F468438

General Info

Members Datasets Scaffolds Average Seq Length
605 392 599 102

Family's Representative Sequence

Representative Sequence 3300005335|Ga0070666_11144327|Ga0070666_111443272
Length 117
Sequence MSAAPKKRRFGFGRKAVEQADIDPRHYDIITAPVITEKATMGSEFGQVTFRVPLTATKPQIKAAVEALFKVNVKAVNTLIAKGKTKRFKGLPGRRSDVKKAIVTLAAGQSIDVTTGV

Samples

Sample ID Description Type Environment
1 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
2 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
3 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
4 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
5 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
8 3300003158 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_3 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
15 3300003559 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
16 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
17 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
18 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
19 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
20 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
21 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
22 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
23 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
24 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
25 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
26 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
27 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
28 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
29 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
30 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
31 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
32 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
33 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
34 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
35 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
36 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
37 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
38 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
39 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
40 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
41 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
42 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
43 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
44 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
45 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
46 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
47 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
48 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
70 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
71 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
72 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
73 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
74 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
75 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
76 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
77 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
80 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
91 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
92 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
101 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
102 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
103 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
104 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
105 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
106 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
107 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
110 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
113 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
115 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
117 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
118 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
162 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
163 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
164 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
165 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
166 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
167 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
168 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
169 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
170 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
171 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
172 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
173 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
177 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
178 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
179 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
180 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
181 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
182 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
183 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
184 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
185 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
186 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
187 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
188 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
189 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
190 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
191 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
192 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
193 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
194 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
195 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
196 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
197 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
198 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
199 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
200 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
201 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
202 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
203 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
204 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
205 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
206 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
207 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
208 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
209 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
210 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
211 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
212 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
213 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
214 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
215 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
216 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
217 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
218 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
219 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
220 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
221 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
222 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
223 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
224 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
225 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
226 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
227 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
228 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
229 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
230 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
231 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
232 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
233 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
234 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
235 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
236 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
237 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
238 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
239 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
240 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
241 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
242 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
243 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
244 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
245 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
246 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
247 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
248 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
249 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
250 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
251 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
252 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
253 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
254 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
255 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
256 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
257 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
258 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
259 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
260 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
261 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
262 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
263 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
264 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
265 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
266 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
267 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
268 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
269 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
270 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
271 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
272 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
273 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
274 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
275 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
276 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
277 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
278 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
279 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
280 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
281 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
282 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
283 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
284 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
285 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
286 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
287 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
288 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
289 3300049545 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
290 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
291 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
298 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
301 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
302 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
303 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
304 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
306 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
307 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
308 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
309 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
310 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
311 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
312 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
313 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
314 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
315 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
316 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
317 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
318 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
319 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
320 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
321 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
322 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
323 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
324 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
325 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
326 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
327 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
328 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
329 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
330 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
331 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
332 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
333 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
334 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
335 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
336 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
337 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
338 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
339 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
340 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
341 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
342 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
343 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
344 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
345 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
346 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
347 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
348 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
349 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
350 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
351 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
352 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
353 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
354 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
355 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
356 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
357 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
358 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
359 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
360 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
361 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
362 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
363 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
364 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
365 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
366 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
367 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
368 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
369 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
370 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
371 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
372 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
373 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
374 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
375 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
376 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
377 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
378 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
379 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
380 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
381 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
382 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
383 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
384 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
385 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
386 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
387 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
388 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
389 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
390 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
391 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
392 8054002106 Azospirillum lipoferum 59b Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 84.3
Metatranscriptomes 14.71
Isolates 0.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.5
Nodule 0
Rhizoplane 3.14
Rhizosphere 69.26
Stem 0
Stem Tuber 0
Unclassified 8.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10031233 3300002459 Bacteria 1105
2 JGI25159J45721_1005639 3300002987 Bacteria 3897
3 Ga0006760J45825_104920 3300003158 Bacteria 644
4 Ga0006759J45824_1069825 3300003163 Bacteria 736
5 Ga0006759J45824_1093412 3300003163 Bacteria 972
6 JGI25151J46595_10000624 3300003187 Bacteria 30772
7 JGI25153J46596_10020623 3300003215 Bacteria 2486
8 rootL2_10069702 3300003322 Bacteria 1371
9 rootL2_10134251 3300003322 Bacteria 1105
10 rootH1_10228499 3300003323 Bacteria 1411
11 JGI25160J50197_1004313 3300003354 Bacteria 6163
12 Ga0007427J51700_108029 3300003559 Bacteria 831
13 Ga0007429J51699_1025305 3300003579 Bacteria 934
14 Ga0032354_1009883 3300003693 Bacteria 2257
15 Ga0032354_1036765 3300003693 Bacteria 2457
16 Ga0055526_1026248 3300003771 Bacteria 1843
17 Ga0055537_1004503 3300003773 Bacteria 3972
18 Ga0055524_1037192 3300003775 Bacteria 1295
19 Ga0055524_1052374 3300003775 Bacteria 912
20 Ga0055534_1043029 3300003784 Bacteria 659
21 Ga0055528_1007701 3300003790 Bacteria 4722
22 Ga0055530_10053500 3300003791 Bacteria 927
23 Ga0055531_10023544 3300003794 Bacteria 2303
24 Ga0055531_10068005 3300003794 Bacteria 835
25 Ga0055543_1043964 3300004625 Bacteria 747
26 Ga0065165_1002762 3300005262 Bacteria 13954
27 Ga0065704_10007805 3300005289 Bacteria 2508
28 Ga0070658_10503281 3300005327 Bacteria 1046
29 Ga0070658_10737474 3300005327 Bacteria 855
30 Ga0070683_100461961 3300005329 Bacteria 1212
31 Ga0070670_100461539 3300005331 Bacteria 1126
32 Ga0068869_101085680 3300005334 Bacteria 700
33 Ga0070666_11144327 3300005335 Bacteria 579
34 Ga0070680_101335264 3300005336 Bacteria 621
35 Ga0070682_101299911 3300005337 Bacteria 618
36 Ga0068868_101014902 3300005338 Bacteria 760
37 Ga0070660_100775744 3300005339 Bacteria 806
38 Ga0070661_100418722 3300005344 Bacteria 1062
39 Ga0070668_100001882 3300005347 Bacteria 15339
40 Ga0070669_100050591 3300005353 Bacteria 3035
41 Ga0070671_100011171 3300005355 Bacteria 7211
42 Ga0070673_101556241 3300005364 Bacteria 624
43 Ga0070659_101321666 3300005366 Bacteria 640
44 Ga0070667_100021170 3300005367 Bacteria 5403
45 Ga0070667_100594634 3300005367 Bacteria 1019
46 Ga0070709_10402063 3300005434 Bacteria 1023
47 Ga0070714_100285187 3300005435 Bacteria 1535
48 Ga0070714_101687603 3300005435 Bacteria 619
49 Ga0070713_100107963 3300005436 Bacteria 2422
50 Ga0070710_10136161 3300005437 Bacteria 1502
51 Ga0070711_100557170 3300005439 Bacteria 952
52 Ga0070663_101215590 3300005455 Bacteria 663
53 Ga0070663_101589573 3300005455 Bacteria 583
54 Ga0070678_100463708 3300005456 Bacteria 1112
55 Ga0070685_10005750 3300005466 Bacteria 6302
56 Ga0070684_102023121 3300005535 Bacteria 544
57 Ga0070672_101379419 3300005543 Bacteria 630
58 Ga0070686_100505957 3300005544 Bacteria 938
59 Ga0070686_101397684 3300005544 Bacteria 587
60 Ga0070665_100349684 3300005548 Bacteria 1483
61 Ga0068855_100575861 3300005563 Bacteria 1216
62 Ga0068855_101677522 3300005563 Bacteria 648
63 Ga0070664_101039164 3300005564 Bacteria 771
64 Ga0070664_102350384 3300005564 Bacteria 506
65 Ga0068856_100134295 3300005614 Bacteria 2480
66 Ga0068856_100694970 3300005614 Bacteria 1037
67 Ga0068852_101458078 3300005616 Bacteria 707
68 Ga0068864_100030863 3300005618 Bacteria 4544
69 Ga0068861_102704965 3300005719 Bacteria 500
70 Ga0068863_100080807 3300005841 Bacteria 3079
71 Ga0068863_100182679 3300005841 Bacteria 2013
72 Ga0068858_100000261 3300005842 Bacteria 56197
73 Ga0068860_100000042 3300005843 Bacteria 227404
74 Ga0068862_100003686 3300005844 Bacteria 13105
75 Ga0068862_102162301 3300005844 Bacteria 568
76 Ga0081455_10058498 3300005937 Bacteria 3261
77 Ga0081540_1017843 3300005983 Bacteria 4377
78 Ga0070717_10294886 3300006028 Bacteria 1441
79 Ga0075365_10444201 3300006038 Bacteria 916
80 Ga0075363_100292289 3300006048 Bacteria 944
81 Ga0075364_10327156 3300006051 Bacteria 1044
82 Ga0070716_100158507 3300006173 Bacteria 1464
83 Ga0070712_100227825 3300006175 Bacteria 1479
84 Ga0075362_10306772 3300006177 Bacteria 788
85 Ga0075362_10559589 3300006177 Bacteria 588
86 Ga0075367_10767659 3300006178 Bacteria 614
87 Ga0075369_10010071 3300006186 Bacteria 3692
88 Ga0075366_10031500 3300006195 Bacteria 3121
89 Ga0097621_100328028 3300006237 Bacteria 1357
90 Ga0075370_10363622 3300006353 Bacteria 865
91 Ga0075370_10855728 3300006353 Bacteria 555
92 Ga0075430_100652120 3300006846 Bacteria 868
93 Ga0105240_10022560 3300009093 Bacteria 8342
94 Ga0105240_10058879 3300009093 Bacteria 4795
95 Ga0105240_10255649 3300009093 Bacteria 2023
96 Ga0105240_10413825 3300009093 Bacteria 1516
97 Ga0105240_12393746 3300009093 Bacteria 547
98 Ga0105245_11808632 3300009098 Bacteria 664
99 Ga0105241_10326042 3300009174 Bacteria 1326
100 Ga0105241_11546966 3300009174 Bacteria 640
101 Ga0105242_10461280 3300009176 Bacteria 1200
102 Ga0105248_10440021 3300009177 Bacteria 1469
103 Ga0105248_12360574 3300009177 Bacteria 606
104 Ga0105237_10224191 3300009545 Bacteria 1880
105 Ga0105237_10433354 3300009545 Bacteria 1320
106 Ga0105237_12630793 3300009545 Bacteria 514
107 Ga0105238_10196243 3300009551 Bacteria 1994
108 Ga0105238_10326749 3300009551 Bacteria 1520
109 Ga0105238_10724768 3300009551 Bacteria 1007
110 Ga0105238_10829427 3300009551 Bacteria 941
111 Ga0105238_10859111 3300009551 Bacteria 925
112 Ga0105033_104982 3300009986 Bacteria 1137
113 Ga0105239_10905051 3300010375 Bacteria 1013
114 Ga0105239_11856159 3300010375 Bacteria 699
115 Ga0157347_1011264 3300012502 Bacteria 948
116 Ga0157327_1004697 3300012512 Bacteria 1072
117 Ga0157373_10348597 3300013100 Bacteria 1056
118 Ga0157370_10483229 3300013104 Bacteria 1138
119 Ga0157378_12825693 3300013297 Bacteria 538
120 Ga0163162_11460712 3300013306 Bacteria 778
121 Ga0157372_10364270 3300013307 Bacteria 1684
122 Ga0163163_10269543 3300014325 Bacteria 1754
123 Ga0163163_11528902 3300014325 Bacteria 729
124 Ga0157379_10238620 3300014968 Bacteria 1649
125 Ga0163161_10878043 3300017792 Bacteria 758
126 Ga0213873_10031217 3300021358 Bacteria 1324
127 Ga0213872_10039932 3300021361 Bacteria 2142
128 Ga0213874_10161379 3300021377 Bacteria 788
129 Ga0213876_10008440 3300021384 Bacteria 5577
130 Ga0213875_10058981 3300021388 Bacteria 1796
131 Ga0213871_10012207 3300021441 Bacteria 1990
132 Ga0213871_10111587 3300021441 Bacteria 809
133 Ga0209233_1017172 3300025261 Bacteria 1977
134 Ga0209565_1000925 3300025263 Bacteria 15538
135 Ga0209673_1001876 3300025273 Bacteria 16959
136 Ga0209130_1000706 3300025284 Bacteria 29893
137 Ga0209675_1002644 3300025291 Bacteria 9054
138 Ga0209675_1038255 3300025291 Bacteria 1070
139 Ga0209676_1022325 3300025292 Bacteria 2100
140 Ga0209025_1000750 3300025294 Bacteria 54523
141 Ga0209564_1007568 3300025295 Bacteria 5584
142 Ga0209564_1015779 3300025295 Bacteria 3053
143 Ga0209758_1023594 3300025297 Bacteria 2776
144 Ga0209050_1019693 3300025298 Bacteria 2548
145 Ga0209256_1003893 3300025299 Bacteria 9891
146 Ga0209256_1020366 3300025299 Bacteria 2072
147 Ga0207426_1000336 3300025302 Bacteria 88370
148 Ga0209051_1000877 3300025303 Bacteria 30359
149 Ga0209257_1000976 3300025304 Bacteria 38920
150 Ga0209257_1008377 3300025304 Bacteria 5898
151 Ga0207692_10089803 3300025898 Bacteria 1664
152 Ga0207647_10645457 3300025904 Bacteria 581
153 Ga0207645_10029047 3300025907 Bacteria 3565
154 Ga0207705_10672397 3300025909 Bacteria 805
155 Ga0207707_11353605 3300025912 Bacteria 570
156 Ga0207695_10049522 3300025913 Bacteria 4427
157 Ga0207695_10076710 3300025913 Bacteria 3397
158 Ga0207671_10258019 3300025914 Bacteria 1371
159 Ga0207671_10790721 3300025914 Bacteria 753
160 Ga0207657_10493531 3300025919 Bacteria 959
161 Ga0207649_10214678 3300025920 Bacteria 1367
162 Ga0207652_10439885 3300025921 Bacteria 1176
163 Ga0207681_10452633 3300025923 Bacteria 1045
164 Ga0207694_10027541 3300025924 Bacteria 4329
165 Ga0207694_10211628 3300025924 Bacteria 1579
166 Ga0207694_10677710 3300025924 Bacteria 869
167 Ga0207694_10748388 3300025924 Bacteria 825
168 Ga0207650_11485020 3300025925 Bacteria 576
169 Ga0207659_11811051 3300025926 Bacteria 518
170 Ga0207700_10111800 3300025928 Bacteria 2199
171 Ga0207664_10019250 3300025929 Bacteria 5041
172 Ga0207664_11891233 3300025929 Bacteria 519
173 Ga0207644_10018207 3300025931 Bacteria 4749
174 Ga0207690_10870636 3300025932 Bacteria 746
175 Ga0207706_11091972 3300025933 Bacteria 667
176 Ga0207686_11529165 3300025934 Bacteria 550
177 Ga0207665_10064425 3300025939 Bacteria 2490
178 Ga0207691_11556722 3300025940 Bacteria 539
179 Ga0207711_11898226 3300025941 Bacteria 538
180 Ga0207711_12094047 3300025941 Bacteria 508
181 Ga0207661_11079713 3300025944 Bacteria 739
182 Ga0207679_11297557 3300025945 Bacteria 668
183 Ga0207667_10014133 3300025949 Bacteria 9112
184 Ga0207667_10434857 3300025949 Bacteria 1334
185 Ga0207667_12015332 3300025949 Bacteria 537
186 Ga0207651_11387531 3300025960 Bacteria 632
187 Ga0207658_10000002 3300025986 Bacteria 1364188
188 Ga0207703_10000253 3300026035 Bacteria 60255
189 Ga0207703_11582981 3300026035 Bacteria 630
190 Ga0207678_11114722 3300026067 Bacteria 699
191 Ga0207678_11369025 3300026067 Bacteria 626
192 Ga0207702_10683874 3300026078 Bacteria 1010
193 Ga0207702_11087444 3300026078 Bacteria 793
194 Ga0207641_10001025 3300026088 Bacteria 28336
195 Ga0207641_10101679 3300026088 Bacteria 2533
196 Ga0207648_11040737 3300026089 Bacteria 767
197 Ga0207676_10173154 3300026095 Bacteria 1882
198 Ga0207674_10434651 3300026116 Bacteria 1268
199 Ga0207698_11282310 3300026142 Bacteria 747
200 Ga0209970_1062345 3300027614 Bacteria 685
201 Ga0209974_10065831 3300027876 Bacteria 1231
202 Ga0268266_10005155 3300028379 Bacteria 12306
203 Ga0268266_12119386 3300028379 Bacteria 535
204 Ga0268265_10000582 3300028380 Bacteria 36910
205 Ga0268264_10000001 3300028381 Bacteria 1221000
206 Ga0268264_11979525 3300028381 Bacteria 592
207 Ga0307517_10130623 3300028786 Bacteria 1810
208 Ga0307515_10072026 3300028794 Bacteria 4673
209 Ga0307515_10486084 3300028794 Bacteria 846
210 Ga0307512_10169625 3300030522 Bacteria 1255
211 Ga0265332_10232294 3300031238 Bacteria 764
212 Ga0265331_10156725 3300031250 Bacteria 1033
213 Ga0265331_10463231 3300031250 Bacteria 570
214 Ga0265327_10007046 3300031251 Bacteria 8808
215 Ga0265327_10042561 3300031251 Bacteria 2437
216 Ga0307513_10010515 3300031456 Bacteria 11583
217 Ga0265314_10053314 3300031711 Bacteria 2806
218 Ga0265314_10083091 3300031711 Bacteria 2106
219 Ga0265342_10180916 3300031712 Bacteria 1155
220 Ga0316578_10158531 3300031728 Bacteria 1364
221 Ga0307405_10467527 3300031731 Bacteria 1004
222 Ga0307413_10177034 3300031824 Bacteria 1516
223 Ga0316593_10007944 3300032168 Bacteria 2937
224 Ga0316593_10008633 3300032168 Bacteria 2848
225 Ga0316593_10020888 3300032168 Bacteria 2042
226 Ga0316593_10078785 3300032168 Bacteria 1148
227 Ga0316593_10176011 3300032168 Bacteria 785
228 Ga0316586_1081233 3300033527 Bacteria 605
229 Ga0316596_1008470 3300033541 Bacteria 2451
230 Ga0373944_0256524 3300035089 Bacteria 647
231 Ga0373935_0019032 3300035692 Bacteria 4187
232 Ga0373927_1030299 3300035695 Bacteria 543
233 Ga0373933_0445506 3300035724 Bacteria 847
234 Ga0373933_0498110 3300035724 Bacteria 798
235 Ga0373947_0044569 3300035725 Bacteria 2652
236 Ga0373937_0125512 3300036401 Bacteria 2394
237 Ga0373937_0257814 3300036401 Bacteria 1644
238 Ga0316584_0571924 3300036712 Bacteria 787
239 Ga0373925_0543580 3300037068 Bacteria 955
240 Ga0395899_0000105 3300037312 Bacteria 146163
241 Ga0395899_0128160 3300037312 Bacteria 1814
242 Ga0395900_0060003 3300037418 Bacteria 3915
243 Ga0395900_0776233 3300037418 Bacteria 887
244 Ga0395898_0320867 3300037466 Bacteria 1478
245 Ga0395898_0361499 3300037466 Bacteria 1384
246 Ga0395905_0015820 3300037471 Bacteria 7166
247 Ga0395905_0096583 3300037471 Bacteria 2774
248 Ga0436364_0743164 3300037853 Bacteria 9802
249 Ga0436364_0866406 3300037853 Bacteria 4069
250 Ga0436364_1037710 3300037853 Bacteria 1007
251 Ga0395901_0058183 3300038443 Bacteria 4021
252 Ga0395901_0140376 3300038443 Bacteria 2539
253 Ga0400483_014056 3300039062 Bacteria 3378
254 Ga0400483_046766 3300039062 Bacteria 1297
255 Ga0400483_154328 3300039062 Bacteria 1159
256 Ga0400483_154910 3300039062 Bacteria 1953
257 Ga0400483_187305 3300039062 Bacteria 5029
258 Ga0237816_01805 3300039145 Bacteria 1710
259 Ga0436365_0637755 3300039437 Bacteria 882
260 Ga0436365_1136540 3300039437 Bacteria 40433
261 Ga0436365_1763809 3300039437 Bacteria 1750
262 Ga0436360_0452772 3300039438 Bacteria 2288
263 Ga0436360_1093457 3300039438 Bacteria 642
264 Ga0436361_0328563 3300039447 Bacteria 616
265 Ga0436361_0464948 3300039447 Bacteria 1268
266 Ga0436361_0479485 3300039447 Bacteria 1534
267 Ga0436361_0491418 3300039447 Bacteria 1175
268 Ga0436361_0533438 3300039447 Bacteria 1363
269 Ga0436361_1159961 3300039447 Bacteria 634
270 Ga0436363_0154863 3300039450 Bacteria 868
271 Ga0436363_0409180 3300039450 Bacteria 1522
272 Ga0436363_0899406 3300039450 Bacteria 4002
273 Ga0436362_0010396 3300039453 Bacteria 795
274 Ga0436362_0941954 3300039453 Bacteria 553
275 Ga0436362_0976116 3300039453 Bacteria 8152
276 Ga0436362_1086879 3300039453 Bacteria 807
277 Ga0439465_0225540 3300041413 Bacteria 688
278 Ga0451789_0212428 3300041443 Bacteria 779
279 Ga0451789_1030109 3300041443 Bacteria 593
280 Ga0451793_0901979 3300041452 Bacteria 542
281 Ga0451797_0917049 3300041453 Bacteria 599
282 Ga0451841_1373453 3300041498 Bacteria 777
283 Ga0451846_09700 3300041502 Bacteria 708
284 Ga0451843_0711516 3300041509 Bacteria 508
285 Ga0451853_1947268 3300041512 Bacteria 523
286 Ga0451853_3695048 3300041512 Bacteria 639
287 Ga0439437_004749 3300042000 Bacteria 1487
288 Ga0439441_036985 3300042001 Bacteria 966
289 Ga0439445_0007571 3300042004 Bacteria 2523
290 Ga0439445_0092836 3300042004 Bacteria 851
291 Ga0450891_015951 3300042129 Bacteria 715
292 Ga0450907_028084 3300042146 Bacteria 954
293 Ga0439435_0256023 3300042436 Bacteria 590
294 Ga0439459_0000576 3300042438 Bacteria 4885
295 Ga0450916_000234 3300042530 Bacteria 4330
296 Ga0466969_0016678 3300044656 Bacteria 3841
297 Ga0466969_0096092 3300044656 Bacteria 1399
298 Ga0466966_0001452 3300044684 Bacteria 15233
299 Ga0466966_0116263 3300044684 Bacteria 1646
300 Ga0466961_0000659 3300044693 Bacteria 21720
301 Ga0466961_0237441 3300044693 Bacteria 1121
302 Ga0466963_0248354 3300044694 Bacteria 1248
303 Ga0466971_0010445 3300044719 Bacteria 4057
304 Ga0466970_0024323 3300044765 Bacteria 3166
305 Ga0466957_0095470 3300044842 Bacteria 1867
306 Ga0466957_0642690 3300044842 Bacteria 745
307 Ga0466959_0000162 3300045049 Bacteria 44052
308 Ga0466959_0093014 3300045049 Bacteria 2164
309 Ga0451576_0003979 3300045051 Bacteria 19673
310 Ga0451576_0043660 3300045051 Bacteria 4729
311 Ga0466958_0004660 3300045836 Bacteria 7274
312 Ga0466958_0739905 3300045836 Bacteria 641
313 Ga0466967_0468759 3300045976 Bacteria 1233
314 Ga0495627_000399 3300046453 Bacteria 38947
315 Ga0495590_0000851 3300046457 Bacteria 13774
316 Ga0495590_0253139 3300046457 Bacteria 656
317 Ga0495590_0322944 3300046457 Bacteria 583
318 Ga0495638_0087536 3300046460 Bacteria 1881
319 Ga0495638_0149164 3300046460 Bacteria 1357
320 Ga0495638_0603644 3300046460 Bacteria 538
321 Ga0495650_0001571 3300046471 Bacteria 21474
322 Ga0495585_0057569 3300046492 Bacteria 2145
323 Ga0495583_0000650 3300046506 Bacteria 45814
324 Ga0495606_0013477 3300046507 Bacteria 6451
325 Ga0495606_0151705 3300046507 Bacteria 1359
326 Ga0495610_0026700 3300046512 Bacteria 3079
327 Ga0495610_0059087 3300046512 Bacteria 1831
328 Ga0495616_0069112 3300046513 Bacteria 1713
329 Ga0495620_0125080 3300046515 Bacteria 1011
330 Ga0495631_0019391 3300046518 Bacteria 3189
331 Ga0495632_0004552 3300046519 Bacteria 9398
332 Ga0495632_0140724 3300046519 Bacteria 1119
333 Ga0495637_0016956 3300046520 Bacteria 3401
334 Ga0495637_0091939 3300046520 Bacteria 1195
335 Ga0495643_0094121 3300046522 Bacteria 1542
336 Ga0495643_0167407 3300046522 Bacteria 1077
337 Ga0495648_0002288 3300046524 Bacteria 17871
338 Ga0495648_0445616 3300046524 Bacteria 567
339 Ga0495652_0464478 3300046529 Bacteria 884
340 Ga0495654_0006712 3300046530 Bacteria 6511
341 Ga0495609_0030354 3300046538 Bacteria 2460
342 Ga0495597_0033708 3300046542 Bacteria 2317
343 Ga0495597_0043806 3300046542 Bacteria 1991
344 Ga0495633_0080184 3300046558 Bacteria 1519
345 Ga0495668_0001818 3300046616 Bacteria 19364
346 Ga0495668_0019185 3300046616 Bacteria 3945
347 Ga0495668_0421880 3300046616 Bacteria 733
348 Ga0495625_0001925 3300046660 Bacteria 23466
349 Ga0495625_0058314 3300046660 Bacteria 2743
350 Ga0495625_0232434 3300046660 Bacteria 1203
351 Ga0495625_0430583 3300046660 Bacteria 818
352 Ga0495659_0002869 3300046664 Bacteria 5535
353 Ga0495661_0138934 3300046665 Bacteria 1324
354 Ga0495669_0358366 3300046684 Bacteria 705
355 Ga0495613_0000576 3300046689 Bacteria 29823
356 Ga0495670_0168018 3300046691 Bacteria 1154
357 Ga0495670_0516710 3300046691 Bacteria 649
358 Ga0495671_0285026 3300046692 Bacteria 795
359 Ga0495649_0000981 3300046694 Bacteria 22495
360 Ga0495649_0131040 3300046694 Bacteria 1323
361 Ga0495589_0034715 3300046794 Bacteria 2530
362 Ga0495589_0454372 3300046794 Bacteria 586
363 Ga0495660_0214314 3300046810 Bacteria 911
364 Ga0495660_0338009 3300046810 Bacteria 672
365 Ga0495672_0000439 3300047320 Bacteria 49666
366 Ga0495672_0079376 3300047320 Bacteria 1833
367 Ga0495672_0140450 3300047320 Bacteria 1262
368 Ga0495683_0011199 3300047323 Bacteria 4727
369 Ga0495679_006048 3300047446 Bacteria 5288
370 Ga0495673_0000189 3300047469 Bacteria 99018
371 Ga0495673_0017740 3300047469 Bacteria 3604
372 Ga0495673_0132665 3300047469 Bacteria 978
373 Ga0495681_0064653 3300047470 Bacteria 1674
374 Ga0495686_0026646 3300047472 Bacteria 3781
375 Ga0495686_0072995 3300047472 Bacteria 2108
376 Ga0495686_0079603 3300047472 Bacteria 2003
377 Ga0495686_0117797 3300047472 Bacteria 1586
378 Ga0496100_0545255 3300048903 Bacteria 897
379 Ga0496106_0006912 3300048909 Bacteria 8394
380 Ga0496106_0180175 3300048909 Bacteria 1677
381 Ga0496107_0000073 3300048910 Bacteria 48489
382 Ga0496107_0146752 3300048910 Bacteria 1745
383 Ga0496108_0694872 3300048911 Bacteria 882
384 Ga0496111_0272869 3300048914 Bacteria 1255
385 Ga0496113_0258424 3300048916 Bacteria 1391
386 Ga0496113_0699668 3300048916 Bacteria 809
387 Ga0496114_0000033 3300048917 Bacteria 166897
388 Ga0496114_0245251 3300048917 Bacteria 1576
389 Ga0496114_1642310 3300048917 Bacteria 531
390 Ga0496115_0021048 3300048918 Bacteria 5033
391 Ga0496115_0028924 3300048918 Bacteria 4347
392 Ga0496115_1264471 3300048918 Bacteria 551
393 Ga0496121_0025980 3300048924 Bacteria 5537
394 Ga0496121_0242092 3300048924 Bacteria 1256
395 Ga0496121_0246123 3300048924 Bacteria 1243
396 Ga0496122_0077737 3300048925 Bacteria 2328
397 Ga0496122_0258233 3300048925 Bacteria 969
398 Ga0496122_0549897 3300048925 Bacteria 550
399 Ga0496123_0088232 3300048926 Bacteria 1853
400 Ga0496123_0211923 3300048926 Bacteria 984
401 Ga0496124_0158136 3300048927 Bacteria 1770
402 Ga0496124_0346068 3300048927 Bacteria 1053
403 Ga0496124_0775296 3300048927 Bacteria 597
404 Ga0496125_0153392 3300048928 Bacteria 1578
405 Ga0496126_0049088 3300048929 Bacteria 3854
406 Ga0501341_02239 3300049131 Bacteria 1031
407 Ga0501304_018737 3300049160 Bacteria 671
408 Ga0495678_001705 3300049459 Bacteria 16503
409 Ga0501311_009757 3300049527 Bacteria 1152
410 Ga0501312_032631 3300049528 Bacteria 823
411 Ga0501314_000774 3300049530 Bacteria 2110
412 Ga0501315_004075 3300049531 Bacteria 1505
413 Ga0501315_031740 3300049531 Bacteria 764
414 Ga0501317_006835 3300049533 Bacteria 1269
415 Ga0501317_009026 3300049533 Bacteria 1162
416 Ga0501318_029083 3300049534 Bacteria 743
417 Ga0501319_000756 3300049535 Bacteria 1660
418 Ga0501320_038537 3300049536 Bacteria 619
419 Ga0501323_002237 3300049539 Bacteria 1852
420 Ga0501323_085480 3300049539 Bacteria 520
421 Ga0501324_002768 3300049540 Bacteria 1297
422 Ga0501325_052579 3300049541 Bacteria 521
423 Ga0501329_05361 3300049545 Bacteria 708
424 Ga0501337_019681 3300049553 Bacteria 544
425 Ga0501031_0017521 3300049568 Bacteria 4656
426 Ga0501033_0247888 3300049570 Bacteria 1263
427 Ga0501033_0401378 3300049570 Unclassified 956
428 Ga0501033_0439003 3300049570 Bacteria 908
429 Ga0501033_0648912 3300049570 Bacteria 721
430 Ga0501034_0000482 3300049571 Bacteria 65380
431 Ga0501034_0050358 3300049571 Bacteria 4201
432 Ga0501034_0084731 3300049571 Bacteria 3171
433 Ga0501034_0114101 3300049571 Bacteria 2691
434 Ga0501034_0169117 3300049571 Bacteria 2154
435 Ga0501034_0496951 3300049571 Bacteria 1134
436 Ga0501034_0553111 3300049571 Bacteria 1060
437 Ga0501034_0699995 3300049571 Bacteria 912
438 Ga0501034_0853449 3300049571 Bacteria 801
439 Ga0501034_1568104 3300049571 Bacteria 532
440 Ga0501036_1137566 3300049572 Bacteria 637
441 Ga0501037_0008751 3300049573 Bacteria 7418
442 Ga0501037_0614373 3300049573 Bacteria 729
443 Ga0501038_0001299 3300049574 Bacteria 22755
444 Ga0501038_0277617 3300049574 Bacteria 1320
445 Ga0501039_0241277 3300049575 Bacteria 1421
446 Ga0501039_1180565 3300049575 Unclassified 592
447 Ga0501043_0201620 3300049579 Bacteria 1544
448 Ga0501043_1193160 3300049579 Bacteria 535
449 Ga0501047_0026121 3300049581 Bacteria 5617
450 Ga0501047_0176818 3300049581 Bacteria 2002
451 Ga0501047_0199368 3300049581 Bacteria 1863
452 Ga0501047_0419998 3300049581 Bacteria 1169
453 Ga0501047_0481136 3300049581 Bacteria 1069
454 Ga0501047_0575858 3300049581 Bacteria 949
455 Ga0501068_0922849 3300049584 Bacteria 575
456 Ga0501069_0543334 3300049585 Bacteria 695
457 Ga0501072_1376532 3300049588 Bacteria 546
458 Ga0501238_000524 3300049671 Bacteria 4389
459 Ga0501238_038222 3300049671 Bacteria 703
460 Ga0501035_0281576 3300049822 Bacteria 1405
461 Ga0501035_0430157 3300049822 Bacteria 1095
462 Ga0501035_1518929 3300049822 Bacteria 510
463 Ga0501044_0038551 3300049823 Bacteria 4990
464 Ga0501044_0306578 3300049823 Bacteria 1515
465 Ga0501044_0622533 3300049823 Bacteria 971
466 Ga0501044_0659725 3300049823 Bacteria 934
467 nmdc:mga03683_381207_c1 3300050489 Bacteria 671
468 nmdc:mga03n38_445242_c1 3300050490 Bacteria 720
469 nmdc:mga00v17_937061_c1 3300050491 Bacteria 547
470 nmdc:mga0yw44_618422_c1 3300050492 Bacteria 736
471 nmdc:mga0k408_364897_c1 3300050493 Bacteria 861
472 nmdc:mga07m45_45178_c1 3300050496 Bacteria 2473
473 nmdc:mga0qj67_738371_c1 3300050509 Bacteria 782
474 nmdc:mga0sz30_61499_c1 3300050516 Bacteria 1605
475 Ga0500578_0000459 3300053086 Bacteria 49572
476 Ga0500578_0333499 3300053086 Bacteria 891
477 Ga0500578_0443331 3300053086 Bacteria 740
478 Ga0500643_013573 3300053087 Bacteria 2871
479 Ga0500643_013812 3300053087 Bacteria 2832
480 Ga0500644_0000193 3300053088 Bacteria 37831
481 Ga0500646_0385284 3300053090 Bacteria 516
482 Ga0500647_0049633 3300053091 Bacteria 2018
483 Ga0500647_0107844 3300053091 Bacteria 1326
484 Ga0500651_0346445 3300053093 Bacteria 844
485 Ga0500566_0249094 3300053094 Bacteria 865
486 Ga0500641_0002284 3300053096 Bacteria 6803
487 Ga0500641_0046486 3300053096 Bacteria 1772
488 Ga0500650_0035877 3300053098 Bacteria 2274
489 Ga0500650_0171820 3300053098 Bacteria 996
490 Ga0500554_000324 3300053102 Bacteria 10286
491 Ga0500556_0001068 3300053104 Bacteria 14047
492 Ga0500556_0044275 3300053104 Bacteria 1583
493 Ga0500556_0083999 3300053104 Bacteria 1207
494 Ga0500562_003596 3300053108 Bacteria 3890
495 Ga0500562_004084 3300053108 Bacteria 3679
496 Ga0500572_028551 3300053111 Bacteria 1536
497 Ga0500594_0000153 3300053118 Bacteria 18197
498 Ga0500595_016759 3300053119 Bacteria 2723
499 Ga0500595_184394 3300053119 Bacteria 578
500 Ga0500597_224954 3300053120 Bacteria 778
501 Ga0500608_000165 3300053122 Bacteria 27378
502 Ga0500608_117892 3300053122 Bacteria 1208
503 Ga0500614_054013 3300053123 Bacteria 1063
504 Ga0500614_061429 3300053123 Bacteria 1011
505 Ga0500618_000703 3300053125 Bacteria 19670
506 Ga0500642_0239264 3300053130 Bacteria 837
507 Ga0500655_015206 3300053133 Bacteria 1411
508 Ga0500658_0001787 3300053134 Bacteria 8487
509 Ga0500559_0000113 3300053136 Bacteria 63512
510 Ga0500559_0001398 3300053136 Bacteria 13721
511 Ga0500559_0016148 3300053136 Bacteria 3152
512 Ga0500559_0365135 3300053136 Bacteria 674
513 Ga0500564_000145 3300053138 Bacteria 18335
514 Ga0500568_0044246 3300053139 Bacteria 1777
515 Ga0500568_0080837 3300053139 Bacteria 1234
516 Ga0500573_0144994 3300053140 Bacteria 1304
517 Ga0500577_0027599 3300053142 Bacteria 1946
518 Ga0500588_0023345 3300053146 Bacteria 1694
519 Ga0500589_208111 3300053147 Bacteria 746
520 Ga0500590_172269 3300053148 Bacteria 950
521 Ga0500616_0088560 3300053153 Bacteria 1538
522 Ga0500616_0163696 3300053153 Bacteria 1017
523 Ga0500619_053637 3300053154 Bacteria 1311
524 Ga0500622_0000771 3300053156 Bacteria 27846
525 Ga0500622_0003985 3300053156 Bacteria 9528
526 Ga0500622_0036800 3300053156 Bacteria 2557
527 Ga0500622_0314243 3300053156 Bacteria 662
528 Ga0500622_0350024 3300053156 Bacteria 613
529 Ga0500627_0046520 3300053158 Bacteria 1880
530 Ga0500633_0042334 3300053160 Bacteria 1536
531 Ga0500634_0171596 3300053161 Bacteria 987
532 Ga0500638_179831 3300053162 Bacteria 914
533 Ga0500639_129768 3300053163 Bacteria 1196
534 Ga0500636_0106904 3300053177 Bacteria 1585
535 Ga0500570_140607 3300053724 Bacteria 889
536 Ga0500611_011461 3300053727 Bacteria 1467
537 Ga0500645_009863 3300053730 Bacteria 3189
538 Ga0500645_030083 3300053730 Bacteria 1636
539 Ga0500645_038787 3300053730 Bacteria 1412
540 Ga0500609_000093 3300053731 Bacteria 11592
541 Ga0500609_014359 3300053731 Bacteria 1073
542 Ga0500661_055671 3300055283 Bacteria 710
543 Ga0587084_001790 3300059477 Bacteria 2107
544 Ga0587084_041670 3300059477 Bacteria 782
545 Ga0587084_049791 3300059477 Bacteria 738
546 Ga0587093_018561 3300059478 Bacteria 907
547 Ga0587093_040621 3300059478 Bacteria 704
548 Ga0587093_060739 3300059478 Bacteria 616
549 Ga0587066_021865 3300059490 Bacteria 1065
550 Ga0587066_086518 3300059490 Bacteria 688
551 Ga0587070_023885 3300059491 Bacteria 1054
552 Ga0587073_0095231 3300059492 Bacteria 764
553 Ga0587073_0190089 3300059492 Bacteria 609
554 Ga0587077_000161 3300059493 Bacteria 4481
555 Ga0587077_007264 3300059493 Bacteria 1606
556 Ga0587080_135711 3300059503 Bacteria 558
557 Ga0587083_0138225 3300059505 Bacteria 646
558 Ga0587085_105957 3300059506 Bacteria 600
559 Ga0587086_014512 3300059507 Bacteria 1006
560 Ga0587086_014966 3300059507 Bacteria 996
561 Ga0587086_016563 3300059507 Bacteria 964
562 Ga0587086_028377 3300059507 Bacteria 809
563 Ga0587088_031808 3300059508 Bacteria 947
564 Ga0587088_063117 3300059508 Bacteria 755
565 Ga0587089_050042 3300059509 Bacteria 668
566 Ga0587090_001474 3300059510 Bacteria 2393
567 Ga0587090_007980 3300059510 Bacteria 1407
568 Ga0587091_236636 3300059511 Bacteria 506
569 Ga0587092_032868 3300059512 Bacteria 867
570 Ga0587094_009396 3300059513 Bacteria 1247
571 Ga0587101_001189 3300059623 Bacteria 2164
572 Ga0587109_036454 3300059624 Bacteria 957
573 Ga0587109_197567 3300059624 Bacteria 522
574 Ga0587117_012260 3300059627 Bacteria 1079
575 Ga0587117_072891 3300059627 Bacteria 612
576 Ga0587117_083346 3300059627 Bacteria 586
577 Ga0587062_006587 3300059639 Bacteria 1326
578 Ga0587062_048719 3300059639 Bacteria 711
579 Ga0587068_004838 3300059641 Bacteria 1804
580 Ga0587068_016860 3300059641 Bacteria 1161
581 Ga0587069_041394 3300059642 Bacteria 787
582 Ga0587072_096434 3300059643 Bacteria 658
583 Ga0587075_015780 3300059644 Bacteria 1066
584 Ga0587076_000787 3300059645 Bacteria 2870
585 Ga0587078_000144 3300059646 Bacteria 4156
586 Ga0587078_028975 3300059646 Bacteria 738
587 Ga0587100_008302 3300059648 Bacteria 837
588 Ga0587102_030071 3300059649 Bacteria 659
589 Ga0587107_084058 3300059652 Bacteria 603
590 Ga0587110_003821 3300059654 Bacteria 1280
591 Ga0587124_009577 3300059660 Bacteria 851
592 Ga0587124_016159 3300059660 Bacteria 724
593 Ga0587071_063564 3300060344 Bacteria 789
594 Ga0587111_0000079 3300060346 Bacteria 5946
595 Ga0587111_0000967 3300060346 Bacteria 3179
596 Ga0587111_0037802 3300060346 Bacteria 1016
597 Ga0587111_0126633 3300060346 Bacteria 663
598 Ga0587111_0135908 3300060346 Bacteria 647
599 Ga0466962_0003721 3300061719 Bacteria 7277

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031251 Ga0265327_10042561 Ga0265327_100425614 96
2 3300003784 Ga0055534_1043029 Ga0055534_10430291 97
3 3300005327 Ga0070658_10503281 Ga0070658_105032811 97
4 3300005327 Ga0070658_10737474 Ga0070658_107374741 97
5 3300005329 Ga0070683_100461961 Ga0070683_1004619612 97
6 3300005336 Ga0070680_101335264 Ga0070680_1013352641 97
7 3300005337 Ga0070682_101299911 Ga0070682_1012999112 97
8 3300005338 Ga0068868_101014902 Ga0068868_1010149022 97
9 3300005339 Ga0070660_100775744 Ga0070660_1007757442 97
10 3300005344 Ga0070661_100418722 Ga0070661_1004187222 97
11 3300005364 Ga0070673_101556241 Ga0070673_1015562411 97
12 3300005366 Ga0070659_101321666 Ga0070659_1013216662 97
13 3300005435 Ga0070714_101687603 Ga0070714_1016876031 97
14 3300005456 Ga0070678_100463708 Ga0070678_1004637082 97
15 3300005535 Ga0070684_102023121 Ga0070684_1020231211 97
16 3300005616 Ga0068852_101458078 Ga0068852_1014580782 97
17 3300009098 Ga0105245_11808632 Ga0105245_118086322 97
18 3300009174 Ga0105241_11546966 Ga0105241_115469661 97
19 3300009176 Ga0105242_10461280 Ga0105242_104612802 97
20 3300009177 Ga0105248_12360574 Ga0105248_123605742 97
21 3300009545 Ga0105237_12630793 Ga0105237_126307931 97
22 3300009551 Ga0105238_10829427 Ga0105238_108294272 97
23 3300009551 Ga0105238_10859111 Ga0105238_108591112 97
24 3300010375 Ga0105239_11856159 Ga0105239_118561592 97
25 3300013100 Ga0157373_10348597 Ga0157373_103485972 97
26 3300013104 Ga0157370_10483229 Ga0157370_104832292 97
27 3300013297 Ga0157378_12825693 Ga0157378_128256932 97
28 3300013307 Ga0157372_10364270 Ga0157372_103642703 97
29 3300021441 Ga0213871_10111587 Ga0213871_101115872 97
30 3300025261 Ga0209233_1017172 Ga0209233_10171723 97
31 3300025291 Ga0209675_1002644 Ga0209675_10026442 97
32 3300025904 Ga0207647_10645457 Ga0207647_106454572 97
33 3300025907 Ga0207645_10029047 Ga0207645_100290474 97
34 3300025909 Ga0207705_10672397 Ga0207705_106723972 97
35 3300025919 Ga0207657_10493531 Ga0207657_104935312 97
36 3300025920 Ga0207649_10214678 Ga0207649_102146782 97
37 3300025921 Ga0207652_10439885 Ga0207652_104398852 97
38 3300025924 Ga0207694_10211628 Ga0207694_102116283 97
39 3300025926 Ga0207659_11811051 Ga0207659_118110512 97
40 3300025929 Ga0207664_11891233 Ga0207664_118912331 97
41 3300025932 Ga0207690_10870636 Ga0207690_108706362 97
42 3300025933 Ga0207706_11091972 Ga0207706_110919722 97
43 3300025934 Ga0207686_11529165 Ga0207686_115291652 97
44 3300025941 Ga0207711_12094047 Ga0207711_120940472 97
45 3300025944 Ga0207661_11079713 Ga0207661_110797132 97
46 3300025945 Ga0207679_11297557 Ga0207679_112975572 97
47 3300025949 Ga0207667_12015332 Ga0207667_120153322 97
48 3300025960 Ga0207651_11387531 Ga0207651_113875312 97
49 3300026035 Ga0207703_11582981 Ga0207703_115829812 97
50 3300026067 Ga0207678_11114722 Ga0207678_111147222 97
51 3300026078 Ga0207702_10683874 Ga0207702_106838742 97
52 3300026089 Ga0207648_11040737 Ga0207648_110407372 97
53 3300026116 Ga0207674_10434651 Ga0207674_104346512 97
54 3300026142 Ga0207698_11282310 Ga0207698_112823102 97
55 3300027614 Ga0209970_1062345 Ga0209970_10623452 97
56 3300031238 Ga0265332_10232294 Ga0265332_102322942 97
57 3300031250 Ga0265331_10156725 Ga0265331_101567252 97
58 3300031250 Ga0265331_10463231 Ga0265331_104632312 97
59 3300031251 Ga0265327_10007046 Ga0265327_100070465 97
60 3300031711 Ga0265314_10053314 Ga0265314_100533145 97
61 3300031711 Ga0265314_10083091 Ga0265314_100830912 97
62 3300031712 Ga0265342_10180916 Ga0265342_101809162 97
63 3300035695 Ga0373927_1030299 Ga0373927_1030299_128_421 97
64 3300035724 Ga0373933_0445506 Ga0373933_0445506_398_691 97
65 3300035724 Ga0373933_0498110 Ga0373933_0498110_74_367 97
66 3300036401 Ga0373937_0257814 Ga0373937_0257814_146_439 97
67 3300037418 Ga0395900_0776233 Ga0395900_0776233_459_752 97
68 3300037466 Ga0395898_0361499 Ga0395898_0361499_798_1091 97
69 3300037471 Ga0395905_0096583 Ga0395905_0096583_1032_1325 97
70 3300038443 Ga0395901_0140376 Ga0395901_0140376_791_1084 97
71 3300039447 Ga0436361_0328563 Ga0436361_0328563_30_323 97
72 3300039453 Ga0436362_0941954 Ga0436362_0941954_197_490 97
73 3300046529 Ga0495652_0464478 Ga0495652_0464478_110_403 97
74 3300046689 Ga0495613_0000576 Ga0495613_0000576_27497_27790 97
75 3300048903 Ga0496100_0545255 Ga0496100_0545255_161_454 97
76 3300048909 Ga0496106_0180175 Ga0496106_0180175_435_728 97
77 3300048910 Ga0496107_0146752 Ga0496107_0146752_783_1076 97
78 3300048917 Ga0496114_1642310 Ga0496114_1642310_64_357 97
79 3300048918 Ga0496115_1264471 Ga0496115_1264471_49_342 97
80 3300048924 Ga0496121_0246123 Ga0496121_0246123_822_1115 97
81 3300049528 Ga0501312_032631 Ga0501312_032631_419_712 97
82 3300049533 Ga0501317_009026 Ga0501317_009026_296_589 97
83 3300049534 Ga0501318_029083 Ga0501318_029083_32_325 97
84 3300049570 Ga0501033_0439003 Ga0501033_0439003_342_635 97
85 3300049581 Ga0501047_0419998 Ga0501047_0419998_41_334 97
86 3300049581 Ga0501047_0481136 Ga0501047_0481136_344_637 97
87 3300049822 Ga0501035_0430157 Ga0501035_0430157_450_743 97
88 3300049823 Ga0501044_0306578 Ga0501044_0306578_532_825 97
89 3300049823 Ga0501044_0659725 Ga0501044_0659725_472_765 97
90 3300053091 Ga0500647_0049633 Ga0500647_0049633_814_1107 97
91 3300053111 Ga0500572_028551 Ga0500572_028551_476_769 97
92 3300053119 Ga0500595_184394 Ga0500595_184394_49_342 97
93 3300053120 Ga0500597_224954 Ga0500597_224954_139_432 97
94 3300053123 Ga0500614_061429 Ga0500614_061429_556_849 97
95 3300053136 Ga0500559_0000113 Ga0500559_0000113_57798_58091 97
96 3300053136 Ga0500559_0365135 Ga0500559_0365135_234_527 97
97 3300053148 Ga0500590_172269 Ga0500590_172269_536_829 97
98 3300053154 Ga0500619_053637 Ga0500619_053637_523_816 97
99 3300053162 Ga0500638_179831 Ga0500638_179831_559_852 97
100 3300053163 Ga0500639_129768 Ga0500639_129768_432_725 97
101 3300053177 Ga0500636_0106904 Ga0500636_0106904_865_1158 97
102 3300003163 Ga0006759J45824_1069825 Ga0006759J45824_10698252 98
103 3300003163 Ga0006759J45824_1093412 Ga0006759J45824_10934121 98
104 3300003215 JGI25153J46596_10020623 JGI25153J46596_100206232 98
105 3300003322 rootL2_10134251 rootL2_101342512 98
106 3300003559 Ga0007427J51700_108029 Ga0007427J51700_1080292 98
107 3300003693 Ga0032354_1009883 Ga0032354_10098834 98
108 3300003693 Ga0032354_1036765 Ga0032354_10367654 98
109 3300003771 Ga0055526_1026248 Ga0055526_10262482 98
110 3300003773 Ga0055537_1004503 Ga0055537_10045031 98
111 3300003775 Ga0055524_1037192 Ga0055524_10371923 98
112 3300003775 Ga0055524_1052374 Ga0055524_10523742 98
113 3300003790 Ga0055528_1007701 Ga0055528_10077018 98
114 3300003791 Ga0055530_10053500 Ga0055530_100535002 98
115 3300003794 Ga0055531_10023544 Ga0055531_100235444 98
116 3300003794 Ga0055531_10068005 Ga0055531_100680052 98
117 3300004625 Ga0055543_1043964 Ga0055543_10439642 98
118 3300005262 Ga0065165_1002762 Ga0065165_10027628 98
119 3300005455 Ga0070663_101589573 Ga0070663_1015895732 98
120 3300005543 Ga0070672_101379419 Ga0070672_1013794191 98
121 3300005544 Ga0070686_100505957 Ga0070686_1005059572 98
122 3300005564 Ga0070664_102350384 Ga0070664_1023503842 98
123 3300006038 Ga0075365_10444201 Ga0075365_104442012 98
124 3300006048 Ga0075363_100292289 Ga0075363_1002922892 98
125 3300006051 Ga0075364_10327156 Ga0075364_103271562 98
126 3300006177 Ga0075362_10306772 Ga0075362_103067721 98
127 3300006177 Ga0075362_10559589 Ga0075362_105595892 98
128 3300006178 Ga0075367_10767659 Ga0075367_107676592 98
129 3300006186 Ga0075369_10010071 Ga0075369_100100712 98
130 3300006195 Ga0075366_10031500 Ga0075366_100315007 98
131 3300006237 Ga0097621_100328028 Ga0097621_1003280282 98
132 3300006353 Ga0075370_10363622 Ga0075370_103636222 98
133 3300012502 Ga0157347_1011264 Ga0157347_10112642 98
134 3300012512 Ga0157327_1004697 Ga0157327_10046971 98
135 3300017792 Ga0163161_10878043 Ga0163161_108780432 98
136 3300021358 Ga0213873_10031217 Ga0213873_100312173 98
137 3300021377 Ga0213874_10161379 Ga0213874_101613791 98
138 3300021384 Ga0213876_10008440 Ga0213876_1000844010 98
139 3300021388 Ga0213875_10058981 Ga0213875_100589812 98
140 3300025263 Ga0209565_1000925 Ga0209565_10009252 98
141 3300025273 Ga0209673_1001876 Ga0209673_10018767 98
142 3300025291 Ga0209675_1038255 Ga0209675_10382551 98
143 3300025292 Ga0209676_1022325 Ga0209676_10223254 98
144 3300025295 Ga0209564_1007568 Ga0209564_100756811 98
145 3300025295 Ga0209564_1015779 Ga0209564_10157792 98
146 3300025297 Ga0209758_1023594 Ga0209758_10235943 98
147 3300025298 Ga0209050_1019693 Ga0209050_10196934 98
148 3300025299 Ga0209256_1003893 Ga0209256_10038935 98
149 3300025299 Ga0209256_1020366 Ga0209256_10203664 98
150 3300025303 Ga0209051_1000877 Ga0209051_100087723 98
151 3300025304 Ga0209257_1000976 Ga0209257_100097649 98
152 3300025304 Ga0209257_1008377 Ga0209257_100837710 98
153 3300025940 Ga0207691_11556722 Ga0207691_115567222 98
154 3300026067 Ga0207678_11369025 Ga0207678_113690252 98
155 3300028786 Ga0307517_10130623 Ga0307517_101306232 98
156 3300028794 Ga0307515_10072026 Ga0307515_100720262 98
157 3300028794 Ga0307515_10486084 Ga0307515_104860842 98
158 3300030522 Ga0307512_10169625 Ga0307512_101696252 98
159 3300031731 Ga0307405_10467527 Ga0307405_104675272 98
160 3300032168 Ga0316593_10007944 Ga0316593_100079442 98
161 3300032168 Ga0316593_10020888 Ga0316593_100208884 98
162 3300032168 Ga0316593_10078785 Ga0316593_100787852 98
163 3300032168 Ga0316593_10176011 Ga0316593_101760112 98
164 3300033541 Ga0316596_1008470 Ga0316596_10084704 98
165 3300036712 Ga0316584_0571924 Ga0316584_0571924_44_340 98
166 3300037471 Ga0395905_0015820 Ga0395905_0015820_3283_3579 98
167 3300037853 Ga0436364_0743164 Ga0436364_0743164_6220_6516 98
168 3300037853 Ga0436364_1037710 Ga0436364_1037710_679_975 98
169 3300039062 Ga0400483_014056 Ga0400483_014056_105_401 98
170 3300039062 Ga0400483_046766 Ga0400483_046766_831_1127 98
171 3300039062 Ga0400483_154328 Ga0400483_154328_303_599 98
172 3300039062 Ga0400483_154910 Ga0400483_154910_1266_1562 98
173 3300039062 Ga0400483_187305 Ga0400483_187305_2888_3184 98
174 3300039437 Ga0436365_1136540 Ga0436365_1136540_8829_9125 98
175 3300039437 Ga0436365_1763809 Ga0436365_1763809_1370_1666 98
176 3300039450 Ga0436363_0154863 Ga0436363_0154863_542_838 98
177 3300039450 Ga0436363_0409180 Ga0436363_0409180_181_477 98
178 3300039450 Ga0436363_0899406 Ga0436363_0899406_1783_2079 98
179 3300039453 Ga0436362_0976116 Ga0436362_0976116_2356_2652 98
180 3300041443 Ga0451789_0212428 Ga0451789_0212428_337_633 98
181 3300041443 Ga0451789_1030109 Ga0451789_1030109_40_336 98
182 3300041452 Ga0451793_0901979 Ga0451793_0901979_67_363 98
183 3300041453 Ga0451797_0917049 Ga0451797_0917049_261_557 98
184 3300041498 Ga0451841_1373453 Ga0451841_1373453_381_677 98
185 3300041502 Ga0451846_09700 Ga0451846_09700_87_383 98
186 3300041509 Ga0451843_0711516 Ga0451843_0711516_53_373 98
187 3300041512 Ga0451853_1947268 Ga0451853_1947268_87_383 98
188 3300042000 Ga0439437_004749 Ga0439437_004749_1092_1388 98
189 3300042001 Ga0439441_036985 Ga0439441_036985_274_570 98
190 3300042004 Ga0439445_0007571 Ga0439445_0007571_862_1158 98
191 3300042129 Ga0450891_015951 Ga0450891_015951_390_686 98
192 3300042436 Ga0439435_0256023 Ga0439435_0256023_69_365 98
193 3300042438 Ga0439459_0000576 Ga0439459_0000576_2668_2964 98
194 3300042530 Ga0450916_000234 Ga0450916_000234_3858_4154 98
195 3300044656 Ga0466969_0016678 Ga0466969_0016678_298_594 98
196 3300044684 Ga0466966_0001452 Ga0466966_0001452_4987_5283 98
197 3300044693 Ga0466961_0000659 Ga0466961_0000659_8389_8685 98
198 3300044694 Ga0466963_0248354 Ga0466963_0248354_881_1177 98
199 3300044719 Ga0466971_0010445 Ga0466971_0010445_40_336 98
200 3300044765 Ga0466970_0024323 Ga0466970_0024323_46_342 98
201 3300044842 Ga0466957_0095470 Ga0466957_0095470_1288_1584 98
202 3300045049 Ga0466959_0000162 Ga0466959_0000162_3532_3828 98
203 3300045051 Ga0451576_0043660 Ga0451576_0043660_2136_2456 98
204 3300045836 Ga0466958_0004660 Ga0466958_0004660_3262_3558 98
205 3300045976 Ga0466967_0468759 Ga0466967_0468759_232_528 98
206 3300046453 Ga0495627_000399 Ga0495627_000399_3883_4179 98
207 3300046457 Ga0495590_0000851 Ga0495590_0000851_11764_12060 98
208 3300046457 Ga0495590_0322944 Ga0495590_0322944_164_460 98
209 3300046460 Ga0495638_0087536 Ga0495638_0087536_182_478 98
210 3300046460 Ga0495638_0149164 Ga0495638_0149164_877_1173 98
211 3300046460 Ga0495638_0603644 Ga0495638_0603644_197_493 98
212 3300046471 Ga0495650_0001571 Ga0495650_0001571_16029_16325 98
213 3300046492 Ga0495585_0057569 Ga0495585_0057569_833_1129 98
214 3300046506 Ga0495583_0000650 Ga0495583_0000650_12842_13138 98
215 3300046507 Ga0495606_0013477 Ga0495606_0013477_4305_4601 98
216 3300046507 Ga0495606_0151705 Ga0495606_0151705_832_1128 98
217 3300046512 Ga0495610_0026700 Ga0495610_0026700_661_957 98
218 3300046512 Ga0495610_0059087 Ga0495610_0059087_938_1234 98
219 3300046513 Ga0495616_0069112 Ga0495616_0069112_725_1021 98
220 3300046515 Ga0495620_0125080 Ga0495620_0125080_139_435 98
221 3300046518 Ga0495631_0019391 Ga0495631_0019391_1389_1685 98
222 3300046519 Ga0495632_0004552 Ga0495632_0004552_452_748 98
223 3300046519 Ga0495632_0140724 Ga0495632_0140724_75_371 98
224 3300046520 Ga0495637_0016956 Ga0495637_0016956_3070_3366 98
225 3300046520 Ga0495637_0091939 Ga0495637_0091939_347_643 98
226 3300046522 Ga0495643_0094121 Ga0495643_0094121_39_335 98
227 3300046522 Ga0495643_0167407 Ga0495643_0167407_367_663 98
228 3300046524 Ga0495648_0002288 Ga0495648_0002288_15921_16217 98
229 3300046524 Ga0495648_0445616 Ga0495648_0445616_39_335 98
230 3300046530 Ga0495654_0006712 Ga0495654_0006712_5491_5787 98
231 3300046538 Ga0495609_0030354 Ga0495609_0030354_1998_2294 98
232 3300046542 Ga0495597_0033708 Ga0495597_0033708_245_541 98
233 3300046542 Ga0495597_0043806 Ga0495597_0043806_1503_1799 98
234 3300046558 Ga0495633_0080184 Ga0495633_0080184_358_654 98
235 3300046616 Ga0495668_0001818 Ga0495668_0001818_13941_14237 98
236 3300046616 Ga0495668_0019185 Ga0495668_0019185_2582_2878 98
237 3300046616 Ga0495668_0421880 Ga0495668_0421880_15_311 98
238 3300046660 Ga0495625_0001925 Ga0495625_0001925_10610_10906 98
239 3300046660 Ga0495625_0058314 Ga0495625_0058314_943_1239 98
240 3300046660 Ga0495625_0232434 Ga0495625_0232434_29_325 98
241 3300046660 Ga0495625_0430583 Ga0495625_0430583_112_408 98
242 3300046664 Ga0495659_0002869 Ga0495659_0002869_4899_5195 98
243 3300046665 Ga0495661_0138934 Ga0495661_0138934_834_1130 98
244 3300046691 Ga0495670_0168018 Ga0495670_0168018_811_1107 98
245 3300046691 Ga0495670_0516710 Ga0495670_0516710_14_310 98
246 3300046692 Ga0495671_0285026 Ga0495671_0285026_303_599 98
247 3300046694 Ga0495649_0131040 Ga0495649_0131040_214_510 98
248 3300046794 Ga0495589_0034715 Ga0495589_0034715_427_723 98
249 3300046810 Ga0495660_0214314 Ga0495660_0214314_313_609 98
250 3300046810 Ga0495660_0338009 Ga0495660_0338009_66_362 98
251 3300047320 Ga0495672_0000439 Ga0495672_0000439_44523_44819 98
252 3300047323 Ga0495683_0011199 Ga0495683_0011199_3325_3621 98
253 3300047446 Ga0495679_006048 Ga0495679_006048_1813_2109 98
254 3300047469 Ga0495673_0000189 Ga0495673_0000189_98062_98358 98
255 3300047469 Ga0495673_0017740 Ga0495673_0017740_2980_3276 98
256 3300047470 Ga0495681_0064653 Ga0495681_0064653_671_967 98
257 3300047472 Ga0495686_0026646 Ga0495686_0026646_3126_3422 98
258 3300047472 Ga0495686_0072995 Ga0495686_0072995_264_560 98
259 3300047472 Ga0495686_0079603 Ga0495686_0079603_1183_1479 98
260 3300048909 Ga0496106_0006912 Ga0496106_0006912_619_915 98
261 3300048910 Ga0496107_0000073 Ga0496107_0000073_47466_47762 98
262 3300048911 Ga0496108_0694872 Ga0496108_0694872_455_751 98
263 3300048914 Ga0496111_0272869 Ga0496111_0272869_484_780 98
264 3300048916 Ga0496113_0258424 Ga0496113_0258424_176_472 98
265 3300048917 Ga0496114_0245251 Ga0496114_0245251_1143_1439 98
266 3300048918 Ga0496115_0021048 Ga0496115_0021048_707_1003 98
267 3300048918 Ga0496115_0028924 Ga0496115_0028924_3845_4141 98
268 3300048924 Ga0496121_0025980 Ga0496121_0025980_4165_4461 98
269 3300048924 Ga0496121_0242092 Ga0496121_0242092_244_540 98
270 3300048925 Ga0496122_0549897 Ga0496122_0549897_228_524 98
271 3300048926 Ga0496123_0088232 Ga0496123_0088232_1078_1374 98
272 3300048926 Ga0496123_0211923 Ga0496123_0211923_201_497 98
273 3300048927 Ga0496124_0346068 Ga0496124_0346068_273_569 98
274 3300048927 Ga0496124_0775296 Ga0496124_0775296_27_323 98
275 3300048928 Ga0496125_0153392 Ga0496125_0153392_1229_1525 98
276 3300048929 Ga0496126_0049088 Ga0496126_0049088_548_844 98
277 3300049131 Ga0501341_02239 Ga0501341_02239_39_335 98
278 3300049160 Ga0501304_018737 Ga0501304_018737_30_326 98
279 3300049459 Ga0495678_001705 Ga0495678_001705_1630_1926 98
280 3300049527 Ga0501311_009757 Ga0501311_009757_421_717 98
281 3300049531 Ga0501315_004075 Ga0501315_004075_972_1271 98
282 3300049531 Ga0501315_031740 Ga0501315_031740_358_654 98
283 3300049533 Ga0501317_006835 Ga0501317_006835_621_917 98
284 3300049535 Ga0501319_000756 Ga0501319_000756_593_889 98
285 3300049536 Ga0501320_038537 Ga0501320_038537_138_437 98
286 3300049539 Ga0501323_002237 Ga0501323_002237_775_1071 98
287 3300049539 Ga0501323_085480 Ga0501323_085480_87_386 98
288 3300049540 Ga0501324_002768 Ga0501324_002768_983_1279 98
289 3300049541 Ga0501325_052579 Ga0501325_052579_159_455 98
290 3300049545 Ga0501329_05361 Ga0501329_05361_79_375 98
291 3300049553 Ga0501337_019681 Ga0501337_019681_170_466 98
292 3300049570 Ga0501033_0247888 Ga0501033_0247888_172_468 98
293 3300049571 Ga0501034_0000482 Ga0501034_0000482_46387_46683 98
294 3300049571 Ga0501034_0699995 Ga0501034_0699995_52_348 98
295 3300049572 Ga0501036_1137566 Ga0501036_1137566_216_512 98
296 3300049581 Ga0501047_0176818 Ga0501047_0176818_777_1073 98
297 3300049581 Ga0501047_0199368 Ga0501047_0199368_1506_1802 98
298 3300049581 Ga0501047_0575858 Ga0501047_0575858_209_532 98
299 3300049671 Ga0501238_000524 Ga0501238_000524_615_911 98
300 3300049671 Ga0501238_038222 Ga0501238_038222_117_413 98
301 3300050490 nmdc:mga03n38_445242_c1 nmdc:mga03n38_445242_c1_235_531 98
302 3300050491 nmdc:mga00v17_937061_c1 nmdc:mga00v17_937061_c1_238_534 98
303 3300050492 nmdc:mga0yw44_618422_c1 nmdc:mga0yw44_618422_c1_298_594 98
304 3300050493 nmdc:mga0k408_364897_c1 nmdc:mga0k408_364897_c1_131_427 98
305 3300050496 nmdc:mga07m45_45178_c1 nmdc:mga07m45_45178_c1_1619_1915 98
306 3300050516 nmdc:mga0sz30_61499_c1 nmdc:mga0sz30_61499_c1_588_884 98
307 3300053086 Ga0500578_0000459 Ga0500578_0000459_35167_35463 98
308 3300053086 Ga0500578_0333499 Ga0500578_0333499_117_413 98
309 3300053086 Ga0500578_0443331 Ga0500578_0443331_283_579 98
310 3300053087 Ga0500643_013573 Ga0500643_013573_315_611 98
311 3300053087 Ga0500643_013812 Ga0500643_013812_1048_1344 98
312 3300053088 Ga0500644_0000193 Ga0500644_0000193_13910_14206 98
313 3300053090 Ga0500646_0385284 Ga0500646_0385284_94_390 98
314 3300053093 Ga0500651_0346445 Ga0500651_0346445_380_676 98
315 3300053094 Ga0500566_0249094 Ga0500566_0249094_256_552 98
316 3300053096 Ga0500641_0002284 Ga0500641_0002284_2406_2702 98
317 3300053096 Ga0500641_0046486 Ga0500641_0046486_55_351 98
318 3300053098 Ga0500650_0035877 Ga0500650_0035877_330_626 98
319 3300053102 Ga0500554_000324 Ga0500554_000324_9376_9672 98
320 3300053104 Ga0500556_0001068 Ga0500556_0001068_12566_12862 98
321 3300053104 Ga0500556_0044275 Ga0500556_0044275_605_901 98
322 3300053104 Ga0500556_0083999 Ga0500556_0083999_16_312 98
323 3300053108 Ga0500562_003596 Ga0500562_003596_628_924 98
324 3300053108 Ga0500562_004084 Ga0500562_004084_1434_1730 98
325 3300053118 Ga0500594_0000153 Ga0500594_0000153_3810_4106 98
326 3300053122 Ga0500608_000165 Ga0500608_000165_844_1140 98
327 3300053122 Ga0500608_117892 Ga0500608_117892_164_460 98
328 3300053123 Ga0500614_054013 Ga0500614_054013_726_1022 98
329 3300053125 Ga0500618_000703 Ga0500618_000703_6019_6315 98
330 3300053130 Ga0500642_0239264 Ga0500642_0239264_479_775 98
331 3300053133 Ga0500655_015206 Ga0500655_015206_1083_1379 98
332 3300053134 Ga0500658_0001787 Ga0500658_0001787_2178_2474 98
333 3300053136 Ga0500559_0001398 Ga0500559_0001398_1792_2088 98
334 3300053136 Ga0500559_0016148 Ga0500559_0016148_1618_1914 98
335 3300053138 Ga0500564_000145 Ga0500564_000145_4130_4426 98
336 3300053139 Ga0500568_0044246 Ga0500568_0044246_1026_1322 98
337 3300053142 Ga0500577_0027599 Ga0500577_0027599_1453_1749 98
338 3300053147 Ga0500589_208111 Ga0500589_208111_320_616 98
339 3300053153 Ga0500616_0088560 Ga0500616_0088560_1175_1471 98
340 3300053153 Ga0500616_0163696 Ga0500616_0163696_627_923 98
341 3300053156 Ga0500622_0000771 Ga0500622_0000771_9641_9937 98
342 3300053156 Ga0500622_0003985 Ga0500622_0003985_8363_8659 98
343 3300053156 Ga0500622_0036800 Ga0500622_0036800_2080_2376 98
344 3300053156 Ga0500622_0314243 Ga0500622_0314243_199_495 98
345 3300053156 Ga0500622_0350024 Ga0500622_0350024_35_331 98
346 3300053158 Ga0500627_0046520 Ga0500627_0046520_1441_1737 98
347 3300053160 Ga0500633_0042334 Ga0500633_0042334_785_1081 98
348 3300053161 Ga0500634_0171596 Ga0500634_0171596_317_613 98
349 3300053724 Ga0500570_140607 Ga0500570_140607_337_633 98
350 3300053727 Ga0500611_011461 Ga0500611_011461_283_579 98
351 3300053730 Ga0500645_009863 Ga0500645_009863_2169_2465 98
352 3300053730 Ga0500645_030083 Ga0500645_030083_1083_1379 98
353 3300053730 Ga0500645_038787 Ga0500645_038787_43_339 98
354 3300053731 Ga0500609_000093 Ga0500609_000093_4420_4716 98
355 3300055283 Ga0500661_055671 Ga0500661_055671_289_585 98
356 3300059477 Ga0587084_049791 Ga0587084_049791_276_572 98
357 3300059478 Ga0587093_040621 Ga0587093_040621_361_657 98
358 3300059478 Ga0587093_060739 Ga0587093_060739_236_532 98
359 3300059490 Ga0587066_021865 Ga0587066_021865_300_596 98
360 3300059491 Ga0587070_023885 Ga0587070_023885_255_551 98
361 3300059493 Ga0587077_007264 Ga0587077_007264_689_985 98
362 3300059503 Ga0587080_135711 Ga0587080_135711_81_377 98
363 3300059506 Ga0587085_105957 Ga0587085_105957_206_502 98
364 3300059507 Ga0587086_014512 Ga0587086_014512_452_748 98
365 3300059507 Ga0587086_028377 Ga0587086_028377_328_624 98
366 3300059510 Ga0587090_007980 Ga0587090_007980_495_791 98
367 3300059511 Ga0587091_236636 Ga0587091_236636_98_394 98
368 3300059624 Ga0587109_197567 Ga0587109_197567_42_338 98
369 3300059627 Ga0587117_083346 Ga0587117_083346_89_385 98
370 3300059639 Ga0587062_006587 Ga0587062_006587_591_887 98
371 3300059641 Ga0587068_016860 Ga0587068_016860_569_865 98
372 3300059642 Ga0587069_041394 Ga0587069_041394_444_740 98
373 3300059646 Ga0587078_028975 Ga0587078_028975_223_519 98
374 3300059648 Ga0587100_008302 Ga0587100_008302_82_378 98
375 3300059649 Ga0587102_030071 Ga0587102_030071_321_617 98
376 3300059660 Ga0587124_009577 Ga0587124_009577_434_730 98
377 3300060344 Ga0587071_063564 Ga0587071_063564_14_310 98
378 3300060346 Ga0587111_0037802 Ga0587111_0037802_576_872 98
379 3300061719 Ga0466962_0003721 Ga0466962_0003721_547_843 98
380 iso_pu_bacteria 2511231221 2512032375 98
381 iso_pu_bacteria 2597490356 2599105609 98
382 iso_pu_bacteria 2846952575 2846954705 98
383 iso_pu_bacteria 2848858292 2848859028 98
384 iso_pu_bacteria 8054002106 8054005923 98
385 3300031456 Ga0307513_10010515 Ga0307513_100105155 99
386 3300031728 Ga0316578_10158531 Ga0316578_101585312 99
387 3300033527 Ga0316586_1081233 Ga0316586_10812332 99
388 3300037312 Ga0395899_0000105 Ga0395899_0000105_141949_142248 99
389 3300037466 Ga0395898_0320867 Ga0395898_0320867_317_616 99
390 3300039447 Ga0436361_0464948 Ga0436361_0464948_10_309 99
391 3300039447 Ga0436361_0491418 Ga0436361_0491418_370_669 99
392 3300039447 Ga0436361_0533438 Ga0436361_0533438_462_761 99
393 3300039447 Ga0436361_1159961 Ga0436361_1159961_232_531 99
394 3300044656 Ga0466969_0096092 Ga0466969_0096092_371_670 99
395 3300044684 Ga0466966_0116263 Ga0466966_0116263_1040_1339 99
396 3300044693 Ga0466961_0237441 Ga0466961_0237441_349_648 99
397 3300045049 Ga0466959_0093014 Ga0466959_0093014_1536_1835 99
398 3300045836 Ga0466958_0739905 Ga0466958_0739905_179_478 99
399 3300047320 Ga0495672_0079376 Ga0495672_0079376_1118_1417 99
400 3300048927 Ga0496124_0158136 Ga0496124_0158136_96_395 99
401 iso_pu_bacteria 2844533157 2844534359 99
402 3300027876 Ga0209974_10065831 Ga0209974_100658312 100
403 3300039437 Ga0436365_0637755 Ga0436365_0637755_407_709 100
404 3300046694 Ga0495649_0000981 Ga0495649_0000981_9485_9787 100
405 3300048925 Ga0496122_0258233 Ga0496122_0258233_421_723 100
406 3300049530 Ga0501314_000774 Ga0501314_000774_447_749 100
407 3300049581 Ga0501047_0026121 Ga0501047_0026121_4226_4528 100
408 3300053140 Ga0500573_0144994 Ga0500573_0144994_221_523 100
409 3300021441 Ga0213871_10012207 Ga0213871_100122073 101
410 3300039438 Ga0436360_0452772 Ga0436360_0452772_416_754 101
411 3300049571 Ga0501034_0553111 Ga0501034_0553111_532_837 101
412 3300049571 Ga0501034_0853449 Ga0501034_0853449_261_596 101
413 3300049571 Ga0501034_1568104 Ga0501034_1568104_53_370 101
414 3300049574 Ga0501038_0001299 Ga0501038_0001299_1913_2230 101
415 3300049579 Ga0501043_0201620 Ga0501043_0201620_712_1047 101
416 3300049822 Ga0501035_0281576 Ga0501035_0281576_65_400 101
417 3300002987 JGI25159J45721_1005639 JGI25159J45721_10056392 102
418 3300003158 Ga0006760J45825_104920 Ga0006760J45825_1049202 102
419 3300003187 JGI25151J46595_10000624 JGI25151J46595_1000062440 102
420 3300003322 rootL2_10069702 rootL2_100697022 102
421 3300003323 rootH1_10228499 rootH1_102284994 102
422 3300003354 JGI25160J50197_1004313 JGI25160J50197_10043135 102
423 3300003579 Ga0007429J51699_1025305 Ga0007429J51699_10253052 102
424 3300005289 Ga0065704_10007805 Ga0065704_100078052 102
425 3300005844 Ga0068862_102162301 Ga0068862_1021623012 102
426 3300005937 Ga0081455_10058498 Ga0081455_100584986 102
427 3300005983 Ga0081540_1017843 Ga0081540_10178436 102
428 3300006353 Ga0075370_10855728 Ga0075370_108557281 102
429 3300009986 Ga0105033_104982 Ga0105033_1049822 102
430 3300025284 Ga0209130_1000706 Ga0209130_100070639 102
431 3300025294 Ga0209025_1000750 Ga0209025_10007505 102
432 3300025302 Ga0207426_1000336 Ga0207426_100033693 102
433 3300025941 Ga0207711_11898226 Ga0207711_118982262 102
434 3300031824 Ga0307413_10177034 Ga0307413_101770342 102
435 3300032168 Ga0316593_10008633 Ga0316593_100086332 102
436 3300041413 Ga0439465_0225540 Ga0439465_0225540_280_606 102
437 3300041512 Ga0451853_3695048 Ga0451853_3695048_65_379 102
438 3300042004 Ga0439445_0092836 Ga0439445_0092836_485_811 102
439 3300042146 Ga0450907_028084 Ga0450907_028084_112_438 102
440 3300044842 Ga0466957_0642690 Ga0466957_0642690_173_499 102
441 3300047469 Ga0495673_0132665 Ga0495673_0132665_347_673 102
442 3300048925 Ga0496122_0077737 Ga0496122_0077737_51_368 102
443 3300049568 Ga0501031_0017521 Ga0501031_0017521_3583_3903 102
444 3300049570 Ga0501033_0401378 Ga0501033_0401378_83_403 102
445 3300049571 Ga0501034_0084731 Ga0501034_0084731_61_381 102
446 3300049571 Ga0501034_0169117 Ga0501034_0169117_1450_1770 102
447 3300049574 Ga0501038_0277617 Ga0501038_0277617_496_822 102
448 3300049575 Ga0501039_0241277 Ga0501039_0241277_431_751 102
449 3300049575 Ga0501039_1180565 Ga0501039_1180565_118_438 102
450 3300049579 Ga0501043_1193160 Ga0501043_1193160_26_334 102
451 3300049588 Ga0501072_1376532 Ga0501072_1376532_18_344 102
452 3300049823 Ga0501044_0622533 Ga0501044_0622533_254_571 102
453 3300050489 nmdc:mga03683_381207_c1 nmdc:mga03683_381207_c1_64_390 102
454 3300053139 Ga0500568_0080837 Ga0500568_0080837_752_1078 102
455 3300059477 Ga0587084_001790 Ga0587084_001790_1486_1803 102
456 3300059477 Ga0587084_041670 Ga0587084_041670_153_464 102
457 3300059493 Ga0587077_000161 Ga0587077_000161_2189_2506 102
458 3300059507 Ga0587086_014966 Ga0587086_014966_359_676 102
459 3300059510 Ga0587090_001474 Ga0587090_001474_1678_1995 102
460 3300059623 Ga0587101_001189 Ga0587101_001189_351_668 102
461 3300059624 Ga0587109_036454 Ga0587109_036454_359_676 102
462 3300059627 Ga0587117_072891 Ga0587117_072891_150_461 102
463 3300059641 Ga0587068_004838 Ga0587068_004838_331_648 102
464 3300059643 Ga0587072_096434 Ga0587072_096434_244_555 102
465 3300059644 Ga0587075_015780 Ga0587075_015780_581_898 102
466 3300059645 Ga0587076_000787 Ga0587076_000787_2184_2501 102
467 3300059646 Ga0587078_000144 Ga0587078_000144_2280_2597 102
468 3300059652 Ga0587107_084058 Ga0587107_084058_145_456 102
469 3300060346 Ga0587111_0000079 Ga0587111_0000079_5231_5548 102
470 3300060346 Ga0587111_0000967 Ga0587111_0000967_1144_1461 102
471 3300005466 Ga0070685_10005750 Ga0070685_100057509 103
472 3300005544 Ga0070686_101397684 Ga0070686_1013976841 103
473 3300009093 Ga0105240_10022560 Ga0105240_100225605 103
474 3300021361 Ga0213872_10039932 Ga0213872_100399322 103
475 3300025913 Ga0207695_10076710 Ga0207695_100767102 103
476 3300036401 Ga0373937_0125512 Ga0373937_0125512_1414_1725 103
477 3300037853 Ga0436364_0866406 Ga0436364_0866406_3068_3412 103
478 3300039145 Ga0237816_01805 Ga0237816_01805_1147_1467 103
479 3300039447 Ga0436361_0479485 Ga0436361_0479485_518_868 103
480 3300039453 Ga0436362_0010396 Ga0436362_0010396_309_623 103
481 3300039453 Ga0436362_1086879 Ga0436362_1086879_329_658 103
482 3300047320 Ga0495672_0140450 Ga0495672_0140450_330_644 103
483 3300047472 Ga0495686_0117797 Ga0495686_0117797_609_923 103
484 3300049571 Ga0501034_0114101 Ga0501034_0114101_450_773 103
485 3300002459 JGI24751J29686_10031233 JGI24751J29686_100312332 104
486 3300005331 Ga0070670_100461539 Ga0070670_1004615391 104
487 3300005334 Ga0068869_101085680 Ga0068869_1010856802 104
488 3300005335 Ga0070666_11144327 Ga0070666_111443272 104
489 3300005347 Ga0070668_100001882 Ga0070668_10000188213 104
490 3300005353 Ga0070669_100050591 Ga0070669_1000505914 104
491 3300005355 Ga0070671_100011171 Ga0070671_1000111716 104
492 3300005367 Ga0070667_100021170 Ga0070667_1000211708 104
493 3300005367 Ga0070667_100594634 Ga0070667_1005946342 104
494 3300005434 Ga0070709_10402063 Ga0070709_104020632 104
495 3300005435 Ga0070714_100285187 Ga0070714_1002851872 104
496 3300005436 Ga0070713_100107963 Ga0070713_1001079632 104
497 3300005437 Ga0070710_10136161 Ga0070710_101361612 104
498 3300005439 Ga0070711_100557170 Ga0070711_1005571702 104
499 3300005455 Ga0070663_101215590 Ga0070663_1012155902 104
500 3300005548 Ga0070665_100349684 Ga0070665_1003496842 104
501 3300005563 Ga0068855_100575861 Ga0068855_1005758612 104
502 3300005563 Ga0068855_101677522 Ga0068855_1016775222 104
503 3300005564 Ga0070664_101039164 Ga0070664_1010391642 104
504 3300005614 Ga0068856_100134295 Ga0068856_1001342955 104
505 3300005614 Ga0068856_100694970 Ga0068856_1006949702 104
506 3300005618 Ga0068864_100030863 Ga0068864_1000308633 104
507 3300005719 Ga0068861_102704965 Ga0068861_1027049651 104
508 3300005841 Ga0068863_100080807 Ga0068863_1000808073 104
509 3300005841 Ga0068863_100182679 Ga0068863_1001826792 104
510 3300005842 Ga0068858_100000261 Ga0068858_10000026135 104
511 3300005843 Ga0068860_100000042 Ga0068860_100000042187 104
512 3300005844 Ga0068862_100003686 Ga0068862_10000368613 104
513 3300006028 Ga0070717_10294886 Ga0070717_102948862 104
514 3300006173 Ga0070716_100158507 Ga0070716_1001585072 104
515 3300006175 Ga0070712_100227825 Ga0070712_1002278252 104
516 3300006846 Ga0075430_100652120 Ga0075430_1006521202 104
517 3300009093 Ga0105240_10058879 Ga0105240_100588794 104
518 3300009093 Ga0105240_10255649 Ga0105240_102556492 104
519 3300009093 Ga0105240_10413825 Ga0105240_104138252 104
520 3300009093 Ga0105240_12393746 Ga0105240_123937462 104
521 3300009174 Ga0105241_10326042 Ga0105241_103260422 104
522 3300009177 Ga0105248_10440021 Ga0105248_104400211 104
523 3300009545 Ga0105237_10224191 Ga0105237_102241913 104
524 3300009545 Ga0105237_10433354 Ga0105237_104333543 104
525 3300009551 Ga0105238_10196243 Ga0105238_101962432 104
526 3300009551 Ga0105238_10326749 Ga0105238_103267492 104
527 3300009551 Ga0105238_10724768 Ga0105238_107247682 104
528 3300010375 Ga0105239_10905051 Ga0105239_109050512 104
529 3300013306 Ga0163162_11460712 Ga0163162_114607122 104
530 3300014325 Ga0163163_10269543 Ga0163163_102695433 104
531 3300014325 Ga0163163_11528902 Ga0163163_115289022 104
532 3300014968 Ga0157379_10238620 Ga0157379_102386203 104
533 3300025898 Ga0207692_10089803 Ga0207692_100898032 104
534 3300025912 Ga0207707_11353605 Ga0207707_113536051 104
535 3300025913 Ga0207695_10049522 Ga0207695_100495225 104
536 3300025914 Ga0207671_10258019 Ga0207671_102580191 104
537 3300025914 Ga0207671_10790721 Ga0207671_107907212 104
538 3300025923 Ga0207681_10452633 Ga0207681_104526332 104
539 3300025924 Ga0207694_10027541 Ga0207694_100275417 104
540 3300025924 Ga0207694_10677710 Ga0207694_106777102 104
541 3300025924 Ga0207694_10748388 Ga0207694_107483882 104
542 3300025925 Ga0207650_11485020 Ga0207650_114850202 104
543 3300025928 Ga0207700_10111800 Ga0207700_101118003 104
544 3300025929 Ga0207664_10019250 Ga0207664_100192504 104
545 3300025931 Ga0207644_10018207 Ga0207644_100182076 104
546 3300025939 Ga0207665_10064425 Ga0207665_100644255 104
547 3300025949 Ga0207667_10014133 Ga0207667_1001413314 104
548 3300025949 Ga0207667_10434857 Ga0207667_104348573 104
549 3300025986 Ga0207658_10000002 Ga0207658_1000000222 104
550 3300026035 Ga0207703_10000253 Ga0207703_1000025339 104
551 3300026078 Ga0207702_11087444 Ga0207702_110874442 104
552 3300026088 Ga0207641_10001025 Ga0207641_1000102523 104
553 3300026088 Ga0207641_10101679 Ga0207641_101016795 104
554 3300026095 Ga0207676_10173154 Ga0207676_101731543 104
555 3300028379 Ga0268266_10005155 Ga0268266_1000515511 104
556 3300028379 Ga0268266_12119386 Ga0268266_121193862 104
557 3300028380 Ga0268265_10000582 Ga0268265_1000058226 104
558 3300028381 Ga0268264_10000001 Ga0268264_10000001347 104
559 3300028381 Ga0268264_11979525 Ga0268264_119795252 104
560 3300035089 Ga0373944_0256524 Ga0373944_0256524_274_591 104
561 3300035692 Ga0373935_0019032 Ga0373935_0019032_303_620 104
562 3300035725 Ga0373947_0044569 Ga0373947_0044569_1901_2218 104
563 3300037068 Ga0373925_0543580 Ga0373925_0543580_181_498 104
564 3300037312 Ga0395899_0128160 Ga0395899_0128160_418_771 104
565 3300037418 Ga0395900_0060003 Ga0395900_0060003_704_1057 104
566 3300038443 Ga0395901_0058183 Ga0395901_0058183_561_914 104
567 3300039438 Ga0436360_1093457 Ga0436360_1093457_54_407 104
568 3300045051 Ga0451576_0003979 Ga0451576_0003979_17458_17799 104
569 3300046457 Ga0495590_0253139 Ga0495590_0253139_296_613 104
570 3300046684 Ga0495669_0358366 Ga0495669_0358366_283_600 104
571 3300046794 Ga0495589_0454372 Ga0495589_0454372_117_434 104
572 3300048916 Ga0496113_0699668 Ga0496113_0699668_204_557 104
573 3300048917 Ga0496114_0000033 Ga0496114_0000033_1907_2224 104
574 3300049570 Ga0501033_0648912 Ga0501033_0648912_206_559 104
575 3300049571 Ga0501034_0050358 Ga0501034_0050358_1995_2309 104
576 3300049571 Ga0501034_0496951 Ga0501034_0496951_379_732 104
577 3300049573 Ga0501037_0008751 Ga0501037_0008751_236_550 104
578 3300049573 Ga0501037_0614373 Ga0501037_0614373_174_527 104
579 3300049584 Ga0501068_0922849 Ga0501068_0922849_169_489 104
580 3300049585 Ga0501069_0543334 Ga0501069_0543334_105_425 104
581 3300049822 Ga0501035_1518929 Ga0501035_1518929_53_367 104
582 3300049823 Ga0501044_0038551 Ga0501044_0038551_152_466 104
583 3300050509 nmdc:mga0qj67_738371_c1 nmdc:mga0qj67_738371_c1_246_581 104
584 3300053091 Ga0500647_0107844 Ga0500647_0107844_784_1134 104
585 3300053098 Ga0500650_0171820 Ga0500650_0171820_392_745 104
586 3300053119 Ga0500595_016759 Ga0500595_016759_628_981 104
587 3300053146 Ga0500588_0023345 Ga0500588_0023345_770_1123 104
588 3300053731 Ga0500609_014359 Ga0500609_014359_379_732 104
589 3300059478 Ga0587093_018561 Ga0587093_018561_294_647 104
590 3300059490 Ga0587066_086518 Ga0587066_086518_44_397 104
591 3300059492 Ga0587073_0095231 Ga0587073_0095231_285_638 104
592 3300059492 Ga0587073_0190089 Ga0587073_0190089_122_475 104
593 3300059505 Ga0587083_0138225 Ga0587083_0138225_269_622 104
594 3300059507 Ga0587086_016563 Ga0587086_016563_422_775 104
595 3300059508 Ga0587088_031808 Ga0587088_031808_293_646 104
596 3300059508 Ga0587088_063117 Ga0587088_063117_251_604 104
597 3300059509 Ga0587089_050042 Ga0587089_050042_39_392 104
598 3300059512 Ga0587092_032868 Ga0587092_032868_266_619 104
599 3300059513 Ga0587094_009396 Ga0587094_009396_303_656 104
600 3300059627 Ga0587117_012260 Ga0587117_012260_438_791 104
601 3300059639 Ga0587062_048719 Ga0587062_048719_71_424 104
602 3300059654 Ga0587110_003821 Ga0587110_003821_240_593 104
603 3300059660 Ga0587124_016159 Ga0587124_016159_284_637 104
604 3300060346 Ga0587111_0126633 Ga0587111_0126633_300_653 104
605 3300060346 Ga0587111_0135908 Ga0587111_0135908_70_423 104

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00276

Ribosomal_L23

Ribosomal protein L23

28

113

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7m4z-assembly1.cif.gz_S a. baumannii ribosome-eravacycline complex: hpf-bound 70s 0.9734 12 97
8cvm-assembly1.cif.gz_s cutibacterium acnes 50s ribosomal subunit with p-site trna and sarecycline bound in the local refined map 0.9653 13 100
6tnn-assembly1.cif.gz_m mini-rnase iii (mini-iii) bound to 50s ribosome with precursor 23s rrna 0.9511 13 100
7jil-assembly1.cif.gz_T 70s ribosome flavobacterium johnsoniae 0.9491 16 99
8cgd-assembly1.cif.gz_s clindamycin bound to the 50s subunit 0.949 12 93
ID Description Score Start End Superfamily
6hmaR00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.9455 13 99 3.30.70.330
af_P61845_1_86_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.9234 15 99 3.30.70.330
af_P54016_1_86_3.30.70.330 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.9133 13 96 3.30.70.330
4garT00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.909 10 98 3.30.70.330
6hmaR00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;RRM (RNA recognition motif) domain 0.9053 13 99 3.30.70.330
ID Description Score Start End GO Terms
AF-A0A529KDH5-F1-model_v4 50S ribosomal protein L23 0.9892 10 91 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A1F6BQ52-F1-model_v4 Large ribosomal subunit protein uL23 0.9879 15 101 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A554LQX1-F1-model_v4 Large ribosomal subunit protein uL23 0.9875 15 100 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A365Z1K3-F1-model_v4 Large ribosomal subunit protein uL23 0.9868 12 101 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A1G1NIZ4-F1-model_v4 Large ribosomal subunit protein uL23 0.9866 13 99 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Feature Viewer

pLDDT pTM Quality
88.41 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map