F467190

General Info

Members Datasets Scaffolds Average Seq Length
593 389 553 260

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100384078|Ga0070680_1003840781
Length 296
Sequence MKLARAAGTGFTGWRRNRWYANLAAANPREVRMRKIIMGALCAIAMVTSAKAAIKEEPVTYKDGETTLKGFVVYDDATQAKRPGIVMVHEWWGITPHIHNEARKFAQQGYVAFIADMYGDAKTADNPKDASALSSSVMKNPGVMESRFNAARTELAKQASVNPQRIGAVGYCFGGAVVLNMARAGADLAAVAGFHASLGLNTPAPAPGTVKAKVLILNGADDPFVKREQYDALKKDFXXXXADYRIIEYPGAVHAFTNPEATELGKKFNLPLRYDAKVDQEAKAEAAKFFAVDLQK

Samples

Sample ID Description Type Environment
1 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
2 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
3 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
4 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
5 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
6 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
7 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
8 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
9 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
10 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
11 2773857925 Microvirga vignae BR3299 Isolate Unclassified
12 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
13 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
14 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
15 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
16 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
17 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
18 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
19 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
20 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
21 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
22 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
23 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
24 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
25 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
26 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
27 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
28 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
29 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
30 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
31 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
32 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
33 3300003502 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM Metagenome Rhizosphere
34 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
35 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
36 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
37 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
38 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
39 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
40 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
41 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
42 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
43 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
44 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
45 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
46 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
47 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
48 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
49 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
50 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
51 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
52 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
53 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
54 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
55 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
56 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
57 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
58 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
59 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
60 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
61 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
62 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
63 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
64 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
65 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
66 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
67 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
68 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
69 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
70 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
71 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
72 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
73 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
74 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
75 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
76 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
77 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
78 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
79 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
80 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
81 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
82 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
83 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
84 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
85 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
86 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
87 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
88 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
89 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
90 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
91 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
92 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
93 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
94 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
95 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
96 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
97 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
98 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
99 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
100 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
102 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
103 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
104 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
105 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
106 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
108 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
109 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
110 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
111 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
112 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
113 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
114 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
115 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
116 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
117 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
118 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
119 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
120 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
121 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
122 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
123 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
124 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
125 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
126 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
127 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
128 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
129 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
133 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
134 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
135 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
138 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
140 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
182 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
183 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
185 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
186 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
201 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
203 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
204 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
205 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
206 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
207 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
208 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
209 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
210 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
211 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
212 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
213 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
214 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
215 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
216 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
217 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
218 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
219 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
220 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
221 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
222 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
223 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
224 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
225 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
226 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
227 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
228 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
229 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
230 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
231 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
232 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
233 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
234 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
235 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
236 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
237 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
238 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
239 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
240 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
241 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
242 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
243 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
244 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
245 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
246 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
247 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
248 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
249 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
250 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
251 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
252 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
253 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
254 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
255 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
256 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
257 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
258 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
259 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
260 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
261 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
262 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
263 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
264 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
265 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
266 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
267 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
268 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
269 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
270 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
271 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
272 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
273 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
274 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
275 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
276 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
277 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
278 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
279 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
280 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
281 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
282 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
283 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
284 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
285 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
286 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
287 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
288 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
289 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
290 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
291 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
292 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
293 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
294 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
295 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
296 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
297 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
298 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
299 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
300 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
301 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
302 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
303 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
304 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
305 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
306 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
307 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
308 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
309 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
310 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
311 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
312 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
313 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
314 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
315 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
316 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
317 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
318 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
319 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
320 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
321 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
322 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
323 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
324 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
325 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
326 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
327 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
328 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
329 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
330 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
331 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
332 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
333 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
334 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
335 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
337 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
339 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
340 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
341 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
342 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
343 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
346 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
347 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
348 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
349 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
350 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
351 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
352 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
353 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
354 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
355 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
356 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
357 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
358 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
359 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
360 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
361 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
362 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
363 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
364 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
365 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
366 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
367 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
368 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
369 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
370 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
371 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
372 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
373 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
374 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
375 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
376 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
377 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
378 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
379 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
380 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
381 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
382 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
383 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
384 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
385 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
386 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
387 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
388 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
389 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.88
Metatranscriptomes 0.85
Isolates 6.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.05
Nodule 5.73
Rhizoplane 5.56
Rhizosphere 79.93
Stem 0
Stem Tuber 0
Unclassified 4.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI26143J51219_1000353 3300003502 Bacteria 1818
2 Ga0065715_10201289 3300005293 Bacteria 1360
3 Ga0070658_10004166 3300005327 Bacteria 11839
4 Ga0070658_10165520 3300005327 Bacteria 1856
5 Ga0070683_100019712 3300005329 Bacteria 5993
6 Ga0070683_100044821 3300005329 Bacteria 4080
7 Ga0070690_100101977 3300005330 Bacteria 1904
8 Ga0070690_100239863 3300005330 Bacteria 1278
9 Ga0070670_100324373 3300005331 Bacteria 1350
10 Ga0068869_100080041 3300005334 Bacteria 2436
11 Ga0070680_100001078 3300005336 Bacteria 19598
12 Ga0070680_100161887 3300005336 Bacteria 1881
13 Ga0070680_100384078 3300005336 Bacteria 1196
14 Ga0070682_100000481 3300005337 Bacteria 25103
15 Ga0068868_100250741 3300005338 Bacteria 1490
16 Ga0070691_10011437 3300005341 Bacteria 4053
17 Ga0070691_10027417 3300005341 Bacteria 2658
18 Ga0070661_100109645 3300005344 Bacteria 2060
19 Ga0070661_100138647 3300005344 Bacteria 1832
20 Ga0070668_100354266 3300005347 Bacteria 1243
21 Ga0070674_100157084 3300005356 Bacteria 1722
22 Ga0070688_100258805 3300005365 Bacteria 1242
23 Ga0070659_100171080 3300005366 Bacteria 1779
24 Ga0070703_10038605 3300005406 Bacteria 1477
25 Ga0070709_10015164 3300005434 Bacteria 4378
26 Ga0070709_10403527 3300005434 Bacteria 1021
27 Ga0070714_100143918 3300005435 Bacteria 2142
28 Ga0070714_100372398 3300005435 Bacteria 1345
29 Ga0070711_100258933 3300005439 Bacteria 1368
30 Ga0070711_100685827 3300005439 Bacteria 861
31 Ga0070705_100037431 3300005440 Bacteria 2737
32 Ga0070705_100103853 3300005440 Bacteria 1801
33 Ga0070700_100228179 3300005441 Bacteria 1324
34 Ga0070694_100002954 3300005444 Bacteria 10102
35 Ga0070694_100045616 3300005444 Bacteria 2938
36 Ga0070694_100198549 3300005444 Bacteria 1494
37 Ga0070678_100038480 3300005456 Bacteria 3368
38 Ga0070678_100065266 3300005456 Bacteria 2702
39 Ga0070678_100570958 3300005456 Bacteria 1006
40 Ga0070662_100017449 3300005457 Bacteria 4841
41 Ga0070662_100076593 3300005457 Bacteria 2480
42 Ga0070681_10036488 3300005458 Bacteria 4936
43 Ga0070681_10076383 3300005458 Bacteria 3308
44 Ga0070681_10083047 3300005458 Bacteria 3157
45 Ga0070681_10132644 3300005458 Bacteria 2423
46 Ga0070681_10163471 3300005458 Bacteria 2149
47 Ga0070681_10195978 3300005458 Bacteria 1939
48 Ga0070706_100196437 3300005467 Bacteria 1885
49 Ga0070707_100131887 3300005468 Bacteria 2430
50 Ga0070699_100016637 3300005518 Bacteria 6314
51 Ga0070699_100037010 3300005518 Bacteria 4223
52 Ga0070679_100012870 3300005530 Bacteria 8008
53 Ga0070679_100043723 3300005530 Bacteria 4461
54 Ga0070679_100070045 3300005530 Bacteria 3498
55 Ga0070679_100412269 3300005530 Bacteria 1296
56 Ga0070684_100072813 3300005535 Bacteria 3026
57 Ga0070697_100026559 3300005536 Bacteria 4627
58 Ga0068853_100072609 3300005539 Bacteria 2999
59 Ga0070686_100388964 3300005544 Bacteria 1058
60 Ga0070695_100002088 3300005545 Bacteria 11428
61 Ga0070695_100003816 3300005545 Bacteria 8786
62 Ga0070695_100099035 3300005545 Bacteria 1960
63 Ga0070695_100199310 3300005545 Bacteria 1430
64 Ga0070696_100113243 3300005546 Bacteria 1956
65 Ga0070665_100249931 3300005548 Bacteria 1774
66 Ga0068855_100006227 3300005563 Bacteria 14540
67 Ga0068855_100668946 3300005563 Bacteria 1114
68 Ga0068855_100735727 3300005563 Bacteria 1053
69 Ga0068855_100815194 3300005563 Bacteria 991
70 Ga0070664_100019941 3300005564 Bacteria 5519
71 Ga0070664_100185293 3300005564 Bacteria 1852
72 Ga0070664_100229313 3300005564 Bacteria 1664
73 Ga0068857_100228895 3300005577 Bacteria 1700
74 Ga0068857_100560075 3300005577 Bacteria 1077
75 Ga0068854_100533575 3300005578 Bacteria 993
76 Ga0068856_100014174 3300005614 Bacteria 7706
77 Ga0068856_100170576 3300005614 Bacteria 2188
78 Ga0070702_100251171 3300005615 Bacteria 1199
79 Ga0068852_100046705 3300005616 Bacteria 3691
80 Ga0068859_100109634 3300005617 Bacteria 2822
81 Ga0068864_100163377 3300005618 Bacteria 2025
82 Ga0068861_100395334 3300005719 Bacteria 1225
83 Ga0068863_100168180 3300005841 Bacteria 2102
84 Ga0068858_100119853 3300005842 Bacteria 2460
85 Ga0081455_10031659 3300005937 Bacteria 4779
86 Ga0081455_10073009 3300005937 Bacteria 2838
87 Ga0081540_1099687 3300005983 Bacteria 1254
88 Ga0081539_10070587 3300005985 Bacteria 1874
89 Ga0075365_10102395 3300006038 Bacteria 1962
90 Ga0075365_10313225 3300006038 Bacteria 1105
91 Ga0075364_10203775 3300006051 Bacteria 1341
92 Ga0075432_10042468 3300006058 Bacteria 1591
93 Ga0070715_10017664 3300006163 Bacteria 2704
94 Ga0070712_100256862 3300006175 Bacteria 1399
95 Ga0075362_10025252 3300006177 Bacteria 2528
96 Ga0075367_10060824 3300006178 Bacteria 2253
97 Ga0075369_10036203 3300006186 Bacteria 2100
98 Ga0068871_100255653 3300006358 Bacteria 1527
99 Ga0075428_100127951 3300006844 Bacteria 2763
100 Ga0075431_100290547 3300006847 Bacteria 1654
101 Ga0075431_100505121 3300006847 Bacteria 1200
102 Ga0075433_10014494 3300006852 Bacteria 6442
103 Ga0075433_10176527 3300006852 Bacteria 1901
104 Ga0075434_100019670 3300006871 Bacteria 6534
105 Ga0075434_100302801 3300006871 Bacteria 1619
106 Ga0075434_100351460 3300006871 Bacteria 1495
107 Ga0075429_100300762 3300006880 Bacteria 1405
108 Ga0075436_100000048 3300006914 Bacteria 72013
109 Ga0075436_100003324 3300006914 Bacteria 11006
110 Ga0075436_100139885 3300006914 Bacteria 1701
111 Ga0075436_100170458 3300006914 Bacteria 1537
112 Ga0097620_100109629 3300006931 Bacteria 2822
113 Ga0099824_1004050 3300006942 Bacteria 21204
114 Ga0099822_1000838 3300006943 Bacteria 32461
115 Ga0099823_1023231 3300006944 Bacteria 5691
116 Ga0099794_10008323 3300007265 Bacteria 4302
117 Ga0105240_10004610 3300009093 Bacteria 20893
118 Ga0105240_10017345 3300009093 Bacteria 9708
119 Ga0105240_10022961 3300009093 Bacteria 8264
120 Ga0105240_10071117 3300009093 Bacteria 4303
121 Ga0105240_10193105 3300009093 Bacteria 2393
122 Ga0105240_10581534 3300009093 Bacteria 1235
123 Ga0111539_10007553 3300009094 Bacteria 13898
124 Ga0111539_10069454 3300009094 Bacteria 4160
125 Ga0111539_10316134 3300009094 Bacteria 1817
126 Ga0105245_10421373 3300009098 Bacteria 1338
127 Ga0105247_10017454 3300009101 Bacteria 4308
128 Ga0105247_10047179 3300009101 Bacteria 2645
129 Ga0105247_10319233 3300009101 Bacteria 1083
130 Ga0114129_10046650 3300009147 Bacteria 6089
131 Ga0114129_10527887 3300009147 Bacteria 1538
132 Ga0105243_10066158 3300009148 Bacteria 2906
133 Ga0105243_10197741 3300009148 Bacteria 1761
134 Ga0105241_10152017 3300009174 Bacteria 1894
135 Ga0105241_10175767 3300009174 Bacteria 1772
136 Ga0105248_10088532 3300009177 Bacteria 3484
137 Ga0105237_10024741 3300009545 Bacteria 6142
138 Ga0105237_10052651 3300009545 Bacteria 4085
139 Ga0105237_10207462 3300009545 Bacteria 1960
140 Ga0105237_10502104 3300009545 Bacteria 1219
141 Ga0105237_10523209 3300009545 Bacteria 1193
142 Ga0105237_10570553 3300009545 Bacteria 1138
143 Ga0105238_10210539 3300009551 Bacteria 1920
144 Ga0105238_10294261 3300009551 Bacteria 1606
145 Ga0105249_10822540 3300009553 Bacteria 993
146 Ga0105239_10310509 3300010375 Bacteria 1777
147 Ga0105239_10355205 3300010375 Bacteria 1655
148 Ga0105246_10053172 3300011119 Bacteria 2786
149 Ga0105246_10229006 3300011119 Bacteria 1462
150 Ga0105246_10438842 3300011119 Bacteria 1094
151 Ga0157373_10208552 3300013100 Bacteria 1378
152 Ga0157370_10037773 3300013104 Bacteria 4677
153 Ga0157370_10095545 3300013104 Bacteria 2788
154 Ga0157370_10215626 3300013104 Bacteria 1778
155 Ga0157369_10001066 3300013105 Bacteria 34424
156 Ga0157369_10008770 3300013105 Bacteria 11585
157 Ga0157369_10015054 3300013105 Bacteria 8730
158 Ga0157369_10766867 3300013105 Bacteria 992
159 Ga0157374_10011905 3300013296 Bacteria 7549
160 Ga0163162_10106064 3300013306 Bacteria 2905
161 Ga0163162_10264800 3300013306 Bacteria 1850
162 Ga0157372_10007867 3300013307 Bacteria 11330
163 Ga0157372_10064962 3300013307 Bacteria 4096
164 Ga0157372_10106574 3300013307 Bacteria 3206
165 Ga0157372_10127301 3300013307 Bacteria 2929
166 Ga0157372_10445358 3300013307 Bacteria 1509
167 Ga0157372_10583581 3300013307 Bacteria 1303
168 Ga0157375_10061140 3300013308 Bacteria 3739
169 Ga0163163_10004105 3300014325 Bacteria 12418
170 Ga0157380_10643843 3300014326 Bacteria 1056
171 Ga0157379_10250980 3300014968 Bacteria 1606
172 Ga0157376_10016629 3300014969 Bacteria 5591
173 Ga0157376_10033332 3300014969 Bacteria 4146
174 Ga0157376_10610532 3300014969 Bacteria 1087
175 Ga0197907_10840968 3300020069 Bacteria 2269
176 Ga0206354_10314709 3300020081 Bacteria 1132
177 Ga0206353_10361580 3300020082 Bacteria 2049
178 Ga0206353_10796463 3300020082 Bacteria 866
179 Ga0213872_10031020 3300021361 Bacteria 2450
180 Ga0213872_10057692 3300021361 Bacteria 1758
181 Ga0213874_10006912 3300021377 Bacteria 2703
182 Ga0213876_10011982 3300021384 Bacteria 4619
183 Ga0224712_10004141 3300022467 Bacteria 3877
184 Ga0209148_1007840 3300025254 Bacteria 2185
185 Ga0209148_1008086 3300025254 Bacteria 2135
186 Ga0209233_1002084 3300025261 Bacteria 7561
187 Ga0209233_1003813 3300025261 Bacteria 5254
188 Ga0209455_1008935 3300025272 Bacteria 2672
189 Ga0209455_1017412 3300025272 Bacteria 1507
190 Ga0207426_1011926 3300025302 Bacteria 3287
191 Ga0207697_10063829 3300025315 Bacteria 1535
192 Ga0207656_10077917 3300025321 Bacteria 1485
193 Ga0207653_10056141 3300025885 Bacteria 1320
194 Ga0207710_10016454 3300025900 Bacteria 3129
195 Ga0207710_10141853 3300025900 Bacteria 1160
196 Ga0207647_10232339 3300025904 Bacteria 1061
197 Ga0207699_10202351 3300025906 Bacteria 1346
198 Ga0207699_10283237 3300025906 Bacteria 1152
199 Ga0207705_10020951 3300025909 Bacteria 4664
200 Ga0207684_10167333 3300025910 Bacteria 1895
201 Ga0207684_10212329 3300025910 Bacteria 1669
202 Ga0207707_10006487 3300025912 Bacteria 10215
203 Ga0207707_10050125 3300025912 Bacteria 3638
204 Ga0207707_10083909 3300025912 Bacteria 2782
205 Ga0207695_10014945 3300025913 Bacteria 9161
206 Ga0207695_10045551 3300025913 Bacteria 4655
207 Ga0207695_10139798 3300025913 Bacteria 2371
208 Ga0207695_10144255 3300025913 Bacteria 2327
209 Ga0207695_10193589 3300025913 Bacteria 1950
210 Ga0207695_10215948 3300025913 Bacteria 1827
211 Ga0207695_10530410 3300025913 Bacteria 1059
212 Ga0207671_10073045 3300025914 Bacteria 2561
213 Ga0207671_10229534 3300025914 Bacteria 1456
214 Ga0207671_10474990 3300025914 Bacteria 996
215 Ga0207693_10118444 3300025915 Bacteria 2079
216 Ga0207663_10279147 3300025916 Bacteria 1240
217 Ga0207660_10004857 3300025917 Bacteria 8752
218 Ga0207657_10090112 3300025919 Bacteria 2560
219 Ga0207649_10415838 3300025920 Bacteria 1009
220 Ga0207652_10002046 3300025921 Bacteria 17348
221 Ga0207652_10226646 3300025921 Bacteria 1684
222 Ga0207652_10244131 3300025921 Bacteria 1619
223 Ga0207652_10245021 3300025921 Bacteria 1616
224 Ga0207646_10111425 3300025922 Bacteria 2456
225 Ga0207646_10452141 3300025922 Bacteria 1159
226 Ga0207694_10242777 3300025924 Bacteria 1472
227 Ga0207664_10096149 3300025929 Bacteria 2438
228 Ga0207664_10102465 3300025929 Bacteria 2367
229 Ga0207706_10014388 3300025933 Bacteria 7170
230 Ga0207706_10028860 3300025933 Bacteria 4953
231 Ga0207706_10105288 3300025933 Bacteria 2482
232 Ga0207709_10460217 3300025935 Bacteria 985
233 Ga0207669_10121483 3300025937 Bacteria 1774
234 Ga0207661_10004194 3300025944 Bacteria 10081
235 Ga0207661_10037431 3300025944 Bacteria 3794
236 Ga0207661_10044565 3300025944 Bacteria 3506
237 Ga0207661_10382061 3300025944 Bacteria 1275
238 Ga0207679_10124886 3300025945 Bacteria 2055
239 Ga0207667_10017399 3300025949 Bacteria 8090
240 Ga0207667_10708174 3300025949 Bacteria 1009
241 Ga0207651_10525831 3300025960 Bacteria 1026
242 Ga0207712_10182678 3300025961 Bacteria 1649
243 Ga0207668_10295080 3300025972 Bacteria 1335
244 Ga0207677_10251699 3300026023 Bacteria 1435
245 Ga0207703_10462181 3300026035 Bacteria 1187
246 Ga0207639_10079945 3300026041 Bacteria 2585
247 Ga0207639_10334420 3300026041 Bacteria 1349
248 Ga0207678_10045244 3300026067 Bacteria 3807
249 Ga0207708_10105451 3300026075 Bacteria 2185
250 Ga0207702_10027656 3300026078 Bacteria 4710
251 Ga0207702_10090941 3300026078 Bacteria 2671
252 Ga0207648_10487037 3300026089 Bacteria 1127
253 Ga0207676_10174920 3300026095 Bacteria 1874
254 Ga0207674_10022908 3300026116 Bacteria 6701
255 Ga0207675_100250651 3300026118 Bacteria 1713
256 Ga0207683_10036901 3300026121 Bacteria 4256
257 Ga0207683_10051441 3300026121 Bacteria 3609
258 Ga0207698_10018596 3300026142 Bacteria 4739
259 Ga0207698_10041118 3300026142 Bacteria 3441
260 Ga0207698_10380746 3300026142 Bacteria 1342
261 Ga0209389_1000009 3300027296 Bacteria 226873
262 Ga0209589_1000007 3300027357 Bacteria 425699
263 Ga0209969_1003934 3300027360 Bacteria 2069
264 Ga0209969_1009500 3300027360 Bacteria 1387
265 Ga0209969_1014151 3300027360 Bacteria 1160
266 Ga0209489_100008 3300027361 Bacteria 425699
267 Ga0209489_100050 3300027361 Bacteria 154669
268 Ga0209700_100009 3300027363 Bacteria 425699
269 Ga0209700_100016 3300027363 Bacteria 252567
270 Ga0209967_1002962 3300027364 Bacteria 2225
271 Ga0209967_1009637 3300027364 Bacteria 1341
272 Ga0209981_1007002 3300027378 Bacteria 1515
273 Ga0209996_1007316 3300027395 Bacteria 1436
274 Ga0210000_1000898 3300027462 Bacteria 4142
275 Ga0209968_1001999 3300027526 Bacteria 3101
276 Ga0209999_1003048 3300027543 Bacteria 2983
277 Ga0209982_1001411 3300027552 Bacteria 3279
278 Ga0210002_1004158 3300027617 Bacteria 2144
279 Ga0209983_1002175 3300027665 Bacteria 4317
280 Ga0209588_1059248 3300027671 Bacteria 1238
281 Ga0209971_1000022 3300027682 Bacteria 56932
282 Ga0209966_1000218 3300027695 Bacteria 22793
283 Ga0209966_1010184 3300027695 Bacteria 1691
284 Ga0209998_10000283 3300027717 Bacteria 15845
285 Ga0209998_10018368 3300027717 Bacteria 1485
286 Ga0209974_10000598 3300027876 Bacteria 12109
287 Ga0209974_10032184 3300027876 Bacteria 1738
288 Ga0207428_10002151 3300027907 Bacteria 19792
289 Ga0268264_10606097 3300028381 Bacteria 1080
290 Ga0268264_10765828 3300028381 Bacteria 963
291 Ga0265334_10002639 3300028573 Bacteria 8330
292 Ga0265332_10062677 3300031238 Bacteria 1589
293 Ga0265332_10091458 3300031238 Bacteria 1286
294 Ga0265340_10086176 3300031247 Bacteria 1473
295 Ga0265339_10003896 3300031249 Bacteria 10346
296 Ga0265327_10009058 3300031251 Bacteria 7273
297 Ga0265316_10067456 3300031344 Bacteria 2767
298 Ga0307509_10240038 3300031507 Bacteria 1606
299 Ga0265342_10083224 3300031712 Bacteria 1845
300 Ga0307405_10048949 3300031731 Bacteria 2610
301 Ga0307413_10185014 3300031824 Bacteria 1489
302 Ga0307410_10023944 3300031852 Bacteria 3807
303 Ga0307409_100156889 3300031995 Bacteria 1984
304 Ga0307409_100437748 3300031995 Bacteria 1259
305 Ga0307416_100019675 3300032002 Bacteria 4794
306 Ga0307416_100088314 3300032002 Bacteria 2650
307 Ga0307416_100099173 3300032002 Bacteria 2529
308 Ga0307414_10185483 3300032004 Bacteria 1678
309 Ga0307411_10022339 3300032005 Bacteria 3723
310 Ga0307510_10040464 3300033180 Bacteria 5117
311 Ga0307510_10115602 3300033180 Bacteria 2407
312 Ga0373930_0020324 3300034816 Bacteria 1293
313 Ga0373928_0063947 3300035084 Bacteria 896
314 Ga0373934_0009988 3300035086 Bacteria 3561
315 Ga0373932_0053562 3300035112 Bacteria 1205
316 Ga0373953_0000324 3300035117 Bacteria 12878
317 Ga0373953_0135959 3300035117 Bacteria 1050
318 Ga0373954_0000154 3300035118 Bacteria 24448
319 Ga0373956_0001735 3300035119 Bacteria 8973
320 Ga0373957_0021496 3300035120 Bacteria 2291
321 Ga0373943_0085321 3300035170 Bacteria 1626
322 Ga0373946_0066700 3300035171 Bacteria 1544
323 Ga0373955_0002922 3300035172 Bacteria 7501
324 Ga0373942_0004077 3300035207 Bacteria 3407
325 Ga0373931_0001468 3300035691 Bacteria 10152
326 Ga0373927_0012556 3300035695 Bacteria 5640
327 Ga0373927_0020670 3300035695 Bacteria 4317
328 Ga0373927_0154988 3300035695 Bacteria 1500
329 Ga0373933_0000619 3300035724 Bacteria 22192
330 Ga0373937_0001690 3300036401 Bacteria 18558
331 Ga0373937_0039413 3300036401 Bacteria 4306
332 Ga0373937_0297793 3300036401 Bacteria 1524
333 Ga0373925_0540765 3300037068 Bacteria 958
334 Ga0373925_0649873 3300037068 Bacteria 869
335 Ga0395899_0038114 3300037312 Bacteria 3601
336 Ga0395899_0258417 3300037312 Bacteria 1192
337 Ga0395900_0021470 3300037418 Bacteria 6601
338 Ga0395900_0066506 3300037418 Bacteria 3703
339 Ga0395900_0073274 3300037418 Bacteria 3521
340 Ga0395900_0370771 3300037418 Bacteria 1401
341 Ga0395898_0004174 3300037466 Bacteria 15829
342 Ga0395898_0755954 3300037466 Bacteria 913
343 Ga0395901_0001831 3300038443 Bacteria 21964
344 Ga0395901_0002599 3300038443 Bacteria 18294
345 Ga0395901_0032279 3300038443 Bacteria 5403
346 Ga0395901_0061217 3300038443 Bacteria 3917
347 Ga0242420_005503 3300038996 Bacteria 1967
348 Ga0436365_0866501 3300039437 Bacteria 1163
349 Ga0436365_1229160 3300039437 Bacteria 1350
350 Ga0436365_1239960 3300039437 Bacteria 8858
351 Ga0436360_0428535 3300039438 Bacteria 951
352 Ga0436361_0562961 3300039447 Bacteria 7241
353 Ga0436361_0761784 3300039447 Bacteria 2525
354 Ga0436361_1119451 3300039447 Bacteria 882
355 Ga0436363_1277791 3300039450 Bacteria 14539
356 Ga0436362_0587509 3300039453 Bacteria 1965
357 Ga0451807_0443856 3300041486 Bacteria 1072
358 Ga0451839_1236941 3300041496 Bacteria 952
359 Ga0439446_0000346 3300042156 Bacteria 8901
360 Ga0439435_0000284 3300042436 Bacteria 7512
361 Ga0439464_0001129 3300042439 Bacteria 6176
362 Ga0439460_0002903 3300042461 Bacteria 4131
363 Ga0451577_0045968 3300042876 Bacteria 3907
364 Ga0451577_0149817 3300042876 Bacteria 2099
365 Ga0453683_0055425 3300044673 Bacteria 2481
366 Ga0466961_0294288 3300044693 Bacteria 992
367 Ga0466963_0011506 3300044694 Bacteria 5389
368 Ga0466964_0109028 3300044706 Bacteria 1232
369 Ga0453684_0018602 3300044712 Bacteria 10651
370 Ga0453684_0169548 3300044712 Bacteria 2574
371 Ga0466970_0160623 3300044765 Bacteria 1243
372 Ga0466957_0306402 3300044842 Bacteria 1068
373 Ga0466960_0121244 3300044901 Bacteria 1370
374 Ga0451576_0103677 3300045051 Bacteria 2959
375 Ga0451576_0129683 3300045051 Bacteria 2628
376 Ga0451576_0181167 3300045051 Bacteria 2199
377 Ga0466967_0052770 3300045976 Bacteria 3571
378 Ga0466967_0055936 3300045976 Bacteria 3477
379 Ga0466967_0191504 3300045976 Bacteria 1933
380 Ga0466967_0228595 3300045976 Bacteria 1770
381 Ga0466967_0251418 3300045976 Bacteria 1689
382 Ga0466967_0377720 3300045976 Bacteria 1375
383 Ga0495592_0055023 3300046454 Bacteria 2945
384 Ga0495592_0167327 3300046454 Bacteria 1508
385 Ga0495592_0246741 3300046454 Bacteria 1182
386 Ga0495603_0086682 3300046455 Bacteria 1832
387 Ga0495629_0001324 3300046459 Bacteria 19480
388 Ga0495638_0205843 3300046460 Bacteria 1108
389 Ga0495651_0004057 3300046462 Bacteria 11189
390 Ga0495651_0070717 3300046462 Bacteria 2654
391 Ga0495653_0002693 3300046463 Bacteria 14155
392 Ga0495580_0269079 3300046472 Bacteria 1164
393 Ga0495605_0027863 3300046474 Bacteria 2922
394 Ga0495664_0041743 3300046477 Bacteria 2715
395 Ga0495585_0185131 3300046492 Bacteria 1068
396 Ga0495583_0112408 3300046506 Bacteria 1153
397 Ga0495606_0010252 3300046507 Bacteria 7806
398 Ga0495608_0042374 3300046511 Bacteria 3044
399 Ga0495618_0117915 3300046514 Bacteria 1700
400 Ga0495628_0022280 3300046516 Bacteria 5205
401 Ga0495631_0096254 3300046518 Bacteria 1274
402 Ga0495643_0075696 3300046522 Bacteria 1761
403 Ga0495648_0017345 3300046524 Bacteria 5150
404 Ga0495648_0106565 3300046524 Bacteria 1534
405 Ga0495663_0041937 3300046525 Bacteria 1393
406 Ga0495652_0000858 3300046529 Bacteria 35023
407 Ga0495640_0058304 3300046533 Bacteria 2633
408 Ga0495587_0036264 3300046536 Bacteria 2966
409 Ga0495609_0072328 3300046538 Bacteria 1514
410 Ga0495621_0015386 3300046539 Bacteria 2439
411 Ga0495645_0009577 3300046543 Bacteria 6776
412 Ga0495622_0097721 3300046557 Bacteria 1347
413 Ga0495633_0104160 3300046558 Bacteria 1316
414 Ga0495667_0028389 3300046559 Bacteria 3767
415 Ga0495656_0169321 3300046615 Bacteria 1067
416 Ga0495668_0079923 3300046616 Bacteria 1794
417 Ga0495611_0013680 3300046648 Bacteria 3458
418 Ga0495625_0057234 3300046660 Bacteria 2773
419 Ga0495635_0000644 3300046663 Bacteria 22418
420 Ga0495657_0065078 3300046675 Bacteria 2398
421 Ga0495599_0005428 3300046678 Bacteria 7618
422 Ga0495599_0206741 3300046678 Bacteria 1205
423 Ga0495623_0004234 3300046679 Bacteria 9451
424 Ga0495646_0035505 3300046680 Bacteria 3092
425 Ga0495658_0333857 3300046683 Bacteria 962
426 Ga0495613_0135238 3300046689 Bacteria 1764
427 Ga0495670_0118467 3300046691 Bacteria 1374
428 Ga0495671_0103941 3300046692 Bacteria 1387
429 Ga0495649_0018372 3300046694 Bacteria 3934
430 Ga0495581_0035186 3300047315 Bacteria 2898
431 Ga0495604_0010041 3300047317 Bacteria 7495
432 Ga0495636_0075640 3300047318 Bacteria 1443
433 Ga0495674_0055850 3300047319 Bacteria 3461
434 Ga0495674_0357337 3300047319 Bacteria 1185
435 Ga0495680_0002127 3300047322 Bacteria 20560
436 Ga0495683_0027380 3300047323 Bacteria 2914
437 Ga0495683_0067908 3300047323 Bacteria 1755
438 Ga0495675_0001422 3300047444 Bacteria 14504
439 Ga0495684_0000380 3300047471 Bacteria 36351
440 Ga0495686_0207877 3300047472 Bacteria 1120
441 Ga0495593_0015720 3300047673 Bacteria 4280
442 Ga0495602_0040522 3300048088 Bacteria 4268
443 Ga0496100_0051575 3300048903 Bacteria 2671
444 Ga0496101_0006832 3300048904 Bacteria 7365
445 Ga0496101_0051620 3300048904 Bacteria 2963
446 Ga0496102_0011957 3300048905 Bacteria 7496
447 Ga0496102_0019548 3300048905 Bacteria 5967
448 Ga0496102_0426746 3300048905 Bacteria 1245
449 Ga0496103_0091813 3300048906 Bacteria 1916
450 Ga0496104_0025964 3300048907 Bacteria 5402
451 Ga0496104_0076484 3300048907 Bacteria 3188
452 Ga0496105_0024512 3300048908 Bacteria 4902
453 Ga0496105_0069094 3300048908 Bacteria 2919
454 Ga0496106_0033602 3300048909 Bacteria 3827
455 Ga0496106_0206478 3300048909 Bacteria 1564
456 Ga0496107_0005017 3300048910 Bacteria 9018
457 Ga0496107_0174945 3300048910 Bacteria 1593
458 Ga0496108_0438783 3300048911 Bacteria 1140
459 Ga0496109_0064889 3300048912 Bacteria 3342
460 Ga0496109_0196747 3300048912 Bacteria 1895
461 Ga0496109_0599653 3300048912 Bacteria 1037
462 Ga0496110_0007162 3300048913 Bacteria 8880
463 Ga0496110_0125669 3300048913 Bacteria 2314
464 Ga0496111_0043747 3300048914 Bacteria 3219
465 Ga0496112_0000561 3300048915 Bacteria 25482
466 Ga0496112_0007927 3300048915 Bacteria 9464
467 Ga0496112_0019836 3300048915 Bacteria 6360
468 Ga0496113_0020841 3300048916 Bacteria 4616
469 Ga0496113_0223043 3300048916 Bacteria 1502
470 Ga0496113_0298091 3300048916 Bacteria 1291
471 Ga0496114_0012803 3300048917 Bacteria 6716
472 Ga0496115_0001600 3300048918 Bacteria 16275
473 Ga0496115_0359017 3300048918 Bacteria 1187
474 Ga0496121_0347467 3300048924 Bacteria 989
475 Ga0496126_0110581 3300048929 Bacteria 2393
476 Ga0496126_0248460 3300048929 Bacteria 1483
477 Ga0496126_0403380 3300048929 Bacteria 1108
478 Ga0495682_0010920 3300049460 Bacteria 3500
479 Ga0501032_0022974 3300049569 Bacteria 4318
480 Ga0501034_0000266 3300049571 Bacteria 94491
481 Ga0501034_0002518 3300049571 Bacteria 21975
482 Ga0501034_0178922 3300049571 Bacteria 2086
483 Ga0501037_0001462 3300049573 Bacteria 17325
484 Ga0501038_0007952 3300049574 Bacteria 9769
485 Ga0501039_0004154 3300049575 Bacteria 10898
486 Ga0501039_0092106 3300049575 Bacteria 2362
487 Ga0501040_0004355 3300049576 Bacteria 9204
488 Ga0501041_0127381 3300049577 Bacteria 1585
489 Ga0501042_0007623 3300049578 Bacteria 7102
490 Ga0501042_0139771 3300049578 Bacteria 1746
491 Ga0501043_0015876 3300049579 Bacteria 5903
492 Ga0501046_0000274 3300049580 Bacteria 52364
493 Ga0501046_0057394 3300049580 Bacteria 3054
494 Ga0501046_0143868 3300049580 Bacteria 1802
495 Ga0501047_0017300 3300049581 Bacteria 6904
496 Ga0501047_0124986 3300049581 Bacteria 2453
497 Ga0501048_0057841 3300049582 Bacteria 2749
498 Ga0501067_0007660 3300049583 Bacteria 6002
499 Ga0501067_0233689 3300049583 Bacteria 1023
500 Ga0501068_0035217 3300049584 Bacteria 2987
501 Ga0501069_0218747 3300049585 Bacteria 1106
502 Ga0501070_0017283 3300049586 Bacteria 6057
503 Ga0501071_0311941 3300049587 Bacteria 1193
504 Ga0501074_0012078 3300049590 Bacteria 6276
505 Ga0501074_0124193 3300049590 Bacteria 1846
506 Ga0501075_0020905 3300049591 Bacteria 4767
507 Ga0501076_0438312 3300049592 Bacteria 1075
508 Ga0501077_0064626 3300049593 Bacteria 2321
509 Ga0501079_0001294 3300049741 Bacteria 17601
510 Ga0501080_0055113 3300049742 Bacteria 3703
511 Ga0501081_0009318 3300049743 Bacteria 6397
512 Ga0501083_0078583 3300049744 Bacteria 2188
513 Ga0501035_0024945 3300049822 Bacteria 5482
514 Ga0501035_0256049 3300049822 Bacteria 1485
515 Ga0501035_0344413 3300049822 Bacteria 1248
516 Ga0501044_0146979 3300049823 Bacteria 2342
517 Ga0501045_0010223 3300049824 Bacteria 6569
518 nmdc:mga03683_9964_c1 3300050489 Bacteria 2599
519 nmdc:mga00v17_211640_c1 3300050491 Bacteria 1254
520 nmdc:mga00v17_414064_c1 3300050491 Bacteria 875
521 nmdc:mga0yw44_345068_c1 3300050492 Bacteria 1002
522 nmdc:mga0yw44_985_c1 3300050492 Bacteria 10866
523 nmdc:mga06z11_20737_c1 3300050494 Bacteria 3042
524 nmdc:mga07m45_95589_c1 3300050496 Bacteria 1704
525 nmdc:mga05p37_287775_c1 3300050507 Bacteria 1957
526 nmdc:mga05p37_55915_c1 3300050507 Bacteria 4858
527 nmdc:mga09592_160324_c1 3300050508 Bacteria 1943
528 nmdc:mga06r32_186871_c1 3300050510 Bacteria 2059
529 nmdc:mga08y16_17600_c1 3300050511 Bacteria 7526
530 nmdc:mga08y16_25146_c1 3300050511 Bacteria 6280
531 nmdc:mga0n895_1415_c1 3300050512 Bacteria 17921
532 nmdc:mga0n895_326612_c1 3300050512 Bacteria 1554
533 nmdc:mga0n895_339750_c1 3300050512 Bacteria 1521
534 nmdc:mga08x19_10505_c1 3300050514 Bacteria 5560
535 nmdc:mga08x19_12681_c1 3300050514 Bacteria 5081
536 nmdc:mga08x19_177929_c1 3300050514 Bacteria 1451
537 nmdc:mga08x19_348_c1 3300050514 Bacteria 33504
538 nmdc:mga0a205_773_c1 3300050515 Bacteria 25870
539 nmdc:mga0a205_8519_c1 3300050515 Bacteria 9325
540 nmdc:mga0sz30_16264_c1 3300050516 Bacteria 2951
541 Ga0495601_0038444 3300053077 Bacteria 2994
542 Ga0495601_0132443 3300053077 Bacteria 1624
543 Ga0495655_0003589 3300053083 Bacteria 2573
544 Ga0495619_0054634 3300053085 Bacteria 2643
545 Ga0500578_0052031 3300053086 Bacteria 2623
546 Ga0500557_038035 3300053105 Bacteria 1496
547 Ga0500595_016429 3300053119 Bacteria 2757
548 Ga0501084_0001144 3300054114 Bacteria 20689
549 Ga0501084_0412203 3300054114 Bacteria 1142
550 Ga0501082_0000973 3300060353 Bacteria 25299
551 Ga0501082_0611262 3300060353 Bacteria 954
552 Ga0466962_0036951 3300061719 Bacteria 2338
553 Ga0530510_0114640 3300061734 Bacteria 1975

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300054114 Ga0501084_0412203 Ga0501084_0412203_75_815 230
2 3300011119 Ga0105246_10053172 Ga0105246_100531724 236
3 iso_pu_bacteria 2904699407 2904705656 239
4 3300044706 Ga0466964_0109028 Ga0466964_0109028_453_1208 240
5 3300005330 Ga0070690_100239863 Ga0070690_1002398631 241
6 3300009545 Ga0105237_10570553 Ga0105237_105705531 241
7 3300035112 Ga0373932_0053562 Ga0373932_0053562_49_816 243
8 3300037068 Ga0373925_0649873 Ga0373925_0649873_23_754 243
9 3300009098 Ga0105245_10421373 Ga0105245_104213731 244
10 3300009148 Ga0105243_10066158 Ga0105243_100661581 244
11 3300009545 Ga0105237_10502104 Ga0105237_105021041 244
12 3300009551 Ga0105238_10294261 Ga0105238_102942612 244
13 3300010375 Ga0105239_10355205 Ga0105239_103552051 244
14 3300013296 Ga0157374_10011905 Ga0157374_100119058 244
15 3300014325 Ga0163163_10004105 Ga0163163_1000410510 244
16 3300014969 Ga0157376_10016629 Ga0157376_100166296 244
17 3300014969 Ga0157376_10610532 Ga0157376_106105321 244
18 3300044901 Ga0466960_0121244 Ga0466960_0121244_44_820 244
19 3300046474 Ga0495605_0027863 Ga0495605_0027863_1766_2521 244
20 3300046507 Ga0495606_0010252 Ga0495606_0010252_5411_6166 244
21 3300046522 Ga0495643_0075696 Ga0495643_0075696_475_1230 244
22 3300046524 Ga0495648_0017345 Ga0495648_0017345_1543_2298 244
23 3300046538 Ga0495609_0072328 Ga0495609_0072328_555_1310 244
24 3300046660 Ga0495625_0057234 Ga0495625_0057234_73_828 244
25 3300046694 Ga0495649_0018372 Ga0495649_0018372_1885_2640 244
26 3300047323 Ga0495683_0027380 Ga0495683_0027380_1734_2489 244
27 3300048903 Ga0496100_0051575 Ga0496100_0051575_1819_2574 244
28 3300048904 Ga0496101_0006832 Ga0496101_0006832_134_889 244
29 3300048905 Ga0496102_0011957 Ga0496102_0011957_6603_7358 244
30 3300048905 Ga0496102_0426746 Ga0496102_0426746_465_1220 244
31 3300048907 Ga0496104_0076484 Ga0496104_0076484_161_916 244
32 3300048908 Ga0496105_0069094 Ga0496105_0069094_184_939 244
33 3300048910 Ga0496107_0005017 Ga0496107_0005017_132_887 244
34 3300048911 Ga0496108_0438783 Ga0496108_0438783_231_986 244
35 3300048912 Ga0496109_0599653 Ga0496109_0599653_121_876 244
36 3300048913 Ga0496110_0125669 Ga0496110_0125669_1418_2173 244
37 3300048915 Ga0496112_0007927 Ga0496112_0007927_7508_8263 244
38 3300048916 Ga0496113_0223043 Ga0496113_0223043_620_1375 244
39 3300048916 Ga0496113_0298091 Ga0496113_0298091_107_862 244
40 3300048918 Ga0496115_0001600 Ga0496115_0001600_138_893 244
41 3300048924 Ga0496121_0347467 Ga0496121_0347467_81_836 244
42 3300048929 Ga0496126_0248460 Ga0496126_0248460_556_1311 244
43 3300049460 Ga0495682_0010920 Ga0495682_0010920_533_1288 244
44 3300050491 nmdc:mga00v17_414064_c1 nmdc:mga00v17_414064_c1_57_812 244
45 3300050492 nmdc:mga0yw44_345068_c1 nmdc:mga0yw44_345068_c1_83_838 244
46 3300053083 Ga0495655_0003589 Ga0495655_0003589_632_1387 244
47 3300053086 Ga0500578_0052031 Ga0500578_0052031_709_1464 244
48 3300005444 Ga0070694_100045616 Ga0070694_1000456163 245
49 3300044693 Ga0466961_0294288 Ga0466961_0294288_201_956 246
50 3300013307 Ga0157372_10583581 Ga0157372_105835812 247
51 3300005440 Ga0070705_100037431 Ga0070705_1000374313 249
52 3300005564 Ga0070664_100185293 Ga0070664_1001852933 249
53 3300006914 Ga0075436_100003324 Ga0075436_1000033243 249
54 3300009101 Ga0105247_10017454 Ga0105247_100174542 249
55 3300009545 Ga0105237_10523209 Ga0105237_105232091 249
56 3300025900 Ga0207710_10016454 Ga0207710_100164542 249
57 3300025910 Ga0207684_10212329 Ga0207684_102123292 249
58 3300025945 Ga0207679_10124886 Ga0207679_101248863 249
59 3300035171 Ga0373946_0066700 Ga0373946_0066700_37_819 249
60 3300035695 Ga0373927_0012556 Ga0373927_0012556_683_1465 249
61 3300046477 Ga0495664_0041743 Ga0495664_0041743_929_1711 249
62 3300046514 Ga0495618_0117915 Ga0495618_0117915_70_852 249
63 3300047315 Ga0495581_0035186 Ga0495581_0035186_1266_2048 249
64 3300047319 Ga0495674_0055850 Ga0495674_0055850_827_1609 249
65 3300049571 Ga0501034_0178922 Ga0501034_0178922_950_1732 249
66 3300050489 nmdc:mga03683_9964_c1 nmdc:mga03683_9964_c1_769_1551 249
67 3300050492 nmdc:mga0yw44_985_c1 nmdc:mga0yw44_985_c1_6209_6991 249
68 3300050494 nmdc:mga06z11_20737_c1 nmdc:mga06z11_20737_c1_1627_2409 249
69 3300050496 nmdc:mga07m45_95589_c1 nmdc:mga07m45_95589_c1_390_1172 249
70 3300050516 nmdc:mga0sz30_16264_c1 nmdc:mga0sz30_16264_c1_981_1763 249
71 3300005406 Ga0070703_10038605 Ga0070703_100386052 250
72 3300005444 Ga0070694_100198549 Ga0070694_1001985492 250
73 3300005467 Ga0070706_100196437 Ga0070706_1001964372 250
74 3300005536 Ga0070697_100026559 Ga0070697_1000265592 250
75 3300005545 Ga0070695_100003816 Ga0070695_1000038162 250
76 3300025885 Ga0207653_10056141 Ga0207653_100561412 250
77 3300025922 Ga0207646_10452141 Ga0207646_104521411 250
78 3300005293 Ga0065715_10201289 Ga0065715_102012892 251
79 3300005434 Ga0070709_10403527 Ga0070709_104035271 251
80 3300005439 Ga0070711_100685827 Ga0070711_1006858271 251
81 3300009093 Ga0105240_10004610 Ga0105240_1000461017 251
82 3300009093 Ga0105240_10581534 Ga0105240_105815342 251
83 3300009101 Ga0105247_10047179 Ga0105247_100471793 251
84 3300009101 Ga0105247_10319233 Ga0105247_103192331 251
85 3300009148 Ga0105243_10197741 Ga0105243_101977413 251
86 3300009177 Ga0105248_10088532 Ga0105248_100885323 251
87 3300009545 Ga0105237_10024741 Ga0105237_100247414 251
88 3300009551 Ga0105238_10210539 Ga0105238_102105392 251
89 3300009553 Ga0105249_10822540 Ga0105249_108225402 251
90 3300010375 Ga0105239_10310509 Ga0105239_103105091 251
91 3300011119 Ga0105246_10229006 Ga0105246_102290062 251
92 3300013104 Ga0157370_10215626 Ga0157370_102156261 251
93 3300013105 Ga0157369_10001066 Ga0157369_1000106623 251
94 3300013306 Ga0163162_10106064 Ga0163162_101060642 251
95 3300013306 Ga0163162_10264800 Ga0163162_102648003 251
96 3300013307 Ga0157372_10007867 Ga0157372_1000786711 251
97 3300013308 Ga0157375_10061140 Ga0157375_100611405 251
98 3300014968 Ga0157379_10250980 Ga0157379_102509802 251
99 3300025944 Ga0207661_10382061 Ga0207661_103820612 251
100 3300034816 Ga0373930_0020324 Ga0373930_0020324_468_1223 251
101 3300035084 Ga0373928_0063947 Ga0373928_0063947_88_843 251
102 3300035691 Ga0373931_0001468 Ga0373931_0001468_5290_6045 251
103 3300035695 Ga0373927_0020670 Ga0373927_0020670_536_1291 251
104 3300037312 Ga0395899_0258417 Ga0395899_0258417_210_965 251
105 3300037418 Ga0395900_0021470 Ga0395900_0021470_1190_1945 251
106 3300037418 Ga0395900_0370771 Ga0395900_0370771_604_1359 251
107 3300037466 Ga0395898_0004174 Ga0395898_0004174_11789_12544 251
108 3300037466 Ga0395898_0755954 Ga0395898_0755954_134_889 251
109 3300038443 Ga0395901_0001831 Ga0395901_0001831_21188_21943 251
110 3300038443 Ga0395901_0032279 Ga0395901_0032279_515_1270 251
111 3300039437 Ga0436365_1229160 Ga0436365_1229160_304_1059 251
112 3300039438 Ga0436360_0428535 Ga0436360_0428535_134_889 251
113 3300039447 Ga0436361_0562961 Ga0436361_0562961_6264_7019 251
114 3300039447 Ga0436361_0761784 Ga0436361_0761784_1459_2214 251
115 3300045976 Ga0466967_0055936 Ga0466967_0055936_1846_2601 251
116 3300045976 Ga0466967_0191504 Ga0466967_0191504_373_1128 251
117 3300046455 Ga0495603_0086682 Ga0495603_0086682_940_1695 251
118 3300046460 Ga0495638_0205843 Ga0495638_0205843_216_971 251
119 3300046492 Ga0495585_0185131 Ga0495585_0185131_47_802 251
120 3300046506 Ga0495583_0112408 Ga0495583_0112408_324_1079 251
121 3300046518 Ga0495631_0096254 Ga0495631_0096254_458_1213 251
122 3300046524 Ga0495648_0106565 Ga0495648_0106565_105_860 251
123 3300046539 Ga0495621_0015386 Ga0495621_0015386_1476_2231 251
124 3300046543 Ga0495645_0009577 Ga0495645_0009577_1762_2517 251
125 3300046557 Ga0495622_0097721 Ga0495622_0097721_221_976 251
126 3300046558 Ga0495633_0104160 Ga0495633_0104160_293_1048 251
127 3300046615 Ga0495656_0169321 Ga0495656_0169321_60_815 251
128 3300046616 Ga0495668_0079923 Ga0495668_0079923_223_978 251
129 3300046648 Ga0495611_0013680 Ga0495611_0013680_1246_2001 251
130 3300046691 Ga0495670_0118467 Ga0495670_0118467_449_1204 251
131 3300046692 Ga0495671_0103941 Ga0495671_0103941_459_1214 251
132 3300047318 Ga0495636_0075640 Ga0495636_0075640_378_1133 251
133 3300047319 Ga0495674_0357337 Ga0495674_0357337_279_1034 251
134 3300047323 Ga0495683_0067908 Ga0495683_0067908_172_927 251
135 3300048904 Ga0496101_0051620 Ga0496101_0051620_2167_2922 251
136 3300048905 Ga0496102_0019548 Ga0496102_0019548_3172_3927 251
137 3300048906 Ga0496103_0091813 Ga0496103_0091813_965_1720 251
138 3300048907 Ga0496104_0025964 Ga0496104_0025964_1193_1948 251
139 3300048908 Ga0496105_0024512 Ga0496105_0024512_684_1439 251
140 3300048909 Ga0496106_0033602 Ga0496106_0033602_983_1738 251
141 3300048910 Ga0496107_0174945 Ga0496107_0174945_171_926 251
142 3300048912 Ga0496109_0064889 Ga0496109_0064889_1004_1759 251
143 3300048913 Ga0496110_0007162 Ga0496110_0007162_4519_5274 251
144 3300048914 Ga0496111_0043747 Ga0496111_0043747_1801_2556 251
145 3300048915 Ga0496112_0019836 Ga0496112_0019836_1084_1839 251
146 3300048916 Ga0496113_0020841 Ga0496113_0020841_2163_2918 251
147 3300048917 Ga0496114_0012803 Ga0496114_0012803_3020_3775 251
148 3300048918 Ga0496115_0359017 Ga0496115_0359017_117_872 251
149 3300048929 Ga0496126_0110581 Ga0496126_0110581_899_1654 251
150 3300049581 Ga0501047_0017300 Ga0501047_0017300_23_778 251
151 3300049590 Ga0501074_0124193 Ga0501074_0124193_419_1174 251
152 3300049742 Ga0501080_0055113 Ga0501080_0055113_1951_2706 251
153 3300049822 Ga0501035_0344413 Ga0501035_0344413_438_1193 251
154 3300053077 Ga0495601_0132443 Ga0495601_0132443_481_1236 251
155 3300006944 Ga0099823_1023231 Ga0099823_10232313 252
156 3300027296 Ga0209389_1000009 Ga0209389_100000937 252
157 3300027361 Ga0209489_100050 Ga0209489_10005089 252
158 3300027363 Ga0209700_100016 Ga0209700_100016197 252
159 3300006038 Ga0075365_10102395 Ga0075365_101023952 253
160 3300006177 Ga0075362_10025252 Ga0075362_100252522 253
161 3300006178 Ga0075367_10060824 Ga0075367_100608242 253
162 3300006186 Ga0075369_10036203 Ga0075369_100362032 253
163 3300020069 Ga0197907_10840968 Ga0197907_108409683 253
164 3300031238 Ga0265332_10062677 Ga0265332_100626772 253
165 3300044694 Ga0466963_0011506 Ga0466963_0011506_660_1454 253
166 3300044842 Ga0466957_0306402 Ga0466957_0306402_134_928 253
167 3300048909 Ga0496106_0206478 Ga0496106_0206478_13_960 253
168 3300021384 Ga0213876_10011982 Ga0213876_100119824 254
169 3300039437 Ga0436365_1239960 Ga0436365_1239960_5233_6027 254
170 3300044765 Ga0466970_0160623 Ga0466970_0160623_224_1003 254
171 3300061719 Ga0466962_0036951 Ga0466962_0036951_1292_2071 254
172 3300009174 Ga0105241_10152017 Ga0105241_101520171 256
173 3300028381 Ga0268264_10606097 Ga0268264_106060971 256
174 3300048912 Ga0496109_0196747 Ga0496109_0196747_405_1175 256
175 3300048915 Ga0496112_0000561 Ga0496112_0000561_23587_24357 256
176 3300005329 Ga0070683_100044821 Ga0070683_1000448211 257
177 3300005456 Ga0070678_100570958 Ga0070678_1005709581 257
178 3300006038 Ga0075365_10313225 Ga0075365_103132252 257
179 3300006051 Ga0075364_10203775 Ga0075364_102037752 257
180 3300025321 Ga0207656_10077917 Ga0207656_100779172 257
181 3300025910 Ga0207684_10167333 Ga0207684_101673332 257
182 3300025914 Ga0207671_10474990 Ga0207671_104749901 257
183 3300025935 Ga0207709_10460217 Ga0207709_104602171 257
184 3300025944 Ga0207661_10044565 Ga0207661_100445652 257
185 3300026067 Ga0207678_10045244 Ga0207678_100452443 257
186 3300026095 Ga0207676_10174920 Ga0207676_101749202 257
187 3300026142 Ga0207698_10018596 Ga0207698_100185964 257
188 3300028381 Ga0268264_10765828 Ga0268264_107658281 257
189 3300046454 Ga0495592_0246741 Ga0495592_0246741_256_1164 257
190 3300047472 Ga0495686_0207877 Ga0495686_0207877_50_958 257
191 3300048929 Ga0496126_0403380 Ga0496126_0403380_178_1086 257
192 3300050491 nmdc:mga00v17_211640_c1 nmdc:mga00v17_211640_c1_49_843 257
193 3300053119 Ga0500595_016429 Ga0500595_016429_1563_2471 257
194 3300041496 Ga0451839_1236941 Ga0451839_1236941_55_831 258
195 3300050514 nmdc:mga08x19_10505_c1 nmdc:mga08x19_10505_c1_4473_5249 258
196 3300027671 Ga0209588_1059248 Ga0209588_10592481 259
197 3300028573 Ga0265334_10002639 Ga0265334_100026397 259
198 3300031247 Ga0265340_10086176 Ga0265340_100861762 259
199 3300033180 Ga0307510_10115602 Ga0307510_101156023 259
200 3300005337 Ga0070682_100000481 Ga0070682_10000048111 260
201 3300005545 Ga0070695_100099035 Ga0070695_1000990352 260
202 3300009093 Ga0105240_10017345 Ga0105240_100173455 260
203 3300035086 Ga0373934_0009988 Ga0373934_0009988_1660_2442 260
204 3300035117 Ga0373953_0000324 Ga0373953_0000324_6799_7581 260
205 3300035118 Ga0373954_0000154 Ga0373954_0000154_8166_8948 260
206 3300035119 Ga0373956_0001735 Ga0373956_0001735_1058_1840 260
207 3300035170 Ga0373943_0085321 Ga0373943_0085321_710_1492 260
208 3300035172 Ga0373955_0002922 Ga0373955_0002922_4030_4812 260
209 3300035695 Ga0373927_0154988 Ga0373927_0154988_89_871 260
210 3300035724 Ga0373933_0000619 Ga0373933_0000619_3900_4682 260
211 3300036401 Ga0373937_0001690 Ga0373937_0001690_9579_10361 260
212 3300037068 Ga0373925_0540765 Ga0373925_0540765_69_878 260
213 3300042156 Ga0439446_0000346 Ga0439446_0000346_2899_3681 260
214 3300042436 Ga0439435_0000284 Ga0439435_0000284_4421_5203 260
215 3300045976 Ga0466967_0052770 Ga0466967_0052770_1590_2375 260
216 3300046454 Ga0495592_0055023 Ga0495592_0055023_1519_2301 260
217 3300046459 Ga0495629_0001324 Ga0495629_0001324_738_1520 260
218 3300046462 Ga0495651_0070717 Ga0495651_0070717_1181_1963 260
219 3300046463 Ga0495653_0002693 Ga0495653_0002693_1142_1924 260
220 3300046472 Ga0495580_0269079 Ga0495580_0269079_298_1080 260
221 3300046511 Ga0495608_0042374 Ga0495608_0042374_1467_2249 260
222 3300046516 Ga0495628_0022280 Ga0495628_0022280_2158_2940 260
223 3300046529 Ga0495652_0000858 Ga0495652_0000858_13448_14230 260
224 3300046533 Ga0495640_0058304 Ga0495640_0058304_487_1269 260
225 3300046536 Ga0495587_0036264 Ga0495587_0036264_1493_2275 260
226 3300046559 Ga0495667_0028389 Ga0495667_0028389_1467_2249 260
227 3300046663 Ga0495635_0000644 Ga0495635_0000644_1498_2280 260
228 3300046675 Ga0495657_0065078 Ga0495657_0065078_464_1246 260
229 3300046678 Ga0495599_0005428 Ga0495599_0005428_1500_2282 260
230 3300046679 Ga0495623_0004234 Ga0495623_0004234_3799_4581 260
231 3300046680 Ga0495646_0035505 Ga0495646_0035505_2204_2986 260
232 3300046683 Ga0495658_0333857 Ga0495658_0333857_89_871 260
233 3300046689 Ga0495613_0135238 Ga0495613_0135238_856_1638 260
234 3300047317 Ga0495604_0010041 Ga0495604_0010041_1505_2287 260
235 3300047322 Ga0495680_0002127 Ga0495680_0002127_6422_7204 260
236 3300047444 Ga0495675_0001422 Ga0495675_0001422_12232_13014 260
237 3300047471 Ga0495684_0000380 Ga0495684_0000380_1152_1934 260
238 3300047673 Ga0495593_0015720 Ga0495593_0015720_1441_2223 260
239 3300048088 Ga0495602_0040522 Ga0495602_0040522_2691_3473 260
240 3300049580 Ga0501046_0143868 Ga0501046_0143868_381_1163 260
241 3300053077 Ga0495601_0038444 Ga0495601_0038444_1983_2765 260
242 3300053085 Ga0495619_0054634 Ga0495619_0054634_1170_1952 260
243 iso_pu_bacteria 2513237092 2513627077 260
244 iso_pu_bacteria 2524023228 2524534360 260
245 iso_pu_bacteria 2528768022 2528850386 260
246 iso_pu_bacteria 2667528175 2671123365 260
247 iso_pu_bacteria 2728368998 2728753723 260
248 iso_pu_bacteria 2744054633 2745082769 260
249 iso_pu_bacteria 2773857925 2774872453 260
250 iso_pu_bacteria 2775506901 2776261763 260
251 iso_pu_bacteria 2791355197 2793072291 260
252 iso_pu_bacteria 2847930680 2847938032 260
253 iso_pu_bacteria 2879083081 2879084421 260
254 iso_pu_bacteria 2885374607 2885378106 260
255 iso_pu_bacteria 2894232714 2894240052 260
256 iso_pu_bacteria 2903748898 2903754509 260
257 iso_pu_bacteria 2906610324 2906611343 260
258 iso_pu_bacteria 2906626472 2906627703 260
259 iso_pu_bacteria 2906643746 2906647087 260
260 iso_pu_bacteria 2908739725 2908744923 260
261 iso_pu_bacteria 2922425934 2922428029 260
262 iso_pu_bacteria 2929615660 2929619885 260
263 iso_pu_bacteria 2929624759 2929629197 260
264 iso_pu_bacteria 2933577622 2933581803 260
265 iso_pu_bacteria 2935630451 2935632573 260
266 iso_pu_bacteria 2941507105 2941508763 260
267 iso_pu_bacteria 2941515067 2941516593 260
268 iso_pu_bacteria 2941523033 2941524391 260
269 iso_pu_bacteria 3005474847 3005477730 260
270 iso_pu_bacteria 8006933436 8006933503 260
271 iso_pu_bacteria 8006973647 8006983176 260
272 iso_pu_bacteria 8019555841 8019559394 260
273 iso_pu_bacteria 8055742211 8055750363 260
274 iso_pu_bacteria 8056681323 8056689805 260
275 3300005334 Ga0068869_100080041 Ga0068869_1000800412 261
276 3300005440 Ga0070705_100103853 Ga0070705_1001038531 261
277 3300005546 Ga0070696_100113243 Ga0070696_1001132432 261
278 3300005564 Ga0070664_100019941 Ga0070664_1000199413 261
279 3300005614 Ga0068856_100170576 Ga0068856_1001705762 261
280 3300005985 Ga0081539_10070587 Ga0081539_100705871 261
281 3300006163 Ga0070715_10017664 Ga0070715_100176641 261
282 3300009093 Ga0105240_10071117 Ga0105240_100711172 261
283 3300025906 Ga0207699_10202351 Ga0207699_102023512 261
284 3300025915 Ga0207693_10118444 Ga0207693_101184442 261
285 3300027360 Ga0209969_1009500 Ga0209969_10095004 261
286 3300027364 Ga0209967_1002962 Ga0209967_10029622 261
287 3300039437 Ga0436365_0866501 Ga0436365_0866501_19_804 261
288 3300039450 Ga0436363_1277791 Ga0436363_1277791_10858_11643 261
289 3300039453 Ga0436362_0587509 Ga0436362_0587509_275_1060 261
290 3300045051 Ga0451576_0103677 Ga0451576_0103677_1531_2316 261
291 3300045051 Ga0451576_0129683 Ga0451576_0129683_553_1344 261
292 3300049586 Ga0501070_0017283 Ga0501070_0017283_139_924 261
293 3300005330 Ga0070690_100101977 Ga0070690_1001019772 262
294 3300005365 Ga0070688_100258805 Ga0070688_1002588052 262
295 3300005441 Ga0070700_100228179 Ga0070700_1002281792 262
296 3300005468 Ga0070707_100131887 Ga0070707_1001318872 262
297 3300005544 Ga0070686_100388964 Ga0070686_1003889642 262
298 3300005545 Ga0070695_100199310 Ga0070695_1001993102 262
299 3300005615 Ga0070702_100251171 Ga0070702_1002511712 262
300 3300005617 Ga0068859_100109634 Ga0068859_1001096343 262
301 3300005618 Ga0068864_100163377 Ga0068864_1001633772 262
302 3300006880 Ga0075429_100300762 Ga0075429_1003007622 262
303 3300006931 Ga0097620_100109629 Ga0097620_1001096293 262
304 3300009093 Ga0105240_10193105 Ga0105240_101931052 262
305 3300009094 Ga0111539_10069454 Ga0111539_100694542 262
306 3300009094 Ga0111539_10316134 Ga0111539_103161342 262
307 3300013105 Ga0157369_10766867 Ga0157369_107668671 262
308 3300013307 Ga0157372_10127301 Ga0157372_101273012 262
309 3300014326 Ga0157380_10643843 Ga0157380_106438432 262
310 3300025922 Ga0207646_10111425 Ga0207646_101114252 262
311 3300026078 Ga0207702_10027656 Ga0207702_100276564 262
312 3300032002 Ga0307416_100088314 Ga0307416_1000883143 262
313 3300035117 Ga0373953_0135959 Ga0373953_0135959_210_1001 262
314 3300036401 Ga0373937_0039413 Ga0373937_0039413_1269_2060 262
315 3300041486 Ga0451807_0443856 Ga0451807_0443856_132_926 262
316 3300046678 Ga0495599_0206741 Ga0495599_0206741_325_1116 262
317 3300050507 nmdc:mga05p37_287775_c1 nmdc:mga05p37_287775_c1_1108_1908 262
318 3300050508 nmdc:mga09592_160324_c1 nmdc:mga09592_160324_c1_660_1454 262
319 3300050510 nmdc:mga06r32_186871_c1 nmdc:mga06r32_186871_c1_269_1069 262
320 3300050511 nmdc:mga08y16_25146_c1 nmdc:mga08y16_25146_c1_1057_1851 262
321 3300050515 nmdc:mga0a205_773_c1 nmdc:mga0a205_773_c1_9260_10048 262
322 3300005458 Ga0070681_10132644 Ga0070681_101326443 263
323 3300006871 Ga0075434_100019670 Ga0075434_1000196703 263
324 3300006914 Ga0075436_100139885 Ga0075436_1001398851 263
325 3300025912 Ga0207707_10083909 Ga0207707_100839093 263
326 3300031731 Ga0307405_10048949 Ga0307405_100489492 263
327 3300031824 Ga0307413_10185014 Ga0307413_101850141 263
328 3300031852 Ga0307410_10023944 Ga0307410_100239445 263
329 3300031995 Ga0307409_100156889 Ga0307409_1001568893 263
330 3300032002 Ga0307416_100019675 Ga0307416_1000196753 263
331 3300032004 Ga0307414_10185483 Ga0307414_101854832 263
332 3300032005 Ga0307411_10022339 Ga0307411_100223393 263
333 3300050512 nmdc:mga0n895_1415_c1 nmdc:mga0n895_1415_c1_2694_3485 263
334 3300050514 nmdc:mga08x19_177929_c1 nmdc:mga08x19_177929_c1_77_868 263
335 iso_pu_bacteria 2513237096 2513661041 263
336 iso_pu_bacteria 2513237137 2513860560 263
337 iso_pu_bacteria 2513237145 2513918967 263
338 iso_pu_bacteria 2517572143 2517888290 263
339 iso_pu_bacteria 2906635258 2906639147 263
340 iso_pu_bacteria 2906660503 2906666715 263
341 iso_pu_bacteria 2935959822 2935966263 263
342 3300003502 JGI26143J51219_1000353 JGI26143J51219_10003532 264
343 3300005327 Ga0070658_10004166 Ga0070658_100041668 264
344 3300005327 Ga0070658_10165520 Ga0070658_101655202 264
345 3300005329 Ga0070683_100019712 Ga0070683_1000197123 264
346 3300005331 Ga0070670_100324373 Ga0070670_1003243731 264
347 3300005336 Ga0070680_100001078 Ga0070680_1000010787 264
348 3300005336 Ga0070680_100161887 Ga0070680_1001618871 264
349 3300005336 Ga0070680_100384078 Ga0070680_1003840781 264
350 3300005338 Ga0068868_100250741 Ga0068868_1002507412 264
351 3300005341 Ga0070691_10011437 Ga0070691_100114374 264
352 3300005341 Ga0070691_10027417 Ga0070691_100274173 264
353 3300005344 Ga0070661_100109645 Ga0070661_1001096452 264
354 3300005344 Ga0070661_100138647 Ga0070661_1001386471 264
355 3300005347 Ga0070668_100354266 Ga0070668_1003542661 264
356 3300005356 Ga0070674_100157084 Ga0070674_1001570841 264
357 3300005366 Ga0070659_100171080 Ga0070659_1001710801 264
358 3300005434 Ga0070709_10015164 Ga0070709_100151642 264
359 3300005435 Ga0070714_100143918 Ga0070714_1001439182 264
360 3300005435 Ga0070714_100372398 Ga0070714_1003723981 264
361 3300005439 Ga0070711_100258933 Ga0070711_1002589332 264
362 3300005444 Ga0070694_100002954 Ga0070694_1000029547 264
363 3300005456 Ga0070678_100038480 Ga0070678_1000384806 264
364 3300005456 Ga0070678_100065266 Ga0070678_1000652661 264
365 3300005457 Ga0070662_100017449 Ga0070662_1000174492 264
366 3300005457 Ga0070662_100076593 Ga0070662_1000765931 264
367 3300005458 Ga0070681_10036488 Ga0070681_100364882 264
368 3300005458 Ga0070681_10076383 Ga0070681_100763834 264
369 3300005458 Ga0070681_10083047 Ga0070681_100830473 264
370 3300005458 Ga0070681_10163471 Ga0070681_101634712 264
371 3300005458 Ga0070681_10195978 Ga0070681_101959782 264
372 3300005518 Ga0070699_100016637 Ga0070699_1000166373 264
373 3300005518 Ga0070699_100037010 Ga0070699_1000370103 264
374 3300005530 Ga0070679_100012870 Ga0070679_1000128707 264
375 3300005530 Ga0070679_100043723 Ga0070679_1000437233 264
376 3300005530 Ga0070679_100070045 Ga0070679_1000700454 264
377 3300005530 Ga0070679_100412269 Ga0070679_1004122691 264
378 3300005535 Ga0070684_100072813 Ga0070684_1000728132 264
379 3300005539 Ga0068853_100072609 Ga0068853_1000726092 264
380 3300005545 Ga0070695_100002088 Ga0070695_1000020886 264
381 3300005548 Ga0070665_100249931 Ga0070665_1002499312 264
382 3300005563 Ga0068855_100006227 Ga0068855_1000062272 264
383 3300005563 Ga0068855_100668946 Ga0068855_1006689461 264
384 3300005563 Ga0068855_100735727 Ga0068855_1007357271 264
385 3300005563 Ga0068855_100815194 Ga0068855_1008151942 264
386 3300005564 Ga0070664_100229313 Ga0070664_1002293132 264
387 3300005577 Ga0068857_100228895 Ga0068857_1002288952 264
388 3300005577 Ga0068857_100560075 Ga0068857_1005600751 264
389 3300005578 Ga0068854_100533575 Ga0068854_1005335752 264
390 3300005614 Ga0068856_100014174 Ga0068856_1000141743 264
391 3300005616 Ga0068852_100046705 Ga0068852_1000467053 264
392 3300005719 Ga0068861_100395334 Ga0068861_1003953342 264
393 3300005841 Ga0068863_100168180 Ga0068863_1001681802 264
394 3300005842 Ga0068858_100119853 Ga0068858_1001198533 264
395 3300005937 Ga0081455_10031659 Ga0081455_100316592 264
396 3300005937 Ga0081455_10073009 Ga0081455_100730092 264
397 3300005983 Ga0081540_1099687 Ga0081540_10996872 264
398 3300006058 Ga0075432_10042468 Ga0075432_100424682 264
399 3300006175 Ga0070712_100256862 Ga0070712_1002568622 264
400 3300006358 Ga0068871_100255653 Ga0068871_1002556532 264
401 3300006844 Ga0075428_100127951 Ga0075428_1001279512 264
402 3300006847 Ga0075431_100290547 Ga0075431_1002905471 264
403 3300006847 Ga0075431_100505121 Ga0075431_1005051212 264
404 3300006852 Ga0075433_10014494 Ga0075433_100144943 264
405 3300006852 Ga0075433_10176527 Ga0075433_101765273 264
406 3300006871 Ga0075434_100302801 Ga0075434_1003028012 264
407 3300006871 Ga0075434_100351460 Ga0075434_1003514602 264
408 3300006914 Ga0075436_100000048 Ga0075436_10000004866 264
409 3300006914 Ga0075436_100170458 Ga0075436_1001704582 264
410 3300006942 Ga0099824_1004050 Ga0099824_100405015 264
411 3300006943 Ga0099822_1000838 Ga0099822_100083826 264
412 3300007265 Ga0099794_10008323 Ga0099794_100083235 264
413 3300009093 Ga0105240_10022961 Ga0105240_100229617 264
414 3300009094 Ga0111539_10007553 Ga0111539_100075539 264
415 3300009147 Ga0114129_10046650 Ga0114129_100466508 264
416 3300009147 Ga0114129_10527887 Ga0114129_105278872 264
417 3300009174 Ga0105241_10175767 Ga0105241_101757672 264
418 3300009545 Ga0105237_10052651 Ga0105237_100526513 264
419 3300009545 Ga0105237_10207462 Ga0105237_102074623 264
420 3300011119 Ga0105246_10438842 Ga0105246_104388421 264
421 3300013100 Ga0157373_10208552 Ga0157373_102085523 264
422 3300013104 Ga0157370_10037773 Ga0157370_100377734 264
423 3300013104 Ga0157370_10095545 Ga0157370_100955451 264
424 3300013105 Ga0157369_10008770 Ga0157369_100087704 264
425 3300013105 Ga0157369_10015054 Ga0157369_100150544 264
426 3300013307 Ga0157372_10064962 Ga0157372_100649622 264
427 3300013307 Ga0157372_10106574 Ga0157372_101065743 264
428 3300013307 Ga0157372_10445358 Ga0157372_104453582 264
429 3300014969 Ga0157376_10033332 Ga0157376_100333325 264
430 3300020081 Ga0206354_10314709 Ga0206354_103147092 264
431 3300020082 Ga0206353_10361580 Ga0206353_103615803 264
432 3300020082 Ga0206353_10796463 Ga0206353_107964631 264
433 3300021361 Ga0213872_10031020 Ga0213872_100310203 264
434 3300021361 Ga0213872_10057692 Ga0213872_100576922 264
435 3300021377 Ga0213874_10006912 Ga0213874_100069122 264
436 3300022467 Ga0224712_10004141 Ga0224712_100041413 264
437 3300025254 Ga0209148_1007840 Ga0209148_10078401 264
438 3300025254 Ga0209148_1008086 Ga0209148_10080861 264
439 3300025261 Ga0209233_1002084 Ga0209233_10020845 264
440 3300025261 Ga0209233_1003813 Ga0209233_10038132 264
441 3300025272 Ga0209455_1008935 Ga0209455_10089351 264
442 3300025272 Ga0209455_1017412 Ga0209455_10174122 264
443 3300025302 Ga0207426_1011926 Ga0207426_10119262 264
444 3300025315 Ga0207697_10063829 Ga0207697_100638292 264
445 3300025900 Ga0207710_10141853 Ga0207710_101418531 264
446 3300025904 Ga0207647_10232339 Ga0207647_102323391 264
447 3300025906 Ga0207699_10283237 Ga0207699_102832372 264
448 3300025909 Ga0207705_10020951 Ga0207705_100209512 264
449 3300025912 Ga0207707_10006487 Ga0207707_100064873 264
450 3300025912 Ga0207707_10050125 Ga0207707_100501253 264
451 3300025913 Ga0207695_10014945 Ga0207695_100149451 264
452 3300025913 Ga0207695_10045551 Ga0207695_100455513 264
453 3300025913 Ga0207695_10139798 Ga0207695_101397982 264
454 3300025913 Ga0207695_10144255 Ga0207695_101442551 264
455 3300025913 Ga0207695_10193589 Ga0207695_101935893 264
456 3300025913 Ga0207695_10215948 Ga0207695_102159481 264
457 3300025913 Ga0207695_10530410 Ga0207695_105304101 264
458 3300025914 Ga0207671_10073045 Ga0207671_100730453 264
459 3300025914 Ga0207671_10229534 Ga0207671_102295341 264
460 3300025916 Ga0207663_10279147 Ga0207663_102791472 264
461 3300025917 Ga0207660_10004857 Ga0207660_100048577 264
462 3300025919 Ga0207657_10090112 Ga0207657_100901122 264
463 3300025920 Ga0207649_10415838 Ga0207649_104158381 264
464 3300025921 Ga0207652_10002046 Ga0207652_1000204611 264
465 3300025921 Ga0207652_10226646 Ga0207652_102266462 264
466 3300025921 Ga0207652_10244131 Ga0207652_102441312 264
467 3300025921 Ga0207652_10245021 Ga0207652_102450211 264
468 3300025924 Ga0207694_10242777 Ga0207694_102427772 264
469 3300025929 Ga0207664_10096149 Ga0207664_100961492 264
470 3300025929 Ga0207664_10102465 Ga0207664_101024653 264
471 3300025933 Ga0207706_10014388 Ga0207706_100143885 264
472 3300025933 Ga0207706_10028860 Ga0207706_100288602 264
473 3300025933 Ga0207706_10105288 Ga0207706_101052882 264
474 3300025937 Ga0207669_10121483 Ga0207669_101214831 264
475 3300025944 Ga0207661_10004194 Ga0207661_100041949 264
476 3300025944 Ga0207661_10037431 Ga0207661_100374311 264
477 3300025949 Ga0207667_10017399 Ga0207667_100173992 264
478 3300025949 Ga0207667_10708174 Ga0207667_107081741 264
479 3300025960 Ga0207651_10525831 Ga0207651_105258311 264
480 3300025961 Ga0207712_10182678 Ga0207712_101826782 264
481 3300025972 Ga0207668_10295080 Ga0207668_102950802 264
482 3300026023 Ga0207677_10251699 Ga0207677_102516992 264
483 3300026035 Ga0207703_10462181 Ga0207703_104621811 264
484 3300026041 Ga0207639_10079945 Ga0207639_100799452 264
485 3300026041 Ga0207639_10334420 Ga0207639_103344202 264
486 3300026075 Ga0207708_10105451 Ga0207708_101054512 264
487 3300026078 Ga0207702_10090941 Ga0207702_100909411 264
488 3300026089 Ga0207648_10487037 Ga0207648_104870371 264
489 3300026116 Ga0207674_10022908 Ga0207674_100229087 264
490 3300026118 Ga0207675_100250651 Ga0207675_1002506512 264
491 3300026121 Ga0207683_10036901 Ga0207683_100369013 264
492 3300026121 Ga0207683_10051441 Ga0207683_100514412 264
493 3300026142 Ga0207698_10041118 Ga0207698_100411182 264
494 3300026142 Ga0207698_10380746 Ga0207698_103807461 264
495 3300027357 Ga0209589_1000007 Ga0209589_1000007195 264
496 3300027360 Ga0209969_1003934 Ga0209969_10039341 264
497 3300027360 Ga0209969_1014151 Ga0209969_10141511 264
498 3300027361 Ga0209489_100008 Ga0209489_100008195 264
499 3300027363 Ga0209700_100009 Ga0209700_100009195 264
500 3300027364 Ga0209967_1009637 Ga0209967_10096372 264
501 3300027378 Ga0209981_1007002 Ga0209981_10070022 264
502 3300027395 Ga0209996_1007316 Ga0209996_10073162 264
503 3300027462 Ga0210000_1000898 Ga0210000_10008982 264
504 3300027526 Ga0209968_1001999 Ga0209968_10019993 264
505 3300027543 Ga0209999_1003048 Ga0209999_10030482 264
506 3300027552 Ga0209982_1001411 Ga0209982_10014112 264
507 3300027617 Ga0210002_1004158 Ga0210002_10041581 264
508 3300027665 Ga0209983_1002175 Ga0209983_10021755 264
509 3300027682 Ga0209971_1000022 Ga0209971_100002237 264
510 3300027695 Ga0209966_1000218 Ga0209966_10002185 264
511 3300027695 Ga0209966_1010184 Ga0209966_10101841 264
512 3300027717 Ga0209998_10000283 Ga0209998_100002832 264
513 3300027717 Ga0209998_10018368 Ga0209998_100183681 264
514 3300027876 Ga0209974_10000598 Ga0209974_100005982 264
515 3300027876 Ga0209974_10032184 Ga0209974_100321842 264
516 3300027907 Ga0207428_10002151 Ga0207428_1000215112 264
517 3300031238 Ga0265332_10091458 Ga0265332_100914581 264
518 3300031249 Ga0265339_10003896 Ga0265339_100038965 264
519 3300031251 Ga0265327_10009058 Ga0265327_100090582 264
520 3300031344 Ga0265316_10067456 Ga0265316_100674562 264
521 3300031507 Ga0307509_10240038 Ga0307509_102400382 264
522 3300031712 Ga0265342_10083224 Ga0265342_100832241 264
523 3300031995 Ga0307409_100437748 Ga0307409_1004377481 264
524 3300032002 Ga0307416_100099173 Ga0307416_1000991734 264
525 3300033180 Ga0307510_10040464 Ga0307510_100404645 264
526 3300035120 Ga0373957_0021496 Ga0373957_0021496_1324_2142 264
527 3300035207 Ga0373942_0004077 Ga0373942_0004077_859_1656 264
528 3300036401 Ga0373937_0297793 Ga0373937_0297793_452_1270 264
529 3300037312 Ga0395899_0038114 Ga0395899_0038114_1263_2057 264
530 3300037418 Ga0395900_0066506 Ga0395900_0066506_581_1375 264
531 3300037418 Ga0395900_0073274 Ga0395900_0073274_320_1114 264
532 3300038443 Ga0395901_0002599 Ga0395901_0002599_15390_16184 264
533 3300038443 Ga0395901_0061217 Ga0395901_0061217_111_905 264
534 3300038996 Ga0242420_005503 Ga0242420_005503_1103_1897 264
535 3300039447 Ga0436361_1119451 Ga0436361_1119451_19_813 264
536 3300042439 Ga0439464_0001129 Ga0439464_0001129_2470_3264 264
537 3300042461 Ga0439460_0002903 Ga0439460_0002903_1221_2015 264
538 3300042876 Ga0451577_0045968 Ga0451577_0045968_1666_2499 264
539 3300042876 Ga0451577_0149817 Ga0451577_0149817_834_1628 264
540 3300044673 Ga0453683_0055425 Ga0453683_0055425_722_1594 264
541 3300044712 Ga0453684_0018602 Ga0453684_0018602_421_1215 264
542 3300044712 Ga0453684_0169548 Ga0453684_0169548_334_1224 264
543 3300045051 Ga0451576_0181167 Ga0451576_0181167_1336_2130 264
544 3300045976 Ga0466967_0228595 Ga0466967_0228595_319_1113 264
545 3300045976 Ga0466967_0251418 Ga0466967_0251418_614_1486 264
546 3300045976 Ga0466967_0377720 Ga0466967_0377720_459_1253 264
547 3300046454 Ga0495592_0167327 Ga0495592_0167327_167_985 264
548 3300046462 Ga0495651_0004057 Ga0495651_0004057_8448_9266 264
549 3300046525 Ga0495663_0041937 Ga0495663_0041937_287_1081 264
550 3300049569 Ga0501032_0022974 Ga0501032_0022974_2262_3113 264
551 3300049571 Ga0501034_0000266 Ga0501034_0000266_20564_21433 264
552 3300049571 Ga0501034_0002518 Ga0501034_0002518_15207_16001 264
553 3300049573 Ga0501037_0001462 Ga0501037_0001462_128_979 264
554 3300049574 Ga0501038_0007952 Ga0501038_0007952_376_1227 264
555 3300049575 Ga0501039_0004154 Ga0501039_0004154_5417_6268 264
556 3300049575 Ga0501039_0092106 Ga0501039_0092106_123_917 264
557 3300049576 Ga0501040_0004355 Ga0501040_0004355_4907_5701 264
558 3300049577 Ga0501041_0127381 Ga0501041_0127381_691_1485 264
559 3300049578 Ga0501042_0007623 Ga0501042_0007623_1835_2629 264
560 3300049578 Ga0501042_0139771 Ga0501042_0139771_246_1097 264
561 3300049579 Ga0501043_0015876 Ga0501043_0015876_3582_4433 264
562 3300049580 Ga0501046_0000274 Ga0501046_0000274_4896_5690 264
563 3300049580 Ga0501046_0057394 Ga0501046_0057394_2130_2981 264
564 3300049581 Ga0501047_0124986 Ga0501047_0124986_1640_2434 264
565 3300049582 Ga0501048_0057841 Ga0501048_0057841_634_1428 264
566 3300049583 Ga0501067_0007660 Ga0501067_0007660_2326_3120 264
567 3300049583 Ga0501067_0233689 Ga0501067_0233689_207_1001 264
568 3300049584 Ga0501068_0035217 Ga0501068_0035217_810_1604 264
569 3300049585 Ga0501069_0218747 Ga0501069_0218747_214_1008 264
570 3300049587 Ga0501071_0311941 Ga0501071_0311941_112_906 264
571 3300049590 Ga0501074_0012078 Ga0501074_0012078_579_1373 264
572 3300049591 Ga0501075_0020905 Ga0501075_0020905_1185_1979 264
573 3300049592 Ga0501076_0438312 Ga0501076_0438312_161_955 264
574 3300049593 Ga0501077_0064626 Ga0501077_0064626_782_1576 264
575 3300049741 Ga0501079_0001294 Ga0501079_0001294_13870_14664 264
576 3300049743 Ga0501081_0009318 Ga0501081_0009318_690_1484 264
577 3300049744 Ga0501083_0078583 Ga0501083_0078583_112_906 264
578 3300049822 Ga0501035_0024945 Ga0501035_0024945_2199_3050 264
579 3300049822 Ga0501035_0256049 Ga0501035_0256049_134_928 264
580 3300049823 Ga0501044_0146979 Ga0501044_0146979_924_1727 264
581 3300049824 Ga0501045_0010223 Ga0501045_0010223_4913_5707 264
582 3300050507 nmdc:mga05p37_55915_c1 nmdc:mga05p37_55915_c1_935_1729 264
583 3300050511 nmdc:mga08y16_17600_c1 nmdc:mga08y16_17600_c1_3608_4480 264
584 3300050512 nmdc:mga0n895_326612_c1 nmdc:mga0n895_326612_c1_471_1265 264
585 3300050512 nmdc:mga0n895_339750_c1 nmdc:mga0n895_339750_c1_298_1092 264
586 3300050514 nmdc:mga08x19_12681_c1 nmdc:mga08x19_12681_c1_3291_4085 264
587 3300050514 nmdc:mga08x19_348_c1 nmdc:mga08x19_348_c1_13154_13948 264
588 3300050515 nmdc:mga0a205_8519_c1 nmdc:mga0a205_8519_c1_3677_4549 264
589 3300053105 Ga0500557_038035 Ga0500557_038035_443_1237 264
590 3300054114 Ga0501084_0001144 Ga0501084_0001144_15045_15839 264
591 3300060353 Ga0501082_0000973 Ga0501082_0000973_19599_20393 264
592 3300060353 Ga0501082_0611262 Ga0501082_0611262_18_812 264
593 3300061734 Ga0530510_0114640 Ga0530510_0114640_1048_1842 264

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01738

DLH

Dienelactone hydrolase family

68

293

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7jka-assembly1.cif.gz_A dienelactone hydrolase family protein m3dlh from halieaceae bacterium 0.955 21 261
7jka-assembly1.cif.gz_A dienelactone hydrolase family protein m3dlh from halieaceae bacterium 0.9434 21 261
7jiz-assembly1.cif.gz_B dienelactone hydrolase family protein scdlh from solimonas sp. k1w22b-7 0.9252 21 261
4zi5-assembly1.cif.gz_B crystal structure of dienelactone hydrolase-like promiscuous phospotriesterase p91 from metagenomic libraries 0.9209 21 261
7jiz-assembly1.cif.gz_B dienelactone hydrolase family protein scdlh from solimonas sp. k1w22b-7 0.9178 21 261
ID Description Score Start End Superfamily
af_Q18927_1_243_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9329 21 261 3.40.50.1820
af_Q18925_2_245_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9282 23 261 3.40.50.1820
af_Q18927_1_243_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9218 21 261 3.40.50.1820
af_O17263_18_263_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9214 19 259 3.40.50.1820
4zi5A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9207 21 261 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A5N7MHY7-F1-model_v4 Dienelactone hydrolase family protein 0.9944 14 263 GO:0052689
AF-A0A5N7MHY7-F1-model_v4 Dienelactone hydrolase family protein 0.9866 14 263 GO:0052689
AF-A0A2D5TYZ1-F1-model_v4 Dienelactone hydrolase 0.9826 21 261 GO:0052689
AF-A0A847F251-F1-model_v4 Dienelactone hydrolase family protein 0.9791 21 260 GO:0052689
AF-A0A3T0K4T0-F1-model_v4 deleted 0.9776 20 263

Feature Viewer

pLDDT pTM Quality
93.58 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map