F464837

General Info

Members Datasets Scaffolds Average Seq Length
570 332 1140 141

Family's Representative Sequence

Representative Sequence 3300026035|Ga0207703_10359449|Ga0207703_103594493
Length 169
Sequence MARLIKRLPMTQTHEDENMKKSDTHQDRSASELISKRIAELEDWRGETLSRMRKLIKQADADVVEEWKWMDVPVWSHDGIICTGESYKKVVKLTFAKGAFLKDPSRLFNSSLEGNTRRAIDIHEGEEVNASAFKALVREAVALNSSGKSKPSTKARVKPGSSQGAPAAR

Samples

Sample ID Description Type Environment
1 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
4 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
5 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
6 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
7 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
8 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
74 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
81 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
82 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
89 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
90 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
91 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
108 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
109 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
110 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
117 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
118 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
119 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
120 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
121 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
122 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
123 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
129 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
131 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
187 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
189 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
193 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
194 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
195 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
196 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
197 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
198 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
199 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
200 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
203 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
204 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
205 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
206 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
207 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
208 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
209 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
210 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
211 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
212 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
213 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
214 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
215 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
216 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
217 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
218 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
219 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
220 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
221 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
222 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
223 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
224 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
225 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
226 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
227 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
228 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
229 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
230 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
231 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
232 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
233 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
234 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
235 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
236 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
237 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
238 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
239 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
240 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
241 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
242 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
243 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
244 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
245 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
246 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
247 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
248 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
249 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
250 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
251 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
252 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
253 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
254 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
255 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
256 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
257 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
258 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
259 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
260 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
261 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
262 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
263 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
264 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
265 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
266 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
267 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
268 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
269 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
270 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
271 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
272 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
273 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
274 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
275 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
276 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
277 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
278 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
279 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
280 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
281 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
282 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
283 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
284 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
285 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
286 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
287 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
288 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
289 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
290 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
291 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
292 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
293 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
294 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
295 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
296 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
297 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
298 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
299 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
300 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
301 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
302 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
303 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
304 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
305 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
306 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
307 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
308 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
309 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
310 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
312 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
313 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
314 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
315 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
316 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
317 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
318 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
319 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
320 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
321 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
322 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
323 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
324 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
325 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
326 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
327 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
328 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
329 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
330 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
331 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
332 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.47
Metatranscriptomes 0.35
Isolates 0.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.39
Nodule 0
Rhizoplane 5.26
Rhizosphere 89.47
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207703_10359449 3300026035 Bacteria 1342
2 JGI25162J39368_1000061 3300002737 Bacteria 136847
3 JGI25165J46597_1000117 3300003214 Bacteria 137891
4 Ga0055538_1000046 3300003751 Bacteria 137891
5 Ga0055539_1000065 3300003752 Bacteria 136847
6 Ga0055533_1000075 3300003756 Bacteria 137891
7 Ga0055525_1000095 3300003759 Bacteria 137891
8 Ga0055541_1000047 3300003841 Bacteria 136847
9 Ga0065714_10345702 3300005288 Bacteria 641
10 Ga0065715_10231459 3300005293 Bacteria 1232
11 Ga0065707_10307824 3300005295 Bacteria 991
12 Ga0070683_100109611 3300005329 Bacteria 2604
13 Ga0070690_100011878 3300005330 Bacteria 5110
14 Ga0070690_100037024 3300005330 Bacteria 3071
15 Ga0070690_100474521 3300005330 Bacteria 931
16 Ga0070670_100001322 3300005331 Bacteria 19795
17 Ga0070670_101413644 3300005331 Bacteria 638
18 Ga0070677_10535804 3300005333 Bacteria 640
19 Ga0068869_100001120 3300005334 Bacteria 15629
20 Ga0068869_100017236 3300005334 Bacteria 4891
21 Ga0070666_10182331 3300005335 Bacteria 1473
22 Ga0070680_100453241 3300005336 Bacteria 1096
23 Ga0070689_100019635 3300005340 Bacteria 4998
24 Ga0070689_100291760 3300005340 Bacteria 1356
25 Ga0070689_100662105 3300005340 Bacteria 909
26 Ga0070687_100007377 3300005343 Bacteria 4579
27 Ga0070687_100012154 3300005343 Bacteria 3791
28 Ga0070687_100066780 3300005343 Bacteria 1917
29 Ga0070687_100109502 3300005343 Bacteria 1561
30 Ga0070692_10005925 3300005345 Bacteria 5264
31 Ga0070668_100042492 3300005347 Bacteria 3485
32 Ga0070669_100055846 3300005353 Bacteria 2894
33 Ga0070675_100170180 3300005354 Bacteria 1878
34 Ga0070671_100464351 3300005355 Bacteria 1087
35 Ga0070671_100689223 3300005355 Bacteria 886
36 Ga0070674_100001013 3300005356 Bacteria 14683
37 Ga0070674_100096352 3300005356 Bacteria 2147
38 Ga0070688_100000374 3300005365 Bacteria 22697
39 Ga0070688_100372318 3300005365 Bacteria 1051
40 Ga0070688_100417879 3300005365 Bacteria 996
41 Ga0070659_100046152 3300005366 Bacteria 3415
42 Ga0070659_100076385 3300005366 Bacteria 2671
43 Ga0070667_100027716 3300005367 Bacteria 4713
44 Ga0070667_100189657 3300005367 Bacteria 1821
45 Ga0070703_10559128 3300005406 Bacteria 523
46 Ga0070713_100101928 3300005436 Bacteria 2488
47 Ga0070713_101076653 3300005436 Bacteria 777
48 Ga0070710_10223878 3300005437 Bacteria 1198
49 Ga0070701_10024727 3300005438 Bacteria 2909
50 Ga0070701_10262267 3300005438 Bacteria 1048
51 Ga0070711_100144063 3300005439 Bacteria 1790
52 Ga0070705_100034000 3300005440 Bacteria 2846
53 Ga0070705_100221738 3300005440 Bacteria 1310
54 Ga0070700_100093123 3300005441 Bacteria 1970
55 Ga0070700_101022553 3300005441 Bacteria 681
56 Ga0070700_101165042 3300005441 Bacteria 642
57 Ga0070694_100007169 3300005444 Bacteria 6789
58 Ga0070694_100111845 3300005444 Bacteria 1947
59 Ga0070694_100472989 3300005444 Bacteria 993
60 Ga0070694_100677991 3300005444 Bacteria 836
61 Ga0070694_100681416 3300005444 Bacteria 834
62 Ga0070708_100121254 3300005445 Bacteria 2412
63 Ga0070663_100635008 3300005455 Bacteria 902
64 Ga0070663_101061592 3300005455 Bacteria 707
65 Ga0070678_100015303 3300005456 Bacteria 4872
66 Ga0070662_100233778 3300005457 Bacteria 1471
67 Ga0070681_10234009 3300005458 Bacteria 1751
68 Ga0070681_10474765 3300005458 Bacteria 1163
69 Ga0068867_100007464 3300005459 Bacteria 7731
70 Ga0068867_100010157 3300005459 Bacteria 6640
71 Ga0068867_100567174 3300005459 Bacteria 985
72 Ga0070685_10001541 3300005466 Bacteria 12156
73 Ga0070685_10347567 3300005466 Bacteria 1013
74 Ga0070706_100076208 3300005467 Bacteria 3104
75 Ga0070706_100091020 3300005467 Bacteria 2829
76 Ga0070698_100143551 3300005471 Bacteria 2337
77 Ga0070698_100218345 3300005471 Bacteria 1841
78 Ga0070698_100555368 3300005471 Bacteria 1088
79 Ga0070679_101429263 3300005530 Bacteria 638
80 Ga0070697_100176450 3300005536 Bacteria 1810
81 Ga0068853_100741037 3300005539 Bacteria 939
82 Ga0070686_100016110 3300005544 Bacteria 4343
83 Ga0070686_100048056 3300005544 Bacteria 2702
84 Ga0070695_100092205 3300005545 Bacteria 2025
85 Ga0070695_100200884 3300005545 Bacteria 1425
86 Ga0070696_100022610 3300005546 Bacteria 4273
87 Ga0070696_100277170 3300005546 Bacteria 1277
88 Ga0070696_100476038 3300005546 Bacteria 989
89 Ga0070693_100009587 3300005547 Bacteria 4819
90 Ga0070693_100044138 3300005547 Bacteria 2521
91 Ga0070665_100166921 3300005548 Bacteria 2203
92 Ga0070665_100448591 3300005548 Bacteria 1299
93 Ga0070704_100055875 3300005549 Bacteria 2800
94 Ga0068855_100045399 3300005563 Bacteria 5197
95 Ga0070664_100110226 3300005564 Bacteria 2401
96 Ga0070664_100593813 3300005564 Bacteria 1026
97 Ga0070664_100841126 3300005564 Bacteria 859
98 Ga0068857_100035963 3300005577 Bacteria 4387
99 Ga0068854_100746476 3300005578 Bacteria 849
100 Ga0068856_100048390 3300005614 Bacteria 4189
101 Ga0068856_102270814 3300005614 Bacteria 551
102 Ga0070702_100014473 3300005615 Bacteria 4002
103 Ga0068852_100147506 3300005616 Bacteria 2184
104 Ga0068852_100157732 3300005616 Bacteria 2116
105 Ga0068859_100024710 3300005617 Bacteria 6030
106 Ga0068859_100034728 3300005617 Bacteria 5060
107 Ga0068859_100476611 3300005617 Bacteria 1343
108 Ga0068859_100538162 3300005617 Bacteria 1263
109 Ga0068864_100264049 3300005618 Bacteria 1602
110 Ga0068864_100357133 3300005618 Bacteria 1380
111 Ga0068864_100553779 3300005618 Bacteria 1112
112 Ga0068864_100822861 3300005618 Bacteria 914
113 Ga0068864_100893905 3300005618 Bacteria 877
114 Ga0068866_10013748 3300005718 Bacteria 3558
115 Ga0068866_10139681 3300005718 Bacteria 1389
116 Ga0068866_10144871 3300005718 Bacteria 1368
117 Ga0068861_100007078 3300005719 Bacteria 7675
118 Ga0068861_100016510 3300005719 Bacteria 5226
119 Ga0068851_10413302 3300005834 Bacteria 796
120 Ga0068870_10097995 3300005840 Bacteria 1651
121 Ga0068863_100017700 3300005841 Bacteria 6821
122 Ga0068863_100788317 3300005841 Bacteria 947
123 Ga0068863_102110494 3300005841 Bacteria 574
124 Ga0068858_100022502 3300005842 Bacteria 5881
125 Ga0068858_100023415 3300005842 Bacteria 5753
126 Ga0068858_100027022 3300005842 Bacteria 5330
127 Ga0068858_100640402 3300005842 Bacteria 1033
128 Ga0068858_100928239 3300005842 Bacteria 852
129 Ga0068860_100016578 3300005843 Bacteria 7185
130 Ga0068860_100017163 3300005843 Bacteria 7057
131 Ga0068860_100277181 3300005843 Bacteria 1638
132 Ga0068860_100943859 3300005843 Bacteria 880
133 Ga0068862_100136445 3300005844 Bacteria 2174
134 Ga0068862_100266081 3300005844 Bacteria 1566
135 Ga0075368_10239267 3300006042 Bacteria 774
136 Ga0070715_10581635 3300006163 Bacteria 653
137 Ga0070716_100093226 3300006173 Bacteria 1828
138 Ga0070716_100142985 3300006173 Bacteria 1528
139 Ga0070716_100943322 3300006173 Bacteria 679
140 Ga0070712_100002245 3300006175 Bacteria 11887
141 Ga0070712_101191129 3300006175 Bacteria 662
142 Ga0075366_10671767 3300006195 Bacteria 643
143 Ga0097621_100012483 3300006237 Bacteria 6301
144 Ga0097621_100042837 3300006237 Bacteria 3647
145 Ga0068871_100004543 3300006358 Bacteria 9676
146 Ga0068871_100016254 3300006358 Bacteria 5598
147 Ga0068871_100118176 3300006358 Bacteria 2237
148 Ga0075428_100010774 3300006844 Bacteria 10164
149 Ga0075430_100130418 3300006846 Bacteria 2095
150 Ga0075431_100175892 3300006847 Bacteria 2199
151 Ga0075431_100487704 3300006847 Bacteria 1224
152 Ga0075431_100710346 3300006847 Bacteria 982
153 Ga0075431_100867202 3300006847 Bacteria 873
154 Ga0075431_101052217 3300006847 Bacteria 779
155 Ga0075434_100091794 3300006871 Bacteria 3038
156 Ga0075429_100180774 3300006880 Bacteria 1848
157 Ga0075429_100417170 3300006880 Bacteria 1176
158 Ga0075429_100430468 3300006880 Bacteria 1156
159 Ga0075429_100703043 3300006880 Bacteria 885
160 Ga0068865_100003191 3300006881 Bacteria 9814
161 Ga0068865_100739819 3300006881 Bacteria 844
162 Ga0075436_100762470 3300006914 Bacteria 719
163 Ga0097620_100024710 3300006931 Bacteria 6030
164 Ga0097620_100034729 3300006931 Bacteria 5060
165 Ga0097620_100476613 3300006931 Bacteria 1343
166 Ga0097620_100538167 3300006931 Bacteria 1263
167 Ga0075435_100035543 3300007076 Bacteria 3954
168 Ga0075435_100128562 3300007076 Bacteria 2119
169 Ga0099794_10510609 3300007265 Bacteria 633
170 Ga0099795_10000026 3300007788 Bacteria 42982
171 Ga0105250_10527145 3300009092 Bacteria 539
172 Ga0105240_10048834 3300009093 Bacteria 5346
173 Ga0111539_10001236 3300009094 Bacteria 34016
174 Ga0111539_10202422 3300009094 Bacteria 2315
175 Ga0111539_10494880 3300009094 Bacteria 1424
176 Ga0111539_11316796 3300009094 Bacteria 838
177 Ga0105245_10001706 3300009098 Bacteria 20010
178 Ga0105245_10004246 3300009098 Bacteria 12707
179 Ga0105245_10043267 3300009098 Bacteria 4017
180 Ga0105245_10611534 3300009098 Bacteria 1117
181 Ga0105247_10001136 3300009101 Bacteria 19692
182 Ga0105247_10029667 3300009101 Bacteria 3316
183 Ga0105247_10033063 3300009101 Bacteria 3145
184 Ga0105247_10101914 3300009101 Bacteria 1836
185 Ga0105247_10165673 3300009101 Bacteria 1466
186 Ga0114129_11044956 3300009147 Bacteria 1026
187 Ga0105243_10013735 3300009148 Bacteria 6127
188 Ga0105243_10328516 3300009148 Bacteria 1396
189 Ga0105243_10966867 3300009148 Bacteria 852
190 Ga0105243_11401723 3300009148 Bacteria 719
191 Ga0105241_10287291 3300009174 Bacteria 1407
192 Ga0105241_11529596 3300009174 Bacteria 643
193 Ga0105242_10022308 3300009176 Bacteria 4977
194 Ga0105248_10002658 3300009177 Bacteria 19845
195 Ga0105248_10096266 3300009177 Bacteria 3334
196 Ga0105248_10125192 3300009177 Bacteria 2899
197 Ga0105248_10264233 3300009177 Bacteria 1937
198 Ga0105248_10515127 3300009177 Bacteria 1349
199 Ga0105248_10697762 3300009177 Bacteria 1145
200 Ga0105248_10726547 3300009177 Bacteria 1120
201 Ga0105237_10034139 3300009545 Bacteria 5153
202 Ga0105237_11028580 3300009545 Bacteria 831
203 Ga0105238_10000001 3300009551 Bacteria 2036163
204 Ga0105238_10152931 3300009551 Bacteria 2282
205 Ga0105238_11194329 3300009551 Bacteria 785
206 Ga0105249_10000124 3300009553 Bacteria 104120
207 Ga0105249_11653588 3300009553 Bacteria 713
208 Ga0099796_10000202 3300010159 Bacteria 9163
209 Ga0099796_10000462 3300010159 Bacteria 6817
210 Ga0099796_10131482 3300010159 Bacteria 971
211 Ga0105239_10077455 3300010375 Bacteria 3659
212 Ga0105239_11796260 3300010375 Bacteria 710
213 Ga0105246_10030899 3300011119 Bacteria 3541
214 Ga0105246_10082549 3300011119 Bacteria 2294
215 Ga0157314_1035964 3300012500 Bacteria 578
216 Ga0157324_1053872 3300012506 Bacteria 531
217 Ga0157370_10003838 3300013104 Bacteria 17525
218 Ga0157369_10018627 3300013105 Bacteria 7783
219 Ga0157374_10001248 3300013296 Bacteria 21702
220 Ga0157374_10208412 3300013296 Bacteria 1916
221 Ga0157374_10250091 3300013296 Bacteria 1744
222 Ga0157374_10514253 3300013296 Bacteria 1203
223 Ga0157374_10699454 3300013296 Bacteria 1027
224 Ga0157374_11424930 3300013296 Bacteria 716
225 Ga0157378_10010450 3300013297 Bacteria 8107
226 Ga0157378_10024843 3300013297 Bacteria 5277
227 Ga0157378_10070705 3300013297 Bacteria 3133
228 Ga0157378_10150766 3300013297 Bacteria 2166
229 Ga0163162_10015967 3300013306 Bacteria 7338
230 Ga0163162_10048926 3300013306 Bacteria 4237
231 Ga0163162_10119622 3300013306 Bacteria 2737
232 Ga0163162_10672675 3300013306 Bacteria 1158
233 Ga0157372_10087571 3300013307 Bacteria 3534
234 Ga0157375_10092300 3300013308 Bacteria 3091
235 Ga0157375_10092726 3300013308 Bacteria 3085
236 Ga0157375_10613345 3300013308 Bacteria 1247
237 Ga0163163_10000025 3300014325 Bacteria 182686
238 Ga0163163_10037422 3300014325 Bacteria 4721
239 Ga0163163_10335075 3300014325 Bacteria 1568
240 Ga0157380_10012432 3300014326 Bacteria 6177
241 Ga0157380_10219574 3300014326 Bacteria 1700
242 Ga0157377_10062020 3300014745 Bacteria 2138
243 Ga0157379_10005140 3300014968 Bacteria 11230
244 Ga0157379_10122850 3300014968 Bacteria 2336
245 Ga0157376_10002178 3300014969 Bacteria 13188
246 Ga0157376_11224613 3300014969 Bacteria 779
247 Ga0182006_1003729 3300015261 Bacteria 7701
248 Ga0209760_101663 3300025207 Bacteria 2267
249 Ga0209784_100010 3300025224 Bacteria 683664
250 Ga0209566_100008 3300025225 Bacteria 683664
251 Ga0209674_100019 3300025226 Bacteria 683664
252 Ga0209672_105273 3300025228 Bacteria 2245
253 Ga0209563_100021 3300025230 Bacteria 683764
254 Ga0209437_100019 3300025233 Bacteria 683764
255 Ga0209677_100011 3300025253 Bacteria 683664
256 Ga0209233_1000025 3300025261 Bacteria 683764
257 Ga0207697_10012954 3300025315 Bacteria 3484
258 Ga0207655_1100429 3300025728 Bacteria 998
259 Ga0207653_10054596 3300025885 Bacteria 1336
260 Ga0207682_10225045 3300025893 Bacteria 868
261 Ga0207692_10017935 3300025898 Bacteria 3167
262 Ga0207692_10235314 3300025898 Bacteria 1092
263 Ga0207642_10008533 3300025899 Bacteria 3521
264 Ga0207642_10117789 3300025899 Bacteria 1364
265 Ga0207710_10012156 3300025900 Bacteria 3619
266 Ga0207710_10014355 3300025900 Bacteria 3339
267 Ga0207710_10064659 3300025900 Bacteria 1666
268 Ga0207680_10375430 3300025903 Bacteria 1002
269 Ga0207699_10714109 3300025906 Bacteria 734
270 Ga0207645_10318859 3300025907 Bacteria 1037
271 Ga0207643_10006343 3300025908 Bacteria 6334
272 Ga0207643_10010512 3300025908 Bacteria 4985
273 Ga0207684_10001002 3300025910 Bacteria 31689
274 Ga0207684_10785272 3300025910 Bacteria 806
275 Ga0207707_10016583 3300025912 Bacteria 6421
276 Ga0207707_10197015 3300025912 Bacteria 1757
277 Ga0207707_10382395 3300025912 Bacteria 1210
278 Ga0207707_11117387 3300025912 Bacteria 642
279 Ga0207695_10028890 3300025913 Bacteria 6138
280 Ga0207671_10185805 3300025914 Bacteria 1619
281 Ga0207693_10002539 3300025915 Bacteria 15871
282 Ga0207663_10100669 3300025916 Bacteria 1940
283 Ga0207662_10024882 3300025918 Bacteria 3446
284 Ga0207652_11307527 3300025921 Bacteria 628
285 Ga0207646_10000740 3300025922 Bacteria 42433
286 Ga0207646_10051524 3300025922 Bacteria 3683
287 Ga0207681_10294126 3300025923 Bacteria 1283
288 Ga0207681_10367244 3300025923 Bacteria 1156
289 Ga0207694_10000001 3300025924 Bacteria 4078485
290 Ga0207694_11319896 3300025924 Bacteria 610
291 Ga0207650_10016143 3300025925 Bacteria 5214
292 Ga0207659_10154835 3300025926 Bacteria 1793
293 Ga0207687_10021124 3300025927 Bacteria 4322
294 Ga0207687_10041424 3300025927 Bacteria 3162
295 Ga0207687_10073957 3300025927 Bacteria 2441
296 Ga0207687_10396434 3300025927 Bacteria 1134
297 Ga0207700_11335694 3300025928 Bacteria 638
298 Ga0207690_10140203 3300025932 Bacteria 1780
299 Ga0207706_10158952 3300025933 Bacteria 1987
300 Ga0207686_10017911 3300025934 Bacteria 4001
301 Ga0207686_10448978 3300025934 Bacteria 991
302 Ga0207709_10015087 3300025935 Bacteria 4281
303 Ga0207670_10001724 3300025936 Bacteria 11418
304 Ga0207670_10113204 3300025936 Bacteria 1959
305 Ga0207670_10513541 3300025936 Bacteria 975
306 Ga0207670_10777486 3300025936 Bacteria 797
307 Ga0207669_10048449 3300025937 Bacteria 2524
308 Ga0207669_10080228 3300025937 Bacteria 2086
309 Ga0207704_10066399 3300025938 Bacteria 2264
310 Ga0207704_10270985 3300025938 Bacteria 1285
311 Ga0207665_10006836 3300025939 Bacteria 7552
312 Ga0207665_10066267 3300025939 Bacteria 2457
313 Ga0207691_10179560 3300025940 Bacteria 1850
314 Ga0207711_10012097 3300025941 Bacteria 7173
315 Ga0207711_10057494 3300025941 Bacteria 3344
316 Ga0207711_10660547 3300025941 Bacteria 975
317 Ga0207711_10920421 3300025941 Bacteria 813
318 Ga0207689_10000161 3300025942 Bacteria 57831
319 Ga0207689_10000481 3300025942 Bacteria 37621
320 Ga0207689_10058629 3300025942 Bacteria 3166
321 Ga0207679_10173163 3300025945 Bacteria 1779
322 Ga0207679_10724226 3300025945 Bacteria 904
323 Ga0207667_10035279 3300025949 Bacteria 5366
324 Ga0207651_11870440 3300025960 Bacteria 540
325 Ga0207712_10000112 3300025961 Bacteria 88317
326 Ga0207712_10190413 3300025961 Bacteria 1619
327 Ga0207658_10035798 3300025986 Bacteria 3557
328 Ga0207658_10239264 3300025986 Bacteria 1537
329 Ga0207677_10183398 3300026023 Bacteria 1648
330 Ga0207703_10016015 3300026035 Bacteria 5847
331 Ga0207703_10029781 3300026035 Bacteria 4309
332 Ga0207703_11337144 3300026035 Bacteria 689
333 Ga0207678_10177073 3300026067 Bacteria 1821
334 Ga0207708_10184628 3300026075 Bacteria 1657
335 Ga0207708_10611363 3300026075 Bacteria 924
336 Ga0207708_10854041 3300026075 Bacteria 786
337 Ga0207702_10068893 3300026078 Bacteria 3040
338 Ga0207641_10245432 3300026088 Bacteria 1670
339 Ga0207641_12209006 3300026088 Bacteria 550
340 Ga0207648_10000348 3300026089 Bacteria 50841
341 Ga0207648_10002882 3300026089 Bacteria 18213
342 Ga0207676_10122057 3300026095 Bacteria 2199
343 Ga0207676_10619365 3300026095 Bacteria 1041
344 Ga0207674_10006487 3300026116 Bacteria 13757
345 Ga0207674_10037234 3300026116 Bacteria 5062
346 Ga0207675_100003704 3300026118 Bacteria 14888
347 Ga0207675_100017166 3300026118 Bacteria 6760
348 Ga0207675_100142861 3300026118 Bacteria 2274
349 Ga0207683_10019716 3300026121 Bacteria 5762
350 Ga0207683_10253500 3300026121 Bacteria 1606
351 Ga0207698_10177069 3300026142 Bacteria 1885
352 Ga0209588_1154844 3300027671 Bacteria 725
353 Ga0209588_1194226 3300027671 Bacteria 634
354 Ga0209971_1089385 3300027682 Bacteria 752
355 Ga0209813_10280870 3300027866 Bacteria 641
356 Ga0209974_10035617 3300027876 Bacteria 1653
357 Ga0207428_10001663 3300027907 Bacteria 23040
358 Ga0268266_10118406 3300028379 Bacteria 2354
359 Ga0268266_10387757 3300028379 Bacteria 1319
360 Ga0268265_10411643 3300028380 Bacteria 1253
361 Ga0268265_10466667 3300028380 Bacteria 1182
362 Ga0268265_10494688 3300028380 Bacteria 1151
363 Ga0268265_11680930 3300028380 Bacteria 640
364 Ga0268264_10088887 3300028381 Bacteria 2659
365 Ga0265337_1073289 3300028556 Bacteria 940
366 Ga0265319_1005442 3300028563 Bacteria 6088
367 Ga0265318_10002344 3300028577 Bacteria 10157
368 Ga0265318_10015417 3300028577 Bacteria 3179
369 Ga0265322_10023353 3300028654 Bacteria 1768
370 Ga0265336_10044915 3300028666 Bacteria 1344
371 Ga0307515_10202027 3300028794 Bacteria 1860
372 Ga0265338_10016638 3300028800 Bacteria 7978
373 Ga0265324_10317649 3300029957 Bacteria 530
374 Ga0265773_1045383 3300031018 Bacteria 514
375 Ga0265760_10103884 3300031090 Bacteria 900
376 Ga0265330_10038168 3300031235 Bacteria 2136
377 Ga0265328_10004055 3300031239 Bacteria 6412
378 Ga0265320_10017083 3300031240 Bacteria 4041
379 Ga0265325_10067990 3300031241 Bacteria 1794
380 Ga0265340_10057255 3300031247 Bacteria 1873
381 Ga0265331_10001100 3300031250 Bacteria 20824
382 Ga0265316_10143059 3300031344 Bacteria 1795
383 Ga0307513_10039442 3300031456 Bacteria 5235
384 Ga0307509_10230751 3300031507 Bacteria 1654
385 Ga0265314_10003240 3300031711 Bacteria 15912
386 Ga0265342_10046560 3300031712 Bacteria 2606
387 Ga0265342_10047098 3300031712 Bacteria 2588
388 Ga0307516_10142163 3300031730 Bacteria 2168
389 Ga0307405_10163524 3300031731 Bacteria 1579
390 Ga0307413_10002616 3300031824 Bacteria 7361
391 Ga0307407_10054847 3300031903 Bacteria 2300
392 Ga0307412_10037739 3300031911 Bacteria 3106
393 Ga0307416_100056356 3300032002 Bacteria 3171
394 Ga0307414_11788014 3300032004 Bacteria 573
395 Ga0307411_10012862 3300032005 Bacteria 4588
396 Ga0307415_100100901 3300032126 Bacteria 2116
397 Ga0373934_0024124 3300035086 Bacteria 2352
398 Ga0373944_0080532 3300035089 Bacteria 1075
399 Ga0373951_0113396 3300035091 Bacteria 732
400 Ga0373936_0238928 3300035113 Bacteria 809
401 Ga0373945_0056808 3300035116 Bacteria 1452
402 Ga0373953_0007834 3300035117 Bacteria 3599
403 Ga0373954_0005789 3300035118 Bacteria 5368
404 Ga0373954_0010895 3300035118 Bacteria 4020
405 Ga0373956_0448059 3300035119 Bacteria 616
406 Ga0373957_0131266 3300035120 Bacteria 1020
407 Ga0373943_0044736 3300035170 Bacteria 2155
408 Ga0373946_0048408 3300035171 Bacteria 1770
409 Ga0373946_0393043 3300035171 Bacteria 699
410 Ga0373955_0010027 3300035172 Bacteria 4459
411 Ga0373955_0170806 3300035172 Bacteria 1287
412 Ga0373955_0262463 3300035172 Bacteria 1037
413 Ga0373955_0370832 3300035172 Bacteria 868
414 Ga0373924_0462255 3300035410 Bacteria 569
415 Ga0373935_0027249 3300035692 Bacteria 3532
416 Ga0373927_0290399 3300035695 Bacteria 1076
417 Ga0373933_0030736 3300035724 Bacteria 3111
418 Ga0373937_0241605 3300036401 Bacteria 1701
419 Ga0373937_0275975 3300036401 Bacteria 1587
420 Ga0373937_1257023 3300036401 Bacteria 688
421 Ga0373937_1386575 3300036401 Bacteria 651
422 Ga0373925_0186961 3300037068 Bacteria 1642
423 Ga0373925_0247180 3300037068 Bacteria 1430
424 Ga0373925_0252464 3300037068 Bacteria 1415
425 Ga0373925_0543826 3300037068 Bacteria 955
426 Ga0395900_0006828 3300037418 Bacteria 11845
427 Ga0395900_1709689 3300037418 Bacteria 540
428 Ga0395898_0004974 3300037466 Bacteria 14423
429 Ga0395901_0001392 3300038443 Bacteria 25273
430 Ga0242419_007648 3300038698 Bacteria 799
431 Ga0436361_0423834 3300039447 Bacteria 5606
432 Ga0436362_0973539 3300039453 Bacteria 872
433 Ga0439438_141324 3300041405 Bacteria 576
434 Ga0439439_0123405 3300041406 Bacteria 723
435 Ga0451802_1819958 3300041460 Bacteria 969
436 Ga0451853_2650418 3300041512 Bacteria 668
437 Ga0439451_019554 3300042009 Bacteria 1365
438 Ga0439446_0214456 3300042156 Bacteria 654
439 Ga0439434_0097564 3300042435 Bacteria 945
440 Ga0439460_0052790 3300042461 Bacteria 1223
441 Ga0451577_0062509 3300042876 Bacteria 3321
442 Ga0451577_0114944 3300042876 Bacteria 2409
443 Ga0439440_0263052 3300042993 Bacteria 528
444 Ga0453683_0003741 3300044673 Bacteria 11095
445 Ga0453683_0011339 3300044673 Bacteria 5876
446 Ga0453684_0007315 3300044712 Bacteria 20420
447 Ga0453684_0016187 3300044712 Bacteria 11688
448 Ga0453684_1142442 3300044712 Bacteria 821
449 Ga0451576_0041834 3300045051 Bacteria 4841
450 Ga0451576_0288988 3300045051 Bacteria 1714
451 Ga0451576_0474732 3300045051 Bacteria 1313
452 Ga0451576_0694124 3300045051 Bacteria 1069
453 Ga0451576_1935749 3300045051 Bacteria 608
454 Ga0495592_0603473 3300046454 Bacteria 669
455 Ga0495629_0101568 3300046459 Bacteria 2007
456 Ga0495651_0154452 3300046462 Bacteria 1651
457 Ga0495580_0000404 3300046472 Bacteria 35481
458 Ga0495580_0005107 3300046472 Bacteria 10931
459 Ga0495580_0098103 3300046472 Bacteria 2038
460 Ga0495580_0396187 3300046472 Bacteria 931
461 Ga0495582_0262481 3300046473 Bacteria 991
462 Ga0495605_0412754 3300046474 Bacteria 560
463 Ga0495639_0309502 3300046475 Bacteria 789
464 Ga0495584_0000002 3300046491 Bacteria 512179
465 Ga0495606_0065204 3300046507 Bacteria 2315
466 Ga0495608_0107534 3300046511 Bacteria 1795
467 Ga0495628_0046838 3300046516 Bacteria 3433
468 Ga0495628_0485443 3300046516 Bacteria 894
469 Ga0495628_0995954 3300046516 Bacteria 577
470 Ga0495637_0261785 3300046520 Bacteria 621
471 Ga0495643_0053090 3300046522 Bacteria 2174
472 Ga0495666_0036880 3300046526 Bacteria 2380
473 Ga0495652_0007112 3300046529 Bacteria 10326
474 Ga0495652_0713052 3300046529 Bacteria 674
475 Ga0495665_0020451 3300046531 Bacteria 3555
476 Ga0495640_0095326 3300046533 Bacteria 1959
477 Ga0495640_0163360 3300046533 Bacteria 1426
478 Ga0495586_0070489 3300046535 Bacteria 1909
479 Ga0495587_0026071 3300046536 Bacteria 3567
480 Ga0495587_0112859 3300046536 Bacteria 1560
481 Ga0495621_0036079 3300046539 Bacteria 1715
482 Ga0495645_0009202 3300046543 Bacteria 6903
483 Ga0495645_0034466 3300046543 Bacteria 3693
484 Ga0495645_0132083 3300046543 Bacteria 1749
485 Ga0495667_0018688 3300046559 Bacteria 4680
486 Ga0495667_0072882 3300046559 Bacteria 2238
487 Ga0495635_0163437 3300046663 Bacteria 1515
488 Ga0495657_0488071 3300046675 Bacteria 719
489 Ga0495657_0738232 3300046675 Bacteria 565
490 Ga0495623_0022017 3300046679 Bacteria 4117
491 Ga0495623_0287052 3300046679 Bacteria 913
492 Ga0495646_0003650 3300046680 Bacteria 9604
493 Ga0495647_0357609 3300046681 Bacteria 665
494 Ga0495658_0383154 3300046683 Bacteria 895
495 Ga0495658_0540969 3300046683 Bacteria 746
496 Ga0495669_0645651 3300046684 Bacteria 515
497 Ga0495613_0199170 3300046689 Bacteria 1412
498 Ga0495613_0745941 3300046689 Bacteria 642
499 Ga0495604_0189740 3300047317 Bacteria 1433
500 Ga0495636_0058754 3300047318 Bacteria 1622
501 Ga0495674_0072786 3300047319 Bacteria 2964
502 Ga0495674_0128532 3300047319 Bacteria 2136
503 Ga0495680_0065364 3300047322 Bacteria 2786
504 Ga0495680_0086595 3300047322 Bacteria 2357
505 Ga0495684_0385992 3300047471 Bacteria 987
506 Ga0495684_0945383 3300047471 Bacteria 552
507 Ga0496100_0777252 3300048903 Bacteria 750
508 Ga0496101_0246989 3300048904 Bacteria 1390
509 Ga0496102_1339178 3300048905 Bacteria 635
510 Ga0496104_0076421 3300048907 Bacteria 3190
511 Ga0496105_0055401 3300048908 Bacteria 3274
512 Ga0496105_0058325 3300048908 Bacteria 3187
513 Ga0496106_1270561 3300048909 Bacteria 572
514 Ga0496107_0056138 3300048910 Bacteria 2845
515 Ga0496107_0582199 3300048910 Bacteria 828
516 Ga0496108_0015718 3300048911 Bacteria 6172
517 Ga0496108_0078646 3300048911 Bacteria 2792
518 Ga0496108_0751081 3300048911 Bacteria 844
519 Ga0496109_0007942 3300048912 Bacteria 8994
520 Ga0496109_0008897 3300048912 Bacteria 8554
521 Ga0496109_0270197 3300048912 Bacteria 1602
522 Ga0496110_0174570 3300048913 Bacteria 1950
523 Ga0496110_0212012 3300048913 Bacteria 1761
524 Ga0496110_0384035 3300048913 Bacteria 1280
525 Ga0496111_0032304 3300048914 Bacteria 3731
526 Ga0496112_0002492 3300048915 Bacteria 14861
527 Ga0496112_0006574 3300048915 Bacteria 10229
528 Ga0496112_0057934 3300048915 Bacteria 3814
529 Ga0496113_0015392 3300048916 Bacteria 5255
530 Ga0496113_0100916 3300048916 Bacteria 2237
531 Ga0496113_0611303 3300048916 Bacteria 873
532 Ga0496114_0079629 3300048917 Bacteria 2766
533 Ga0496114_0998845 3300048917 Bacteria 720
534 Ga0496115_0168427 3300048918 Bacteria 1812
535 Ga0496115_0209334 3300048918 Bacteria 1611
536 Ga0495682_0287569 3300049460 Bacteria 580
537 Ga0501046_0755393 3300049580 Bacteria 683
538 Ga0501071_1104924 3300049587 Bacteria 613
539 Ga0501073_0292554 3300049589 Bacteria 1124
540 Ga0501076_0121216 3300049592 Bacteria 2118
541 Ga0501076_1285372 3300049592 Bacteria 602
542 Ga0501217_262655 3300049661 Bacteria 560
543 nmdc:mga03n38_107794_c1 3300050490 Bacteria 1352
544 nmdc:mga04h51_313720_c1 3300050495 Bacteria 641
545 nmdc:mga05p37_43322_c1 3300050507 Bacteria 5537
546 nmdc:mga09592_1262936_c1 3300050508 Bacteria 608
547 nmdc:mga09592_521164_c1 3300050508 Bacteria 1022
548 nmdc:mga09592_53008_c1 3300050508 Bacteria 3424
549 nmdc:mga09592_726314_c1 3300050508 Bacteria 844
550 nmdc:mga06r32_246850_c1 3300050510 Bacteria 1773
551 nmdc:mga06r32_789741_c1 3300050510 Bacteria 911
552 nmdc:mga08y16_12578_c1 3300050511 Bacteria 8904
553 nmdc:mga08y16_1830867_c1 3300050511 Bacteria 559
554 nmdc:mga08y16_433601_c1 3300050511 Bacteria 1342
555 nmdc:mga0n895_120573_c1 3300050512 Bacteria 2644
556 nmdc:mga0n895_55223_c1 3300050512 Bacteria 3909
557 nmdc:mga0rr50_472801_c1 3300050513 Bacteria 1064
558 nmdc:mga08x19_502221_c1 3300050514 Bacteria 856
559 nmdc:mga0a205_17056_c1 3300050515 Bacteria 6798
560 nmdc:mga0a205_380499_c1 3300050515 Bacteria 1277
561 nmdc:mga0a205_428715_c1 3300050515 Bacteria 1184
562 Ga0495619_0449021 3300053085 Bacteria 889
563 Ga0495619_0548067 3300053085 Bacteria 793
564 Ga0500641_0020970 3300053096 Bacteria 2484
565 Ga0500559_0011979 3300053136 Bacteria 3695
566 Ga0500574_060917 3300053141 Bacteria 1095
567 Ga0500636_0110288 3300053177 Bacteria 1556
568 Ga0501084_0875072 3300054114 Bacteria 756
569 Ga0590071_172162 3300059421 Bacteria 566
570 2945946281 2945945610 Bacteria 5951079
571 Ga0207703_10359449
572 JGI25162J39368_1000061
573 JGI25165J46597_1000117
574 Ga0055538_1000046
575 Ga0055539_1000065
576 Ga0055533_1000075
577 Ga0055525_1000095
578 Ga0055541_1000047
579 Ga0065714_10345702
580 Ga0065715_10231459
581 Ga0065707_10307824
582 Ga0070683_100109611
583 Ga0070690_100011878
584 Ga0070690_100037024
585 Ga0070690_100474521
586 Ga0070670_100001322
587 Ga0070670_101413644
588 Ga0070677_10535804
589 Ga0068869_100001120
590 Ga0068869_100017236
591 Ga0070666_10182331
592 Ga0070680_100453241
593 Ga0070689_100019635
594 Ga0070689_100291760
595 Ga0070689_100662105
596 Ga0070687_100007377
597 Ga0070687_100012154
598 Ga0070687_100066780
599 Ga0070687_100109502
600 Ga0070692_10005925
601 Ga0070668_100042492
602 Ga0070669_100055846
603 Ga0070675_100170180
604 Ga0070671_100464351
605 Ga0070671_100689223
606 Ga0070674_100001013
607 Ga0070674_100096352
608 Ga0070688_100000374
609 Ga0070688_100372318
610 Ga0070688_100417879
611 Ga0070659_100046152
612 Ga0070659_100076385
613 Ga0070667_100027716
614 Ga0070667_100189657
615 Ga0070703_10559128
616 Ga0070713_100101928
617 Ga0070713_101076653
618 Ga0070710_10223878
619 Ga0070701_10024727
620 Ga0070701_10262267
621 Ga0070711_100144063
622 Ga0070705_100034000
623 Ga0070705_100221738
624 Ga0070700_100093123
625 Ga0070700_101022553
626 Ga0070700_101165042
627 Ga0070694_100007169
628 Ga0070694_100111845
629 Ga0070694_100472989
630 Ga0070694_100677991
631 Ga0070694_100681416
632 Ga0070708_100121254
633 Ga0070663_100635008
634 Ga0070663_101061592
635 Ga0070678_100015303
636 Ga0070662_100233778
637 Ga0070681_10234009
638 Ga0070681_10474765
639 Ga0068867_100007464
640 Ga0068867_100010157
641 Ga0068867_100567174
642 Ga0070685_10001541
643 Ga0070685_10347567
644 Ga0070706_100076208
645 Ga0070706_100091020
646 Ga0070698_100143551
647 Ga0070698_100218345
648 Ga0070698_100555368
649 Ga0070679_101429263
650 Ga0070697_100176450
651 Ga0068853_100741037
652 Ga0070686_100016110
653 Ga0070686_100048056
654 Ga0070695_100092205
655 Ga0070695_100200884
656 Ga0070696_100022610
657 Ga0070696_100277170
658 Ga0070696_100476038
659 Ga0070693_100009587
660 Ga0070693_100044138
661 Ga0070665_100166921
662 Ga0070665_100448591
663 Ga0070704_100055875
664 Ga0068855_100045399
665 Ga0070664_100110226
666 Ga0070664_100593813
667 Ga0070664_100841126
668 Ga0068857_100035963
669 Ga0068854_100746476
670 Ga0068856_100048390
671 Ga0068856_102270814
672 Ga0070702_100014473
673 Ga0068852_100147506
674 Ga0068852_100157732
675 Ga0068859_100024710
676 Ga0068859_100034728
677 Ga0068859_100476611
678 Ga0068859_100538162
679 Ga0068864_100264049
680 Ga0068864_100357133
681 Ga0068864_100553779
682 Ga0068864_100822861
683 Ga0068864_100893905
684 Ga0068866_10013748
685 Ga0068866_10139681
686 Ga0068866_10144871
687 Ga0068861_100007078
688 Ga0068861_100016510
689 Ga0068851_10413302
690 Ga0068870_10097995
691 Ga0068863_100017700
692 Ga0068863_100788317
693 Ga0068863_102110494
694 Ga0068858_100022502
695 Ga0068858_100023415
696 Ga0068858_100027022
697 Ga0068858_100640402
698 Ga0068858_100928239
699 Ga0068860_100016578
700 Ga0068860_100017163
701 Ga0068860_100277181
702 Ga0068860_100943859
703 Ga0068862_100136445
704 Ga0068862_100266081
705 Ga0075368_10239267
706 Ga0070715_10581635
707 Ga0070716_100093226
708 Ga0070716_100142985
709 Ga0070716_100943322
710 Ga0070712_100002245
711 Ga0070712_101191129
712 Ga0075366_10671767
713 Ga0097621_100012483
714 Ga0097621_100042837
715 Ga0068871_100004543
716 Ga0068871_100016254
717 Ga0068871_100118176
718 Ga0075428_100010774
719 Ga0075430_100130418
720 Ga0075431_100175892
721 Ga0075431_100487704
722 Ga0075431_100710346
723 Ga0075431_100867202
724 Ga0075431_101052217
725 Ga0075434_100091794
726 Ga0075429_100180774
727 Ga0075429_100417170
728 Ga0075429_100430468
729 Ga0075429_100703043
730 Ga0068865_100003191
731 Ga0068865_100739819
732 Ga0075436_100762470
733 Ga0097620_100024710
734 Ga0097620_100034729
735 Ga0097620_100476613
736 Ga0097620_100538167
737 Ga0075435_100035543
738 Ga0075435_100128562
739 Ga0099794_10510609
740 Ga0099795_10000026
741 Ga0105250_10527145
742 Ga0105240_10048834
743 Ga0111539_10001236
744 Ga0111539_10202422
745 Ga0111539_10494880
746 Ga0111539_11316796
747 Ga0105245_10001706
748 Ga0105245_10004246
749 Ga0105245_10043267
750 Ga0105245_10611534
751 Ga0105247_10001136
752 Ga0105247_10029667
753 Ga0105247_10033063
754 Ga0105247_10101914
755 Ga0105247_10165673
756 Ga0114129_11044956
757 Ga0105243_10013735
758 Ga0105243_10328516
759 Ga0105243_10966867
760 Ga0105243_11401723
761 Ga0105241_10287291
762 Ga0105241_11529596
763 Ga0105242_10022308
764 Ga0105248_10002658
765 Ga0105248_10096266
766 Ga0105248_10125192
767 Ga0105248_10264233
768 Ga0105248_10515127
769 Ga0105248_10697762
770 Ga0105248_10726547
771 Ga0105237_10034139
772 Ga0105237_11028580
773 Ga0105238_10000001
774 Ga0105238_10152931
775 Ga0105238_11194329
776 Ga0105249_10000124
777 Ga0105249_11653588
778 Ga0099796_10000202
779 Ga0099796_10000462
780 Ga0099796_10131482
781 Ga0105239_10077455
782 Ga0105239_11796260
783 Ga0105246_10030899
784 Ga0105246_10082549
785 Ga0157314_1035964
786 Ga0157324_1053872
787 Ga0157370_10003838
788 Ga0157369_10018627
789 Ga0157374_10001248
790 Ga0157374_10208412
791 Ga0157374_10250091
792 Ga0157374_10514253
793 Ga0157374_10699454
794 Ga0157374_11424930
795 Ga0157378_10010450
796 Ga0157378_10024843
797 Ga0157378_10070705
798 Ga0157378_10150766
799 Ga0163162_10015967
800 Ga0163162_10048926
801 Ga0163162_10119622
802 Ga0163162_10672675
803 Ga0157372_10087571
804 Ga0157375_10092300
805 Ga0157375_10092726
806 Ga0157375_10613345
807 Ga0163163_10000025
808 Ga0163163_10037422
809 Ga0163163_10335075
810 Ga0157380_10012432
811 Ga0157380_10219574
812 Ga0157377_10062020
813 Ga0157379_10005140
814 Ga0157379_10122850
815 Ga0157376_10002178
816 Ga0157376_11224613
817 Ga0182006_1003729
818 Ga0209760_101663
819 Ga0209784_100010
820 Ga0209566_100008
821 Ga0209674_100019
822 Ga0209672_105273
823 Ga0209563_100021
824 Ga0209437_100019
825 Ga0209677_100011
826 Ga0209233_1000025
827 Ga0207697_10012954
828 Ga0207655_1100429
829 Ga0207653_10054596
830 Ga0207682_10225045
831 Ga0207692_10017935
832 Ga0207692_10235314
833 Ga0207642_10008533
834 Ga0207642_10117789
835 Ga0207710_10012156
836 Ga0207710_10014355
837 Ga0207710_10064659
838 Ga0207680_10375430
839 Ga0207699_10714109
840 Ga0207645_10318859
841 Ga0207643_10006343
842 Ga0207643_10010512
843 Ga0207684_10001002
844 Ga0207684_10785272
845 Ga0207707_10016583
846 Ga0207707_10197015
847 Ga0207707_10382395
848 Ga0207707_11117387
849 Ga0207695_10028890
850 Ga0207671_10185805
851 Ga0207693_10002539
852 Ga0207663_10100669
853 Ga0207662_10024882
854 Ga0207652_11307527
855 Ga0207646_10000740
856 Ga0207646_10051524
857 Ga0207681_10294126
858 Ga0207681_10367244
859 Ga0207694_10000001
860 Ga0207694_11319896
861 Ga0207650_10016143
862 Ga0207659_10154835
863 Ga0207687_10021124
864 Ga0207687_10041424
865 Ga0207687_10073957
866 Ga0207687_10396434
867 Ga0207700_11335694
868 Ga0207690_10140203
869 Ga0207706_10158952
870 Ga0207686_10017911
871 Ga0207686_10448978
872 Ga0207709_10015087
873 Ga0207670_10001724
874 Ga0207670_10113204
875 Ga0207670_10513541
876 Ga0207670_10777486
877 Ga0207669_10048449
878 Ga0207669_10080228
879 Ga0207704_10066399
880 Ga0207704_10270985
881 Ga0207665_10006836
882 Ga0207665_10066267
883 Ga0207691_10179560
884 Ga0207711_10012097
885 Ga0207711_10057494
886 Ga0207711_10660547
887 Ga0207711_10920421
888 Ga0207689_10000161
889 Ga0207689_10000481
890 Ga0207689_10058629
891 Ga0207679_10173163
892 Ga0207679_10724226
893 Ga0207667_10035279
894 Ga0207651_11870440
895 Ga0207712_10000112
896 Ga0207712_10190413
897 Ga0207658_10035798
898 Ga0207658_10239264
899 Ga0207677_10183398
900 Ga0207703_10016015
901 Ga0207703_10029781
902 Ga0207703_11337144
903 Ga0207678_10177073
904 Ga0207708_10184628
905 Ga0207708_10611363
906 Ga0207708_10854041
907 Ga0207702_10068893
908 Ga0207641_10245432
909 Ga0207641_12209006
910 Ga0207648_10000348
911 Ga0207648_10002882
912 Ga0207676_10122057
913 Ga0207676_10619365
914 Ga0207674_10006487
915 Ga0207674_10037234
916 Ga0207675_100003704
917 Ga0207675_100017166
918 Ga0207675_100142861
919 Ga0207683_10019716
920 Ga0207683_10253500
921 Ga0207698_10177069
922 Ga0209588_1154844
923 Ga0209588_1194226
924 Ga0209971_1089385
925 Ga0209813_10280870
926 Ga0209974_10035617
927 Ga0207428_10001663
928 Ga0268266_10118406
929 Ga0268266_10387757
930 Ga0268265_10411643
931 Ga0268265_10466667
932 Ga0268265_10494688
933 Ga0268265_11680930
934 Ga0268264_10088887
935 Ga0265337_1073289
936 Ga0265319_1005442
937 Ga0265318_10002344
938 Ga0265318_10015417
939 Ga0265322_10023353
940 Ga0265336_10044915
941 Ga0307515_10202027
942 Ga0265338_10016638
943 Ga0265324_10317649
944 Ga0265773_1045383
945 Ga0265760_10103884
946 Ga0265330_10038168
947 Ga0265328_10004055
948 Ga0265320_10017083
949 Ga0265325_10067990
950 Ga0265340_10057255
951 Ga0265331_10001100
952 Ga0265316_10143059
953 Ga0307513_10039442
954 Ga0307509_10230751
955 Ga0265314_10003240
956 Ga0265342_10046560
957 Ga0265342_10047098
958 Ga0307516_10142163
959 Ga0307405_10163524
960 Ga0307413_10002616
961 Ga0307407_10054847
962 Ga0307412_10037739
963 Ga0307416_100056356
964 Ga0307414_11788014
965 Ga0307411_10012862
966 Ga0307415_100100901
967 Ga0373934_0024124
968 Ga0373944_0080532
969 Ga0373951_0113396
970 Ga0373936_0238928
971 Ga0373945_0056808
972 Ga0373953_0007834
973 Ga0373954_0005789
974 Ga0373954_0010895
975 Ga0373956_0448059
976 Ga0373957_0131266
977 Ga0373943_0044736
978 Ga0373946_0048408
979 Ga0373946_0393043
980 Ga0373955_0010027
981 Ga0373955_0170806
982 Ga0373955_0262463
983 Ga0373955_0370832
984 Ga0373924_0462255
985 Ga0373935_0027249
986 Ga0373927_0290399
987 Ga0373933_0030736
988 Ga0373937_0241605
989 Ga0373937_0275975
990 Ga0373937_1257023
991 Ga0373937_1386575
992 Ga0373925_0186961
993 Ga0373925_0247180
994 Ga0373925_0252464
995 Ga0373925_0543826
996 Ga0395900_0006828
997 Ga0395900_1709689
998 Ga0395898_0004974
999 Ga0395901_0001392
1000 Ga0242419_007648
1001 Ga0436361_0423834
1002 Ga0436362_0973539
1003 Ga0439438_141324
1004 Ga0439439_0123405
1005 Ga0451802_1819958
1006 Ga0451853_2650418
1007 Ga0439451_019554
1008 Ga0439446_0214456
1009 Ga0439434_0097564
1010 Ga0439460_0052790
1011 Ga0451577_0062509
1012 Ga0451577_0114944
1013 Ga0439440_0263052
1014 Ga0453683_0003741
1015 Ga0453683_0011339
1016 Ga0453684_0007315
1017 Ga0453684_0016187
1018 Ga0453684_1142442
1019 Ga0451576_0041834
1020 Ga0451576_0288988
1021 Ga0451576_0474732
1022 Ga0451576_0694124
1023 Ga0451576_1935749
1024 Ga0495592_0603473
1025 Ga0495629_0101568
1026 Ga0495651_0154452
1027 Ga0495580_0000404
1028 Ga0495580_0005107
1029 Ga0495580_0098103
1030 Ga0495580_0396187
1031 Ga0495582_0262481
1032 Ga0495605_0412754
1033 Ga0495639_0309502
1034 Ga0495584_0000002
1035 Ga0495606_0065204
1036 Ga0495608_0107534
1037 Ga0495628_0046838
1038 Ga0495628_0485443
1039 Ga0495628_0995954
1040 Ga0495637_0261785
1041 Ga0495643_0053090
1042 Ga0495666_0036880
1043 Ga0495652_0007112
1044 Ga0495652_0713052
1045 Ga0495665_0020451
1046 Ga0495640_0095326
1047 Ga0495640_0163360
1048 Ga0495586_0070489
1049 Ga0495587_0026071
1050 Ga0495587_0112859
1051 Ga0495621_0036079
1052 Ga0495645_0009202
1053 Ga0495645_0034466
1054 Ga0495645_0132083
1055 Ga0495667_0018688
1056 Ga0495667_0072882
1057 Ga0495635_0163437
1058 Ga0495657_0488071
1059 Ga0495657_0738232
1060 Ga0495623_0022017
1061 Ga0495623_0287052
1062 Ga0495646_0003650
1063 Ga0495647_0357609
1064 Ga0495658_0383154
1065 Ga0495658_0540969
1066 Ga0495669_0645651
1067 Ga0495613_0199170
1068 Ga0495613_0745941
1069 Ga0495604_0189740
1070 Ga0495636_0058754
1071 Ga0495674_0072786
1072 Ga0495674_0128532
1073 Ga0495680_0065364
1074 Ga0495680_0086595
1075 Ga0495684_0385992
1076 Ga0495684_0945383
1077 Ga0496100_0777252
1078 Ga0496101_0246989
1079 Ga0496102_1339178
1080 Ga0496104_0076421
1081 Ga0496105_0055401
1082 Ga0496105_0058325
1083 Ga0496106_1270561
1084 Ga0496107_0056138
1085 Ga0496107_0582199
1086 Ga0496108_0015718
1087 Ga0496108_0078646
1088 Ga0496108_0751081
1089 Ga0496109_0007942
1090 Ga0496109_0008897
1091 Ga0496109_0270197
1092 Ga0496110_0174570
1093 Ga0496110_0212012
1094 Ga0496110_0384035
1095 Ga0496111_0032304
1096 Ga0496112_0002492
1097 Ga0496112_0006574
1098 Ga0496112_0057934
1099 Ga0496113_0015392
1100 Ga0496113_0100916
1101 Ga0496113_0611303
1102 Ga0496114_0079629
1103 Ga0496114_0998845
1104 Ga0496115_0168427
1105 Ga0496115_0209334
1106 Ga0495682_0287569
1107 Ga0501046_0755393
1108 Ga0501071_1104924
1109 Ga0501073_0292554
1110 Ga0501076_0121216
1111 Ga0501076_1285372
1112 Ga0501217_262655
1113 nmdc:mga03n38_107794_c1
1114 nmdc:mga04h51_313720_c1
1115 nmdc:mga05p37_43322_c1
1116 nmdc:mga09592_1262936_c1
1117 nmdc:mga09592_521164_c1
1118 nmdc:mga09592_53008_c1
1119 nmdc:mga09592_726314_c1
1120 nmdc:mga06r32_246850_c1
1121 nmdc:mga06r32_789741_c1
1122 nmdc:mga08y16_12578_c1
1123 nmdc:mga08y16_1830867_c1
1124 nmdc:mga08y16_433601_c1
1125 nmdc:mga0n895_120573_c1
1126 nmdc:mga0n895_55223_c1
1127 nmdc:mga0rr50_472801_c1
1128 nmdc:mga08x19_502221_c1
1129 nmdc:mga0a205_17056_c1
1130 nmdc:mga0a205_380499_c1
1131 nmdc:mga0a205_428715_c1
1132 Ga0495619_0449021
1133 Ga0495619_0548067
1134 Ga0500641_0020970
1135 Ga0500559_0011979
1136 Ga0500574_060917
1137 Ga0500636_0110288
1138 Ga0501084_0875072
1139 Ga0590071_172162
1140 2945946281

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08818

DUF1801

Domain of unknown function (DU1801)

45

141

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2oc6-assembly2.cif.gz_B crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution 0.7325 14 134
2kl4-assembly1.cif.gz_A nmr structure of the protein nb7804a 0.6969 9 130
2oc6-assembly2.cif.gz_B crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution 0.6921 14 134
2kl4-assembly1.cif.gz_A nmr structure of the protein nb7804a 0.6873 9 130
5v8w-assembly3.cif.gz_F crystal structure of human integrator ints9-ints11 ctd complex 0.6289 27 75
ID Description Score Start End Superfamily
af_Q2FVG5_6_119_3.90.1150.200 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.8529 14 123 3.90.1150.200
af_Q2FVG5_6_119_3.90.1150.200 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.8192 14 123 3.90.1150.200
2oc6B01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7334 14 131 3.90.1150.200
2oc6B01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7224 14 131 3.90.1150.200
af_P0AAT2_2_121_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.71 34 132 3.90.1150.30
ID Description Score Start End GO Terms
AF-A0A4V5MSA1-F1-model_v4 deleted 0.9958 10 127
AF-A0A349L252-F1-model_v4 YdhG-like domain-containing protein 0.994 12 132
AF-A0A370D3G0-F1-model_v4 deleted 0.9918 9 127
AF-A0A7V9TMV2-F1-model_v4 DUF1801 domain-containing protein 0.9866 7 130
AF-A0A127MU54-F1-model_v4 deleted 0.9842 12 130

Map