Ga0500658_0001787_2178_2474 | 98 |
| 333 | 3300053136 | Ga0500559_0001398 | Ga0500559_0001398_1792_2088 | 98 |
| 334 | 3300053136 | Ga0500559_0016148 | Ga0500559_0016148_1618_1914 | 98 |
| 335 | 3300053138 | Ga0500564_000145 | Ga0500564_000145_4130_4426 | 98 |
| 336 | 3300053139 | Ga0500568_0044246 | Ga0500568_0044246_1026_1322 | 98 |
| 337 | 3300053142 | Ga0500577_0027599 | Ga0500577_0027599_1453_1749 | 98 |
| 338 | 3300053147 | Ga0500589_208111 | Ga0500589_208111_320_616 | 98 |
| 339 | 3300053153 | Ga0500616_0088560 | Ga0500616_0088560_1175_1471 | 98 |
| 340 | 3300053153 | Ga0500616_0163696 | Ga0500616_0163696_627_923 | 98 |
| 341 | 3300053156 | Ga0500622_0000771 | Ga0500622_0000771_9641_9937 | 98 |
| 342 | 3300053156 | Ga0500622_0003985 | Ga0500622_0003985_8363_8659 | 98 |
| 343 | 3300053156 | Ga0500622_0036800 | Ga0500622_0036800_2080_2376 | 98 |
| 344 | 3300053156 | Ga0500622_0314243 | Ga0500622_0314243_199_495 | 98 |
| 345 | 3300053156 | Ga0500622_0350024 | Ga0500622_0350024_35_331 | 98 |
| 346 | 3300053158 | Ga0500627_0046520 | Ga0500627_0046520_1441_1737 | 98 |
| 347 | 3300053160 | Ga0500633_0042334 | Ga0500633_0042334_785_1081 | 98 |
| 348 | 3300053161 | Ga0500634_0171596 | Ga0500634_0171596_317_613 | 98 |
| 349 | 3300053724 | Ga0500570_140607 | Ga0500570_140607_337_633 | 98 |
| 350 | 3300053727 | Ga0500611_011461 | Ga0500611_011461_283_579 | 98 |
| 351 | 3300053730 | Ga0500645_009863 | Ga0500645_009863_2169_2465 | 98 |
| 352 | 3300053730 | Ga0500645_030083 | Ga0500645_030083_1083_1379 | 98 |
| 353 | 3300053730 | Ga0500645_038787 | Ga0500645_038787_43_339 | 98 |
| 354 | 3300053731 | Ga0500609_000093 | Ga0500609_000093_4420_4716 | 98 |
| 355 | 3300055283 | Ga0500661_055671 | Ga0500661_055671_289_585 | 98 |
| 356 | 3300059477 | Ga0587084_049791 | Ga0587084_049791_276_572 | 98 |
| 357 | 3300059478 | Ga0587093_040621 | Ga0587093_040621_361_657 | 98 |
| 358 | 3300059478 | Ga0587093_060739 | Ga0587093_060739_236_532 | 98 |
| 359 | 3300059490 | Ga0587066_021865 | Ga0587066_021865_300_596 | 98 |
| 360 | 3300059491 | Ga0587070_023885 | Ga0587070_023885_255_551 | 98 |
| 361 | 3300059493 | Ga0587077_007264 | Ga0587077_007264_689_985 | 98 |
| 362 | 3300059503 | Ga0587080_135711 | Ga0587080_135711_81_377 | 98 |
| 363 | 3300059506 | Ga0587085_105957 | Ga0587085_105957_206_502 | 98 |
| 364 | 3300059507 | Ga0587086_014512 | Ga0587086_014512_452_748 | 98 |
| 365 | 3300059507 | Ga0587086_028377 | Ga0587086_028377_328_624 | 98 |
| 366 | 3300059510 | Ga0587090_007980 | Ga0587090_007980_495_791 | 98 |
| 367 | 3300059511 | Ga0587091_236636 | Ga0587091_236636_98_394 | 98 |
| 368 | 3300059624 | Ga0587109_197567 | Ga0587109_197567_42_338 | 98 |
| 369 | 3300059627 | Ga0587117_083346 | Ga0587117_083346_89_385 | 98 |
| 370 | 3300059639 | Ga0587062_006587 | Ga0587062_006587_591_887 | 98 |
| 371 | 3300059641 | Ga0587068_016860 | Ga0587068_016860_569_865 | 98 |
| 372 | 3300059642 | Ga0587069_041394 | Ga0587069_041394_444_740 | 98 |
| 373 | 3300059646 | Ga0587078_028975 | Ga0587078_028975_223_519 | 98 |
| 374 | 3300059648 | Ga0587100_008302 | Ga0587100_008302_82_378 | 98 |
| 375 | 3300059649 | Ga0587102_030071 | Ga0587102_030071_321_617 | 98 |
| 376 | 3300059660 | Ga0587124_009577 | Ga0587124_009577_434_730 | 98 |
| 377 | 3300060344 | Ga0587071_063564 | Ga0587071_063564_14_310 | 98 |
| 378 | 3300060346 | Ga0587111_0037802 | Ga0587111_0037802_576_872 | 98 |
| 379 | 3300061719 | Ga0466962_0003721 | Ga0466962_0003721_547_843 | 98 |
| 380 | iso_pu_bacteria | 2511231221 | 2512032375 | 98 |
| 381 | iso_pu_bacteria | 2597490356 | 2599105609 | 98 |
| 382 | iso_pu_bacteria | 2846952575 | 2846954705 | 98 |
| 383 | iso_pu_bacteria | 2848858292 | 2848859028 | 98 |
| 384 | iso_pu_bacteria | 8054002106 | 8054005923 | 98 |
| 385 | 3300031456 | Ga0307513_10010515 | Ga0307513_100105155 | 99 |
| 386 | 3300031728 | Ga0316578_10158531 | Ga0316578_101585312 | 99 |
| 387 | 3300033527 | Ga0316586_1081233 | Ga0316586_10812332 | 99 |
| 388 | 3300037312 | Ga0395899_0000105 | Ga0395899_0000105_141949_142248 | 99 |
| 389 | 3300037466 | Ga0395898_0320867 | Ga0395898_0320867_317_616 | 99 |
| 390 | 3300039447 | Ga0436361_0464948 | Ga0436361_0464948_10_309 | 99 |
| 391 | 3300039447 | Ga0436361_0491418 | Ga0436361_0491418_370_669 | 99 |
| 392 | 3300039447 | Ga0436361_0533438 | Ga0436361_0533438_462_761 | 99 |
| 393 | 3300039447 | Ga0436361_1159961 | Ga0436361_1159961_232_531 | 99 |
| 394 | 3300044656 | Ga0466969_0096092 | Ga0466969_0096092_371_670 | 99 |
| 395 | 3300044684 | Ga0466966_0116263 | Ga0466966_0116263_1040_1339 | 99 |
| 396 | 3300044693 | Ga0466961_0237441 | Ga0466961_0237441_349_648 | 99 |
| 397 | 3300045049 | Ga0466959_0093014 | Ga0466959_0093014_1536_1835 | 99 |
| 398 | 3300045836 | Ga0466958_0739905 | Ga0466958_0739905_179_478 | 99 |
| 399 | 3300047320 | Ga0495672_0079376 | Ga0495672_0079376_1118_1417 | 99 |
| 400 | 3300048927 | Ga0496124_0158136 | Ga0496124_0158136_96_395 | 99 |
| 401 | iso_pu_bacteria | 2844533157 | 2844534359 | 99 |
| 402 | 3300027876 | Ga0209974_10065831 | Ga0209974_100658312 | 100 |
| 403 | 3300039437 | Ga0436365_0637755 | Ga0436365_0637755_407_709 | 100 |
| 404 | 3300046694 | Ga0495649_0000981 | Ga0495649_0000981_9485_9787 | 100 |
| 405 | 3300048925 | Ga0496122_0258233 | Ga0496122_0258233_421_723 | 100 |
| 406 | 3300049530 | Ga0501314_000774 | Ga0501314_000774_447_749 | 100 |
| 407 | 3300049581 | Ga0501047_0026121 | Ga0501047_0026121_4226_4528 | 100 |
| 408 | 3300053140 | Ga0500573_0144994 | Ga0500573_0144994_221_523 | 100 |
| 409 | 3300021441 | Ga0213871_10012207 | Ga0213871_100122073 | 101 |
| 410 | 3300039438 | Ga0436360_0452772 | Ga0436360_0452772_416_754 | 101 |
| 411 | 3300049571 | Ga0501034_0553111 | Ga0501034_0553111_532_837 | 101 |
| 412 | 3300049571 | Ga0501034_0853449 | Ga0501034_0853449_261_596 | 101 |
| 413 | 3300049571 | Ga0501034_1568104 | Ga0501034_1568104_53_370 | 101 |
| 414 | 3300049574 | Ga0501038_0001299 | Ga0501038_0001299_1913_2230 | 101 |
| 415 | 3300049579 | Ga0501043_0201620 | Ga0501043_0201620_712_1047 | 101 |
| 416 | 3300049822 | Ga0501035_0281576 | Ga0501035_0281576_65_400 | 101 |
| 417 | 3300002987 | JGI25159J45721_1005639 | JGI25159J45721_10056392 | 102 |
| 418 | 3300003158 | Ga0006760J45825_104920 | Ga0006760J45825_1049202 | 102 |
| 419 | 3300003187 | JGI25151J46595_10000624 | JGI25151J46595_1000062440 | 102 |
| 420 | 3300003322 | rootL2_10069702 | rootL2_100697022 | 102 |
| 421 | 3300003323 | rootH1_10228499 | rootH1_102284994 | 102 |
| 422 | 3300003354 | JGI25160J50197_1004313 | JGI25160J50197_10043135 | 102 |
| 423 | 3300003579 | Ga0007429J51699_1025305 | Ga0007429J51699_10253052 | 102 |
| 424 | 3300005289 | Ga0065704_10007805 | Ga0065704_100078052 | 102 |
| 425 | 3300005844 | Ga0068862_102162301 | Ga0068862_1021623012 | 102 |
| 426 | 3300005937 | Ga0081455_10058498 | Ga0081455_100584986 | 102 |
| 427 | 3300005983 | Ga0081540_1017843 | Ga0081540_10178436 | 102 |
| 428 | 3300006353 | Ga0075370_10855728 | Ga0075370_108557281 | 102 |
| 429 | 3300009986 | Ga0105033_104982 | Ga0105033_1049822 | 102 |
| 430 | 3300025284 | Ga0209130_1000706 | Ga0209130_100070639 | 102 |
| 431 | 3300025294 | Ga0209025_1000750 | Ga0209025_10007505 | 102 |
| 432 | 3300025302 | Ga0207426_1000336 | Ga0207426_100033693 | 102 |
| 433 | 3300025941 | Ga0207711_11898226 | Ga0207711_118982262 | 102 |
| 434 | 3300031824 | Ga0307413_10177034 | Ga0307413_101770342 | 102 |
| 435 | 3300032168 | Ga0316593_10008633 | Ga0316593_100086332 | 102 |
| 436 | 3300041413 | Ga0439465_0225540 | Ga0439465_0225540_280_606 | 102 |
| 437 | 3300041512 | Ga0451853_3695048 | Ga0451853_3695048_65_379 | 102 |
| 438 | 3300042004 | Ga0439445_0092836 | Ga0439445_0092836_485_811 | 102 |
| 439 | 3300042146 | Ga0450907_028084 | Ga0450907_028084_112_438 | 102 |
| 440 | 3300044842 | Ga0466957_0642690 | Ga0466957_0642690_173_499 | 102 |
| 441 | 3300047469 | Ga0495673_0132665 | Ga0495673_0132665_347_673 | 102 |
| 442 | 3300048925 | Ga0496122_0077737 | Ga0496122_0077737_51_368 | 102 |
| 443 | 3300049568 | Ga0501031_0017521 | Ga0501031_0017521_3583_3903 | 102 |
| 444 | 3300049570 | Ga0501033_0401378 | Ga0501033_0401378_83_403 | 102 |
| 445 | 3300049571 | Ga0501034_0084731 | Ga0501034_0084731_61_381 | 102 |
| 446 | 3300049571 | Ga0501034_0169117 | Ga0501034_0169117_1450_1770 | 102 |
| 447 | 3300049574 | Ga0501038_0277617 | Ga0501038_0277617_496_822 | 102 |
| 448 | 3300049575 | Ga0501039_0241277 | Ga0501039_0241277_431_751 | 102 |
| 449 | 3300049575 | Ga0501039_1180565 | Ga0501039_1180565_118_438 | 102 |
| 450 | 3300049579 | Ga0501043_1193160 | Ga0501043_1193160_26_334 | 102 |
| 451 | 3300049588 | Ga0501072_1376532 | Ga0501072_1376532_18_344 | 102 |
| 452 | 3300049823 | Ga0501044_0622533 | Ga0501044_0622533_254_571 | 102 |
| 453 | 3300050489 | nmdc:mga03683_381207_c1 | nmdc:mga03683_381207_c1_64_390 | 102 |
| 454 | 3300053139 | Ga0500568_0080837 | Ga0500568_0080837_752_1078 | 102 |
| 455 | 3300059477 | Ga0587084_001790 | Ga0587084_001790_1486_1803 | 102 |
| 456 | 3300059477 | Ga0587084_041670 | Ga0587084_041670_153_464 | 102 |
| 457 | 3300059493 | Ga0587077_000161 | Ga0587077_000161_2189_2506 | 102 |
| 458 | 3300059507 | Ga0587086_014966 | Ga0587086_014966_359_676 | 102 |
| 459 | 3300059510 | Ga0587090_001474 | Ga0587090_001474_1678_1995 | 102 |
| 460 | 3300059623 | Ga0587101_001189 | Ga0587101_001189_351_668 | 102 |
| 461 | 3300059624 | Ga0587109_036454 | Ga0587109_036454_359_676 | 102 |
| 462 | 3300059627 | Ga0587117_072891 | Ga0587117_072891_150_461 | 102 |
| 463 | 3300059641 | Ga0587068_004838 | Ga0587068_004838_331_648 | 102 |
| 464 | 3300059643 | Ga0587072_096434 | Ga0587072_096434_244_555 | 102 |
| 465 | 3300059644 | Ga0587075_015780 | Ga0587075_015780_581_898 | 102 |
| 466 | 3300059645 | Ga0587076_000787 | Ga0587076_000787_2184_2501 | 102 |
| 467 | 3300059646 | Ga0587078_000144 | Ga0587078_000144_2280_2597 | 102 |
| 468 | 3300059652 | Ga0587107_084058 | Ga0587107_084058_145_456 | 102 |
| 469 | 3300060346 | Ga0587111_0000079 | Ga0587111_0000079_5231_5548 | 102 |
| 470 | 3300060346 | Ga0587111_0000967 | Ga0587111_0000967_1144_1461 | 102 |
| 471 | 3300005466 | Ga0070685_10005750 | Ga0070685_100057509 | 103 |
| 472 | 3300005544 | Ga0070686_101397684 | Ga0070686_1013976841 | 103 |
| 473 | 3300009093 | Ga0105240_10022560 | Ga0105240_100225605 | 103 |
| 474 | 3300021361 | Ga0213872_10039932 | Ga0213872_100399322 | 103 |
| 475 | 3300025913 | Ga0207695_10076710 | Ga0207695_100767102 | 103 |
| 476 | 3300036401 | Ga0373937_0125512 | Ga0373937_0125512_1414_1725 | 103 |
| 477 | 3300037853 | Ga0436364_0866406 | Ga0436364_0866406_3068_3412 | 103 |
| 478 | 3300039145 | Ga0237816_01805 | Ga0237816_01805_1147_1467 | 103 |
| 479 | 3300039447 | Ga0436361_0479485 | Ga0436361_0479485_518_868 | 103 |
| 480 | 3300039453 | Ga0436362_0010396 | Ga0436362_0010396_309_623 | 103 |
| 481 | 3300039453 | Ga0436362_1086879 | Ga0436362_1086879_329_658 | 103 |
| 482 | 3300047320 | Ga0495672_0140450 | Ga0495672_0140450_330_644 | 103 |
| 483 | 3300047472 | Ga0495686_0117797 | Ga0495686_0117797_609_923 | 103 |
| 484 | 3300049571 | Ga0501034_0114101 | Ga0501034_0114101_450_773 | 103 |
| 485 | 3300002459 | JGI24751J29686_10031233 | JGI24751J29686_100312332 | 104 |
| 486 | 3300005331 | Ga0070670_100461539 | Ga0070670_1004615391 | 104 |
| 487 | 3300005334 | Ga0068869_101085680 | Ga0068869_1010856802 | 104 |
| 488 | 3300005335 | Ga0070666_11144327 | Ga0070666_111443272 | 104 |
| 489 | 3300005347 | Ga0070668_100001882 | Ga0070668_10000188213 | 104 |
| 490 | 3300005353 | Ga0070669_100050591 | Ga0070669_1000505914 | 104 |
| 491 | 3300005355 | Ga0070671_100011171 | Ga0070671_1000111716 | 104 |
| 492 | 3300005367 | Ga0070667_100021170 | Ga0070667_1000211708 | 104 |
| 493 | 3300005367 | Ga0070667_100594634 | Ga0070667_1005946342 | 104 |
| 494 | 3300005434 | Ga0070709_10402063 | Ga0070709_104020632 | 104 |
| 495 | 3300005435 | Ga0070714_100285187 | Ga0070714_1002851872 | 104 |
| 496 | 3300005436 | Ga0070713_100107963 | Ga0070713_1001079632 | 104 |
| 497 | 3300005437 | Ga0070710_10136161 | Ga0070710_101361612 | 104 |
| 498 | 3300005439 | Ga0070711_100557170 | Ga0070711_1005571702 | 104 |
| 499 | 3300005455 | Ga0070663_101215590 | Ga0070663_1012155902 | 104 |
| 500 | 3300005548 | Ga0070665_100349684 | Ga0070665_1003496842 | 104 |
| 501 | 3300005563 | Ga0068855_100575861 | Ga0068855_1005758612 | 104 |
| 502 | 3300005563 | Ga0068855_101677522 | Ga0068855_1016775222 | 104 |
| 503 | 3300005564 | Ga0070664_101039164 | Ga0070664_1010391642 | 104 |
| 504 | 3300005614 | Ga0068856_100134295 | Ga0068856_1001342955 | 104 |
| 505 | 3300005614 | Ga0068856_100694970 | Ga0068856_1006949702 | 104 |
| 506 | 3300005618 | Ga0068864_100030863 | Ga0068864_1000308633 | 104 |
| 507 | 3300005719 | Ga0068861_102704965 | Ga0068861_1027049651 | 104 |
| 508 | 3300005841 | Ga0068863_100080807 | Ga0068863_1000808073 | 104 |
| 509 | 3300005841 | Ga0068863_100182679 | Ga0068863_1001826792 | 104 |
| 510 | 3300005842 | Ga0068858_100000261 | Ga0068858_10000026135 | 104 |
| 511 | 3300005843 | Ga0068860_100000042 | Ga0068860_100000042187 | 104 |
| 512 | 3300005844 | Ga0068862_100003686 | Ga0068862_10000368613 | 104 |
| 513 | 3300006028 | Ga0070717_10294886 | Ga0070717_102948862 | 104 |
| 514 | 3300006173 | Ga0070716_100158507 | Ga0070716_1001585072 | 104 |
| 515 | 3300006175 | Ga0070712_100227825 | Ga0070712_1002278252 | 104 |
| 516 | 3300006846 | Ga0075430_100652120 | Ga0075430_1006521202 | 104 |
| 517 | 3300009093 | Ga0105240_10058879 | Ga0105240_100588794 | 104 |
| 518 | 3300009093 | Ga0105240_10255649 | Ga0105240_102556492 | 104 |
| 519 | 3300009093 | Ga0105240_10413825 | Ga0105240_104138252 | 104 |
| 520 | 3300009093 | Ga0105240_12393746 | Ga0105240_123937462 | 104 |
| 521 | 3300009174 | Ga0105241_10326042 | Ga0105241_103260422 | 104 |
| 522 | 3300009177 | Ga0105248_10440021 | Ga0105248_104400211 | 104 |
| 523 | 3300009545 | Ga0105237_10224191 | Ga0105237_102241913 | 104 |
| 524 | 3300009545 | Ga0105237_10433354 | Ga0105237_104333543 | 104 |
| 525 | 3300009551 | Ga0105238_10196243 | Ga0105238_101962432 | 104 |
| 526 | 3300009551 | Ga0105238_10326749 | Ga0105238_103267492 | 104 |
| 527 | 3300009551 | Ga0105238_10724768 | Ga0105238_107247682 | 104 |
| 528 | 3300010375 | Ga0105239_10905051 | Ga0105239_109050512 | 104 |
| 529 | 3300013306 | Ga0163162_11460712 | Ga0163162_114607122 | 104 |
| 530 | 3300014325 | Ga0163163_10269543 | Ga0163163_102695433 | 104 |
| 531 | 3300014325 | Ga0163163_11528902 | Ga0163163_115289022 | 104 |
| 532 | 3300014968 | Ga0157379_10238620 | Ga0157379_102386203 | 104 |
| 533 | 3300025898 | Ga0207692_10089803 | Ga0207692_100898032 | 104 |
| 534 | 3300025912 | Ga0207707_11353605 | Ga0207707_113536051 | 104 |
| 535 | 3300025913 | Ga0207695_10049522 | Ga0207695_100495225 | 104 |
| 536 | 3300025914 | Ga0207671_10258019 | Ga0207671_102580191 | 104 |
| 537 | 3300025914 | Ga0207671_10790721 | Ga0207671_107907212 | 104 |
| 538 | 3300025923 | Ga0207681_10452633 | Ga0207681_104526332 | 104 |
| 539 | 3300025924 | Ga0207694_10027541 | Ga0207694_100275417 | 104 |
| 540 | 3300025924 | Ga0207694_10677710 | Ga0207694_106777102 | 104 |
| 541 | 3300025924 | Ga0207694_10748388 | Ga0207694_107483882 | 104 |
| 542 | 3300025925 | Ga0207650_11485020 | Ga0207650_114850202 | 104 |
| 543 | 3300025928 | Ga0207700_10111800 | Ga0207700_101118003 | 104 |
| 544 | 3300025929 | Ga0207664_10019250 | Ga0207664_100192504 | 104 |
| 545 | 3300025931 | Ga0207644_10018207 | Ga0207644_100182076 | 104 |
| 546 | 3300025939 | Ga0207665_10064425 | Ga0207665_100644255 | 104 |
| 547 | 3300025949 | Ga0207667_10014133 | Ga0207667_1001413314 | 104 |
| 548 | 3300025949 | Ga0207667_10434857 | Ga0207667_104348573 | 104 |
| 549 | 3300025986 | Ga0207658_10000002 | Ga0207658_1000000222 | 104 |
| 550 | 3300026035 | Ga0207703_10000253 | Ga0207703_1000025339 | 104 |
| 551 | 3300026078 | Ga0207702_11087444 | Ga0207702_110874442 | 104 |
| 552 | 3300026088 | Ga0207641_10001025 | Ga0207641_1000102523 | 104 |
| 553 | 3300026088 | Ga0207641_10101679 | Ga0207641_101016795 | 104 |
| 554 | 3300026095 | Ga0207676_10173154 | Ga0207676_101731543 | 104 |
| 555 | 3300028379 | Ga0268266_10005155 | Ga0268266_1000515511 | 104 |
| 556 | 3300028379 | Ga0268266_12119386 | Ga0268266_121193862 | 104 |
| 557 | 3300028380 | Ga0268265_10000582 | Ga0268265_1000058226 | 104 |
| 558 | 3300028381 | Ga0268264_10000001 | Ga0268264_10000001347 | 104 |
| 559 | 3300028381 | Ga0268264_11979525 | Ga0268264_119795252 | 104 |
| 560 | 3300035089 | Ga0373944_0256524 | Ga0373944_0256524_274_591 | 104 |
| 561 | 3300035692 | Ga0373935_0019032 | Ga0373935_0019032_303_620 | 104 |
| 562 | 3300035725 | Ga0373947_0044569 | Ga0373947_0044569_1901_2218 | 104 |
| 563 | 3300037068 | Ga0373925_0543580 | Ga0373925_0543580_181_498 | 104 |
| 564 | 3300037312 | Ga0395899_0128160 | Ga0395899_0128160_418_771 | 104 |
| 565 | 3300037418 | Ga0395900_0060003 | Ga0395900_0060003_704_1057 | 104 |
| 566 | 3300038443 | Ga0395901_0058183 | Ga0395901_0058183_561_914 | 104 |
| 567 | 3300039438 | Ga0436360_1093457 | Ga0436360_1093457_54_407 | 104 |
| 568 | 3300045051 | Ga0451576_0003979 | Ga0451576_0003979_17458_17799 | 104 |
| 569 | 3300046457 | Ga0495590_0253139 | Ga0495590_0253139_296_613 | 104 |
| 570 | 3300046684 | Ga0495669_0358366 | Ga0495669_0358366_283_600 | 104 |
| 571 | 3300046794 | Ga0495589_0454372 | Ga0495589_0454372_117_434 | 104 |
| 572 | 3300048916 | Ga0496113_0699668 | Ga0496113_0699668_204_557 | 104 |
| 573 | 3300048917 | Ga0496114_0000033 | Ga0496114_0000033_1907_2224 | 104 |
| 574 | 3300049570 | Ga0501033_0648912 | Ga0501033_0648912_206_559 | 104 |
| 575 | 3300049571 | Ga0501034_0050358 | Ga0501034_0050358_1995_2309 | 104 |
| 576 | 3300049571 | Ga0501034_0496951 | Ga0501034_0496951_379_732 | 104 |
| 577 | 3300049573 | Ga0501037_0008751 | Ga0501037_0008751_236_550 | 104 |
| 578 | 3300049573 | Ga0501037_0614373 | Ga0501037_0614373_174_527 | 104 |
| 579 | 3300049584 | Ga0501068_0922849 | Ga0501068_0922849_169_489 | 104 |
| 580 | 3300049585 | Ga0501069_0543334 | Ga0501069_0543334_105_425 | 104 |
| 581 | 3300049822 | Ga0501035_1518929 | Ga0501035_1518929_53_367 | 104 |
| 582 | 3300049823 | Ga0501044_0038551 | Ga0501044_0038551_152_466 | 104 |
| 583 | 3300050509 | nmdc:mga0qj67_738371_c1 | nmdc:mga0qj67_738371_c1_246_581 | 104 |
| 584 | 3300053091 | Ga0500647_0107844 | Ga0500647_0107844_784_1134 | 104 |
| 585 | 3300053098 | Ga0500650_0171820 | Ga0500650_0171820_392_745 | 104 |
| 586 | 3300053119 | Ga0500595_016759 | Ga0500595_016759_628_981 | 104 |
| 587 | 3300053146 | Ga0500588_0023345 | Ga0500588_0023345_770_1123 | 104 |
| 588 | 3300053731 | Ga0500609_014359 | Ga0500609_014359_379_732 | 104 |
| 589 | 3300059478 | Ga0587093_018561 | Ga0587093_018561_294_647 | 104 |
| 590 | 3300059490 | Ga0587066_086518 | Ga0587066_086518_44_397 | 104 |
| 591 | 3300059492 | Ga0587073_0095231 | Ga0587073_0095231_285_638 | 104 |
| 592 | 3300059492 | Ga0587073_0190089 | Ga0587073_0190089_122_475 | 104 |
| 593 | 3300059505 | Ga0587083_0138225 | Ga0587083_0138225_269_622 | 104 |
| 594 | 3300059507 | Ga0587086_016563 | Ga0587086_016563_422_775 | 104 |
| 595 | 3300059508 | Ga0587088_031808 | Ga0587088_031808_293_646 | 104 |
| 596 | 3300059508 | Ga0587088_063117 | Ga0587088_063117_251_604 | 104 |
| 597 | 3300059509 | Ga0587089_050042 | Ga0587089_050042_39_392 | 104 |
| 598 | 3300059512 | Ga0587092_032868 | Ga0587092_032868_266_619 | 104 |
| 599 | 3300059513 | Ga0587094_009396 | Ga0587094_009396_303_656 | 104 |
| 600 | 3300059627 | Ga0587117_012260 | Ga0587117_012260_438_791 | 104 |
| 601 | 3300059639 | Ga0587062_048719 | Ga0587062_048719_71_424 | 104 |
| 602 | 3300059654 | Ga0587110_003821 | Ga0587110_003821_240_593 | 104 |
| 603 | 3300059660 | Ga0587124_016159 | Ga0587124_016159_284_637 | 104 |
| 604 | 3300060346 | Ga0587111_0126633 | Ga0587111_0126633_300_653 | 104 |
| 605 | 3300060346 | Ga0587111_0135908 | Ga0587111_0135908_70_423 | 104 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7m4z-assembly1.cif.gz_S | a. baumannii ribosome-eravacycline complex: hpf-bound 70s | 0.9734 | 12 | 97 |
| 8cvm-assembly1.cif.gz_s | cutibacterium acnes 50s ribosomal subunit with p-site trna and sarecycline bound in the local refined map | 0.9653 | 13 | 100 |
| 6tnn-assembly1.cif.gz_m | mini-rnase iii (mini-iii) bound to 50s ribosome with precursor 23s rrna | 0.9511 | 13 | 100 |
| 7jil-assembly1.cif.gz_T | 70s ribosome flavobacterium johnsoniae | 0.9491 | 16 | 99 |
| 8cgd-assembly1.cif.gz_s | clindamycin bound to the 50s subunit | 0.949 | 12 | 93 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6hmaR00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.9455 | 13 | 99 | 3.30.70.330 |
| af_P61845_1_86_3.30.70.330 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.9234 | 15 | 99 | 3.30.70.330 |
| af_P54016_1_86_3.30.70.330 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.9133 | 13 | 96 | 3.30.70.330 |
| 4garT00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.909 | 10 | 98 | 3.30.70.330 |
| 6hmaR00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain | 0.9053 | 13 | 99 | 3.30.70.330 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A529KDH5-F1-model_v4 | 50S ribosomal protein L23 | 0.9892 | 10 | 91 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A1F6BQ52-F1-model_v4 | Large ribosomal subunit protein uL23 | 0.9879 | 15 | 101 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A554LQX1-F1-model_v4 | Large ribosomal subunit protein uL23 | 0.9875 | 15 | 100 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A365Z1K3-F1-model_v4 | Large ribosomal subunit protein uL23 | 0.9868 | 12 | 101 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A1G1NIZ4-F1-model_v4 | Large ribosomal subunit protein uL23 | 0.9866 | 13 | 99 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar