F467190
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 593 | 389 | 553 | 260 |
Family's Representative Sequence
| Representative Sequence | 3300005336|Ga0070680_100384078|Ga0070680_1003840781 |
| Length | 296 |
| Sequence | MKLARAAGTGFTGWRRNRWYANLAAANPREVRMRKIIMGALCAIAMVTSAKAAIKEEPVTYKDGETTLKGFVVYDDATQAKRPGIVMVHEWWGITPHIHNEARKFAQQGYVAFIADMYGDAKTADNPKDASALSSSVMKNPGVMESRFNAARTELAKQASVNPQRIGAVGYCFGGAVVLNMARAGADLAAVAGFHASLGLNTPAPAPGTVKAKVLILNGADDPFVKREQYDALKKDFXXXXADYRIIEYPGAVHAFTNPEATELGKKFNLPLRYDAKVDQEAKAEAAKFFAVDLQK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 2 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 3 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 4 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 5 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 6 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 7 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 8 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 9 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 10 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 11 | 2773857925 | Microvirga vignae BR3299 | Isolate | Unclassified |
| 12 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 13 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 14 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 15 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 16 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 17 | 2894232714 | Microvirga tunisiensis Lmie10 | Isolate | Nodule |
| 18 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 19 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 20 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 21 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 22 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 23 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 24 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 25 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 26 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 27 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 28 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 29 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 30 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 31 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 32 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 33 | 3300003502 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM | Metagenome | Rhizosphere |
| 34 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 35 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 40 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 43 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 48 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 63 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 66 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 67 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 71 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 73 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 74 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 75 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 77 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 78 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 79 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 80 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 81 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 82 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 83 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 84 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 85 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 86 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 87 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 88 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 89 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 90 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 91 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 92 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 93 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 94 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 95 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 96 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 97 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 98 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 99 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 100 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 102 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 103 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 104 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 105 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 130 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 131 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 132 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 133 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 134 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 135 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 136 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 182 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 183 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 185 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 186 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 201 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 203 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 204 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 205 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 206 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 207 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 208 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 209 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 210 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 211 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 212 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 213 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 214 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 215 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 216 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 217 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 218 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 219 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 220 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 221 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 222 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 223 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 224 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 225 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 226 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 227 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 228 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 229 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 230 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 231 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 232 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 233 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 234 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 235 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 236 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 237 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 238 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 239 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 240 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 241 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 242 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 243 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 244 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 245 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 246 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 247 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 248 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 249 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 250 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 251 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 252 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 253 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 254 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 255 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 256 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 257 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 258 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 259 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 260 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 261 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 262 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 316 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 317 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 318 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 319 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 320 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 321 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 322 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 323 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 324 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 325 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 326 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 327 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 328 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 329 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 330 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 331 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 332 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 333 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 341 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 358 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 363 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 364 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 365 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 366 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 367 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 372 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 373 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 374 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 375 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 379 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 380 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 381 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 384 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 385 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 386 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 387 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 388 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 389 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.88 |
| Metatranscriptomes | 0.85 |
| Isolates | 6.27 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.05 |
| Nodule | 5.73 |
| Rhizoplane | 5.56 |
| Rhizosphere | 79.93 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.72 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI26143J51219_1000353 | 3300003502 | Bacteria | 1818 |
| 2 | Ga0065715_10201289 | 3300005293 | Bacteria | 1360 |
| 3 | Ga0070658_10004166 | 3300005327 | Bacteria | 11839 |
| 4 | Ga0070658_10165520 | 3300005327 | Bacteria | 1856 |
| 5 | Ga0070683_100019712 | 3300005329 | Bacteria | 5993 |
| 6 | Ga0070683_100044821 | 3300005329 | Bacteria | 4080 |
| 7 | Ga0070690_100101977 | 3300005330 | Bacteria | 1904 |
| 8 | Ga0070690_100239863 | 3300005330 | Bacteria | 1278 |
| 9 | Ga0070670_100324373 | 3300005331 | Bacteria | 1350 |
| 10 | Ga0068869_100080041 | 3300005334 | Bacteria | 2436 |
| 11 | Ga0070680_100001078 | 3300005336 | Bacteria | 19598 |
| 12 | Ga0070680_100161887 | 3300005336 | Bacteria | 1881 |
| 13 | Ga0070680_100384078 | 3300005336 | Bacteria | 1196 |
| 14 | Ga0070682_100000481 | 3300005337 | Bacteria | 25103 |
| 15 | Ga0068868_100250741 | 3300005338 | Bacteria | 1490 |
| 16 | Ga0070691_10011437 | 3300005341 | Bacteria | 4053 |
| 17 | Ga0070691_10027417 | 3300005341 | Bacteria | 2658 |
| 18 | Ga0070661_100109645 | 3300005344 | Bacteria | 2060 |
| 19 | Ga0070661_100138647 | 3300005344 | Bacteria | 1832 |
| 20 | Ga0070668_100354266 | 3300005347 | Bacteria | 1243 |
| 21 | Ga0070674_100157084 | 3300005356 | Bacteria | 1722 |
| 22 | Ga0070688_100258805 | 3300005365 | Bacteria | 1242 |
| 23 | Ga0070659_100171080 | 3300005366 | Bacteria | 1779 |
| 24 | Ga0070703_10038605 | 3300005406 | Bacteria | 1477 |
| 25 | Ga0070709_10015164 | 3300005434 | Bacteria | 4378 |
| 26 | Ga0070709_10403527 | 3300005434 | Bacteria | 1021 |
| 27 | Ga0070714_100143918 | 3300005435 | Bacteria | 2142 |
| 28 | Ga0070714_100372398 | 3300005435 | Bacteria | 1345 |
| 29 | Ga0070711_100258933 | 3300005439 | Bacteria | 1368 |
| 30 | Ga0070711_100685827 | 3300005439 | Bacteria | 861 |
| 31 | Ga0070705_100037431 | 3300005440 | Bacteria | 2737 |
| 32 | Ga0070705_100103853 | 3300005440 | Bacteria | 1801 |
| 33 | Ga0070700_100228179 | 3300005441 | Bacteria | 1324 |
| 34 | Ga0070694_100002954 | 3300005444 | Bacteria | 10102 |
| 35 | Ga0070694_100045616 | 3300005444 | Bacteria | 2938 |
| 36 | Ga0070694_100198549 | 3300005444 | Bacteria | 1494 |
| 37 | Ga0070678_100038480 | 3300005456 | Bacteria | 3368 |
| 38 | Ga0070678_100065266 | 3300005456 | Bacteria | 2702 |
| 39 | Ga0070678_100570958 | 3300005456 | Bacteria | 1006 |
| 40 | Ga0070662_100017449 | 3300005457 | Bacteria | 4841 |
| 41 | Ga0070662_100076593 | 3300005457 | Bacteria | 2480 |
| 42 | Ga0070681_10036488 | 3300005458 | Bacteria | 4936 |
| 43 | Ga0070681_10076383 | 3300005458 | Bacteria | 3308 |
| 44 | Ga0070681_10083047 | 3300005458 | Bacteria | 3157 |
| 45 | Ga0070681_10132644 | 3300005458 | Bacteria | 2423 |
| 46 | Ga0070681_10163471 | 3300005458 | Bacteria | 2149 |
| 47 | Ga0070681_10195978 | 3300005458 | Bacteria | 1939 |
| 48 | Ga0070706_100196437 | 3300005467 | Bacteria | 1885 |
| 49 | Ga0070707_100131887 | 3300005468 | Bacteria | 2430 |
| 50 | Ga0070699_100016637 | 3300005518 | Bacteria | 6314 |
| 51 | Ga0070699_100037010 | 3300005518 | Bacteria | 4223 |
| 52 | Ga0070679_100012870 | 3300005530 | Bacteria | 8008 |
| 53 | Ga0070679_100043723 | 3300005530 | Bacteria | 4461 |
| 54 | Ga0070679_100070045 | 3300005530 | Bacteria | 3498 |
| 55 | Ga0070679_100412269 | 3300005530 | Bacteria | 1296 |
| 56 | Ga0070684_100072813 | 3300005535 | Bacteria | 3026 |
| 57 | Ga0070697_100026559 | 3300005536 | Bacteria | 4627 |
| 58 | Ga0068853_100072609 | 3300005539 | Bacteria | 2999 |
| 59 | Ga0070686_100388964 | 3300005544 | Bacteria | 1058 |
| 60 | Ga0070695_100002088 | 3300005545 | Bacteria | 11428 |
| 61 | Ga0070695_100003816 | 3300005545 | Bacteria | 8786 |
| 62 | Ga0070695_100099035 | 3300005545 | Bacteria | 1960 |
| 63 | Ga0070695_100199310 | 3300005545 | Bacteria | 1430 |
| 64 | Ga0070696_100113243 | 3300005546 | Bacteria | 1956 |
| 65 | Ga0070665_100249931 | 3300005548 | Bacteria | 1774 |
| 66 | Ga0068855_100006227 | 3300005563 | Bacteria | 14540 |
| 67 | Ga0068855_100668946 | 3300005563 | Bacteria | 1114 |
| 68 | Ga0068855_100735727 | 3300005563 | Bacteria | 1053 |
| 69 | Ga0068855_100815194 | 3300005563 | Bacteria | 991 |
| 70 | Ga0070664_100019941 | 3300005564 | Bacteria | 5519 |
| 71 | Ga0070664_100185293 | 3300005564 | Bacteria | 1852 |
| 72 | Ga0070664_100229313 | 3300005564 | Bacteria | 1664 |
| 73 | Ga0068857_100228895 | 3300005577 | Bacteria | 1700 |
| 74 | Ga0068857_100560075 | 3300005577 | Bacteria | 1077 |
| 75 | Ga0068854_100533575 | 3300005578 | Bacteria | 993 |
| 76 | Ga0068856_100014174 | 3300005614 | Bacteria | 7706 |
| 77 | Ga0068856_100170576 | 3300005614 | Bacteria | 2188 |
| 78 | Ga0070702_100251171 | 3300005615 | Bacteria | 1199 |
| 79 | Ga0068852_100046705 | 3300005616 | Bacteria | 3691 |
| 80 | Ga0068859_100109634 | 3300005617 | Bacteria | 2822 |
| 81 | Ga0068864_100163377 | 3300005618 | Bacteria | 2025 |
| 82 | Ga0068861_100395334 | 3300005719 | Bacteria | 1225 |
| 83 | Ga0068863_100168180 | 3300005841 | Bacteria | 2102 |
| 84 | Ga0068858_100119853 | 3300005842 | Bacteria | 2460 |
| 85 | Ga0081455_10031659 | 3300005937 | Bacteria | 4779 |
| 86 | Ga0081455_10073009 | 3300005937 | Bacteria | 2838 |
| 87 | Ga0081540_1099687 | 3300005983 | Bacteria | 1254 |
| 88 | Ga0081539_10070587 | 3300005985 | Bacteria | 1874 |
| 89 | Ga0075365_10102395 | 3300006038 | Bacteria | 1962 |
| 90 | Ga0075365_10313225 | 3300006038 | Bacteria | 1105 |
| 91 | Ga0075364_10203775 | 3300006051 | Bacteria | 1341 |
| 92 | Ga0075432_10042468 | 3300006058 | Bacteria | 1591 |
| 93 | Ga0070715_10017664 | 3300006163 | Bacteria | 2704 |
| 94 | Ga0070712_100256862 | 3300006175 | Bacteria | 1399 |
| 95 | Ga0075362_10025252 | 3300006177 | Bacteria | 2528 |
| 96 | Ga0075367_10060824 | 3300006178 | Bacteria | 2253 |
| 97 | Ga0075369_10036203 | 3300006186 | Bacteria | 2100 |
| 98 | Ga0068871_100255653 | 3300006358 | Bacteria | 1527 |
| 99 | Ga0075428_100127951 | 3300006844 | Bacteria | 2763 |
| 100 | Ga0075431_100290547 | 3300006847 | Bacteria | 1654 |
| 101 | Ga0075431_100505121 | 3300006847 | Bacteria | 1200 |
| 102 | Ga0075433_10014494 | 3300006852 | Bacteria | 6442 |
| 103 | Ga0075433_10176527 | 3300006852 | Bacteria | 1901 |
| 104 | Ga0075434_100019670 | 3300006871 | Bacteria | 6534 |
| 105 | Ga0075434_100302801 | 3300006871 | Bacteria | 1619 |
| 106 | Ga0075434_100351460 | 3300006871 | Bacteria | 1495 |
| 107 | Ga0075429_100300762 | 3300006880 | Bacteria | 1405 |
| 108 | Ga0075436_100000048 | 3300006914 | Bacteria | 72013 |
| 109 | Ga0075436_100003324 | 3300006914 | Bacteria | 11006 |
| 110 | Ga0075436_100139885 | 3300006914 | Bacteria | 1701 |
| 111 | Ga0075436_100170458 | 3300006914 | Bacteria | 1537 |
| 112 | Ga0097620_100109629 | 3300006931 | Bacteria | 2822 |
| 113 | Ga0099824_1004050 | 3300006942 | Bacteria | 21204 |
| 114 | Ga0099822_1000838 | 3300006943 | Bacteria | 32461 |
| 115 | Ga0099823_1023231 | 3300006944 | Bacteria | 5691 |
| 116 | Ga0099794_10008323 | 3300007265 | Bacteria | 4302 |
| 117 | Ga0105240_10004610 | 3300009093 | Bacteria | 20893 |
| 118 | Ga0105240_10017345 | 3300009093 | Bacteria | 9708 |
| 119 | Ga0105240_10022961 | 3300009093 | Bacteria | 8264 |
| 120 | Ga0105240_10071117 | 3300009093 | Bacteria | 4303 |
| 121 | Ga0105240_10193105 | 3300009093 | Bacteria | 2393 |
| 122 | Ga0105240_10581534 | 3300009093 | Bacteria | 1235 |
| 123 | Ga0111539_10007553 | 3300009094 | Bacteria | 13898 |
| 124 | Ga0111539_10069454 | 3300009094 | Bacteria | 4160 |
| 125 | Ga0111539_10316134 | 3300009094 | Bacteria | 1817 |
| 126 | Ga0105245_10421373 | 3300009098 | Bacteria | 1338 |
| 127 | Ga0105247_10017454 | 3300009101 | Bacteria | 4308 |
| 128 | Ga0105247_10047179 | 3300009101 | Bacteria | 2645 |
| 129 | Ga0105247_10319233 | 3300009101 | Bacteria | 1083 |
| 130 | Ga0114129_10046650 | 3300009147 | Bacteria | 6089 |
| 131 | Ga0114129_10527887 | 3300009147 | Bacteria | 1538 |
| 132 | Ga0105243_10066158 | 3300009148 | Bacteria | 2906 |
| 133 | Ga0105243_10197741 | 3300009148 | Bacteria | 1761 |
| 134 | Ga0105241_10152017 | 3300009174 | Bacteria | 1894 |
| 135 | Ga0105241_10175767 | 3300009174 | Bacteria | 1772 |
| 136 | Ga0105248_10088532 | 3300009177 | Bacteria | 3484 |
| 137 | Ga0105237_10024741 | 3300009545 | Bacteria | 6142 |
| 138 | Ga0105237_10052651 | 3300009545 | Bacteria | 4085 |
| 139 | Ga0105237_10207462 | 3300009545 | Bacteria | 1960 |
| 140 | Ga0105237_10502104 | 3300009545 | Bacteria | 1219 |
| 141 | Ga0105237_10523209 | 3300009545 | Bacteria | 1193 |
| 142 | Ga0105237_10570553 | 3300009545 | Bacteria | 1138 |
| 143 | Ga0105238_10210539 | 3300009551 | Bacteria | 1920 |
| 144 | Ga0105238_10294261 | 3300009551 | Bacteria | 1606 |
| 145 | Ga0105249_10822540 | 3300009553 | Bacteria | 993 |
| 146 | Ga0105239_10310509 | 3300010375 | Bacteria | 1777 |
| 147 | Ga0105239_10355205 | 3300010375 | Bacteria | 1655 |
| 148 | Ga0105246_10053172 | 3300011119 | Bacteria | 2786 |
| 149 | Ga0105246_10229006 | 3300011119 | Bacteria | 1462 |
| 150 | Ga0105246_10438842 | 3300011119 | Bacteria | 1094 |
| 151 | Ga0157373_10208552 | 3300013100 | Bacteria | 1378 |
| 152 | Ga0157370_10037773 | 3300013104 | Bacteria | 4677 |
| 153 | Ga0157370_10095545 | 3300013104 | Bacteria | 2788 |
| 154 | Ga0157370_10215626 | 3300013104 | Bacteria | 1778 |
| 155 | Ga0157369_10001066 | 3300013105 | Bacteria | 34424 |
| 156 | Ga0157369_10008770 | 3300013105 | Bacteria | 11585 |
| 157 | Ga0157369_10015054 | 3300013105 | Bacteria | 8730 |
| 158 | Ga0157369_10766867 | 3300013105 | Bacteria | 992 |
| 159 | Ga0157374_10011905 | 3300013296 | Bacteria | 7549 |
| 160 | Ga0163162_10106064 | 3300013306 | Bacteria | 2905 |
| 161 | Ga0163162_10264800 | 3300013306 | Bacteria | 1850 |
| 162 | Ga0157372_10007867 | 3300013307 | Bacteria | 11330 |
| 163 | Ga0157372_10064962 | 3300013307 | Bacteria | 4096 |
| 164 | Ga0157372_10106574 | 3300013307 | Bacteria | 3206 |
| 165 | Ga0157372_10127301 | 3300013307 | Bacteria | 2929 |
| 166 | Ga0157372_10445358 | 3300013307 | Bacteria | 1509 |
| 167 | Ga0157372_10583581 | 3300013307 | Bacteria | 1303 |
| 168 | Ga0157375_10061140 | 3300013308 | Bacteria | 3739 |
| 169 | Ga0163163_10004105 | 3300014325 | Bacteria | 12418 |
| 170 | Ga0157380_10643843 | 3300014326 | Bacteria | 1056 |
| 171 | Ga0157379_10250980 | 3300014968 | Bacteria | 1606 |
| 172 | Ga0157376_10016629 | 3300014969 | Bacteria | 5591 |
| 173 | Ga0157376_10033332 | 3300014969 | Bacteria | 4146 |
| 174 | Ga0157376_10610532 | 3300014969 | Bacteria | 1087 |
| 175 | Ga0197907_10840968 | 3300020069 | Bacteria | 2269 |
| 176 | Ga0206354_10314709 | 3300020081 | Bacteria | 1132 |
| 177 | Ga0206353_10361580 | 3300020082 | Bacteria | 2049 |
| 178 | Ga0206353_10796463 | 3300020082 | Bacteria | 866 |
| 179 | Ga0213872_10031020 | 3300021361 | Bacteria | 2450 |
| 180 | Ga0213872_10057692 | 3300021361 | Bacteria | 1758 |
| 181 | Ga0213874_10006912 | 3300021377 | Bacteria | 2703 |
| 182 | Ga0213876_10011982 | 3300021384 | Bacteria | 4619 |
| 183 | Ga0224712_10004141 | 3300022467 | Bacteria | 3877 |
| 184 | Ga0209148_1007840 | 3300025254 | Bacteria | 2185 |
| 185 | Ga0209148_1008086 | 3300025254 | Bacteria | 2135 |
| 186 | Ga0209233_1002084 | 3300025261 | Bacteria | 7561 |
| 187 | Ga0209233_1003813 | 3300025261 | Bacteria | 5254 |
| 188 | Ga0209455_1008935 | 3300025272 | Bacteria | 2672 |
| 189 | Ga0209455_1017412 | 3300025272 | Bacteria | 1507 |
| 190 | Ga0207426_1011926 | 3300025302 | Bacteria | 3287 |
| 191 | Ga0207697_10063829 | 3300025315 | Bacteria | 1535 |
| 192 | Ga0207656_10077917 | 3300025321 | Bacteria | 1485 |
| 193 | Ga0207653_10056141 | 3300025885 | Bacteria | 1320 |
| 194 | Ga0207710_10016454 | 3300025900 | Bacteria | 3129 |
| 195 | Ga0207710_10141853 | 3300025900 | Bacteria | 1160 |
| 196 | Ga0207647_10232339 | 3300025904 | Bacteria | 1061 |
| 197 | Ga0207699_10202351 | 3300025906 | Bacteria | 1346 |
| 198 | Ga0207699_10283237 | 3300025906 | Bacteria | 1152 |
| 199 | Ga0207705_10020951 | 3300025909 | Bacteria | 4664 |
| 200 | Ga0207684_10167333 | 3300025910 | Bacteria | 1895 |
| 201 | Ga0207684_10212329 | 3300025910 | Bacteria | 1669 |
| 202 | Ga0207707_10006487 | 3300025912 | Bacteria | 10215 |
| 203 | Ga0207707_10050125 | 3300025912 | Bacteria | 3638 |
| 204 | Ga0207707_10083909 | 3300025912 | Bacteria | 2782 |
| 205 | Ga0207695_10014945 | 3300025913 | Bacteria | 9161 |
| 206 | Ga0207695_10045551 | 3300025913 | Bacteria | 4655 |
| 207 | Ga0207695_10139798 | 3300025913 | Bacteria | 2371 |
| 208 | Ga0207695_10144255 | 3300025913 | Bacteria | 2327 |
| 209 | Ga0207695_10193589 | 3300025913 | Bacteria | 1950 |
| 210 | Ga0207695_10215948 | 3300025913 | Bacteria | 1827 |
| 211 | Ga0207695_10530410 | 3300025913 | Bacteria | 1059 |
| 212 | Ga0207671_10073045 | 3300025914 | Bacteria | 2561 |
| 213 | Ga0207671_10229534 | 3300025914 | Bacteria | 1456 |
| 214 | Ga0207671_10474990 | 3300025914 | Bacteria | 996 |
| 215 | Ga0207693_10118444 | 3300025915 | Bacteria | 2079 |
| 216 | Ga0207663_10279147 | 3300025916 | Bacteria | 1240 |
| 217 | Ga0207660_10004857 | 3300025917 | Bacteria | 8752 |
| 218 | Ga0207657_10090112 | 3300025919 | Bacteria | 2560 |
| 219 | Ga0207649_10415838 | 3300025920 | Bacteria | 1009 |
| 220 | Ga0207652_10002046 | 3300025921 | Bacteria | 17348 |
| 221 | Ga0207652_10226646 | 3300025921 | Bacteria | 1684 |
| 222 | Ga0207652_10244131 | 3300025921 | Bacteria | 1619 |
| 223 | Ga0207652_10245021 | 3300025921 | Bacteria | 1616 |
| 224 | Ga0207646_10111425 | 3300025922 | Bacteria | 2456 |
| 225 | Ga0207646_10452141 | 3300025922 | Bacteria | 1159 |
| 226 | Ga0207694_10242777 | 3300025924 | Bacteria | 1472 |
| 227 | Ga0207664_10096149 | 3300025929 | Bacteria | 2438 |
| 228 | Ga0207664_10102465 | 3300025929 | Bacteria | 2367 |
| 229 | Ga0207706_10014388 | 3300025933 | Bacteria | 7170 |
| 230 | Ga0207706_10028860 | 3300025933 | Bacteria | 4953 |
| 231 | Ga0207706_10105288 | 3300025933 | Bacteria | 2482 |
| 232 | Ga0207709_10460217 | 3300025935 | Bacteria | 985 |
| 233 | Ga0207669_10121483 | 3300025937 | Bacteria | 1774 |
| 234 | Ga0207661_10004194 | 3300025944 | Bacteria | 10081 |
| 235 | Ga0207661_10037431 | 3300025944 | Bacteria | 3794 |
| 236 | Ga0207661_10044565 | 3300025944 | Bacteria | 3506 |
| 237 | Ga0207661_10382061 | 3300025944 | Bacteria | 1275 |
| 238 | Ga0207679_10124886 | 3300025945 | Bacteria | 2055 |
| 239 | Ga0207667_10017399 | 3300025949 | Bacteria | 8090 |
| 240 | Ga0207667_10708174 | 3300025949 | Bacteria | 1009 |
| 241 | Ga0207651_10525831 | 3300025960 | Bacteria | 1026 |
| 242 | Ga0207712_10182678 | 3300025961 | Bacteria | 1649 |
| 243 | Ga0207668_10295080 | 3300025972 | Bacteria | 1335 |
| 244 | Ga0207677_10251699 | 3300026023 | Bacteria | 1435 |
| 245 | Ga0207703_10462181 | 3300026035 | Bacteria | 1187 |
| 246 | Ga0207639_10079945 | 3300026041 | Bacteria | 2585 |
| 247 | Ga0207639_10334420 | 3300026041 | Bacteria | 1349 |
| 248 | Ga0207678_10045244 | 3300026067 | Bacteria | 3807 |
| 249 | Ga0207708_10105451 | 3300026075 | Bacteria | 2185 |
| 250 | Ga0207702_10027656 | 3300026078 | Bacteria | 4710 |
| 251 | Ga0207702_10090941 | 3300026078 | Bacteria | 2671 |
| 252 | Ga0207648_10487037 | 3300026089 | Bacteria | 1127 |
| 253 | Ga0207676_10174920 | 3300026095 | Bacteria | 1874 |
| 254 | Ga0207674_10022908 | 3300026116 | Bacteria | 6701 |
| 255 | Ga0207675_100250651 | 3300026118 | Bacteria | 1713 |
| 256 | Ga0207683_10036901 | 3300026121 | Bacteria | 4256 |
| 257 | Ga0207683_10051441 | 3300026121 | Bacteria | 3609 |
| 258 | Ga0207698_10018596 | 3300026142 | Bacteria | 4739 |
| 259 | Ga0207698_10041118 | 3300026142 | Bacteria | 3441 |
| 260 | Ga0207698_10380746 | 3300026142 | Bacteria | 1342 |
| 261 | Ga0209389_1000009 | 3300027296 | Bacteria | 226873 |
| 262 | Ga0209589_1000007 | 3300027357 | Bacteria | 425699 |
| 263 | Ga0209969_1003934 | 3300027360 | Bacteria | 2069 |
| 264 | Ga0209969_1009500 | 3300027360 | Bacteria | 1387 |
| 265 | Ga0209969_1014151 | 3300027360 | Bacteria | 1160 |
| 266 | Ga0209489_100008 | 3300027361 | Bacteria | 425699 |
| 267 | Ga0209489_100050 | 3300027361 | Bacteria | 154669 |
| 268 | Ga0209700_100009 | 3300027363 | Bacteria | 425699 |
| 269 | Ga0209700_100016 | 3300027363 | Bacteria | 252567 |
| 270 | Ga0209967_1002962 | 3300027364 | Bacteria | 2225 |
| 271 | Ga0209967_1009637 | 3300027364 | Bacteria | 1341 |
| 272 | Ga0209981_1007002 | 3300027378 | Bacteria | 1515 |
| 273 | Ga0209996_1007316 | 3300027395 | Bacteria | 1436 |
| 274 | Ga0210000_1000898 | 3300027462 | Bacteria | 4142 |
| 275 | Ga0209968_1001999 | 3300027526 | Bacteria | 3101 |
| 276 | Ga0209999_1003048 | 3300027543 | Bacteria | 2983 |
| 277 | Ga0209982_1001411 | 3300027552 | Bacteria | 3279 |
| 278 | Ga0210002_1004158 | 3300027617 | Bacteria | 2144 |
| 279 | Ga0209983_1002175 | 3300027665 | Bacteria | 4317 |
| 280 | Ga0209588_1059248 | 3300027671 | Bacteria | 1238 |
| 281 | Ga0209971_1000022 | 3300027682 | Bacteria | 56932 |
| 282 | Ga0209966_1000218 | 3300027695 | Bacteria | 22793 |
| 283 | Ga0209966_1010184 | 3300027695 | Bacteria | 1691 |
| 284 | Ga0209998_10000283 | 3300027717 | Bacteria | 15845 |
| 285 | Ga0209998_10018368 | 3300027717 | Bacteria | 1485 |
| 286 | Ga0209974_10000598 | 3300027876 | Bacteria | 12109 |
| 287 | Ga0209974_10032184 | 3300027876 | Bacteria | 1738 |
| 288 | Ga0207428_10002151 | 3300027907 | Bacteria | 19792 |
| 289 | Ga0268264_10606097 | 3300028381 | Bacteria | 1080 |
| 290 | Ga0268264_10765828 | 3300028381 | Bacteria | 963 |
| 291 | Ga0265334_10002639 | 3300028573 | Bacteria | 8330 |
| 292 | Ga0265332_10062677 | 3300031238 | Bacteria | 1589 |
| 293 | Ga0265332_10091458 | 3300031238 | Bacteria | 1286 |
| 294 | Ga0265340_10086176 | 3300031247 | Bacteria | 1473 |
| 295 | Ga0265339_10003896 | 3300031249 | Bacteria | 10346 |
| 296 | Ga0265327_10009058 | 3300031251 | Bacteria | 7273 |
| 297 | Ga0265316_10067456 | 3300031344 | Bacteria | 2767 |
| 298 | Ga0307509_10240038 | 3300031507 | Bacteria | 1606 |
| 299 | Ga0265342_10083224 | 3300031712 | Bacteria | 1845 |
| 300 | Ga0307405_10048949 | 3300031731 | Bacteria | 2610 |
| 301 | Ga0307413_10185014 | 3300031824 | Bacteria | 1489 |
| 302 | Ga0307410_10023944 | 3300031852 | Bacteria | 3807 |
| 303 | Ga0307409_100156889 | 3300031995 | Bacteria | 1984 |
| 304 | Ga0307409_100437748 | 3300031995 | Bacteria | 1259 |
| 305 | Ga0307416_100019675 | 3300032002 | Bacteria | 4794 |
| 306 | Ga0307416_100088314 | 3300032002 | Bacteria | 2650 |
| 307 | Ga0307416_100099173 | 3300032002 | Bacteria | 2529 |
| 308 | Ga0307414_10185483 | 3300032004 | Bacteria | 1678 |
| 309 | Ga0307411_10022339 | 3300032005 | Bacteria | 3723 |
| 310 | Ga0307510_10040464 | 3300033180 | Bacteria | 5117 |
| 311 | Ga0307510_10115602 | 3300033180 | Bacteria | 2407 |
| 312 | Ga0373930_0020324 | 3300034816 | Bacteria | 1293 |
| 313 | Ga0373928_0063947 | 3300035084 | Bacteria | 896 |
| 314 | Ga0373934_0009988 | 3300035086 | Bacteria | 3561 |
| 315 | Ga0373932_0053562 | 3300035112 | Bacteria | 1205 |
| 316 | Ga0373953_0000324 | 3300035117 | Bacteria | 12878 |
| 317 | Ga0373953_0135959 | 3300035117 | Bacteria | 1050 |
| 318 | Ga0373954_0000154 | 3300035118 | Bacteria | 24448 |
| 319 | Ga0373956_0001735 | 3300035119 | Bacteria | 8973 |
| 320 | Ga0373957_0021496 | 3300035120 | Bacteria | 2291 |
| 321 | Ga0373943_0085321 | 3300035170 | Bacteria | 1626 |
| 322 | Ga0373946_0066700 | 3300035171 | Bacteria | 1544 |
| 323 | Ga0373955_0002922 | 3300035172 | Bacteria | 7501 |
| 324 | Ga0373942_0004077 | 3300035207 | Bacteria | 3407 |
| 325 | Ga0373931_0001468 | 3300035691 | Bacteria | 10152 |
| 326 | Ga0373927_0012556 | 3300035695 | Bacteria | 5640 |
| 327 | Ga0373927_0020670 | 3300035695 | Bacteria | 4317 |
| 328 | Ga0373927_0154988 | 3300035695 | Bacteria | 1500 |
| 329 | Ga0373933_0000619 | 3300035724 | Bacteria | 22192 |
| 330 | Ga0373937_0001690 | 3300036401 | Bacteria | 18558 |
| 331 | Ga0373937_0039413 | 3300036401 | Bacteria | 4306 |
| 332 | Ga0373937_0297793 | 3300036401 | Bacteria | 1524 |
| 333 | Ga0373925_0540765 | 3300037068 | Bacteria | 958 |
| 334 | Ga0373925_0649873 | 3300037068 | Bacteria | 869 |
| 335 | Ga0395899_0038114 | 3300037312 | Bacteria | 3601 |
| 336 | Ga0395899_0258417 | 3300037312 | Bacteria | 1192 |
| 337 | Ga0395900_0021470 | 3300037418 | Bacteria | 6601 |
| 338 | Ga0395900_0066506 | 3300037418 | Bacteria | 3703 |
| 339 | Ga0395900_0073274 | 3300037418 | Bacteria | 3521 |
| 340 | Ga0395900_0370771 | 3300037418 | Bacteria | 1401 |
| 341 | Ga0395898_0004174 | 3300037466 | Bacteria | 15829 |
| 342 | Ga0395898_0755954 | 3300037466 | Bacteria | 913 |
| 343 | Ga0395901_0001831 | 3300038443 | Bacteria | 21964 |
| 344 | Ga0395901_0002599 | 3300038443 | Bacteria | 18294 |
| 345 | Ga0395901_0032279 | 3300038443 | Bacteria | 5403 |
| 346 | Ga0395901_0061217 | 3300038443 | Bacteria | 3917 |
| 347 | Ga0242420_005503 | 3300038996 | Bacteria | 1967 |
| 348 | Ga0436365_0866501 | 3300039437 | Bacteria | 1163 |
| 349 | Ga0436365_1229160 | 3300039437 | Bacteria | 1350 |
| 350 | Ga0436365_1239960 | 3300039437 | Bacteria | 8858 |
| 351 | Ga0436360_0428535 | 3300039438 | Bacteria | 951 |
| 352 | Ga0436361_0562961 | 3300039447 | Bacteria | 7241 |
| 353 | Ga0436361_0761784 | 3300039447 | Bacteria | 2525 |
| 354 | Ga0436361_1119451 | 3300039447 | Bacteria | 882 |
| 355 | Ga0436363_1277791 | 3300039450 | Bacteria | 14539 |
| 356 | Ga0436362_0587509 | 3300039453 | Bacteria | 1965 |
| 357 | Ga0451807_0443856 | 3300041486 | Bacteria | 1072 |
| 358 | Ga0451839_1236941 | 3300041496 | Bacteria | 952 |
| 359 | Ga0439446_0000346 | 3300042156 | Bacteria | 8901 |
| 360 | Ga0439435_0000284 | 3300042436 | Bacteria | 7512 |
| 361 | Ga0439464_0001129 | 3300042439 | Bacteria | 6176 |
| 362 | Ga0439460_0002903 | 3300042461 | Bacteria | 4131 |
| 363 | Ga0451577_0045968 | 3300042876 | Bacteria | 3907 |
| 364 | Ga0451577_0149817 | 3300042876 | Bacteria | 2099 |
| 365 | Ga0453683_0055425 | 3300044673 | Bacteria | 2481 |
| 366 | Ga0466961_0294288 | 3300044693 | Bacteria | 992 |
| 367 | Ga0466963_0011506 | 3300044694 | Bacteria | 5389 |
| 368 | Ga0466964_0109028 | 3300044706 | Bacteria | 1232 |
| 369 | Ga0453684_0018602 | 3300044712 | Bacteria | 10651 |
| 370 | Ga0453684_0169548 | 3300044712 | Bacteria | 2574 |
| 371 | Ga0466970_0160623 | 3300044765 | Bacteria | 1243 |
| 372 | Ga0466957_0306402 | 3300044842 | Bacteria | 1068 |
| 373 | Ga0466960_0121244 | 3300044901 | Bacteria | 1370 |
| 374 | Ga0451576_0103677 | 3300045051 | Bacteria | 2959 |
| 375 | Ga0451576_0129683 | 3300045051 | Bacteria | 2628 |
| 376 | Ga0451576_0181167 | 3300045051 | Bacteria | 2199 |
| 377 | Ga0466967_0052770 | 3300045976 | Bacteria | 3571 |
| 378 | Ga0466967_0055936 | 3300045976 | Bacteria | 3477 |
| 379 | Ga0466967_0191504 | 3300045976 | Bacteria | 1933 |
| 380 | Ga0466967_0228595 | 3300045976 | Bacteria | 1770 |
| 381 | Ga0466967_0251418 | 3300045976 | Bacteria | 1689 |
| 382 | Ga0466967_0377720 | 3300045976 | Bacteria | 1375 |
| 383 | Ga0495592_0055023 | 3300046454 | Bacteria | 2945 |
| 384 | Ga0495592_0167327 | 3300046454 | Bacteria | 1508 |
| 385 | Ga0495592_0246741 | 3300046454 | Bacteria | 1182 |
| 386 | Ga0495603_0086682 | 3300046455 | Bacteria | 1832 |
| 387 | Ga0495629_0001324 | 3300046459 | Bacteria | 19480 |
| 388 | Ga0495638_0205843 | 3300046460 | Bacteria | 1108 |
| 389 | Ga0495651_0004057 | 3300046462 | Bacteria | 11189 |
| 390 | Ga0495651_0070717 | 3300046462 | Bacteria | 2654 |
| 391 | Ga0495653_0002693 | 3300046463 | Bacteria | 14155 |
| 392 | Ga0495580_0269079 | 3300046472 | Bacteria | 1164 |
| 393 | Ga0495605_0027863 | 3300046474 | Bacteria | 2922 |
| 394 | Ga0495664_0041743 | 3300046477 | Bacteria | 2715 |
| 395 | Ga0495585_0185131 | 3300046492 | Bacteria | 1068 |
| 396 | Ga0495583_0112408 | 3300046506 | Bacteria | 1153 |
| 397 | Ga0495606_0010252 | 3300046507 | Bacteria | 7806 |
| 398 | Ga0495608_0042374 | 3300046511 | Bacteria | 3044 |
| 399 | Ga0495618_0117915 | 3300046514 | Bacteria | 1700 |
| 400 | Ga0495628_0022280 | 3300046516 | Bacteria | 5205 |
| 401 | Ga0495631_0096254 | 3300046518 | Bacteria | 1274 |
| 402 | Ga0495643_0075696 | 3300046522 | Bacteria | 1761 |
| 403 | Ga0495648_0017345 | 3300046524 | Bacteria | 5150 |
| 404 | Ga0495648_0106565 | 3300046524 | Bacteria | 1534 |
| 405 | Ga0495663_0041937 | 3300046525 | Bacteria | 1393 |
| 406 | Ga0495652_0000858 | 3300046529 | Bacteria | 35023 |
| 407 | Ga0495640_0058304 | 3300046533 | Bacteria | 2633 |
| 408 | Ga0495587_0036264 | 3300046536 | Bacteria | 2966 |
| 409 | Ga0495609_0072328 | 3300046538 | Bacteria | 1514 |
| 410 | Ga0495621_0015386 | 3300046539 | Bacteria | 2439 |
| 411 | Ga0495645_0009577 | 3300046543 | Bacteria | 6776 |
| 412 | Ga0495622_0097721 | 3300046557 | Bacteria | 1347 |
| 413 | Ga0495633_0104160 | 3300046558 | Bacteria | 1316 |
| 414 | Ga0495667_0028389 | 3300046559 | Bacteria | 3767 |
| 415 | Ga0495656_0169321 | 3300046615 | Bacteria | 1067 |
| 416 | Ga0495668_0079923 | 3300046616 | Bacteria | 1794 |
| 417 | Ga0495611_0013680 | 3300046648 | Bacteria | 3458 |
| 418 | Ga0495625_0057234 | 3300046660 | Bacteria | 2773 |
| 419 | Ga0495635_0000644 | 3300046663 | Bacteria | 22418 |
| 420 | Ga0495657_0065078 | 3300046675 | Bacteria | 2398 |
| 421 | Ga0495599_0005428 | 3300046678 | Bacteria | 7618 |
| 422 | Ga0495599_0206741 | 3300046678 | Bacteria | 1205 |
| 423 | Ga0495623_0004234 | 3300046679 | Bacteria | 9451 |
| 424 | Ga0495646_0035505 | 3300046680 | Bacteria | 3092 |
| 425 | Ga0495658_0333857 | 3300046683 | Bacteria | 962 |
| 426 | Ga0495613_0135238 | 3300046689 | Bacteria | 1764 |
| 427 | Ga0495670_0118467 | 3300046691 | Bacteria | 1374 |
| 428 | Ga0495671_0103941 | 3300046692 | Bacteria | 1387 |
| 429 | Ga0495649_0018372 | 3300046694 | Bacteria | 3934 |
| 430 | Ga0495581_0035186 | 3300047315 | Bacteria | 2898 |
| 431 | Ga0495604_0010041 | 3300047317 | Bacteria | 7495 |
| 432 | Ga0495636_0075640 | 3300047318 | Bacteria | 1443 |
| 433 | Ga0495674_0055850 | 3300047319 | Bacteria | 3461 |
| 434 | Ga0495674_0357337 | 3300047319 | Bacteria | 1185 |
| 435 | Ga0495680_0002127 | 3300047322 | Bacteria | 20560 |
| 436 | Ga0495683_0027380 | 3300047323 | Bacteria | 2914 |
| 437 | Ga0495683_0067908 | 3300047323 | Bacteria | 1755 |
| 438 | Ga0495675_0001422 | 3300047444 | Bacteria | 14504 |
| 439 | Ga0495684_0000380 | 3300047471 | Bacteria | 36351 |
| 440 | Ga0495686_0207877 | 3300047472 | Bacteria | 1120 |
| 441 | Ga0495593_0015720 | 3300047673 | Bacteria | 4280 |
| 442 | Ga0495602_0040522 | 3300048088 | Bacteria | 4268 |
| 443 | Ga0496100_0051575 | 3300048903 | Bacteria | 2671 |
| 444 | Ga0496101_0006832 | 3300048904 | Bacteria | 7365 |
| 445 | Ga0496101_0051620 | 3300048904 | Bacteria | 2963 |
| 446 | Ga0496102_0011957 | 3300048905 | Bacteria | 7496 |
| 447 | Ga0496102_0019548 | 3300048905 | Bacteria | 5967 |
| 448 | Ga0496102_0426746 | 3300048905 | Bacteria | 1245 |
| 449 | Ga0496103_0091813 | 3300048906 | Bacteria | 1916 |
| 450 | Ga0496104_0025964 | 3300048907 | Bacteria | 5402 |
| 451 | Ga0496104_0076484 | 3300048907 | Bacteria | 3188 |
| 452 | Ga0496105_0024512 | 3300048908 | Bacteria | 4902 |
| 453 | Ga0496105_0069094 | 3300048908 | Bacteria | 2919 |
| 454 | Ga0496106_0033602 | 3300048909 | Bacteria | 3827 |
| 455 | Ga0496106_0206478 | 3300048909 | Bacteria | 1564 |
| 456 | Ga0496107_0005017 | 3300048910 | Bacteria | 9018 |
| 457 | Ga0496107_0174945 | 3300048910 | Bacteria | 1593 |
| 458 | Ga0496108_0438783 | 3300048911 | Bacteria | 1140 |
| 459 | Ga0496109_0064889 | 3300048912 | Bacteria | 3342 |
| 460 | Ga0496109_0196747 | 3300048912 | Bacteria | 1895 |
| 461 | Ga0496109_0599653 | 3300048912 | Bacteria | 1037 |
| 462 | Ga0496110_0007162 | 3300048913 | Bacteria | 8880 |
| 463 | Ga0496110_0125669 | 3300048913 | Bacteria | 2314 |
| 464 | Ga0496111_0043747 | 3300048914 | Bacteria | 3219 |
| 465 | Ga0496112_0000561 | 3300048915 | Bacteria | 25482 |
| 466 | Ga0496112_0007927 | 3300048915 | Bacteria | 9464 |
| 467 | Ga0496112_0019836 | 3300048915 | Bacteria | 6360 |
| 468 | Ga0496113_0020841 | 3300048916 | Bacteria | 4616 |
| 469 | Ga0496113_0223043 | 3300048916 | Bacteria | 1502 |
| 470 | Ga0496113_0298091 | 3300048916 | Bacteria | 1291 |
| 471 | Ga0496114_0012803 | 3300048917 | Bacteria | 6716 |
| 472 | Ga0496115_0001600 | 3300048918 | Bacteria | 16275 |
| 473 | Ga0496115_0359017 | 3300048918 | Bacteria | 1187 |
| 474 | Ga0496121_0347467 | 3300048924 | Bacteria | 989 |
| 475 | Ga0496126_0110581 | 3300048929 | Bacteria | 2393 |
| 476 | Ga0496126_0248460 | 3300048929 | Bacteria | 1483 |
| 477 | Ga0496126_0403380 | 3300048929 | Bacteria | 1108 |
| 478 | Ga0495682_0010920 | 3300049460 | Bacteria | 3500 |
| 479 | Ga0501032_0022974 | 3300049569 | Bacteria | 4318 |
| 480 | Ga0501034_0000266 | 3300049571 | Bacteria | 94491 |
| 481 | Ga0501034_0002518 | 3300049571 | Bacteria | 21975 |
| 482 | Ga0501034_0178922 | 3300049571 | Bacteria | 2086 |
| 483 | Ga0501037_0001462 | 3300049573 | Bacteria | 17325 |
| 484 | Ga0501038_0007952 | 3300049574 | Bacteria | 9769 |
| 485 | Ga0501039_0004154 | 3300049575 | Bacteria | 10898 |
| 486 | Ga0501039_0092106 | 3300049575 | Bacteria | 2362 |
| 487 | Ga0501040_0004355 | 3300049576 | Bacteria | 9204 |
| 488 | Ga0501041_0127381 | 3300049577 | Bacteria | 1585 |
| 489 | Ga0501042_0007623 | 3300049578 | Bacteria | 7102 |
| 490 | Ga0501042_0139771 | 3300049578 | Bacteria | 1746 |
| 491 | Ga0501043_0015876 | 3300049579 | Bacteria | 5903 |
| 492 | Ga0501046_0000274 | 3300049580 | Bacteria | 52364 |
| 493 | Ga0501046_0057394 | 3300049580 | Bacteria | 3054 |
| 494 | Ga0501046_0143868 | 3300049580 | Bacteria | 1802 |
| 495 | Ga0501047_0017300 | 3300049581 | Bacteria | 6904 |
| 496 | Ga0501047_0124986 | 3300049581 | Bacteria | 2453 |
| 497 | Ga0501048_0057841 | 3300049582 | Bacteria | 2749 |
| 498 | Ga0501067_0007660 | 3300049583 | Bacteria | 6002 |
| 499 | Ga0501067_0233689 | 3300049583 | Bacteria | 1023 |
| 500 | Ga0501068_0035217 | 3300049584 | Bacteria | 2987 |
| 501 | Ga0501069_0218747 | 3300049585 | Bacteria | 1106 |
| 502 | Ga0501070_0017283 | 3300049586 | Bacteria | 6057 |
| 503 | Ga0501071_0311941 | 3300049587 | Bacteria | 1193 |
| 504 | Ga0501074_0012078 | 3300049590 | Bacteria | 6276 |
| 505 | Ga0501074_0124193 | 3300049590 | Bacteria | 1846 |
| 506 | Ga0501075_0020905 | 3300049591 | Bacteria | 4767 |
| 507 | Ga0501076_0438312 | 3300049592 | Bacteria | 1075 |
| 508 | Ga0501077_0064626 | 3300049593 | Bacteria | 2321 |
| 509 | Ga0501079_0001294 | 3300049741 | Bacteria | 17601 |
| 510 | Ga0501080_0055113 | 3300049742 | Bacteria | 3703 |
| 511 | Ga0501081_0009318 | 3300049743 | Bacteria | 6397 |
| 512 | Ga0501083_0078583 | 3300049744 | Bacteria | 2188 |
| 513 | Ga0501035_0024945 | 3300049822 | Bacteria | 5482 |
| 514 | Ga0501035_0256049 | 3300049822 | Bacteria | 1485 |
| 515 | Ga0501035_0344413 | 3300049822 | Bacteria | 1248 |
| 516 | Ga0501044_0146979 | 3300049823 | Bacteria | 2342 |
| 517 | Ga0501045_0010223 | 3300049824 | Bacteria | 6569 |
| 518 | nmdc:mga03683_9964_c1 | 3300050489 | Bacteria | 2599 |
| 519 | nmdc:mga00v17_211640_c1 | 3300050491 | Bacteria | 1254 |
| 520 | nmdc:mga00v17_414064_c1 | 3300050491 | Bacteria | 875 |
| 521 | nmdc:mga0yw44_345068_c1 | 3300050492 | Bacteria | 1002 |
| 522 | nmdc:mga0yw44_985_c1 | 3300050492 | Bacteria | 10866 |
| 523 | nmdc:mga06z11_20737_c1 | 3300050494 | Bacteria | 3042 |
| 524 | nmdc:mga07m45_95589_c1 | 3300050496 | Bacteria | 1704 |
| 525 | nmdc:mga05p37_287775_c1 | 3300050507 | Bacteria | 1957 |
| 526 | nmdc:mga05p37_55915_c1 | 3300050507 | Bacteria | 4858 |
| 527 | nmdc:mga09592_160324_c1 | 3300050508 | Bacteria | 1943 |
| 528 | nmdc:mga06r32_186871_c1 | 3300050510 | Bacteria | 2059 |
| 529 | nmdc:mga08y16_17600_c1 | 3300050511 | Bacteria | 7526 |
| 530 | nmdc:mga08y16_25146_c1 | 3300050511 | Bacteria | 6280 |
| 531 | nmdc:mga0n895_1415_c1 | 3300050512 | Bacteria | 17921 |
| 532 | nmdc:mga0n895_326612_c1 | 3300050512 | Bacteria | 1554 |
| 533 | nmdc:mga0n895_339750_c1 | 3300050512 | Bacteria | 1521 |
| 534 | nmdc:mga08x19_10505_c1 | 3300050514 | Bacteria | 5560 |
| 535 | nmdc:mga08x19_12681_c1 | 3300050514 | Bacteria | 5081 |
| 536 | nmdc:mga08x19_177929_c1 | 3300050514 | Bacteria | 1451 |
| 537 | nmdc:mga08x19_348_c1 | 3300050514 | Bacteria | 33504 |
| 538 | nmdc:mga0a205_773_c1 | 3300050515 | Bacteria | 25870 |
| 539 | nmdc:mga0a205_8519_c1 | 3300050515 | Bacteria | 9325 |
| 540 | nmdc:mga0sz30_16264_c1 | 3300050516 | Bacteria | 2951 |
| 541 | Ga0495601_0038444 | 3300053077 | Bacteria | 2994 |
| 542 | Ga0495601_0132443 | 3300053077 | Bacteria | 1624 |
| 543 | Ga0495655_0003589 | 3300053083 | Bacteria | 2573 |
| 544 | Ga0495619_0054634 | 3300053085 | Bacteria | 2643 |
| 545 | Ga0500578_0052031 | 3300053086 | Bacteria | 2623 |
| 546 | Ga0500557_038035 | 3300053105 | Bacteria | 1496 |
| 547 | Ga0500595_016429 | 3300053119 | Bacteria | 2757 |
| 548 | Ga0501084_0001144 | 3300054114 | Bacteria | 20689 |
| 549 | Ga0501084_0412203 | 3300054114 | Bacteria | 1142 |
| 550 | Ga0501082_0000973 | 3300060353 | Bacteria | 25299 |
| 551 | Ga0501082_0611262 | 3300060353 | Bacteria | 954 |
| 552 | Ga0466962_0036951 | 3300061719 | Bacteria | 2338 |
| 553 | Ga0530510_0114640 | 3300061734 | Bacteria | 1975 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300054114 | Ga0501084_0412203 | Ga0501084_0412203_75_815 | 230 |
| 2 | 3300011119 | Ga0105246_10053172 | Ga0105246_100531724 | 236 |
| 3 | iso_pu_bacteria | 2904699407 | 2904705656 | 239 |
| 4 | 3300044706 | Ga0466964_0109028 | Ga0466964_0109028_453_1208 | 240 |
| 5 | 3300005330 | Ga0070690_100239863 | Ga0070690_1002398631 | 241 |
| 6 | 3300009545 | Ga0105237_10570553 | Ga0105237_105705531 | 241 |
| 7 | 3300035112 | Ga0373932_0053562 | Ga0373932_0053562_49_816 | 243 |
| 8 | 3300037068 | Ga0373925_0649873 | Ga0373925_0649873_23_754 | 243 |
| 9 | 3300009098 | Ga0105245_10421373 | Ga0105245_104213731 | 244 |
| 10 | 3300009148 | Ga0105243_10066158 | Ga0105243_100661581 | 244 |
| 11 | 3300009545 | Ga0105237_10502104 | Ga0105237_105021041 | 244 |
| 12 | 3300009551 | Ga0105238_10294261 | Ga0105238_102942612 | 244 |
| 13 | 3300010375 | Ga0105239_10355205 | Ga0105239_103552051 | 244 |
| 14 | 3300013296 | Ga0157374_10011905 | Ga0157374_100119058 | 244 |
| 15 | 3300014325 | Ga0163163_10004105 | Ga0163163_1000410510 | 244 |
| 16 | 3300014969 | Ga0157376_10016629 | Ga0157376_100166296 | 244 |
| 17 | 3300014969 | Ga0157376_10610532 | Ga0157376_106105321 | 244 |
| 18 | 3300044901 | Ga0466960_0121244 | Ga0466960_0121244_44_820 | 244 |
| 19 | 3300046474 | Ga0495605_0027863 | Ga0495605_0027863_1766_2521 | 244 |
| 20 | 3300046507 | Ga0495606_0010252 | Ga0495606_0010252_5411_6166 | 244 |
| 21 | 3300046522 | Ga0495643_0075696 | Ga0495643_0075696_475_1230 | 244 |
| 22 | 3300046524 | Ga0495648_0017345 | Ga0495648_0017345_1543_2298 | 244 |
| 23 | 3300046538 | Ga0495609_0072328 | Ga0495609_0072328_555_1310 | 244 |
| 24 | 3300046660 | Ga0495625_0057234 | Ga0495625_0057234_73_828 | 244 |
| 25 | 3300046694 | Ga0495649_0018372 | Ga0495649_0018372_1885_2640 | 244 |
| 26 | 3300047323 | Ga0495683_0027380 | Ga0495683_0027380_1734_2489 | 244 |
| 27 | 3300048903 | Ga0496100_0051575 | Ga0496100_0051575_1819_2574 | 244 |
| 28 | 3300048904 | Ga0496101_0006832 | Ga0496101_0006832_134_889 | 244 |
| 29 | 3300048905 | Ga0496102_0011957 | Ga0496102_0011957_6603_7358 | 244 |
| 30 | 3300048905 | Ga0496102_0426746 | Ga0496102_0426746_465_1220 | 244 |
| 31 | 3300048907 | Ga0496104_0076484 | Ga0496104_0076484_161_916 | 244 |
| 32 | 3300048908 | Ga0496105_0069094 | Ga0496105_0069094_184_939 | 244 |
| 33 | 3300048910 | Ga0496107_0005017 | Ga0496107_0005017_132_887 | 244 |
| 34 | 3300048911 | Ga0496108_0438783 | Ga0496108_0438783_231_986 | 244 |
| 35 | 3300048912 | Ga0496109_0599653 | Ga0496109_0599653_121_876 | 244 |
| 36 | 3300048913 | Ga0496110_0125669 | Ga0496110_0125669_1418_2173 | 244 |
| 37 | 3300048915 | Ga0496112_0007927 | Ga0496112_0007927_7508_8263 | 244 |
| 38 | 3300048916 | Ga0496113_0223043 | Ga0496113_0223043_620_1375 | 244 |
| 39 | 3300048916 | Ga0496113_0298091 | Ga0496113_0298091_107_862 | 244 |
| 40 | 3300048918 | Ga0496115_0001600 | Ga0496115_0001600_138_893 | 244 |
| 41 | 3300048924 | Ga0496121_0347467 | Ga0496121_0347467_81_836 | 244 |
| 42 | 3300048929 | Ga0496126_0248460 | Ga0496126_0248460_556_1311 | 244 |
| 43 | 3300049460 | Ga0495682_0010920 | Ga0495682_0010920_533_1288 | 244 |
| 44 | 3300050491 | nmdc:mga00v17_414064_c1 | nmdc:mga00v17_414064_c1_57_812 | 244 |
| 45 | 3300050492 | nmdc:mga0yw44_345068_c1 | nmdc:mga0yw44_345068_c1_83_838 | 244 |
| 46 | 3300053083 | Ga0495655_0003589 | Ga0495655_0003589_632_1387 | 244 |
| 47 | 3300053086 | Ga0500578_0052031 | Ga0500578_0052031_709_1464 | 244 |
| 48 | 3300005444 | Ga0070694_100045616 | Ga0070694_1000456163 | 245 |
| 49 | 3300044693 | Ga0466961_0294288 | Ga0466961_0294288_201_956 | 246 |
| 50 | 3300013307 | Ga0157372_10583581 | Ga0157372_105835812 | 247 |
| 51 | 3300005440 | Ga0070705_100037431 | Ga0070705_1000374313 | 249 |
| 52 | 3300005564 | Ga0070664_100185293 | Ga0070664_1001852933 | 249 |
| 53 | 3300006914 | Ga0075436_100003324 | Ga0075436_1000033243 | 249 |
| 54 | 3300009101 | Ga0105247_10017454 | Ga0105247_100174542 | 249 |
| 55 | 3300009545 | Ga0105237_10523209 | Ga0105237_105232091 | 249 |
| 56 | 3300025900 | Ga0207710_10016454 | Ga0207710_100164542 | 249 |
| 57 | 3300025910 | Ga0207684_10212329 | Ga0207684_102123292 | 249 |
| 58 | 3300025945 | Ga0207679_10124886 | Ga0207679_101248863 | 249 |
| 59 | 3300035171 | Ga0373946_0066700 | Ga0373946_0066700_37_819 | 249 |
| 60 | 3300035695 | Ga0373927_0012556 | Ga0373927_0012556_683_1465 | 249 |
| 61 | 3300046477 | Ga0495664_0041743 | Ga0495664_0041743_929_1711 | 249 |
| 62 | 3300046514 | Ga0495618_0117915 | Ga0495618_0117915_70_852 | 249 |
| 63 | 3300047315 | Ga0495581_0035186 | Ga0495581_0035186_1266_2048 | 249 |
| 64 | 3300047319 | Ga0495674_0055850 | Ga0495674_0055850_827_1609 | 249 |
| 65 | 3300049571 | Ga0501034_0178922 | Ga0501034_0178922_950_1732 | 249 |
| 66 | 3300050489 | nmdc:mga03683_9964_c1 | nmdc:mga03683_9964_c1_769_1551 | 249 |
| 67 | 3300050492 | nmdc:mga0yw44_985_c1 | nmdc:mga0yw44_985_c1_6209_6991 | 249 |
| 68 | 3300050494 | nmdc:mga06z11_20737_c1 | nmdc:mga06z11_20737_c1_1627_2409 | 249 |
| 69 | 3300050496 | nmdc:mga07m45_95589_c1 | nmdc:mga07m45_95589_c1_390_1172 | 249 |
| 70 | 3300050516 | nmdc:mga0sz30_16264_c1 | nmdc:mga0sz30_16264_c1_981_1763 | 249 |
| 71 | 3300005406 | Ga0070703_10038605 | Ga0070703_100386052 | 250 |
| 72 | 3300005444 | Ga0070694_100198549 | Ga0070694_1001985492 | 250 |
| 73 | 3300005467 | Ga0070706_100196437 | Ga0070706_1001964372 | 250 |
| 74 | 3300005536 | Ga0070697_100026559 | Ga0070697_1000265592 | 250 |
| 75 | 3300005545 | Ga0070695_100003816 | Ga0070695_1000038162 | 250 |
| 76 | 3300025885 | Ga0207653_10056141 | Ga0207653_100561412 | 250 |
| 77 | 3300025922 | Ga0207646_10452141 | Ga0207646_104521411 | 250 |
| 78 | 3300005293 | Ga0065715_10201289 | Ga0065715_102012892 | 251 |
| 79 | 3300005434 | Ga0070709_10403527 | Ga0070709_104035271 | 251 |
| 80 | 3300005439 | Ga0070711_100685827 | Ga0070711_1006858271 | 251 |
| 81 | 3300009093 | Ga0105240_10004610 | Ga0105240_1000461017 | 251 |
| 82 | 3300009093 | Ga0105240_10581534 | Ga0105240_105815342 | 251 |
| 83 | 3300009101 | Ga0105247_10047179 | Ga0105247_100471793 | 251 |
| 84 | 3300009101 | Ga0105247_10319233 | Ga0105247_103192331 | 251 |
| 85 | 3300009148 | Ga0105243_10197741 | Ga0105243_101977413 | 251 |
| 86 | 3300009177 | Ga0105248_10088532 | Ga0105248_100885323 | 251 |
| 87 | 3300009545 | Ga0105237_10024741 | Ga0105237_100247414 | 251 |
| 88 | 3300009551 | Ga0105238_10210539 | Ga0105238_102105392 | 251 |
| 89 | 3300009553 | Ga0105249_10822540 | Ga0105249_108225402 | 251 |
| 90 | 3300010375 | Ga0105239_10310509 | Ga0105239_103105091 | 251 |
| 91 | 3300011119 | Ga0105246_10229006 | Ga0105246_102290062 | 251 |
| 92 | 3300013104 | Ga0157370_10215626 | Ga0157370_102156261 | 251 |
| 93 | 3300013105 | Ga0157369_10001066 | Ga0157369_1000106623 | 251 |
| 94 | 3300013306 | Ga0163162_10106064 | Ga0163162_101060642 | 251 |
| 95 | 3300013306 | Ga0163162_10264800 | Ga0163162_102648003 | 251 |
| 96 | 3300013307 | Ga0157372_10007867 | Ga0157372_1000786711 | 251 |
| 97 | 3300013308 | Ga0157375_10061140 | Ga0157375_100611405 | 251 |
| 98 | 3300014968 | Ga0157379_10250980 | Ga0157379_102509802 | 251 |
| 99 | 3300025944 | Ga0207661_10382061 | Ga0207661_103820612 | 251 |
| 100 | 3300034816 | Ga0373930_0020324 | Ga0373930_0020324_468_1223 | 251 |
| 101 | 3300035084 | Ga0373928_0063947 | Ga0373928_0063947_88_843 | 251 |
| 102 | 3300035691 | Ga0373931_0001468 | Ga0373931_0001468_5290_6045 | 251 |
| 103 | 3300035695 | Ga0373927_0020670 | Ga0373927_0020670_536_1291 | 251 |
| 104 | 3300037312 | Ga0395899_0258417 | Ga0395899_0258417_210_965 | 251 |
| 105 | 3300037418 | Ga0395900_0021470 | Ga0395900_0021470_1190_1945 | 251 |
| 106 | 3300037418 | Ga0395900_0370771 | Ga0395900_0370771_604_1359 | 251 |
| 107 | 3300037466 | Ga0395898_0004174 | Ga0395898_0004174_11789_12544 | 251 |
| 108 | 3300037466 | Ga0395898_0755954 | Ga0395898_0755954_134_889 | 251 |
| 109 | 3300038443 | Ga0395901_0001831 | Ga0395901_0001831_21188_21943 | 251 |
| 110 | 3300038443 | Ga0395901_0032279 | Ga0395901_0032279_515_1270 | 251 |
| 111 | 3300039437 | Ga0436365_1229160 | Ga0436365_1229160_304_1059 | 251 |
| 112 | 3300039438 | Ga0436360_0428535 | Ga0436360_0428535_134_889 | 251 |
| 113 | 3300039447 | Ga0436361_0562961 | Ga0436361_0562961_6264_7019 | 251 |
| 114 | 3300039447 | Ga0436361_0761784 | Ga0436361_0761784_1459_2214 | 251 |
| 115 | 3300045976 | Ga0466967_0055936 | Ga0466967_0055936_1846_2601 | 251 |
| 116 | 3300045976 | Ga0466967_0191504 | Ga0466967_0191504_373_1128 | 251 |
| 117 | 3300046455 | Ga0495603_0086682 | Ga0495603_0086682_940_1695 | 251 |
| 118 | 3300046460 | Ga0495638_0205843 | Ga0495638_0205843_216_971 | 251 |
| 119 | 3300046492 | Ga0495585_0185131 | Ga0495585_0185131_47_802 | 251 |
| 120 | 3300046506 | Ga0495583_0112408 | Ga0495583_0112408_324_1079 | 251 |
| 121 | 3300046518 | Ga0495631_0096254 | Ga0495631_0096254_458_1213 | 251 |
| 122 | 3300046524 | Ga0495648_0106565 | Ga0495648_0106565_105_860 | 251 |
| 123 | 3300046539 | Ga0495621_0015386 | Ga0495621_0015386_1476_2231 | 251 |
| 124 | 3300046543 | Ga0495645_0009577 | Ga0495645_0009577_1762_2517 | 251 |
| 125 | 3300046557 | Ga0495622_0097721 | Ga0495622_0097721_221_976 | 251 |
| 126 | 3300046558 | Ga0495633_0104160 | Ga0495633_0104160_293_1048 | 251 |
| 127 | 3300046615 | Ga0495656_0169321 | Ga0495656_0169321_60_815 | 251 |
| 128 | 3300046616 | Ga0495668_0079923 | Ga0495668_0079923_223_978 | 251 |
| 129 | 3300046648 | Ga0495611_0013680 | Ga0495611_0013680_1246_2001 | 251 |
| 130 | 3300046691 | Ga0495670_0118467 | Ga0495670_0118467_449_1204 | 251 |
| 131 | 3300046692 | Ga0495671_0103941 | Ga0495671_0103941_459_1214 | 251 |
| 132 | 3300047318 | Ga0495636_0075640 | Ga0495636_0075640_378_1133 | 251 |
| 133 | 3300047319 | Ga0495674_0357337 | Ga0495674_0357337_279_1034 | 251 |
| 134 | 3300047323 | Ga0495683_0067908 | Ga0495683_0067908_172_927 | 251 |
| 135 | 3300048904 | Ga0496101_0051620 | Ga0496101_0051620_2167_2922 | 251 |
| 136 | 3300048905 | Ga0496102_0019548 | Ga0496102_0019548_3172_3927 | 251 |
| 137 | 3300048906 | Ga0496103_0091813 | Ga0496103_0091813_965_1720 | 251 |
| 138 | 3300048907 | Ga0496104_0025964 | Ga0496104_0025964_1193_1948 | 251 |
| 139 | 3300048908 | Ga0496105_0024512 | Ga0496105_0024512_684_1439 | 251 |
| 140 | 3300048909 | Ga0496106_0033602 | Ga0496106_0033602_983_1738 | 251 |
| 141 | 3300048910 | Ga0496107_0174945 | Ga0496107_0174945_171_926 | 251 |
| 142 | 3300048912 | Ga0496109_0064889 | Ga0496109_0064889_1004_1759 | 251 |
| 143 | 3300048913 | Ga0496110_0007162 | Ga0496110_0007162_4519_5274 | 251 |
| 144 | 3300048914 | Ga0496111_0043747 | Ga0496111_0043747_1801_2556 | 251 |
| 145 | 3300048915 | Ga0496112_0019836 | Ga0496112_0019836_1084_1839 | 251 |
| 146 | 3300048916 | Ga0496113_0020841 | Ga0496113_0020841_2163_2918 | 251 |
| 147 | 3300048917 | Ga0496114_0012803 | Ga0496114_0012803_3020_3775 | 251 |
| 148 | 3300048918 | Ga0496115_0359017 | Ga0496115_0359017_117_872 | 251 |
| 149 | 3300048929 | Ga0496126_0110581 | Ga0496126_0110581_899_1654 | 251 |
| 150 | 3300049581 | Ga0501047_0017300 | Ga0501047_0017300_23_778 | 251 |
| 151 | 3300049590 | Ga0501074_0124193 | Ga0501074_0124193_419_1174 | 251 |
| 152 | 3300049742 | Ga0501080_0055113 | Ga0501080_0055113_1951_2706 | 251 |
| 153 | 3300049822 | Ga0501035_0344413 | Ga0501035_0344413_438_1193 | 251 |
| 154 | 3300053077 | Ga0495601_0132443 | Ga0495601_0132443_481_1236 | 251 |
| 155 | 3300006944 | Ga0099823_1023231 | Ga0099823_10232313 | 252 |
| 156 | 3300027296 | Ga0209389_1000009 | Ga0209389_100000937 | 252 |
| 157 | 3300027361 | Ga0209489_100050 | Ga0209489_10005089 | 252 |
| 158 | 3300027363 | Ga0209700_100016 | Ga0209700_100016197 | 252 |
| 159 | 3300006038 | Ga0075365_10102395 | Ga0075365_101023952 | 253 |
| 160 | 3300006177 | Ga0075362_10025252 | Ga0075362_100252522 | 253 |
| 161 | 3300006178 | Ga0075367_10060824 | Ga0075367_100608242 | 253 |
| 162 | 3300006186 | Ga0075369_10036203 | Ga0075369_100362032 | 253 |
| 163 | 3300020069 | Ga0197907_10840968 | Ga0197907_108409683 | 253 |
| 164 | 3300031238 | Ga0265332_10062677 | Ga0265332_100626772 | 253 |
| 165 | 3300044694 | Ga0466963_0011506 | Ga0466963_0011506_660_1454 | 253 |
| 166 | 3300044842 | Ga0466957_0306402 | Ga0466957_0306402_134_928 | 253 |
| 167 | 3300048909 | Ga0496106_0206478 | Ga0496106_0206478_13_960 | 253 |
| 168 | 3300021384 | Ga0213876_10011982 | Ga0213876_100119824 | 254 |
| 169 | 3300039437 | Ga0436365_1239960 | Ga0436365_1239960_5233_6027 | 254 |
| 170 | 3300044765 | Ga0466970_0160623 | Ga0466970_0160623_224_1003 | 254 |
| 171 | 3300061719 | Ga0466962_0036951 | Ga0466962_0036951_1292_2071 | 254 |
| 172 | 3300009174 | Ga0105241_10152017 | Ga0105241_101520171 | 256 |
| 173 | 3300028381 | Ga0268264_10606097 | Ga0268264_106060971 | 256 |
| 174 | 3300048912 | Ga0496109_0196747 | Ga0496109_0196747_405_1175 | 256 |
| 175 | 3300048915 | Ga0496112_0000561 | Ga0496112_0000561_23587_24357 | 256 |
| 176 | 3300005329 | Ga0070683_100044821 | Ga0070683_1000448211 | 257 |
| 177 | 3300005456 | Ga0070678_100570958 | Ga0070678_1005709581 | 257 |
| 178 | 3300006038 | Ga0075365_10313225 | Ga0075365_103132252 | 257 |
| 179 | 3300006051 | Ga0075364_10203775 | Ga0075364_102037752 | 257 |
| 180 | 3300025321 | Ga0207656_10077917 | Ga0207656_100779172 | 257 |
| 181 | 3300025910 | Ga0207684_10167333 | Ga0207684_101673332 | 257 |
| 182 | 3300025914 | Ga0207671_10474990 | Ga0207671_104749901 | 257 |
| 183 | 3300025935 | Ga0207709_10460217 | Ga0207709_104602171 | 257 |
| 184 | 3300025944 | Ga0207661_10044565 | Ga0207661_100445652 | 257 |
| 185 | 3300026067 | Ga0207678_10045244 | Ga0207678_100452443 | 257 |
| 186 | 3300026095 | Ga0207676_10174920 | Ga0207676_101749202 | 257 |
| 187 | 3300026142 | Ga0207698_10018596 | Ga0207698_100185964 | 257 |
| 188 | 3300028381 | Ga0268264_10765828 | Ga0268264_107658281 | 257 |
| 189 | 3300046454 | Ga0495592_0246741 | Ga0495592_0246741_256_1164 | 257 |
| 190 | 3300047472 | Ga0495686_0207877 | Ga0495686_0207877_50_958 | 257 |
| 191 | 3300048929 | Ga0496126_0403380 | Ga0496126_0403380_178_1086 | 257 |
| 192 | 3300050491 | nmdc:mga00v17_211640_c1 | nmdc:mga00v17_211640_c1_49_843 | 257 |
| 193 | 3300053119 | Ga0500595_016429 | Ga0500595_016429_1563_2471 | 257 |
| 194 | 3300041496 | Ga0451839_1236941 | Ga0451839_1236941_55_831 | 258 |
| 195 | 3300050514 | nmdc:mga08x19_10505_c1 | nmdc:mga08x19_10505_c1_4473_5249 | 258 |
| 196 | 3300027671 | Ga0209588_1059248 | Ga0209588_10592481 | 259 |
| 197 | 3300028573 | Ga0265334_10002639 | Ga0265334_100026397 | 259 |
| 198 | 3300031247 | Ga0265340_10086176 | Ga0265340_100861762 | 259 |
| 199 | 3300033180 | Ga0307510_10115602 | Ga0307510_101156023 | 259 |
| 200 | 3300005337 | Ga0070682_100000481 | Ga0070682_10000048111 | 260 |
| 201 | 3300005545 | Ga0070695_100099035 | Ga0070695_1000990352 | 260 |
| 202 | 3300009093 | Ga0105240_10017345 | Ga0105240_100173455 | 260 |
| 203 | 3300035086 | Ga0373934_0009988 | Ga0373934_0009988_1660_2442 | 260 |
| 204 | 3300035117 | Ga0373953_0000324 | Ga0373953_0000324_6799_7581 | 260 |
| 205 | 3300035118 | Ga0373954_0000154 | Ga0373954_0000154_8166_8948 | 260 |
| 206 | 3300035119 | Ga0373956_0001735 | Ga0373956_0001735_1058_1840 | 260 |
| 207 | 3300035170 | Ga0373943_0085321 | Ga0373943_0085321_710_1492 | 260 |
| 208 | 3300035172 | Ga0373955_0002922 | Ga0373955_0002922_4030_4812 | 260 |
| 209 | 3300035695 | Ga0373927_0154988 | Ga0373927_0154988_89_871 | 260 |
| 210 | 3300035724 | Ga0373933_0000619 | Ga0373933_0000619_3900_4682 | 260 |
| 211 | 3300036401 | Ga0373937_0001690 | Ga0373937_0001690_9579_10361 | 260 |
| 212 | 3300037068 | Ga0373925_0540765 | Ga0373925_0540765_69_878 | 260 |
| 213 | 3300042156 | Ga0439446_0000346 | Ga0439446_0000346_2899_3681 | 260 |
| 214 | 3300042436 | Ga0439435_0000284 | Ga0439435_0000284_4421_5203 | 260 |
| 215 | 3300045976 | Ga0466967_0052770 | Ga0466967_0052770_1590_2375 | 260 |
| 216 | 3300046454 | Ga0495592_0055023 | Ga0495592_0055023_1519_2301 | 260 |
| 217 | 3300046459 | Ga0495629_0001324 | Ga0495629_0001324_738_1520 | 260 |
| 218 | 3300046462 | Ga0495651_0070717 | Ga0495651_0070717_1181_1963 | 260 |
| 219 | 3300046463 | Ga0495653_0002693 | Ga0495653_0002693_1142_1924 | 260 |
| 220 | 3300046472 | Ga0495580_0269079 | Ga0495580_0269079_298_1080 | 260 |
| 221 | 3300046511 | Ga0495608_0042374 | Ga0495608_0042374_1467_2249 | 260 |
| 222 | 3300046516 | Ga0495628_0022280 | Ga0495628_0022280_2158_2940 | 260 |
| 223 | 3300046529 | Ga0495652_0000858 | Ga0495652_0000858_13448_14230 | 260 |
| 224 | 3300046533 | Ga0495640_0058304 | Ga0495640_0058304_487_1269 | 260 |
| 225 | 3300046536 | Ga0495587_0036264 | Ga0495587_0036264_1493_2275 | 260 |
| 226 | 3300046559 | Ga0495667_0028389 | Ga0495667_0028389_1467_2249 | 260 |
| 227 | 3300046663 | Ga0495635_0000644 | Ga0495635_0000644_1498_2280 | 260 |
| 228 | 3300046675 | Ga0495657_0065078 | Ga0495657_0065078_464_1246 | 260 |
| 229 | 3300046678 | Ga0495599_0005428 | Ga0495599_0005428_1500_2282 | 260 |
| 230 | 3300046679 | Ga0495623_0004234 | Ga0495623_0004234_3799_4581 | 260 |
| 231 | 3300046680 | Ga0495646_0035505 | Ga0495646_0035505_2204_2986 | 260 |
| 232 | 3300046683 | Ga0495658_0333857 | Ga0495658_0333857_89_871 | 260 |
| 233 | 3300046689 | Ga0495613_0135238 | Ga0495613_0135238_856_1638 | 260 |
| 234 | 3300047317 | Ga0495604_0010041 | Ga0495604_0010041_1505_2287 | 260 |
| 235 | 3300047322 | Ga0495680_0002127 | Ga0495680_0002127_6422_7204 | 260 |
| 236 | 3300047444 | Ga0495675_0001422 | Ga0495675_0001422_12232_13014 | 260 |
| 237 | 3300047471 | Ga0495684_0000380 | Ga0495684_0000380_1152_1934 | 260 |
| 238 | 3300047673 | Ga0495593_0015720 | Ga0495593_0015720_1441_2223 | 260 |
| 239 | 3300048088 | Ga0495602_0040522 | Ga0495602_0040522_2691_3473 | 260 |
| 240 | 3300049580 | Ga0501046_0143868 | Ga0501046_0143868_381_1163 | 260 |
| 241 | 3300053077 | Ga0495601_0038444 | Ga0495601_0038444_1983_2765 | 260 |
| 242 | 3300053085 | Ga0495619_0054634 | Ga0495619_0054634_1170_1952 | 260 |
| 243 | iso_pu_bacteria | 2513237092 | 2513627077 | 260 |
| 244 | iso_pu_bacteria | 2524023228 | 2524534360 | 260 |
| 245 | iso_pu_bacteria | 2528768022 | 2528850386 | 260 |
| 246 | iso_pu_bacteria | 2667528175 | 2671123365 | 260 |
| 247 | iso_pu_bacteria | 2728368998 | 2728753723 | 260 |
| 248 | iso_pu_bacteria | 2744054633 | 2745082769 | 260 |
| 249 | iso_pu_bacteria | 2773857925 | 2774872453 | 260 |
| 250 | iso_pu_bacteria | 2775506901 | 2776261763 | 260 |
| 251 | iso_pu_bacteria | 2791355197 | 2793072291 | 260 |
| 252 | iso_pu_bacteria | 2847930680 | 2847938032 | 260 |
| 253 | iso_pu_bacteria | 2879083081 | 2879084421 | 260 |
| 254 | iso_pu_bacteria | 2885374607 | 2885378106 | 260 |
| 255 | iso_pu_bacteria | 2894232714 | 2894240052 | 260 |
| 256 | iso_pu_bacteria | 2903748898 | 2903754509 | 260 |
| 257 | iso_pu_bacteria | 2906610324 | 2906611343 | 260 |
| 258 | iso_pu_bacteria | 2906626472 | 2906627703 | 260 |
| 259 | iso_pu_bacteria | 2906643746 | 2906647087 | 260 |
| 260 | iso_pu_bacteria | 2908739725 | 2908744923 | 260 |
| 261 | iso_pu_bacteria | 2922425934 | 2922428029 | 260 |
| 262 | iso_pu_bacteria | 2929615660 | 2929619885 | 260 |
| 263 | iso_pu_bacteria | 2929624759 | 2929629197 | 260 |
| 264 | iso_pu_bacteria | 2933577622 | 2933581803 | 260 |
| 265 | iso_pu_bacteria | 2935630451 | 2935632573 | 260 |
| 266 | iso_pu_bacteria | 2941507105 | 2941508763 | 260 |
| 267 | iso_pu_bacteria | 2941515067 | 2941516593 | 260 |
| 268 | iso_pu_bacteria | 2941523033 | 2941524391 | 260 |
| 269 | iso_pu_bacteria | 3005474847 | 3005477730 | 260 |
| 270 | iso_pu_bacteria | 8006933436 | 8006933503 | 260 |
| 271 | iso_pu_bacteria | 8006973647 | 8006983176 | 260 |
| 272 | iso_pu_bacteria | 8019555841 | 8019559394 | 260 |
| 273 | iso_pu_bacteria | 8055742211 | 8055750363 | 260 |
| 274 | iso_pu_bacteria | 8056681323 | 8056689805 | 260 |
| 275 | 3300005334 | Ga0068869_100080041 | Ga0068869_1000800412 | 261 |
| 276 | 3300005440 | Ga0070705_100103853 | Ga0070705_1001038531 | 261 |
| 277 | 3300005546 | Ga0070696_100113243 | Ga0070696_1001132432 | 261 |
| 278 | 3300005564 | Ga0070664_100019941 | Ga0070664_1000199413 | 261 |
| 279 | 3300005614 | Ga0068856_100170576 | Ga0068856_1001705762 | 261 |
| 280 | 3300005985 | Ga0081539_10070587 | Ga0081539_100705871 | 261 |
| 281 | 3300006163 | Ga0070715_10017664 | Ga0070715_100176641 | 261 |
| 282 | 3300009093 | Ga0105240_10071117 | Ga0105240_100711172 | 261 |
| 283 | 3300025906 | Ga0207699_10202351 | Ga0207699_102023512 | 261 |
| 284 | 3300025915 | Ga0207693_10118444 | Ga0207693_101184442 | 261 |
| 285 | 3300027360 | Ga0209969_1009500 | Ga0209969_10095004 | 261 |
| 286 | 3300027364 | Ga0209967_1002962 | Ga0209967_10029622 | 261 |
| 287 | 3300039437 | Ga0436365_0866501 | Ga0436365_0866501_19_804 | 261 |
| 288 | 3300039450 | Ga0436363_1277791 | Ga0436363_1277791_10858_11643 | 261 |
| 289 | 3300039453 | Ga0436362_0587509 | Ga0436362_0587509_275_1060 | 261 |
| 290 | 3300045051 | Ga0451576_0103677 | Ga0451576_0103677_1531_2316 | 261 |
| 291 | 3300045051 | Ga0451576_0129683 | Ga0451576_0129683_553_1344 | 261 |
| 292 | 3300049586 | Ga0501070_0017283 | Ga0501070_0017283_139_924 | 261 |
| 293 | 3300005330 | Ga0070690_100101977 | Ga0070690_1001019772 | 262 |
| 294 | 3300005365 | Ga0070688_100258805 | Ga0070688_1002588052 | 262 |
| 295 | 3300005441 | Ga0070700_100228179 | Ga0070700_1002281792 | 262 |
| 296 | 3300005468 | Ga0070707_100131887 | Ga0070707_1001318872 | 262 |
| 297 | 3300005544 | Ga0070686_100388964 | Ga0070686_1003889642 | 262 |
| 298 | 3300005545 | Ga0070695_100199310 | Ga0070695_1001993102 | 262 |
| 299 | 3300005615 | Ga0070702_100251171 | Ga0070702_1002511712 | 262 |
| 300 | 3300005617 | Ga0068859_100109634 | Ga0068859_1001096343 | 262 |
| 301 | 3300005618 | Ga0068864_100163377 | Ga0068864_1001633772 | 262 |
| 302 | 3300006880 | Ga0075429_100300762 | Ga0075429_1003007622 | 262 |
| 303 | 3300006931 | Ga0097620_100109629 | Ga0097620_1001096293 | 262 |
| 304 | 3300009093 | Ga0105240_10193105 | Ga0105240_101931052 | 262 |
| 305 | 3300009094 | Ga0111539_10069454 | Ga0111539_100694542 | 262 |
| 306 | 3300009094 | Ga0111539_10316134 | Ga0111539_103161342 | 262 |
| 307 | 3300013105 | Ga0157369_10766867 | Ga0157369_107668671 | 262 |
| 308 | 3300013307 | Ga0157372_10127301 | Ga0157372_101273012 | 262 |
| 309 | 3300014326 | Ga0157380_10643843 | Ga0157380_106438432 | 262 |
| 310 | 3300025922 | Ga0207646_10111425 | Ga0207646_101114252 | 262 |
| 311 | 3300026078 | Ga0207702_10027656 | Ga0207702_100276564 | 262 |
| 312 | 3300032002 | Ga0307416_100088314 | Ga0307416_1000883143 | 262 |
| 313 | 3300035117 | Ga0373953_0135959 | Ga0373953_0135959_210_1001 | 262 |
| 314 | 3300036401 | Ga0373937_0039413 | Ga0373937_0039413_1269_2060 | 262 |
| 315 | 3300041486 | Ga0451807_0443856 | Ga0451807_0443856_132_926 | 262 |
| 316 | 3300046678 | Ga0495599_0206741 | Ga0495599_0206741_325_1116 | 262 |
| 317 | 3300050507 | nmdc:mga05p37_287775_c1 | nmdc:mga05p37_287775_c1_1108_1908 | 262 |
| 318 | 3300050508 | nmdc:mga09592_160324_c1 | nmdc:mga09592_160324_c1_660_1454 | 262 |
| 319 | 3300050510 | nmdc:mga06r32_186871_c1 | nmdc:mga06r32_186871_c1_269_1069 | 262 |
| 320 | 3300050511 | nmdc:mga08y16_25146_c1 | nmdc:mga08y16_25146_c1_1057_1851 | 262 |
| 321 | 3300050515 | nmdc:mga0a205_773_c1 | nmdc:mga0a205_773_c1_9260_10048 | 262 |
| 322 | 3300005458 | Ga0070681_10132644 | Ga0070681_101326443 | 263 |
| 323 | 3300006871 | Ga0075434_100019670 | Ga0075434_1000196703 | 263 |
| 324 | 3300006914 | Ga0075436_100139885 | Ga0075436_1001398851 | 263 |
| 325 | 3300025912 | Ga0207707_10083909 | Ga0207707_100839093 | 263 |
| 326 | 3300031731 | Ga0307405_10048949 | Ga0307405_100489492 | 263 |
| 327 | 3300031824 | Ga0307413_10185014 | Ga0307413_101850141 | 263 |
| 328 | 3300031852 | Ga0307410_10023944 | Ga0307410_100239445 | 263 |
| 329 | 3300031995 | Ga0307409_100156889 | Ga0307409_1001568893 | 263 |
| 330 | 3300032002 | Ga0307416_100019675 | Ga0307416_1000196753 | 263 |
| 331 | 3300032004 | Ga0307414_10185483 | Ga0307414_101854832 | 263 |
| 332 | 3300032005 | Ga0307411_10022339 | Ga0307411_100223393 | 263 |
| 333 | 3300050512 | nmdc:mga0n895_1415_c1 | nmdc:mga0n895_1415_c1_2694_3485 | 263 |
| 334 | 3300050514 | nmdc:mga08x19_177929_c1 | nmdc:mga08x19_177929_c1_77_868 | 263 |
| 335 | iso_pu_bacteria | 2513237096 | 2513661041 | 263 |
| 336 | iso_pu_bacteria | 2513237137 | 2513860560 | 263 |
| 337 | iso_pu_bacteria | 2513237145 | 2513918967 | 263 |
| 338 | iso_pu_bacteria | 2517572143 | 2517888290 | 263 |
| 339 | iso_pu_bacteria | 2906635258 | 2906639147 | 263 |
| 340 | iso_pu_bacteria | 2906660503 | 2906666715 | 263 |
| 341 | iso_pu_bacteria | 2935959822 | 2935966263 | 263 |
| 342 | 3300003502 | JGI26143J51219_1000353 | JGI26143J51219_10003532 | 264 |
| 343 | 3300005327 | Ga0070658_10004166 | Ga0070658_100041668 | 264 |
| 344 | 3300005327 | Ga0070658_10165520 | Ga0070658_101655202 | 264 |
| 345 | 3300005329 | Ga0070683_100019712 | Ga0070683_1000197123 | 264 |
| 346 | 3300005331 | Ga0070670_100324373 | Ga0070670_1003243731 | 264 |
| 347 | 3300005336 | Ga0070680_100001078 | Ga0070680_1000010787 | 264 |
| 348 | 3300005336 | Ga0070680_100161887 | Ga0070680_1001618871 | 264 |
| 349 | 3300005336 | Ga0070680_100384078 | Ga0070680_1003840781 | 264 |
| 350 | 3300005338 | Ga0068868_100250741 | Ga0068868_1002507412 | 264 |
| 351 | 3300005341 | Ga0070691_10011437 | Ga0070691_100114374 | 264 |
| 352 | 3300005341 | Ga0070691_10027417 | Ga0070691_100274173 | 264 |
| 353 | 3300005344 | Ga0070661_100109645 | Ga0070661_1001096452 | 264 |
| 354 | 3300005344 | Ga0070661_100138647 | Ga0070661_1001386471 | 264 |
| 355 | 3300005347 | Ga0070668_100354266 | Ga0070668_1003542661 | 264 |
| 356 | 3300005356 | Ga0070674_100157084 | Ga0070674_1001570841 | 264 |
| 357 | 3300005366 | Ga0070659_100171080 | Ga0070659_1001710801 | 264 |
| 358 | 3300005434 | Ga0070709_10015164 | Ga0070709_100151642 | 264 |
| 359 | 3300005435 | Ga0070714_100143918 | Ga0070714_1001439182 | 264 |
| 360 | 3300005435 | Ga0070714_100372398 | Ga0070714_1003723981 | 264 |
| 361 | 3300005439 | Ga0070711_100258933 | Ga0070711_1002589332 | 264 |
| 362 | 3300005444 | Ga0070694_100002954 | Ga0070694_1000029547 | 264 |
| 363 | 3300005456 | Ga0070678_100038480 | Ga0070678_1000384806 | 264 |
| 364 | 3300005456 | Ga0070678_100065266 | Ga0070678_1000652661 | 264 |
| 365 | 3300005457 | Ga0070662_100017449 | Ga0070662_1000174492 | 264 |
| 366 | 3300005457 | Ga0070662_100076593 | Ga0070662_1000765931 | 264 |
| 367 | 3300005458 | Ga0070681_10036488 | Ga0070681_100364882 | 264 |
| 368 | 3300005458 | Ga0070681_10076383 | Ga0070681_100763834 | 264 |
| 369 | 3300005458 | Ga0070681_10083047 | Ga0070681_100830473 | 264 |
| 370 | 3300005458 | Ga0070681_10163471 | Ga0070681_101634712 | 264 |
| 371 | 3300005458 | Ga0070681_10195978 | Ga0070681_101959782 | 264 |
| 372 | 3300005518 | Ga0070699_100016637 | Ga0070699_1000166373 | 264 |
| 373 | 3300005518 | Ga0070699_100037010 | Ga0070699_1000370103 | 264 |
| 374 | 3300005530 | Ga0070679_100012870 | Ga0070679_1000128707 | 264 |
| 375 | 3300005530 | Ga0070679_100043723 | Ga0070679_1000437233 | 264 |
| 376 | 3300005530 | Ga0070679_100070045 | Ga0070679_1000700454 | 264 |
| 377 | 3300005530 | Ga0070679_100412269 | Ga0070679_1004122691 | 264 |
| 378 | 3300005535 | Ga0070684_100072813 | Ga0070684_1000728132 | 264 |
| 379 | 3300005539 | Ga0068853_100072609 | Ga0068853_1000726092 | 264 |
| 380 | 3300005545 | Ga0070695_100002088 | Ga0070695_1000020886 | 264 |
| 381 | 3300005548 | Ga0070665_100249931 | Ga0070665_1002499312 | 264 |
| 382 | 3300005563 | Ga0068855_100006227 | Ga0068855_1000062272 | 264 |
| 383 | 3300005563 | Ga0068855_100668946 | Ga0068855_1006689461 | 264 |
| 384 | 3300005563 | Ga0068855_100735727 | Ga0068855_1007357271 | 264 |
| 385 | 3300005563 | Ga0068855_100815194 | Ga0068855_1008151942 | 264 |
| 386 | 3300005564 | Ga0070664_100229313 | Ga0070664_1002293132 | 264 |
| 387 | 3300005577 | Ga0068857_100228895 | Ga0068857_1002288952 | 264 |
| 388 | 3300005577 | Ga0068857_100560075 | Ga0068857_1005600751 | 264 |
| 389 | 3300005578 | Ga0068854_100533575 | Ga0068854_1005335752 | 264 |
| 390 | 3300005614 | Ga0068856_100014174 | Ga0068856_1000141743 | 264 |
| 391 | 3300005616 | Ga0068852_100046705 | Ga0068852_1000467053 | 264 |
| 392 | 3300005719 | Ga0068861_100395334 | Ga0068861_1003953342 | 264 |
| 393 | 3300005841 | Ga0068863_100168180 | Ga0068863_1001681802 | 264 |
| 394 | 3300005842 | Ga0068858_100119853 | Ga0068858_1001198533 | 264 |
| 395 | 3300005937 | Ga0081455_10031659 | Ga0081455_100316592 | 264 |
| 396 | 3300005937 | Ga0081455_10073009 | Ga0081455_100730092 | 264 |
| 397 | 3300005983 | Ga0081540_1099687 | Ga0081540_10996872 | 264 |
| 398 | 3300006058 | Ga0075432_10042468 | Ga0075432_100424682 | 264 |
| 399 | 3300006175 | Ga0070712_100256862 | Ga0070712_1002568622 | 264 |
| 400 | 3300006358 | Ga0068871_100255653 | Ga0068871_1002556532 | 264 |
| 401 | 3300006844 | Ga0075428_100127951 | Ga0075428_1001279512 | 264 |
| 402 | 3300006847 | Ga0075431_100290547 | Ga0075431_1002905471 | 264 |
| 403 | 3300006847 | Ga0075431_100505121 | Ga0075431_1005051212 | 264 |
| 404 | 3300006852 | Ga0075433_10014494 | Ga0075433_100144943 | 264 |
| 405 | 3300006852 | Ga0075433_10176527 | Ga0075433_101765273 | 264 |
| 406 | 3300006871 | Ga0075434_100302801 | Ga0075434_1003028012 | 264 |
| 407 | 3300006871 | Ga0075434_100351460 | Ga0075434_1003514602 | 264 |
| 408 | 3300006914 | Ga0075436_100000048 | Ga0075436_10000004866 | 264 |
| 409 | 3300006914 | Ga0075436_100170458 | Ga0075436_1001704582 | 264 |
| 410 | 3300006942 | Ga0099824_1004050 | Ga0099824_100405015 | 264 |
| 411 | 3300006943 | Ga0099822_1000838 | Ga0099822_100083826 | 264 |
| 412 | 3300007265 | Ga0099794_10008323 | Ga0099794_100083235 | 264 |
| 413 | 3300009093 | Ga0105240_10022961 | Ga0105240_100229617 | 264 |
| 414 | 3300009094 | Ga0111539_10007553 | Ga0111539_100075539 | 264 |
| 415 | 3300009147 | Ga0114129_10046650 | Ga0114129_100466508 | 264 |
| 416 | 3300009147 | Ga0114129_10527887 | Ga0114129_105278872 | 264 |
| 417 | 3300009174 | Ga0105241_10175767 | Ga0105241_101757672 | 264 |
| 418 | 3300009545 | Ga0105237_10052651 | Ga0105237_100526513 | 264 |
| 419 | 3300009545 | Ga0105237_10207462 | Ga0105237_102074623 | 264 |
| 420 | 3300011119 | Ga0105246_10438842 | Ga0105246_104388421 | 264 |
| 421 | 3300013100 | Ga0157373_10208552 | Ga0157373_102085523 | 264 |
| 422 | 3300013104 | Ga0157370_10037773 | Ga0157370_100377734 | 264 |
| 423 | 3300013104 | Ga0157370_10095545 | Ga0157370_100955451 | 264 |
| 424 | 3300013105 | Ga0157369_10008770 | Ga0157369_100087704 | 264 |
| 425 | 3300013105 | Ga0157369_10015054 | Ga0157369_100150544 | 264 |
| 426 | 3300013307 | Ga0157372_10064962 | Ga0157372_100649622 | 264 |
| 427 | 3300013307 | Ga0157372_10106574 | Ga0157372_101065743 | 264 |
| 428 | 3300013307 | Ga0157372_10445358 | Ga0157372_104453582 | 264 |
| 429 | 3300014969 | Ga0157376_10033332 | Ga0157376_100333325 | 264 |
| 430 | 3300020081 | Ga0206354_10314709 | Ga0206354_103147092 | 264 |
| 431 | 3300020082 | Ga0206353_10361580 | Ga0206353_103615803 | 264 |
| 432 | 3300020082 | Ga0206353_10796463 | Ga0206353_107964631 | 264 |
| 433 | 3300021361 | Ga0213872_10031020 | Ga0213872_100310203 | 264 |
| 434 | 3300021361 | Ga0213872_10057692 | Ga0213872_100576922 | 264 |
| 435 | 3300021377 | Ga0213874_10006912 | Ga0213874_100069122 | 264 |
| 436 | 3300022467 | Ga0224712_10004141 | Ga0224712_100041413 | 264 |
| 437 | 3300025254 | Ga0209148_1007840 | Ga0209148_10078401 | 264 |
| 438 | 3300025254 | Ga0209148_1008086 | Ga0209148_10080861 | 264 |
| 439 | 3300025261 | Ga0209233_1002084 | Ga0209233_10020845 | 264 |
| 440 | 3300025261 | Ga0209233_1003813 | Ga0209233_10038132 | 264 |
| 441 | 3300025272 | Ga0209455_1008935 | Ga0209455_10089351 | 264 |
| 442 | 3300025272 | Ga0209455_1017412 | Ga0209455_10174122 | 264 |
| 443 | 3300025302 | Ga0207426_1011926 | Ga0207426_10119262 | 264 |
| 444 | 3300025315 | Ga0207697_10063829 | Ga0207697_100638292 | 264 |
| 445 | 3300025900 | Ga0207710_10141853 | Ga0207710_101418531 | 264 |
| 446 | 3300025904 | Ga0207647_10232339 | Ga0207647_102323391 | 264 |
| 447 | 3300025906 | Ga0207699_10283237 | Ga0207699_102832372 | 264 |
| 448 | 3300025909 | Ga0207705_10020951 | Ga0207705_100209512 | 264 |
| 449 | 3300025912 | Ga0207707_10006487 | Ga0207707_100064873 | 264 |
| 450 | 3300025912 | Ga0207707_10050125 | Ga0207707_100501253 | 264 |
| 451 | 3300025913 | Ga0207695_10014945 | Ga0207695_100149451 | 264 |
| 452 | 3300025913 | Ga0207695_10045551 | Ga0207695_100455513 | 264 |
| 453 | 3300025913 | Ga0207695_10139798 | Ga0207695_101397982 | 264 |
| 454 | 3300025913 | Ga0207695_10144255 | Ga0207695_101442551 | 264 |
| 455 | 3300025913 | Ga0207695_10193589 | Ga0207695_101935893 | 264 |
| 456 | 3300025913 | Ga0207695_10215948 | Ga0207695_102159481 | 264 |
| 457 | 3300025913 | Ga0207695_10530410 | Ga0207695_105304101 | 264 |
| 458 | 3300025914 | Ga0207671_10073045 | Ga0207671_100730453 | 264 |
| 459 | 3300025914 | Ga0207671_10229534 | Ga0207671_102295341 | 264 |
| 460 | 3300025916 | Ga0207663_10279147 | Ga0207663_102791472 | 264 |
| 461 | 3300025917 | Ga0207660_10004857 | Ga0207660_100048577 | 264 |
| 462 | 3300025919 | Ga0207657_10090112 | Ga0207657_100901122 | 264 |
| 463 | 3300025920 | Ga0207649_10415838 | Ga0207649_104158381 | 264 |
| 464 | 3300025921 | Ga0207652_10002046 | Ga0207652_1000204611 | 264 |
| 465 | 3300025921 | Ga0207652_10226646 | Ga0207652_102266462 | 264 |
| 466 | 3300025921 | Ga0207652_10244131 | Ga0207652_102441312 | 264 |
| 467 | 3300025921 | Ga0207652_10245021 | Ga0207652_102450211 | 264 |
| 468 | 3300025924 | Ga0207694_10242777 | Ga0207694_102427772 | 264 |
| 469 | 3300025929 | Ga0207664_10096149 | Ga0207664_100961492 | 264 |
| 470 | 3300025929 | Ga0207664_10102465 | Ga0207664_101024653 | 264 |
| 471 | 3300025933 | Ga0207706_10014388 | Ga0207706_100143885 | 264 |
| 472 | 3300025933 | Ga0207706_10028860 | Ga0207706_100288602 | 264 |
| 473 | 3300025933 | Ga0207706_10105288 | Ga0207706_101052882 | 264 |
| 474 | 3300025937 | Ga0207669_10121483 | Ga0207669_101214831 | 264 |
| 475 | 3300025944 | Ga0207661_10004194 | Ga0207661_100041949 | 264 |
| 476 | 3300025944 | Ga0207661_10037431 | Ga0207661_100374311 | 264 |
| 477 | 3300025949 | Ga0207667_10017399 | Ga0207667_100173992 | 264 |
| 478 | 3300025949 | Ga0207667_10708174 | Ga0207667_107081741 | 264 |
| 479 | 3300025960 | Ga0207651_10525831 | Ga0207651_105258311 | 264 |
| 480 | 3300025961 | Ga0207712_10182678 | Ga0207712_101826782 | 264 |
| 481 | 3300025972 | Ga0207668_10295080 | Ga0207668_102950802 | 264 |
| 482 | 3300026023 | Ga0207677_10251699 | Ga0207677_102516992 | 264 |
| 483 | 3300026035 | Ga0207703_10462181 | Ga0207703_104621811 | 264 |
| 484 | 3300026041 | Ga0207639_10079945 | Ga0207639_100799452 | 264 |
| 485 | 3300026041 | Ga0207639_10334420 | Ga0207639_103344202 | 264 |
| 486 | 3300026075 | Ga0207708_10105451 | Ga0207708_101054512 | 264 |
| 487 | 3300026078 | Ga0207702_10090941 | Ga0207702_100909411 | 264 |
| 488 | 3300026089 | Ga0207648_10487037 | Ga0207648_104870371 | 264 |
| 489 | 3300026116 | Ga0207674_10022908 | Ga0207674_100229087 | 264 |
| 490 | 3300026118 | Ga0207675_100250651 | Ga0207675_1002506512 | 264 |
| 491 | 3300026121 | Ga0207683_10036901 | Ga0207683_100369013 | 264 |
| 492 | 3300026121 | Ga0207683_10051441 | Ga0207683_100514412 | 264 |
| 493 | 3300026142 | Ga0207698_10041118 | Ga0207698_100411182 | 264 |
| 494 | 3300026142 | Ga0207698_10380746 | Ga0207698_103807461 | 264 |
| 495 | 3300027357 | Ga0209589_1000007 | Ga0209589_1000007195 | 264 |
| 496 | 3300027360 | Ga0209969_1003934 | Ga0209969_10039341 | 264 |
| 497 | 3300027360 | Ga0209969_1014151 | Ga0209969_10141511 | 264 |
| 498 | 3300027361 | Ga0209489_100008 | Ga0209489_100008195 | 264 |
| 499 | 3300027363 | Ga0209700_100009 | Ga0209700_100009195 | 264 |
| 500 | 3300027364 | Ga0209967_1009637 | Ga0209967_10096372 | 264 |
| 501 | 3300027378 | Ga0209981_1007002 | Ga0209981_10070022 | 264 |
| 502 | 3300027395 | Ga0209996_1007316 | Ga0209996_10073162 | 264 |
| 503 | 3300027462 | Ga0210000_1000898 | Ga0210000_10008982 | 264 |
| 504 | 3300027526 | Ga0209968_1001999 | Ga0209968_10019993 | 264 |
| 505 | 3300027543 | Ga0209999_1003048 | Ga0209999_10030482 | 264 |
| 506 | 3300027552 | Ga0209982_1001411 | Ga0209982_10014112 | 264 |
| 507 | 3300027617 | Ga0210002_1004158 | Ga0210002_10041581 | 264 |
| 508 | 3300027665 | Ga0209983_1002175 | Ga0209983_10021755 | 264 |
| 509 | 3300027682 | Ga0209971_1000022 | Ga0209971_100002237 | 264 |
| 510 | 3300027695 | Ga0209966_1000218 | Ga0209966_10002185 | 264 |
| 511 | 3300027695 | Ga0209966_1010184 | Ga0209966_10101841 | 264 |
| 512 | 3300027717 | Ga0209998_10000283 | Ga0209998_100002832 | 264 |
| 513 | 3300027717 | Ga0209998_10018368 | Ga0209998_100183681 | 264 |
| 514 | 3300027876 | Ga0209974_10000598 | Ga0209974_100005982 | 264 |
| 515 | 3300027876 | Ga0209974_10032184 | Ga0209974_100321842 | 264 |
| 516 | 3300027907 | Ga0207428_10002151 | Ga0207428_1000215112 | 264 |
| 517 | 3300031238 | Ga0265332_10091458 | Ga0265332_100914581 | 264 |
| 518 | 3300031249 | Ga0265339_10003896 | Ga0265339_100038965 | 264 |
| 519 | 3300031251 | Ga0265327_10009058 | Ga0265327_100090582 | 264 |
| 520 | 3300031344 | Ga0265316_10067456 | Ga0265316_100674562 | 264 |
| 521 | 3300031507 | Ga0307509_10240038 | Ga0307509_102400382 | 264 |
| 522 | 3300031712 | Ga0265342_10083224 | Ga0265342_100832241 | 264 |
| 523 | 3300031995 | Ga0307409_100437748 | Ga0307409_1004377481 | 264 |
| 524 | 3300032002 | Ga0307416_100099173 | Ga0307416_1000991734 | 264 |
| 525 | 3300033180 | Ga0307510_10040464 | Ga0307510_100404645 | 264 |
| 526 | 3300035120 | Ga0373957_0021496 | Ga0373957_0021496_1324_2142 | 264 |
| 527 | 3300035207 | Ga0373942_0004077 | Ga0373942_0004077_859_1656 | 264 |
| 528 | 3300036401 | Ga0373937_0297793 | Ga0373937_0297793_452_1270 | 264 |
| 529 | 3300037312 | Ga0395899_0038114 | Ga0395899_0038114_1263_2057 | 264 |
| 530 | 3300037418 | Ga0395900_0066506 | Ga0395900_0066506_581_1375 | 264 |
| 531 | 3300037418 | Ga0395900_0073274 | Ga0395900_0073274_320_1114 | 264 |
| 532 | 3300038443 | Ga0395901_0002599 | Ga0395901_0002599_15390_16184 | 264 |
| 533 | 3300038443 | Ga0395901_0061217 | Ga0395901_0061217_111_905 | 264 |
| 534 | 3300038996 | Ga0242420_005503 | Ga0242420_005503_1103_1897 | 264 |
| 535 | 3300039447 | Ga0436361_1119451 | Ga0436361_1119451_19_813 | 264 |
| 536 | 3300042439 | Ga0439464_0001129 | Ga0439464_0001129_2470_3264 | 264 |
| 537 | 3300042461 | Ga0439460_0002903 | Ga0439460_0002903_1221_2015 | 264 |
| 538 | 3300042876 | Ga0451577_0045968 | Ga0451577_0045968_1666_2499 | 264 |
| 539 | 3300042876 | Ga0451577_0149817 | Ga0451577_0149817_834_1628 | 264 |
| 540 | 3300044673 | Ga0453683_0055425 | Ga0453683_0055425_722_1594 | 264 |
| 541 | 3300044712 | Ga0453684_0018602 | Ga0453684_0018602_421_1215 | 264 |
| 542 | 3300044712 | Ga0453684_0169548 | Ga0453684_0169548_334_1224 | 264 |
| 543 | 3300045051 | Ga0451576_0181167 | Ga0451576_0181167_1336_2130 | 264 |
| 544 | 3300045976 | Ga0466967_0228595 | Ga0466967_0228595_319_1113 | 264 |
| 545 | 3300045976 | Ga0466967_0251418 | Ga0466967_0251418_614_1486 | 264 |
| 546 | 3300045976 | Ga0466967_0377720 | Ga0466967_0377720_459_1253 | 264 |
| 547 | 3300046454 | Ga0495592_0167327 | Ga0495592_0167327_167_985 | 264 |
| 548 | 3300046462 | Ga0495651_0004057 | Ga0495651_0004057_8448_9266 | 264 |
| 549 | 3300046525 | Ga0495663_0041937 | Ga0495663_0041937_287_1081 | 264 |
| 550 | 3300049569 | Ga0501032_0022974 | Ga0501032_0022974_2262_3113 | 264 |
| 551 | 3300049571 | Ga0501034_0000266 | Ga0501034_0000266_20564_21433 | 264 |
| 552 | 3300049571 | Ga0501034_0002518 | Ga0501034_0002518_15207_16001 | 264 |
| 553 | 3300049573 | Ga0501037_0001462 | Ga0501037_0001462_128_979 | 264 |
| 554 | 3300049574 | Ga0501038_0007952 | Ga0501038_0007952_376_1227 | 264 |
| 555 | 3300049575 | Ga0501039_0004154 | Ga0501039_0004154_5417_6268 | 264 |
| 556 | 3300049575 | Ga0501039_0092106 | Ga0501039_0092106_123_917 | 264 |
| 557 | 3300049576 | Ga0501040_0004355 | Ga0501040_0004355_4907_5701 | 264 |
| 558 | 3300049577 | Ga0501041_0127381 | Ga0501041_0127381_691_1485 | 264 |
| 559 | 3300049578 | Ga0501042_0007623 | Ga0501042_0007623_1835_2629 | 264 |
| 560 | 3300049578 | Ga0501042_0139771 | Ga0501042_0139771_246_1097 | 264 |
| 561 | 3300049579 | Ga0501043_0015876 | Ga0501043_0015876_3582_4433 | 264 |
| 562 | 3300049580 | Ga0501046_0000274 | Ga0501046_0000274_4896_5690 | 264 |
| 563 | 3300049580 | Ga0501046_0057394 | Ga0501046_0057394_2130_2981 | 264 |
| 564 | 3300049581 | Ga0501047_0124986 | Ga0501047_0124986_1640_2434 | 264 |
| 565 | 3300049582 | Ga0501048_0057841 | Ga0501048_0057841_634_1428 | 264 |
| 566 | 3300049583 | Ga0501067_0007660 | Ga0501067_0007660_2326_3120 | 264 |
| 567 | 3300049583 | Ga0501067_0233689 | Ga0501067_0233689_207_1001 | 264 |
| 568 | 3300049584 | Ga0501068_0035217 | Ga0501068_0035217_810_1604 | 264 |
| 569 | 3300049585 | Ga0501069_0218747 | Ga0501069_0218747_214_1008 | 264 |
| 570 | 3300049587 | Ga0501071_0311941 | Ga0501071_0311941_112_906 | 264 |
| 571 | 3300049590 | Ga0501074_0012078 | Ga0501074_0012078_579_1373 | 264 |
| 572 | 3300049591 | Ga0501075_0020905 | Ga0501075_0020905_1185_1979 | 264 |
| 573 | 3300049592 | Ga0501076_0438312 | Ga0501076_0438312_161_955 | 264 |
| 574 | 3300049593 | Ga0501077_0064626 | Ga0501077_0064626_782_1576 | 264 |
| 575 | 3300049741 | Ga0501079_0001294 | Ga0501079_0001294_13870_14664 | 264 |
| 576 | 3300049743 | Ga0501081_0009318 | Ga0501081_0009318_690_1484 | 264 |
| 577 | 3300049744 | Ga0501083_0078583 | Ga0501083_0078583_112_906 | 264 |
| 578 | 3300049822 | Ga0501035_0024945 | Ga0501035_0024945_2199_3050 | 264 |
| 579 | 3300049822 | Ga0501035_0256049 | Ga0501035_0256049_134_928 | 264 |
| 580 | 3300049823 | Ga0501044_0146979 | Ga0501044_0146979_924_1727 | 264 |
| 581 | 3300049824 | Ga0501045_0010223 | Ga0501045_0010223_4913_5707 | 264 |
| 582 | 3300050507 | nmdc:mga05p37_55915_c1 | nmdc:mga05p37_55915_c1_935_1729 | 264 |
| 583 | 3300050511 | nmdc:mga08y16_17600_c1 | nmdc:mga08y16_17600_c1_3608_4480 | 264 |
| 584 | 3300050512 | nmdc:mga0n895_326612_c1 | nmdc:mga0n895_326612_c1_471_1265 | 264 |
| 585 | 3300050512 | nmdc:mga0n895_339750_c1 | nmdc:mga0n895_339750_c1_298_1092 | 264 |
| 586 | 3300050514 | nmdc:mga08x19_12681_c1 | nmdc:mga08x19_12681_c1_3291_4085 | 264 |
| 587 | 3300050514 | nmdc:mga08x19_348_c1 | nmdc:mga08x19_348_c1_13154_13948 | 264 |
| 588 | 3300050515 | nmdc:mga0a205_8519_c1 | nmdc:mga0a205_8519_c1_3677_4549 | 264 |
| 589 | 3300053105 | Ga0500557_038035 | Ga0500557_038035_443_1237 | 264 |
| 590 | 3300054114 | Ga0501084_0001144 | Ga0501084_0001144_15045_15839 | 264 |
| 591 | 3300060353 | Ga0501082_0000973 | Ga0501082_0000973_19599_20393 | 264 |
| 592 | 3300060353 | Ga0501082_0611262 | Ga0501082_0611262_18_812 | 264 |
| 593 | 3300061734 | Ga0530510_0114640 | Ga0530510_0114640_1048_1842 | 264 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7jka-assembly1.cif.gz_A | dienelactone hydrolase family protein m3dlh from halieaceae bacterium | 0.955 | 21 | 261 |
| 7jka-assembly1.cif.gz_A | dienelactone hydrolase family protein m3dlh from halieaceae bacterium | 0.9434 | 21 | 261 |
| 7jiz-assembly1.cif.gz_B | dienelactone hydrolase family protein scdlh from solimonas sp. k1w22b-7 | 0.9252 | 21 | 261 |
| 4zi5-assembly1.cif.gz_B | crystal structure of dienelactone hydrolase-like promiscuous phospotriesterase p91 from metagenomic libraries | 0.9209 | 21 | 261 |
| 7jiz-assembly1.cif.gz_B | dienelactone hydrolase family protein scdlh from solimonas sp. k1w22b-7 | 0.9178 | 21 | 261 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q18927_1_243_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9329 | 21 | 261 | 3.40.50.1820 |
| af_Q18925_2_245_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9282 | 23 | 261 | 3.40.50.1820 |
| af_Q18927_1_243_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9218 | 21 | 261 | 3.40.50.1820 |
| af_O17263_18_263_3.40.50.1820 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9214 | 19 | 259 | 3.40.50.1820 |
| 4zi5A00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain | 0.9207 | 21 | 261 | 3.40.50.1820 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A5N7MHY7-F1-model_v4 | Dienelactone hydrolase family protein | 0.9944 | 14 | 263 |
GO:0052689
|
| AF-A0A5N7MHY7-F1-model_v4 | Dienelactone hydrolase family protein | 0.9866 | 14 | 263 |
GO:0052689
|
| AF-A0A2D5TYZ1-F1-model_v4 | Dienelactone hydrolase | 0.9826 | 21 | 261 |
GO:0052689
|
| AF-A0A847F251-F1-model_v4 | Dienelactone hydrolase family protein | 0.9791 | 21 | 260 |
GO:0052689
|
| AF-A0A3T0K4T0-F1-model_v4 | deleted | 0.9776 | 20 | 263 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar