F467185

General Info

Members Datasets Scaffolds Average Seq Length
593 362 1186 85

Family's Representative Sequence

Representative Sequence 3300003775|Ga0055524_1027828|Ga0055524_10278282
Length 98
Sequence MCERDGLIGAIRPLWKNPMSAHPDQKQLLHLVFGGELDSLEGITFKDLAKLDIVGIYPNYATAHTAWKAKAQQTVDQAQTRYFIVHLHRLLDPETAAG

Samples

Sample ID Description Type Environment
1 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
4 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
5 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
6 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
7 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
8 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
9 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
10 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
11 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
12 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
13 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
14 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
15 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
16 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
17 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
18 3300003503 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM Metagenome Rhizosphere
19 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
20 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
21 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
23 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
24 3300005277 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2) Metagenome Rhizosphere
25 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
26 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
27 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
28 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
29 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
30 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
31 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
32 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
33 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
34 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
35 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
36 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
37 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
38 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
39 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
40 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
41 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
42 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
43 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
44 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
45 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
46 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
47 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
48 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
55 3300005507 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2) Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
74 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
75 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
76 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
77 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
78 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
79 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
80 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
81 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
82 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
83 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
84 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
85 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
86 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
90 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
91 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
92 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
93 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
94 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
95 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
96 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
97 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
99 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
100 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
103 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
104 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
105 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
106 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
109 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
110 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
111 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
112 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
113 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
114 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
115 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
116 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
117 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
118 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
119 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
120 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
121 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
122 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
123 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
124 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
125 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
126 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
127 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
128 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
129 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
131 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
132 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
134 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
136 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
138 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
190 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
194 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
195 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
196 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
197 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
198 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
199 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
200 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
201 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
202 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
203 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
204 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
205 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
206 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
207 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
208 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
209 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
210 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
211 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
212 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
213 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
214 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
215 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
216 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
217 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
218 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
219 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
220 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
221 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
222 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
223 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
224 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
225 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
226 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
227 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
228 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
229 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
230 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
231 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
232 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
233 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
234 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
235 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
236 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
237 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
238 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
239 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
240 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
241 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
242 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
243 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
244 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
245 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
246 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
247 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
248 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
249 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
250 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
251 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
252 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
253 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
254 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
255 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
256 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
257 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
258 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
259 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
260 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
261 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
262 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
263 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
264 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
265 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
266 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
267 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
268 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
269 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
270 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
271 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
272 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
273 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
274 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
275 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
276 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
277 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
278 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
279 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
280 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
281 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
282 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
283 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
284 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
285 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
286 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
287 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
288 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
289 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
290 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
291 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
292 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
293 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
294 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
295 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
296 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
297 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
298 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
299 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
300 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
301 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
302 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
305 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
311 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
312 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
316 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
317 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
318 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
319 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
320 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
321 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
322 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
323 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
324 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
325 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
326 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
327 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
328 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
329 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
330 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
331 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
332 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
334 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
335 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
336 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
337 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
338 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
339 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
340 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
341 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
342 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
343 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
344 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
345 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
346 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
347 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
348 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
349 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
350 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
351 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
352 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
353 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
354 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
355 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
356 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
357 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
358 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
359 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
360 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
361 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
362 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.77
Nodule 0
Rhizoplane 4.55
Rhizosphere 83.47
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055524_1027828 3300003775 Bacteria 1706
2 SwRhRL2b_contig_1015587 2162886007 Bacteria 1305
3 2214767426 2209111006 Bacteria 2785
4 ARcpr5oldR_c000253 3300000041 Bacteria 8505
5 ARSoilYngRDRAFT_c00281 3300000042 Bacteria 7534
6 ARcpr5yngRDRAFT_c002660 3300000043 Bacteria 1837
7 ARSoilOldRDRAFT_c000231 3300000044 Bacteria 8483
8 ARCol0oldRDRAFT_c00994 3300000045 Bacteria 2167
9 ARCol0yngRDRAFT_1000260 3300000652 Bacteria 8518
10 JGI24737J22298_10020391 3300001990 Bacteria 2116
11 JGI24750J21931_1004571 3300002070 Bacteria 1681
12 JGI24035J26624_1001130 3300002126 Bacteria 2528
13 JGI24034J26672_10029907 3300002239 Bacteria 883
14 JGI24751J29686_10073052 3300002459 Bacteria 708
15 JGI25159J45721_1021639 3300002987 Bacteria 1207
16 JGI25151J46595_10000018 3300003187 Bacteria 238438
17 JGI25151J46595_10034061 3300003187 Bacteria 1952
18 JGI25153J46596_10004251 3300003215 Bacteria 7749
19 JGI26141J51220_1016149 3300003503 Bacteria 512
20 Ga0055526_1000362 3300003771 Bacteria 36713
21 Ga0055526_1000571 3300003771 Bacteria 29048
22 Ga0055524_1000048 3300003775 Bacteria 149598
23 Ga0055534_1008656 3300003784 Bacteria 2285
24 JGI25405J52794_10051040 3300003911 Bacteria 886
25 Ga0065165_1000337 3300005262 Bacteria 76914
26 Ga0065717_1002397 3300005276 Bacteria 2048
27 Ga0065716_1001908 3300005277 Bacteria 2776
28 Ga0065714_10369378 3300005288 Bacteria 617
29 Ga0065704_10109412 3300005289 Bacteria 2004
30 Ga0065712_10078300 3300005290 Bacteria 3367
31 Ga0065715_10001249 3300005293 Bacteria 14318
32 Ga0065707_10126362 3300005295 Bacteria 2004
33 Ga0070683_102352263 3300005329 Bacteria 511
34 Ga0070690_100353756 3300005330 Bacteria 1067
35 Ga0070677_10222450 3300005333 Bacteria 923
36 Ga0070666_10499724 3300005335 Bacteria 882
37 Ga0070680_101874744 3300005336 Bacteria 520
38 Ga0070660_100171040 3300005339 Bacteria 1755
39 Ga0070660_101105022 3300005339 Bacteria 671
40 Ga0070689_100005511 3300005340 Bacteria 8652
41 Ga0070689_100132519 3300005340 Bacteria 1999
42 Ga0070689_100418910 3300005340 Bacteria 1135
43 Ga0070691_10738551 3300005341 Bacteria 594
44 Ga0070668_100110155 3300005347 Bacteria 2191
45 Ga0070668_100347040 3300005347 Bacteria 1255
46 Ga0070675_100372984 3300005354 Bacteria 1269
47 Ga0070671_100923777 3300005355 Bacteria 763
48 Ga0070674_100106760 3300005356 Bacteria 2049
49 Ga0070688_100196206 3300005365 Bacteria 1409
50 Ga0070713_100803507 3300005436 Bacteria 902
51 Ga0070710_10723997 3300005437 Bacteria 704
52 Ga0070710_11139953 3300005437 Bacteria 574
53 Ga0070711_100645935 3300005439 Bacteria 887
54 Ga0070700_100229568 3300005441 Bacteria 1320
55 Ga0070700_100879773 3300005441 Bacteria 728
56 Ga0070694_100259073 3300005444 Bacteria 1319
57 Ga0070708_100032775 3300005445 Bacteria 4509
58 Ga0070663_101606501 3300005455 Bacteria 580
59 Ga0070678_102311431 3300005456 Bacteria 510
60 Ga0070662_101043268 3300005457 Bacteria 701
61 Ga0070681_10737194 3300005458 Bacteria 902
62 Ga0068867_100190787 3300005459 Bacteria 1635
63 Ga0068867_100312173 3300005459 Bacteria 1300
64 Ga0068867_101644605 3300005459 Bacteria 601
65 Ga0070685_10083256 3300005466 Bacteria 1922
66 Ga0074259_11049951 3300005507 Bacteria 632
67 Ga0070679_100160756 3300005530 Bacteria 2221
68 Ga0070679_100219484 3300005530 Bacteria 1863
69 Ga0070679_100755994 3300005530 Bacteria 915
70 Ga0070679_101737760 3300005530 Bacteria 572
71 Ga0068853_100088489 3300005539 Bacteria 2719
72 Ga0070672_100651401 3300005543 Bacteria 920
73 Ga0070686_101131385 3300005544 Bacteria 648
74 Ga0070704_100774390 3300005549 Bacteria 856
75 Ga0068855_100109516 3300005563 Bacteria 3172
76 Ga0070664_101830047 3300005564 Bacteria 576
77 Ga0068857_100329950 3300005577 Bacteria 1410
78 Ga0068857_101536523 3300005577 Bacteria 649
79 Ga0068854_100134111 3300005578 Bacteria 1894
80 Ga0068856_101829695 3300005614 Bacteria 619
81 Ga0070702_100358261 3300005615 Bacteria 1030
82 Ga0068859_100026561 3300005617 Bacteria 5806
83 Ga0068859_100636361 3300005617 Bacteria 1159
84 Ga0068864_101185269 3300005618 Bacteria 762
85 Ga0068866_10194266 3300005718 Bacteria 1208
86 Ga0068861_100723613 3300005719 Bacteria 927
87 Ga0068851_10521056 3300005834 Bacteria 715
88 Ga0068858_100017088 3300005842 Bacteria 6809
89 Ga0068862_100930873 3300005844 Bacteria 856
90 Ga0081455_10000110 3300005937 Bacteria 92459
91 Ga0081540_1161839 3300005983 Bacteria 867
92 Ga0081539_10181037 3300005985 Bacteria 988
93 Ga0075365_10029225 3300006038 Bacteria 3521
94 Ga0075368_10135504 3300006042 Bacteria 1025
95 Ga0075368_10514054 3300006042 Bacteria 535
96 Ga0075364_10108738 3300006051 Bacteria 1849
97 Ga0075364_10469646 3300006051 Bacteria 860
98 Ga0075364_10571059 3300006051 Bacteria 773
99 Ga0075432_10028305 3300006058 Bacteria 1933
100 Ga0075432_10201207 3300006058 Bacteria 788
101 Ga0070712_100086102 3300006175 Bacteria 2289
102 Ga0075362_10157543 3300006177 Bacteria 1092
103 Ga0075362_10298600 3300006177 Bacteria 799
104 Ga0075367_10243956 3300006178 Bacteria 1126
105 Ga0075369_10189743 3300006186 Bacteria 947
106 Ga0075427_10003863 3300006194 Bacteria 2090
107 Ga0075366_10005461 3300006195 Bacteria 6889
108 Ga0097621_100649154 3300006237 Bacteria 968
109 Ga0097621_100840131 3300006237 Bacteria 853
110 Ga0097621_101781068 3300006237 Bacteria 587
111 Ga0068871_101419230 3300006358 Bacteria 655
112 Ga0075428_100002521 3300006844 Bacteria 19905
113 Ga0075430_100000128 3300006846 Bacteria 47770
114 Ga0075431_100018884 3300006847 Bacteria 7022
115 Ga0075433_10000103 3300006852 Bacteria 41320
116 Ga0075433_10259258 3300006852 Bacteria 1541
117 Ga0075434_100014461 3300006871 Bacteria 7542
118 Ga0075434_100022954 3300006871 Bacteria 6073
119 Ga0075434_100794325 3300006871 Bacteria 963
120 Ga0075429_100000381 3300006880 Bacteria 32664
121 Ga0075429_100812865 3300006880 Bacteria 818
122 Ga0068865_101632313 3300006881 Bacteria 580
123 Ga0068865_101712111 3300006881 Bacteria 567
124 Ga0075436_100477998 3300006914 Bacteria 910
125 Ga0097620_100026564 3300006931 Bacteria 5806
126 Ga0097620_100636467 3300006931 Bacteria 1159
127 Ga0075435_100006161 3300007076 Bacteria 8456
128 Ga0075435_100011373 3300007076 Bacteria 6542
129 Ga0105240_10519814 3300009093 Bacteria 1321
130 Ga0111539_10000787 3300009094 Bacteria 41244
131 Ga0111539_10002989 3300009094 Bacteria 22418
132 Ga0111539_11186417 3300009094 Bacteria 887
133 Ga0111539_11882510 3300009094 Bacteria 694
134 Ga0111539_13457124 3300009094 Bacteria 507
135 Ga0114129_10018046 3300009147 Bacteria 10051
136 Ga0114129_10045728 3300009147 Bacteria 6153
137 Ga0114129_11023613 3300009147 Bacteria 1039
138 Ga0114129_11684597 3300009147 Bacteria 774
139 Ga0105243_10001716 3300009148 Bacteria 18861
140 Ga0105241_10151490 3300009174 Bacteria 1898
141 Ga0105241_11941110 3300009174 Bacteria 578
142 Ga0105248_10393153 3300009177 Bacteria 1561
143 Ga0105248_12359944 3300009177 Bacteria 606
144 Ga0105237_10661721 3300009545 Bacteria 1051
145 Ga0105249_10064225 3300009553 Bacteria 3374
146 Ga0105239_10022754 3300010375 Bacteria 6909
147 Ga0105246_10130138 3300011119 Bacteria 1878
148 Ga0157343_1000395 3300012488 Bacteria 1720
149 Ga0157322_1000394 3300012490 Bacteria 1565
150 Ga0157329_1006681 3300012491 Bacteria 819
151 Ga0157341_1000469 3300012494 Bacteria 2051
152 Ga0157323_1002712 3300012495 Bacteria 1009
153 Ga0157338_1000826 3300012515 Bacteria 2015
154 Ga0157373_10991369 3300013100 Bacteria 627
155 Ga0157371_10012581 3300013102 Bacteria 6462
156 Ga0157370_10262131 3300013104 Bacteria 1597
157 Ga0171462_1009 3300013250 Bacteria 344993
158 Ga0157374_10162264 3300013296 Bacteria 2177
159 Ga0157378_11068503 3300013297 Bacteria 843
160 Ga0163162_10064822 3300013306 Bacteria 3699
161 Ga0163162_10476111 3300013306 Bacteria 1380
162 Ga0157372_10564395 3300013307 Bacteria 1327
163 Ga0157375_10035488 3300013308 Bacteria 4760
164 Ga0157380_10206239 3300014326 Bacteria 1748
165 Ga0182008_10058838 3300014497 Bacteria 1896
166 Ga0157379_10134584 3300014968 Bacteria 2226
167 Ga0157379_11906609 3300014968 Bacteria 586
168 Ga0157376_11750332 3300014969 Bacteria 657
169 Ga0182007_10058694 3300015262 Bacteria 1262
170 Ga0209673_1008228 3300025273 Bacteria 4667
171 Ga0209130_1001417 3300025284 Bacteria 15975
172 Ga0209675_1000799 3300025291 Bacteria 20784
173 Ga0209676_1038968 3300025292 Bacteria 1355
174 Ga0209025_1000010 3300025294 Bacteria 986612
175 Ga0209025_1001591 3300025294 Bacteria 28576
176 Ga0209025_1040973 3300025294 Bacteria 1993
177 Ga0209564_1000019 3300025295 Bacteria 573686
178 Ga0209564_1000034 3300025295 Bacteria 444284
179 Ga0209758_1000251 3300025297 Bacteria 108814
180 Ga0209256_1000026 3300025299 Bacteria 432835
181 Ga0209256_1000232 3300025299 Bacteria 99687
182 Ga0209256_1029369 3300025299 Bacteria 1534
183 Ga0207426_1013477 3300025302 Bacteria 3028
184 Ga0207426_1031206 3300025302 Bacteria 1740
185 Ga0209257_1031090 3300025304 Bacteria 1713
186 Ga0207697_10022213 3300025315 Bacteria 2600
187 Ga0207682_10173496 3300025893 Bacteria 982
188 Ga0207642_10130969 3300025899 Bacteria 1309
189 Ga0207642_10465215 3300025899 Bacteria 768
190 Ga0207710_10254166 3300025900 Bacteria 879
191 Ga0207688_10147917 3300025901 Bacteria 1386
192 Ga0207680_10366719 3300025903 Bacteria 1013
193 Ga0207680_10638948 3300025903 Bacteria 762
194 Ga0207647_10017565 3300025904 Bacteria 4862
195 Ga0207643_10067655 3300025908 Bacteria 2050
196 Ga0207705_10724240 3300025909 Bacteria 773
197 Ga0207654_10142866 3300025911 Bacteria 1528
198 Ga0207671_10401647 3300025914 Bacteria 1090
199 Ga0207693_10156646 3300025915 Bacteria 1791
200 Ga0207663_10317991 3300025916 Bacteria 1169
201 Ga0207663_10489512 3300025916 Bacteria 954
202 Ga0207660_10140596 3300025917 Bacteria 1845
203 Ga0207660_10515773 3300025917 Bacteria 970
204 Ga0207660_10553604 3300025917 Bacteria 936
205 Ga0207662_10588867 3300025918 Bacteria 773
206 Ga0207657_10028997 3300025919 Bacteria 5043
207 Ga0207652_10116402 3300025921 Bacteria 2375
208 Ga0207652_10539149 3300025921 Bacteria 1049
209 Ga0207652_10576024 3300025921 Bacteria 1011
210 Ga0207652_11883961 3300025921 Bacteria 503
211 Ga0207681_10278335 3300025923 Bacteria 1316
212 Ga0207659_10345391 3300025926 Bacteria 1233
213 Ga0207659_10553011 3300025926 Bacteria 978
214 Ga0207700_10919898 3300025928 Bacteria 783
215 Ga0207644_10829296 3300025931 Bacteria 774
216 Ga0207690_10060890 3300025932 Bacteria 2564
217 Ga0207706_10034755 3300025933 Bacteria 4484
218 Ga0207706_10456056 3300025933 Bacteria 1106
219 Ga0207670_10174202 3300025936 Bacteria 1615
220 Ga0207670_10212125 3300025936 Bacteria 1477
221 Ga0207670_10603344 3300025936 Bacteria 902
222 Ga0207669_10061980 3300025937 Bacteria 2301
223 Ga0207704_11960263 3300025938 Bacteria 504
224 Ga0207691_10083746 3300025940 Bacteria 2863
225 Ga0207691_10608380 3300025940 Bacteria 925
226 Ga0207711_11344942 3300025941 Bacteria 657
227 Ga0207661_10382489 3300025944 Bacteria 1274
228 Ga0207679_11214043 3300025945 Bacteria 692
229 Ga0207712_10606258 3300025961 Bacteria 948
230 Ga0207668_10039219 3300025972 Bacteria 3186
231 Ga0207668_10116212 3300025972 Bacteria 2017
232 Ga0207668_10200609 3300025972 Bacteria 1588
233 Ga0207668_11289945 3300025972 Bacteria 657
234 Ga0207677_10385858 3300026023 Bacteria 1184
235 Ga0207703_10041007 3300026035 Bacteria 3707
236 Ga0207639_10020651 3300026041 Bacteria 4717
237 Ga0207678_10009958 3300026067 Bacteria 8340
238 Ga0207678_10348036 3300026067 Bacteria 1278
239 Ga0207678_11599693 3300026067 Bacteria 574
240 Ga0207708_10035615 3300026075 Bacteria 3787
241 Ga0207708_10137241 3300026075 Bacteria 1916
242 Ga0207708_10583907 3300026075 Bacteria 945
243 Ga0207702_11582907 3300026078 Bacteria 649
244 Ga0207648_10407107 3300026089 Bacteria 1233
245 Ga0207648_11456304 3300026089 Bacteria 644
246 Ga0207674_10372230 3300026116 Bacteria 1381
247 Ga0207674_12045640 3300026116 Bacteria 537
248 Ga0207675_100121622 3300026118 Bacteria 2471
249 Ga0207683_10274075 3300026121 Bacteria 1541
250 Ga0207698_11750292 3300026142 Bacteria 637
251 Ga0209996_1014313 3300027395 Bacteria 1077
252 Ga0210000_1008868 3300027462 Bacteria 1476
253 Ga0209588_1104131 3300027671 Bacteria 912
254 Ga0209971_1004899 3300027682 Bacteria 3181
255 Ga0209966_1015359 3300027695 Bacteria 1437
256 Ga0209966_1116157 3300027695 Bacteria 612
257 Ga0209998_10005564 3300027717 Bacteria 2634
258 Ga0209998_10075583 3300027717 Bacteria 810
259 Ga0209974_10012884 3300027876 Bacteria 2792
260 Ga0209974_10024452 3300027876 Bacteria 1999
261 Ga0209974_10091804 3300027876 Bacteria 1054
262 Ga0207428_10000058 3300027907 Bacteria 158579
263 Ga0207428_10001877 3300027907 Bacteria 21401
264 Ga0207428_10576386 3300027907 Bacteria 812
265 Ga0268266_11034283 3300028379 Bacteria 795
266 Ga0268265_10076997 3300028380 Bacteria 2618
267 Ga0268264_10063477 3300028381 Bacteria 3105
268 Ga0265340_10391574 3300031247 Bacteria 613
269 Ga0265339_10560887 3300031249 Bacteria 525
270 Ga0307408_101105023 3300031548 Bacteria 735
271 Ga0265313_10256165 3300031595 Bacteria 712
272 Ga0316579_10002736 3300031691 Bacteria 6729
273 Ga0265314_10017614 3300031711 Bacteria 5600
274 Ga0265314_10186209 3300031711 Bacteria 1239
275 Ga0265314_10300922 3300031711 Bacteria 900
276 Ga0307406_10039922 3300031901 Bacteria 2915
277 Ga0307406_10285464 3300031901 Bacteria 1261
278 Ga0307416_103263642 3300032002 Bacteria 543
279 Ga0307414_10106706 3300032004 Bacteria 2121
280 Ga0307414_11704598 3300032004 Bacteria 588
281 Ga0316583_10321810 3300032133 Bacteria 535
282 Ga0373930_0000227 3300034816 Bacteria 7077
283 Ga0373948_0021808 3300034817 Bacteria 1229
284 Ga0373950_0000785 3300034818 Bacteria 3965
285 Ga0373959_0000278 3300034820 Bacteria 10960
286 Ga0373938_0000185 3300034957 Bacteria 9182
287 Ga0373928_0000509 3300035084 Bacteria 7637
288 Ga0373929_0000347 3300035085 Bacteria 8661
289 Ga0373934_0033195 3300035086 Bacteria 2026
290 Ga0373940_0000033 3300035088 Bacteria 15017
291 Ga0373949_0007020 3300035090 Bacteria 2470
292 Ga0373951_0002035 3300035091 Bacteria 5174
293 Ga0373952_0000067 3300035092 Bacteria 13144
294 Ga0373932_0011835 3300035112 Bacteria 2138
295 Ga0373939_0005595 3300035114 Bacteria 2994
296 Ga0373941_0000055 3300035115 Bacteria 17323
297 Ga0373953_0139227 3300035117 Bacteria 1037
298 Ga0373954_0034924 3300035118 Bacteria 2330
299 Ga0373957_0013363 3300035120 Bacteria 2785
300 Ga0373960_0000621 3300035121 Bacteria 7257
301 Ga0373943_0962013 3300035170 Bacteria 511
302 Ga0373955_0008944 3300035172 Bacteria 4674
303 Ga0373942_0000604 3300035207 Bacteria 10088
304 Ga0373961_0006501 3300035241 Bacteria 2806
305 Ga0373961_0162518 3300035241 Bacteria 768
306 Ga0373924_0275174 3300035410 Bacteria 746
307 Ga0373935_0146333 3300035692 Bacteria 1600
308 Ga0373933_0053701 3300035724 Bacteria 2413
309 Ga0373947_0058636 3300035725 Bacteria 2333
310 Ga0373937_0051826 3300036401 Bacteria 3761
311 Ga0373937_0705245 3300036401 Bacteria 956
312 Ga0373925_0008196 3300037068 Bacteria 7606
313 Ga0373925_0649790 3300037068 Bacteria 869
314 Ga0242419_012888 3300038698 Bacteria 656
315 Ga0242420_046149 3300038996 Bacteria 842
316 Ga0237816_09314 3300039145 Bacteria 586
317 Ga0439453_0155854 3300041408 Bacteria 544
318 Ga0439465_0236842 3300041413 Bacteria 672
319 Ga0451807_0706480 3300041486 Bacteria 523
320 Ga0439441_108094 3300042001 Bacteria 629
321 Ga0439450_026365 3300042008 Bacteria 1280
322 Ga0439454_051245 3300042011 Bacteria 697
323 Ga0439463_064797 3300042016 Bacteria 934
324 Ga0439458_0030570 3300042157 Bacteria 1282
325 Ga0439435_0278045 3300042436 Bacteria 569
326 Ga0439464_0106588 3300042439 Bacteria 855
327 Ga0439460_0119991 3300042461 Bacteria 859
328 Ga0439440_0139702 3300042993 Bacteria 687
329 Ga0453683_1148553 3300044673 Bacteria 519
330 Ga0453684_0205388 3300044712 Bacteria 2293
331 Ga0466960_0376935 3300044901 Bacteria 814
332 Ga0451576_0178747 3300045051 Bacteria 2215
333 Ga0495592_0004712 3300046454 Bacteria 10006
334 Ga0495641_0042436 3300046461 Bacteria 2108
335 Ga0495651_0272279 3300046462 Bacteria 1147
336 Ga0495653_0154010 3300046463 Bacteria 1603
337 Ga0495664_0148765 3300046477 Bacteria 1420
338 Ga0495628_0005498 3300046516 Bacteria 11090
339 Ga0495630_0117327 3300046517 Bacteria 2018
340 Ga0495632_0003225 3300046519 Bacteria 11714
341 Ga0495652_0033641 3300046529 Bacteria 4472
342 Ga0495640_0378965 3300046533 Bacteria 871
343 Ga0495587_0020754 3300046536 Bacteria 4053
344 Ga0495587_0841355 3300046536 Bacteria 500
345 Ga0495598_0069656 3300046537 Bacteria 1105
346 Ga0495667_0014419 3300046559 Bacteria 5340
347 Ga0495635_0109072 3300046663 Bacteria 1891
348 Ga0495661_0453549 3300046665 Bacteria 617
349 Ga0495588_0445882 3300046674 Bacteria 679
350 Ga0495657_0027025 3300046675 Bacteria 4056
351 Ga0495599_0004339 3300046678 Bacteria 8391
352 Ga0495646_0097491 3300046680 Bacteria 1689
353 Ga0495669_0531215 3300046684 Bacteria 572
354 Ga0495624_0176158 3300046690 Bacteria 1304
355 Ga0495600_0088393 3300046809 Bacteria 2021
356 Ga0495604_0025651 3300047317 Bacteria 4695
357 Ga0495674_0058374 3300047319 Bacteria 3374
358 Ga0495680_0069720 3300047322 Bacteria 2682
359 Ga0495684_0097041 3300047471 Bacteria 2230
360 Ga0495686_0252318 3300047472 Bacteria 991
361 Ga0495593_0383433 3300047673 Bacteria 703
362 Ga0495602_0008977 3300048088 Bacteria 10417
363 Ga0495602_0456574 3300048088 Bacteria 901
364 Ga0496100_0520869 3300048903 Bacteria 918
365 Ga0496102_0044569 3300048905 Bacteria 4026
366 Ga0496105_0089474 3300048908 Bacteria 2543
367 Ga0496106_0012821 3300048909 Bacteria 6188
368 Ga0496107_0087659 3300048910 Bacteria 2272
369 Ga0496108_0105128 3300048911 Bacteria 2410
370 Ga0496108_0440528 3300048911 Bacteria 1138
371 Ga0496109_0439229 3300048912 Bacteria 1233
372 Ga0496109_0496861 3300048912 Bacteria 1151
373 Ga0496109_1175757 3300048912 Bacteria 704
374 Ga0496110_0013167 3300048913 Bacteria 6830
375 Ga0496110_0927345 3300048913 Bacteria 777
376 Ga0496110_1104756 3300048913 Bacteria 701
377 Ga0496110_1194275 3300048913 Bacteria 669
378 Ga0496110_1206768 3300048913 Bacteria 665
379 Ga0496111_0127704 3300048914 Bacteria 1880
380 Ga0496111_0150935 3300048914 Bacteria 1723
381 Ga0496111_0197082 3300048914 Bacteria 1497
382 Ga0496111_1012095 3300048914 Bacteria 595
383 Ga0496113_0081004 3300048916 Bacteria 2488
384 Ga0496113_1034548 3300048916 Bacteria 646
385 Ga0496114_0065824 3300048917 Bacteria 3037
386 Ga0496114_0290353 3300048917 Bacteria 1443
387 Ga0496114_1287127 3300048917 Bacteria 618
388 Ga0496115_0031869 3300048918 Bacteria 4156
389 Ga0496115_0305513 3300048918 Bacteria 1303
390 Ga0496116_0064701 3300048919 Bacteria 2350
391 Ga0496117_0043257 3300048920 Bacteria 3277
392 Ga0496117_0267218 3300048920 Bacteria 923
393 Ga0496118_0328944 3300048921 Bacteria 825
394 Ga0496119_0534602 3300048922 Bacteria 541
395 Ga0496120_0285480 3300048923 Bacteria 761
396 Ga0496121_0307134 3300048924 Bacteria 1074
397 Ga0496122_0064755 3300048925 Bacteria 2657
398 Ga0496122_0219051 3300048925 Bacteria 1094
399 Ga0496123_0041361 3300048926 Bacteria 3196
400 Ga0496123_0173110 3300048926 Bacteria 1136
401 Ga0496123_0183946 3300048926 Bacteria 1088
402 Ga0496125_0000282 3300048928 Bacteria 101380
403 Ga0496125_0160216 3300048928 Bacteria 1530
404 Ga0496125_0331699 3300048928 Bacteria 917
405 Ga0496125_0360107 3300048928 Bacteria 865
406 Ga0496126_0064126 3300048929 Bacteria 3292
407 Ga0496126_0660466 3300048929 Bacteria 817
408 Ga0501031_0056956 3300049568 Bacteria 2547
409 Ga0501032_0005814 3300049569 Bacteria 9122
410 Ga0501032_0022549 3300049569 Bacteria 4364
411 Ga0501032_0080309 3300049569 Bacteria 2170
412 Ga0501032_0128223 3300049569 Bacteria 1675
413 Ga0501032_0583771 3300049569 Bacteria 711
414 Ga0501033_0003939 3300049570 Bacteria 12043
415 Ga0501033_0008967 3300049570 Bacteria 7724
416 Ga0501033_0012798 3300049570 Bacteria 6397
417 Ga0501033_0105529 3300049570 Bacteria 2053
418 Ga0501034_0017011 3300049571 Bacteria 7455
419 Ga0501034_0025138 3300049571 Bacteria 6061
420 Ga0501034_0161102 3300049571 Bacteria 2214
421 Ga0501034_0235966 3300049571 Bacteria 1776
422 Ga0501034_0255410 3300049571 Bacteria 1696
423 Ga0501034_0262862 3300049571 Bacteria 1668
424 Ga0501034_0274917 3300049571 Bacteria 1625
425 Ga0501034_0281175 3300049571 Bacteria 1603
426 Ga0501034_0365764 3300049571 Bacteria 1369
427 Ga0501036_0008301 3300049572 Bacteria 8510
428 Ga0501036_0033397 3300049572 Bacteria 4352
429 Ga0501036_0036040 3300049572 Bacteria 4186
430 Ga0501036_0440571 3300049572 Bacteria 1086
431 Ga0501036_0456638 3300049572 Bacteria 1064
432 Ga0501036_0936996 3300049572 Bacteria 710
433 Ga0501037_0010290 3300049573 Bacteria 6865
434 Ga0501037_0014152 3300049573 Bacteria 5873
435 Ga0501037_0035288 3300049573 Bacteria 3689
436 Ga0501037_0047155 3300049573 Bacteria 3159
437 Ga0501038_0015032 3300049574 Bacteria 7050
438 Ga0501038_0020331 3300049574 Bacteria 5970
439 Ga0501038_0051388 3300049574 Bacteria 3557
440 Ga0501038_0392985 3300049574 Bacteria 1074
441 Ga0501039_0001301 3300049575 Bacteria 18242
442 Ga0501039_0224310 3300049575 Bacteria 1477
443 Ga0501039_0308118 3300049575 Bacteria 1245
444 Ga0501039_0753831 3300049575 Bacteria 760
445 Ga0501041_0297230 3300049577 Bacteria 1017
446 Ga0501042_0083688 3300049578 Bacteria 2287
447 Ga0501042_0141123 3300049578 Bacteria 1737
448 Ga0501043_0002203 3300049579 Bacteria 16610
449 Ga0501043_0041913 3300049579 Bacteria 3596
450 Ga0501043_0087832 3300049579 Bacteria 2443
451 Ga0501043_0326893 3300049579 Bacteria 1168
452 Ga0501043_0379603 3300049579 Bacteria 1070
453 Ga0501043_1176741 3300049579 Bacteria 539
454 Ga0501046_0012154 3300049580 Bacteria 7338
455 Ga0501046_0407519 3300049580 Bacteria 981
456 Ga0501046_0436931 3300049580 Bacteria 942
457 Ga0501046_0732728 3300049580 Bacteria 695
458 Ga0501047_0005496 3300049581 Bacteria 11927
459 Ga0501047_0016792 3300049581 Bacteria 6994
460 Ga0501047_0135752 3300049581 Bacteria 2340
461 Ga0501047_0159507 3300049581 Bacteria 2128
462 Ga0501047_0507416 3300049581 Bacteria 1032
463 Ga0501047_0526369 3300049581 Bacteria 1008
464 Ga0501047_0784139 3300049581 Bacteria 768
465 Ga0501048_0000886 3300049582 Bacteria 22125
466 Ga0501048_0251496 3300049582 Bacteria 1255
467 Ga0501048_0302179 3300049582 Bacteria 1139
468 Ga0501067_0033707 3300049583 Bacteria 2841
469 Ga0501068_0012080 3300049584 Bacteria 4887
470 Ga0501068_0034753 3300049584 Bacteria 3008
471 Ga0501068_0143614 3300049584 Bacteria 1497
472 Ga0501068_0838650 3300049584 Bacteria 604
473 Ga0501068_1208047 3300049584 Bacteria 501
474 Ga0501069_0000437 3300049585 Bacteria 18980
475 Ga0501069_0088479 3300049585 Bacteria 1750
476 Ga0501069_0364034 3300049585 Bacteria 853
477 Ga0501070_0002038 3300049586 Bacteria 17765
478 Ga0501070_0011845 3300049586 Bacteria 7362
479 Ga0501070_0026855 3300049586 Bacteria 4829
480 Ga0501070_0122036 3300049586 Bacteria 2153
481 Ga0501070_0399194 3300049586 Bacteria 1112
482 Ga0501070_0608936 3300049586 Bacteria 870
483 Ga0501070_1034397 3300049586 Bacteria 636
484 Ga0501071_0005718 3300049587 Bacteria 8021
485 Ga0501071_0096456 3300049587 Bacteria 2176
486 Ga0501071_1061781 3300049587 Bacteria 626
487 Ga0501072_0010471 3300049588 Bacteria 7063
488 Ga0501072_0756562 3300049588 Bacteria 762
489 Ga0501073_0006839 3300049589 Bacteria 8478
490 Ga0501073_0007850 3300049589 Bacteria 7921
491 Ga0501073_0016521 3300049589 Bacteria 5350
492 Ga0501073_0028970 3300049589 Bacteria 3956
493 Ga0501073_0455653 3300049589 Bacteria 884
494 Ga0501073_0530836 3300049589 Bacteria 813
495 Ga0501073_0832642 3300049589 Bacteria 636
496 Ga0501073_0858167 3300049589 Bacteria 625
497 Ga0501074_0003168 3300049590 Bacteria 11602
498 Ga0501074_0028988 3300049590 Bacteria 4010
499 Ga0501074_0030900 3300049590 Bacteria 3881
500 Ga0501075_0004711 3300049591 Bacteria 9262
501 Ga0501075_0604168 3300049591 Bacteria 837
502 Ga0501076_0014561 3300049592 Bacteria 5928
503 Ga0501076_0035062 3300049592 Bacteria 3925
504 Ga0501076_0084946 3300049592 Bacteria 2543
505 Ga0501077_0059772 3300049593 Bacteria 2419
506 Ga0501077_0086240 3300049593 Bacteria 1990
507 Ga0501077_0475960 3300049593 Bacteria 800
508 Ga0501079_0009707 3300049741 Bacteria 7297
509 Ga0501079_0046836 3300049741 Bacteria 3337
510 Ga0501079_0088682 3300049741 Bacteria 2395
511 Ga0501079_0529243 3300049741 Bacteria 927
512 Ga0501080_0010101 3300049742 Bacteria 8632
513 Ga0501080_0040450 3300049742 Bacteria 4348
514 Ga0501080_0060516 3300049742 Bacteria 3525
515 Ga0501080_0492287 3300049742 Bacteria 1096
516 Ga0501081_0015721 3300049743 Bacteria 4995
517 Ga0501081_0127376 3300049743 Bacteria 1817
518 Ga0501081_0682676 3300049743 Bacteria 771
519 Ga0501083_0011452 3300049744 Bacteria 6221
520 Ga0501083_0153165 3300049744 Bacteria 1509
521 Ga0501083_0194569 3300049744 Bacteria 1323
522 Ga0501035_0001764 3300049822 Bacteria 21833
523 Ga0501035_0004712 3300049822 Bacteria 12950
524 Ga0501035_0016845 3300049822 Bacteria 6737
525 Ga0501035_0027344 3300049822 Bacteria 5214
526 Ga0501035_0085797 3300049822 Bacteria 2774
527 Ga0501035_0499219 3300049822 Bacteria 1002
528 Ga0501035_1408471 3300049822 Bacteria 534
529 Ga0501044_0010691 3300049823 Bacteria 9958
530 Ga0501044_0018487 3300049823 Bacteria 7467
531 Ga0501044_0025958 3300049823 Bacteria 6206
532 Ga0501044_0044749 3300049823 Bacteria 4591
533 Ga0501044_0110800 3300049823 Bacteria 2753
534 Ga0501045_0018183 3300049824 Bacteria 4996
535 Ga0501045_0707539 3300049824 Bacteria 743
536 nmdc:mga00v17_351574_c1 3300050491 Bacteria 958
537 nmdc:mga0yw44_1064017_c1 3300050492 Bacteria 547
538 nmdc:mga0yw44_485620_c1 3300050492 Bacteria 838
539 nmdc:mga0yw44_914399_c1 3300050492 Bacteria 595
540 nmdc:mga0yw44_937_c1 3300050492 Bacteria 7973
541 nmdc:mga0k408_26602_c1 3300050493 Bacteria 3281
542 nmdc:mga05p37_1492059_c1 3300050507 Bacteria 674
543 nmdc:mga05p37_334227_c1 3300050507 Bacteria 1788
544 nmdc:mga05p37_35_c1 3300050507 Bacteria 110751
545 nmdc:mga05p37_6170_c1 3300050507 Bacteria 14110
546 nmdc:mga05p37_890095_c1 3300050507 Bacteria 961
547 nmdc:mga09592_163_c1 3300050508 Bacteria 46620
548 nmdc:mga09592_41900_c1 3300050508 Bacteria 3851
549 nmdc:mga0qj67_143_c1 3300050509 Bacteria 48269
550 nmdc:mga0qj67_154190_c1 3300050509 Bacteria 1864
551 nmdc:mga06r32_34027_c1 3300050510 Bacteria 4803
552 nmdc:mga06r32_936_c1 3300050510 Bacteria 25964
553 nmdc:mga08y16_1040379_c1 3300050511 Bacteria 797
554 nmdc:mga08y16_1688624_c1 3300050511 Bacteria 589
555 nmdc:mga08y16_231052_c1 3300050511 Bacteria 1913
556 nmdc:mga08y16_2671_c1 3300050511 Bacteria 18327
557 nmdc:mga08y16_6719_c1 3300050511 Bacteria 12057
558 nmdc:mga0n895_33593_c1 3300050512 Bacteria 4932
559 nmdc:mga0n895_356672_c1 3300050512 Bacteria 1481
560 nmdc:mga0n895_457589_c1 3300050512 Bacteria 1288
561 nmdc:mga0rr50_1301_c1 3300050513 Bacteria 13614
562 nmdc:mga0rr50_3039_c1 3300050513 Bacteria 9598
563 nmdc:mga08x19_1012080_c1 3300050514 Bacteria 590
564 nmdc:mga08x19_437774_c1 3300050514 Bacteria 919
565 nmdc:mga0a205_2132_c1 3300050515 Bacteria 17371
566 nmdc:mga0a205_38040_c1 3300050515 Bacteria 4628
567 nmdc:mga0a205_63150_c1 3300050515 Bacteria 3578
568 nmdc:mga0sz30_511555_c1 3300050516 Bacteria 540
569 Ga0495601_0000485 3300053077 Bacteria 20919
570 Ga0495612_0000714 3300053078 Bacteria 13470
571 Ga0495595_0321732 3300053084 Bacteria 779
572 Ga0495595_0336146 3300053084 Bacteria 761
573 Ga0495619_0000487 3300053085 Bacteria 26605
574 Ga0495619_0465601 3300053085 Bacteria 871
575 Ga0500651_0328894 3300053093 Bacteria 871
576 Ga0500569_267146 3300053109 Bacteria 579
577 Ga0500608_254464 3300053122 Bacteria 683
578 Ga0500642_0229223 3300053130 Bacteria 859
579 Ga0500568_0039859 3300053139 Bacteria 1894
580 Ga0500586_272472 3300053145 Bacteria 521
581 Ga0500616_0109020 3300053153 Bacteria 1340
582 Ga0500636_0011757 3300053177 Bacteria 5124
583 Ga0501084_0018001 3300054114 Bacteria 5883
584 Ga0501084_0272197 3300054114 Bacteria 1430
585 Ga0501084_0457801 3300054114 Bacteria 1078
586 Ga0590075_111010 3300059424 Bacteria 716
587 Ga0501082_0029163 3300060353 Bacteria 4754
588 Ga0501082_0057648 3300060353 Bacteria 3346
589 Ga0501082_0227049 3300060353 Bacteria 1625
590 Ga0501082_0338044 3300060353 Bacteria 1312
591 Ga0501082_1331741 3300060353 Bacteria 627
592 Ga0530510_0064349 3300061734 Bacteria 2656
593 Ga0530510_0524342 3300061734 Bacteria 899
594 Ga0055524_1027828
595 SwRhRL2b_contig_1015587
596 2214767426
597 ARcpr5oldR_c000253
598 ARSoilYngRDRAFT_c00281
599 ARcpr5yngRDRAFT_c002660
600 ARSoilOldRDRAFT_c000231
601 ARCol0oldRDRAFT_c00994
602 ARCol0yngRDRAFT_1000260
603 JGI24737J22298_10020391
604 JGI24750J21931_1004571
605 JGI24035J26624_1001130
606 JGI24034J26672_10029907
607 JGI24751J29686_10073052
608 JGI25159J45721_1021639
609 JGI25151J46595_10000018
610 JGI25151J46595_10034061
611 JGI25153J46596_10004251
612 JGI26141J51220_1016149
613 Ga0055526_1000362
614 Ga0055526_1000571
615 Ga0055524_1000048
616 Ga0055534_1008656
617 JGI25405J52794_10051040
618 Ga0065165_1000337
619 Ga0065717_1002397
620 Ga0065716_1001908
621 Ga0065714_10369378
622 Ga0065704_10109412
623 Ga0065712_10078300
624 Ga0065715_10001249
625 Ga0065707_10126362
626 Ga0070683_102352263
627 Ga0070690_100353756
628 Ga0070677_10222450
629 Ga0070666_10499724
630 Ga0070680_101874744
631 Ga0070660_100171040
632 Ga0070660_101105022
633 Ga0070689_100005511
634 Ga0070689_100132519
635 Ga0070689_100418910
636 Ga0070691_10738551
637 Ga0070668_100110155
638 Ga0070668_100347040
639 Ga0070675_100372984
640 Ga0070671_100923777
641 Ga0070674_100106760
642 Ga0070688_100196206
643 Ga0070713_100803507
644 Ga0070710_10723997
645 Ga0070710_11139953
646 Ga0070711_100645935
647 Ga0070700_100229568
648 Ga0070700_100879773
649 Ga0070694_100259073
650 Ga0070708_100032775
651 Ga0070663_101606501
652 Ga0070678_102311431
653 Ga0070662_101043268
654 Ga0070681_10737194
655 Ga0068867_100190787
656 Ga0068867_100312173
657 Ga0068867_101644605
658 Ga0070685_10083256
659 Ga0074259_11049951
660 Ga0070679_100160756
661 Ga0070679_100219484
662 Ga0070679_100755994
663 Ga0070679_101737760
664 Ga0068853_100088489
665 Ga0070672_100651401
666 Ga0070686_101131385
667 Ga0070704_100774390
668 Ga0068855_100109516
669 Ga0070664_101830047
670 Ga0068857_100329950
671 Ga0068857_101536523
672 Ga0068854_100134111
673 Ga0068856_101829695
674 Ga0070702_100358261
675 Ga0068859_100026561
676 Ga0068859_100636361
677 Ga0068864_101185269
678 Ga0068866_10194266
679 Ga0068861_100723613
680 Ga0068851_10521056
681 Ga0068858_100017088
682 Ga0068862_100930873
683 Ga0081455_10000110
684 Ga0081540_1161839
685 Ga0081539_10181037
686 Ga0075365_10029225
687 Ga0075368_10135504
688 Ga0075368_10514054
689 Ga0075364_10108738
690 Ga0075364_10469646
691 Ga0075364_10571059
692 Ga0075432_10028305
693 Ga0075432_10201207
694 Ga0070712_100086102
695 Ga0075362_10157543
696 Ga0075362_10298600
697 Ga0075367_10243956
698 Ga0075369_10189743
699 Ga0075427_10003863
700 Ga0075366_10005461
701 Ga0097621_100649154
702 Ga0097621_100840131
703 Ga0097621_101781068
704 Ga0068871_101419230
705 Ga0075428_100002521
706 Ga0075430_100000128
707 Ga0075431_100018884
708 Ga0075433_10000103
709 Ga0075433_10259258
710 Ga0075434_100014461
711 Ga0075434_100022954
712 Ga0075434_100794325
713 Ga0075429_100000381
714 Ga0075429_100812865
715 Ga0068865_101632313
716 Ga0068865_101712111
717 Ga0075436_100477998
718 Ga0097620_100026564
719 Ga0097620_100636467
720 Ga0075435_100006161
721 Ga0075435_100011373
722 Ga0105240_10519814
723 Ga0111539_10000787
724 Ga0111539_10002989
725 Ga0111539_11186417
726 Ga0111539_11882510
727 Ga0111539_13457124
728 Ga0114129_10018046
729 Ga0114129_10045728
730 Ga0114129_11023613
731 Ga0114129_11684597
732 Ga0105243_10001716
733 Ga0105241_10151490
734 Ga0105241_11941110
735 Ga0105248_10393153
736 Ga0105248_12359944
737 Ga0105237_10661721
738 Ga0105249_10064225
739 Ga0105239_10022754
740 Ga0105246_10130138
741 Ga0157343_1000395
742 Ga0157322_1000394
743 Ga0157329_1006681
744 Ga0157341_1000469
745 Ga0157323_1002712
746 Ga0157338_1000826
747 Ga0157373_10991369
748 Ga0157371_10012581
749 Ga0157370_10262131
750 Ga0171462_1009
751 Ga0157374_10162264
752 Ga0157378_11068503
753 Ga0163162_10064822
754 Ga0163162_10476111
755 Ga0157372_10564395
756 Ga0157375_10035488
757 Ga0157380_10206239
758 Ga0182008_10058838
759 Ga0157379_10134584
760 Ga0157379_11906609
761 Ga0157376_11750332
762 Ga0182007_10058694
763 Ga0209673_1008228
764 Ga0209130_1001417
765 Ga0209675_1000799
766 Ga0209676_1038968
767 Ga0209025_1000010
768 Ga0209025_1001591
769 Ga0209025_1040973
770 Ga0209564_1000019
771 Ga0209564_1000034
772 Ga0209758_1000251
773 Ga0209256_1000026
774 Ga0209256_1000232
775 Ga0209256_1029369
776 Ga0207426_1013477
777 Ga0207426_1031206
778 Ga0209257_1031090
779 Ga0207697_10022213
780 Ga0207682_10173496
781 Ga0207642_10130969
782 Ga0207642_10465215
783 Ga0207710_10254166
784 Ga0207688_10147917
785 Ga0207680_10366719
786 Ga0207680_10638948
787 Ga0207647_10017565
788 Ga0207643_10067655
789 Ga0207705_10724240
790 Ga0207654_10142866
791 Ga0207671_10401647
792 Ga0207693_10156646
793 Ga0207663_10317991
794 Ga0207663_10489512
795 Ga0207660_10140596
796 Ga0207660_10515773
797 Ga0207660_10553604
798 Ga0207662_10588867
799 Ga0207657_10028997
800 Ga0207652_10116402
801 Ga0207652_10539149
802 Ga0207652_10576024
803 Ga0207652_11883961
804 Ga0207681_10278335
805 Ga0207659_10345391
806 Ga0207659_10553011
807 Ga0207700_10919898
808 Ga0207644_10829296
809 Ga0207690_10060890
810 Ga0207706_10034755
811 Ga0207706_10456056
812 Ga0207670_10174202
813 Ga0207670_10212125
814 Ga0207670_10603344
815 Ga0207669_10061980
816 Ga0207704_11960263
817 Ga0207691_10083746
818 Ga0207691_10608380
819 Ga0207711_11344942
820 Ga0207661_10382489
821 Ga0207679_11214043
822 Ga0207712_10606258
823 Ga0207668_10039219
824 Ga0207668_10116212
825 Ga0207668_10200609
826 Ga0207668_11289945
827 Ga0207677_10385858
828 Ga0207703_10041007
829 Ga0207639_10020651
830 Ga0207678_10009958
831 Ga0207678_10348036
832 Ga0207678_11599693
833 Ga0207708_10035615
834 Ga0207708_10137241
835 Ga0207708_10583907
836 Ga0207702_11582907
837 Ga0207648_10407107
838 Ga0207648_11456304
839 Ga0207674_10372230
840 Ga0207674_12045640
841 Ga0207675_100121622
842 Ga0207683_10274075
843 Ga0207698_11750292
844 Ga0209996_1014313
845 Ga0210000_1008868
846 Ga0209588_1104131
847 Ga0209971_1004899
848 Ga0209966_1015359
849 Ga0209966_1116157
850 Ga0209998_10005564
851 Ga0209998_10075583
852 Ga0209974_10012884
853 Ga0209974_10024452
854 Ga0209974_10091804
855 Ga0207428_10000058
856 Ga0207428_10001877
857 Ga0207428_10576386
858 Ga0268266_11034283
859 Ga0268265_10076997
860 Ga0268264_10063477
861 Ga0265340_10391574
862 Ga0265339_10560887
863 Ga0307408_101105023
864 Ga0265313_10256165
865 Ga0316579_10002736
866 Ga0265314_10017614
867 Ga0265314_10186209
868 Ga0265314_10300922
869 Ga0307406_10039922
870 Ga0307406_10285464
871 Ga0307416_103263642
872 Ga0307414_10106706
873 Ga0307414_11704598
874 Ga0316583_10321810
875 Ga0373930_0000227
876 Ga0373948_0021808
877 Ga0373950_0000785
878 Ga0373959_0000278
879 Ga0373938_0000185
880 Ga0373928_0000509
881 Ga0373929_0000347
882 Ga0373934_0033195
883 Ga0373940_0000033
884 Ga0373949_0007020
885 Ga0373951_0002035
886 Ga0373952_0000067
887 Ga0373932_0011835
888 Ga0373939_0005595
889 Ga0373941_0000055
890 Ga0373953_0139227
891 Ga0373954_0034924
892 Ga0373957_0013363
893 Ga0373960_0000621
894 Ga0373943_0962013
895 Ga0373955_0008944
896 Ga0373942_0000604
897 Ga0373961_0006501
898 Ga0373961_0162518
899 Ga0373924_0275174
900 Ga0373935_0146333
901 Ga0373933_0053701
902 Ga0373947_0058636
903 Ga0373937_0051826
904 Ga0373937_0705245
905 Ga0373925_0008196
906 Ga0373925_0649790
907 Ga0242419_012888
908 Ga0242420_046149
909 Ga0237816_09314
910 Ga0439453_0155854
911 Ga0439465_0236842
912 Ga0451807_0706480
913 Ga0439441_108094
914 Ga0439450_026365
915 Ga0439454_051245
916 Ga0439463_064797
917 Ga0439458_0030570
918 Ga0439435_0278045
919 Ga0439464_0106588
920 Ga0439460_0119991
921 Ga0439440_0139702
922 Ga0453683_1148553
923 Ga0453684_0205388
924 Ga0466960_0376935
925 Ga0451576_0178747
926 Ga0495592_0004712
927 Ga0495641_0042436
928 Ga0495651_0272279
929 Ga0495653_0154010
930 Ga0495664_0148765
931 Ga0495628_0005498
932 Ga0495630_0117327
933 Ga0495632_0003225
934 Ga0495652_0033641
935 Ga0495640_0378965
936 Ga0495587_0020754
937 Ga0495587_0841355
938 Ga0495598_0069656
939 Ga0495667_0014419
940 Ga0495635_0109072
941 Ga0495661_0453549
942 Ga0495588_0445882
943 Ga0495657_0027025
944 Ga0495599_0004339
945 Ga0495646_0097491
946 Ga0495669_0531215
947 Ga0495624_0176158
948 Ga0495600_0088393
949 Ga0495604_0025651
950 Ga0495674_0058374
951 Ga0495680_0069720
952 Ga0495684_0097041
953 Ga0495686_0252318
954 Ga0495593_0383433
955 Ga0495602_0008977
956 Ga0495602_0456574
957 Ga0496100_0520869
958 Ga0496102_0044569
959 Ga0496105_0089474
960 Ga0496106_0012821
961 Ga0496107_0087659
962 Ga0496108_0105128
963 Ga0496108_0440528
964 Ga0496109_0439229
965 Ga0496109_0496861
966 Ga0496109_1175757
967 Ga0496110_0013167
968 Ga0496110_0927345
969 Ga0496110_1104756
970 Ga0496110_1194275
971 Ga0496110_1206768
972 Ga0496111_0127704
973 Ga0496111_0150935
974 Ga0496111_0197082
975 Ga0496111_1012095
976 Ga0496113_0081004
977 Ga0496113_1034548
978 Ga0496114_0065824
979 Ga0496114_0290353
980 Ga0496114_1287127
981 Ga0496115_0031869
982 Ga0496115_0305513
983 Ga0496116_0064701
984 Ga0496117_0043257
985 Ga0496117_0267218
986 Ga0496118_0328944
987 Ga0496119_0534602
988 Ga0496120_0285480
989 Ga0496121_0307134
990 Ga0496122_0064755
991 Ga0496122_0219051
992 Ga0496123_0041361
993 Ga0496123_0173110
994 Ga0496123_0183946
995 Ga0496125_0000282
996 Ga0496125_0160216
997 Ga0496125_0331699
998 Ga0496125_0360107
999 Ga0496126_0064126
1000 Ga0496126_0660466
1001 Ga0501031_0056956
1002 Ga0501032_0005814
1003 Ga0501032_0022549
1004 Ga0501032_0080309
1005 Ga0501032_0128223
1006 Ga0501032_0583771
1007 Ga0501033_0003939
1008 Ga0501033_0008967
1009 Ga0501033_0012798
1010 Ga0501033_0105529
1011 Ga0501034_0017011
1012 Ga0501034_0025138
1013 Ga0501034_0161102
1014 Ga0501034_0235966
1015 Ga0501034_0255410
1016 Ga0501034_0262862
1017 Ga0501034_0274917
1018 Ga0501034_0281175
1019 Ga0501034_0365764
1020 Ga0501036_0008301
1021 Ga0501036_0033397
1022 Ga0501036_0036040
1023 Ga0501036_0440571
1024 Ga0501036_0456638
1025 Ga0501036_0936996
1026 Ga0501037_0010290
1027 Ga0501037_0014152
1028 Ga0501037_0035288
1029 Ga0501037_0047155
1030 Ga0501038_0015032
1031 Ga0501038_0020331
1032 Ga0501038_0051388
1033 Ga0501038_0392985
1034 Ga0501039_0001301
1035 Ga0501039_0224310
1036 Ga0501039_0308118
1037 Ga0501039_0753831
1038 Ga0501041_0297230
1039 Ga0501042_0083688
1040 Ga0501042_0141123
1041 Ga0501043_0002203
1042 Ga0501043_0041913
1043 Ga0501043_0087832
1044 Ga0501043_0326893
1045 Ga0501043_0379603
1046 Ga0501043_1176741
1047 Ga0501046_0012154
1048 Ga0501046_0407519
1049 Ga0501046_0436931
1050 Ga0501046_0732728
1051 Ga0501047_0005496
1052 Ga0501047_0016792
1053 Ga0501047_0135752
1054 Ga0501047_0159507
1055 Ga0501047_0507416
1056 Ga0501047_0526369
1057 Ga0501047_0784139
1058 Ga0501048_0000886
1059 Ga0501048_0251496
1060 Ga0501048_0302179
1061 Ga0501067_0033707
1062 Ga0501068_0012080
1063 Ga0501068_0034753
1064 Ga0501068_0143614
1065 Ga0501068_0838650
1066 Ga0501068_1208047
1067 Ga0501069_0000437
1068 Ga0501069_0088479
1069 Ga0501069_0364034
1070 Ga0501070_0002038
1071 Ga0501070_0011845
1072 Ga0501070_0026855
1073 Ga0501070_0122036
1074 Ga0501070_0399194
1075 Ga0501070_0608936
1076 Ga0501070_1034397
1077 Ga0501071_0005718
1078 Ga0501071_0096456
1079 Ga0501071_1061781
1080 Ga0501072_0010471
1081 Ga0501072_0756562
1082 Ga0501073_0006839
1083 Ga0501073_0007850
1084 Ga0501073_0016521
1085 Ga0501073_0028970
1086 Ga0501073_0455653
1087 Ga0501073_0530836
1088 Ga0501073_0832642
1089 Ga0501073_0858167
1090 Ga0501074_0003168
1091 Ga0501074_0028988
1092 Ga0501074_0030900
1093 Ga0501075_0004711
1094 Ga0501075_0604168
1095 Ga0501076_0014561
1096 Ga0501076_0035062
1097 Ga0501076_0084946
1098 Ga0501077_0059772
1099 Ga0501077_0086240
1100 Ga0501077_0475960
1101 Ga0501079_0009707
1102 Ga0501079_0046836
1103 Ga0501079_0088682
1104 Ga0501079_0529243
1105 Ga0501080_0010101
1106 Ga0501080_0040450
1107 Ga0501080_0060516
1108 Ga0501080_0492287
1109 Ga0501081_0015721
1110 Ga0501081_0127376
1111 Ga0501081_0682676
1112 Ga0501083_0011452
1113 Ga0501083_0153165
1114 Ga0501083_0194569
1115 Ga0501035_0001764
1116 Ga0501035_0004712
1117 Ga0501035_0016845
1118 Ga0501035_0027344
1119 Ga0501035_0085797
1120 Ga0501035_0499219
1121 Ga0501035_1408471
1122 Ga0501044_0010691
1123 Ga0501044_0018487
1124 Ga0501044_0025958
1125 Ga0501044_0044749
1126 Ga0501044_0110800
1127 Ga0501045_0018183
1128 Ga0501045_0707539
1129 nmdc:mga00v17_351574_c1
1130 nmdc:mga0yw44_1064017_c1
1131 nmdc:mga0yw44_485620_c1
1132 nmdc:mga0yw44_914399_c1
1133 nmdc:mga0yw44_937_c1
1134 nmdc:mga0k408_26602_c1
1135 nmdc:mga05p37_1492059_c1
1136 nmdc:mga05p37_334227_c1
1137 nmdc:mga05p37_35_c1
1138 nmdc:mga05p37_6170_c1
1139 nmdc:mga05p37_890095_c1
1140 nmdc:mga09592_163_c1
1141 nmdc:mga09592_41900_c1
1142 nmdc:mga0qj67_143_c1
1143 nmdc:mga0qj67_154190_c1
1144 nmdc:mga06r32_34027_c1
1145 nmdc:mga06r32_936_c1
1146 nmdc:mga08y16_1040379_c1
1147 nmdc:mga08y16_1688624_c1
1148 nmdc:mga08y16_231052_c1
1149 nmdc:mga08y16_2671_c1
1150 nmdc:mga08y16_6719_c1
1151 nmdc:mga0n895_33593_c1
1152 nmdc:mga0n895_356672_c1
1153 nmdc:mga0n895_457589_c1
1154 nmdc:mga0rr50_1301_c1
1155 nmdc:mga0rr50_3039_c1
1156 nmdc:mga08x19_1012080_c1
1157 nmdc:mga08x19_437774_c1
1158 nmdc:mga0a205_2132_c1
1159 nmdc:mga0a205_38040_c1
1160 nmdc:mga0a205_63150_c1
1161 nmdc:mga0sz30_511555_c1
1162 Ga0495601_0000485
1163 Ga0495612_0000714
1164 Ga0495595_0321732
1165 Ga0495595_0336146
1166 Ga0495619_0000487
1167 Ga0495619_0465601
1168 Ga0500651_0328894
1169 Ga0500569_267146
1170 Ga0500608_254464
1171 Ga0500642_0229223
1172 Ga0500568_0039859
1173 Ga0500586_272472
1174 Ga0500616_0109020
1175 Ga0500636_0011757
1176 Ga0501084_0018001
1177 Ga0501084_0272197
1178 Ga0501084_0457801
1179 Ga0590075_111010
1180 Ga0501082_0029163
1181 Ga0501082_0057648
1182 Ga0501082_0227049
1183 Ga0501082_0338044
1184 Ga0501082_1331741
1185 Ga0530510_0064349
1186 Ga0530510_0524342

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13773

DUF4170

Domain of unknown function (DUF4170)

28

87

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2mhe-assembly1.cif.gz_B nmr structure of the protein np_419126.1 from caulobacter crescentus 0.7565 1 77
2mhe-assembly1.cif.gz_B nmr structure of the protein np_419126.1 from caulobacter crescentus 0.7217 1 77
3o2h-assembly1.cif.gz_A e. coli clps in complex with a leu n-end rule peptide 0.6408 7 71
7wq5-assembly2.cif.gz_B crystal structure of arabidopsis transcriptional factor wrinkled1 with dsdna 0.6374 18 57
1mg9-assembly1.cif.gz_A the structural basis of clps-mediated switch in clpa substrate recognition 0.6368 9 71
ID Description Score Start End Superfamily
af_K7UQ19_118_172_3.30.730.10 Alpha Beta;2-Layer Sandwich;GCC-box Binding Domain;AP2/ERF domain 0.8179 32 60 3.30.730.10
af_Q2TQ39_75_158_3.30.730.10 Alpha Beta;2-Layer Sandwich;GCC-box Binding Domain;AP2/ERF domain 0.7982 34 57 3.30.730.10
af_Q9SGJ6_29_87_3.30.730.10 Alpha Beta;2-Layer Sandwich;GCC-box Binding Domain;AP2/ERF domain 0.7818 30 57 3.30.730.10
af_C0P9B0_100_150_3.30.730.10 Alpha Beta;2-Layer Sandwich;GCC-box Binding Domain;AP2/ERF domain 0.7594 29 59 3.30.730.10
af_B4FET9_33_90_3.30.730.10 Alpha Beta;2-Layer Sandwich;GCC-box Binding Domain;AP2/ERF domain 0.7568 34 63 3.30.730.10
ID Description Score Start End GO Terms
AF-A0A3D4F2C3-F1-model_v4 deleted 0.9745 13 69
AF-A0A1Q3JIW1-F1-model_v4 Inositol monophosphatase 0.9391 8 77
AF-A0A258DDP0-F1-model_v4 Inositol monophosphatase 0.9377 8 77
AF-A0A2E1RWQ1-F1-model_v4 Inositol monophosphatase 0.9377 9 77
AF-C6XHY3-F1-model_v4 DUF4170 domain-containing protein 0.9358 3 73

Map