F461113

General Info

Members Datasets Scaffolds Average Seq Length
539 334 531 121

Family's Representative Sequence

Representative Sequence 3300005466|Ga0070685_11287305|Ga0070685_112873051
Length 137
Sequence MARVKRGVAAHARHKKVLDQAKGYYGGRRKLIKTAKQAVEKANQYAYRDRKNRKRNFRALWIQRINAASRGLGLTYGRLIDGLARAGIEVDRKVLSDLAIREPAAFAALVEQAKGALAYLKEKTPGEFEKAAGEKAS

Samples

Sample ID Description Type Environment
1 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
2 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
3 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
4 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
5 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
6 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
7 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
8 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
9 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
10 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
11 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
12 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
14 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
15 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
16 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
17 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
18 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
19 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
20 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
21 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
22 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
26 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
73 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
74 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
97 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
98 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
110 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
115 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
116 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
165 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
169 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
170 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
171 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
172 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
173 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
174 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
175 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
176 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
177 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
178 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
179 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
180 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
181 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
182 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
183 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
184 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
185 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
186 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
187 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
188 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
191 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
192 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
193 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
194 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
195 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
196 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
197 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
198 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
199 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
200 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
201 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
202 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
203 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
204 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
205 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
206 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
207 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
208 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
209 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
210 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
211 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
212 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
213 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
214 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
215 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
216 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
217 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
218 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
219 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
220 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
221 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
222 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
223 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
224 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
225 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
226 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
227 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
228 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
229 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
230 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
231 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
232 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
233 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
234 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
235 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
236 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
237 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
238 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
239 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
240 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
241 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
242 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
243 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
244 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
245 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
246 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
247 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
248 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
249 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
250 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
251 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
252 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
253 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
254 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
255 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
256 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
257 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
258 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
259 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
260 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
261 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
262 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
263 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
264 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
265 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
279 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
280 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
281 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
282 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
283 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
284 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
285 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
286 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
287 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
288 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
289 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
290 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
291 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
292 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
293 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
294 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
295 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
296 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
299 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
300 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
301 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
302 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
303 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
304 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
305 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
306 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
307 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
308 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
309 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
310 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
311 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
312 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
313 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
314 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
315 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
316 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
317 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
318 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
319 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
320 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
321 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
322 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
323 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
324 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
325 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
326 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
327 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
328 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
329 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
330 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
331 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
332 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
333 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
334 639633007 Azoarcus olearius BH72 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 91.09
Metatranscriptomes 7.42
Isolates 1.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.04
Nodule 0
Rhizoplane 3.53
Rhizosphere 88.13
Stem 0
Stem Tuber 0
Unclassified 6.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10001505 3300001989 Bacteria 8790
2 JGI24737J22298_10001228 3300001990 Bacteria 9043
3 JGI24735J21928_10020058 3300002067 Bacteria 2050
4 JGI24738J21930_10007469 3300002075 Bacteria 2520
5 Ga0006778J45830_1035605 3300003162 Bacteria 1495
6 Ga0006778J45830_1075563 3300003162 Bacteria 737
7 Ga0006759J45824_1027411 3300003163 Bacteria 1502
8 JGI25406J46586_10051452 3300003203 Bacteria 1378
9 Ga0006770J48903_1039900 3300003305 Bacteria 803
10 Ga0007410J51695_1035445 3300003574 Bacteria 1032
11 Ga0007416J51690_1018437 3300003577 Bacteria 1602
12 Ga0007429J51699_1035293 3300003579 Bacteria 1510
13 Ga0032354_1063990 3300003693 Bacteria 640
14 Ga0065165_1002628 3300005262 Bacteria 14624
15 Ga0065704_10288503 3300005289 Bacteria 908
16 Ga0065707_10521373 3300005295 Bacteria 742
17 Ga0070658_10000177 3300005327 Bacteria 56043
18 Ga0070658_10257732 3300005327 Bacteria 1481
19 Ga0070658_10271077 3300005327 Bacteria 1443
20 Ga0070683_100001495 3300005329 Bacteria 18043
21 Ga0070690_100458459 3300005330 Bacteria 947
22 Ga0070690_100677617 3300005330 Bacteria 790
23 Ga0070677_10492624 3300005333 Bacteria 663
24 Ga0070666_10002272 3300005335 Bacteria 11611
25 Ga0070682_100605758 3300005337 Bacteria 866
26 Ga0070660_100000065 3300005339 Bacteria 61999
27 Ga0070660_100001988 3300005339 Bacteria 14107
28 Ga0070689_100548807 3300005340 Bacteria 995
29 Ga0070689_101995570 3300005340 Bacteria 530
30 Ga0070691_10258314 3300005341 Bacteria 937
31 Ga0070661_100000084 3300005344 Bacteria 74971
32 Ga0070661_100017729 3300005344 Bacteria 5054
33 Ga0070692_10946453 3300005345 Bacteria 599
34 Ga0070668_100000007 3300005347 Bacteria 150621
35 Ga0070668_100739891 3300005347 Bacteria 870
36 Ga0070669_100190232 3300005353 Bacteria 1610
37 Ga0070671_100000068 3300005355 Bacteria 70220
38 Ga0070671_100002759 3300005355 Bacteria 13636
39 Ga0070671_100729436 3300005355 Bacteria 860
40 Ga0070674_100354791 3300005356 Bacteria 1186
41 Ga0070673_100362563 3300005364 Bacteria 1289
42 Ga0070673_101933801 3300005364 Bacteria 559
43 Ga0070688_101128514 3300005365 Bacteria 628
44 Ga0070659_100000067 3300005366 Bacteria 81723
45 Ga0070659_100014861 3300005366 Bacteria 5822
46 Ga0070667_100135390 3300005367 Bacteria 2154
47 Ga0070667_100967785 3300005367 Bacteria 793
48 Ga0070700_100491934 3300005441 Bacteria 942
49 Ga0070663_100000149 3300005455 Bacteria 34310
50 Ga0070663_100056593 3300005455 Bacteria 2810
51 Ga0070662_100000017 3300005457 Bacteria 105478
52 Ga0070662_100863402 3300005457 Bacteria 771
53 Ga0068867_100380423 3300005459 Bacteria 1185
54 Ga0070685_11287305 3300005466 Bacteria 558
55 Ga0070707_100190468 3300005468 Bacteria 2000
56 Ga0070699_100072315 3300005518 Bacteria 3000
57 Ga0070679_100035325 3300005530 Bacteria 4958
58 Ga0070679_100745160 3300005530 Bacteria 922
59 Ga0070684_100053830 3300005535 Bacteria 3505
60 Ga0070697_100272162 3300005536 Bacteria 1452
61 Ga0070697_100998297 3300005536 Bacteria 744
62 Ga0068853_100000784 3300005539 Bacteria 22095
63 Ga0068853_100014615 3300005539 Bacteria 6438
64 Ga0070696_100008619 3300005546 Bacteria 6822
65 Ga0070693_100001717 3300005547 Bacteria 9961
66 Ga0070693_100157034 3300005547 Bacteria 1446
67 Ga0070693_100553350 3300005547 Bacteria 824
68 Ga0070665_100010650 3300005548 Bacteria 9310
69 Ga0070665_100045641 3300005548 Bacteria 4401
70 Ga0070665_101190845 3300005548 Bacteria 773
71 Ga0070704_100717982 3300005549 Bacteria 888
72 Ga0068855_100000194 3300005563 Bacteria 78505
73 Ga0068855_100304790 3300005563 Bacteria 1763
74 Ga0070664_100000098 3300005564 Bacteria 55907
75 Ga0070664_101153376 3300005564 Bacteria 730
76 Ga0068857_100067311 3300005577 Bacteria 3188
77 Ga0068854_100414383 3300005578 Bacteria 1118
78 Ga0068854_100724549 3300005578 Bacteria 860
79 Ga0068854_101528393 3300005578 Bacteria 607
80 Ga0068856_100000098 3300005614 Bacteria 83221
81 Ga0068856_101378873 3300005614 Bacteria 720
82 Ga0070702_100276113 3300005615 Bacteria 1151
83 Ga0068852_100008502 3300005616 Bacteria 7570
84 Ga0068852_100028855 3300005616 Bacteria 4547
85 Ga0068852_101474771 3300005616 Bacteria 702
86 Ga0068859_100020056 3300005617 Bacteria 6713
87 Ga0068859_100588898 3300005617 Bacteria 1206
88 Ga0068859_101251150 3300005617 Bacteria 818
89 Ga0068864_100057029 3300005618 Bacteria 3375
90 Ga0068861_100029893 3300005719 Bacteria 3989
91 Ga0068861_100230096 3300005719 Bacteria 1571
92 Ga0068861_100608619 3300005719 Bacteria 1004
93 Ga0068851_10244100 3300005834 Bacteria 1017
94 Ga0068863_100000027 3300005841 Bacteria 181884
95 Ga0068863_100821485 3300005841 Bacteria 927
96 Ga0068863_101674291 3300005841 Bacteria 646
97 Ga0068858_100007312 3300005842 Bacteria 10696
98 Ga0068858_100372905 3300005842 Bacteria 1369
99 Ga0068860_100162244 3300005843 Bacteria 2155
100 Ga0068860_101238833 3300005843 Bacteria 767
101 Ga0068862_100184213 3300005844 Bacteria 1876
102 Ga0081540_1072081 3300005983 Bacteria 1593
103 Ga0081539_10014655 3300005985 Bacteria 5772
104 Ga0075364_10322049 3300006051 Bacteria 1053
105 Ga0070712_100010353 3300006175 Bacteria 5881
106 Ga0097621_100129378 3300006237 Bacteria 2148
107 Ga0097621_100311796 3300006237 Bacteria 1392
108 Ga0075370_10058862 3300006353 Bacteria 2186
109 Ga0075370_10124864 3300006353 Bacteria 1500
110 Ga0068871_102384922 3300006358 Bacteria 504
111 Ga0075428_101876012 3300006844 Bacteria 623
112 Ga0075430_100240522 3300006846 Bacteria 1500
113 Ga0075434_100092914 3300006871 Bacteria 3020
114 Ga0075434_100397279 3300006871 Bacteria 1399
115 Ga0075434_100709224 3300006871 Bacteria 1023
116 Ga0075436_100054843 3300006914 Bacteria 2752
117 Ga0097620_100020056 3300006931 Bacteria 6713
118 Ga0097620_100588929 3300006931 Bacteria 1206
119 Ga0097620_101251181 3300006931 Bacteria 818
120 Ga0075435_100364507 3300007076 Bacteria 1240
121 Ga0105240_11168809 3300009093 Bacteria 816
122 Ga0111539_10782110 3300009094 Bacteria 1111
123 Ga0105245_10493023 3300009098 Bacteria 1240
124 Ga0114129_13225328 3300009147 Bacteria 530
125 Ga0105241_10042711 3300009174 Bacteria 3432
126 Ga0105242_10384200 3300009176 Bacteria 1306
127 Ga0105248_10000444 3300009177 Bacteria 47003
128 Ga0105248_10428943 3300009177 Bacteria 1489
129 Ga0105237_10097989 3300009545 Bacteria 2923
130 Ga0105238_10152367 3300009551 Bacteria 2287
131 Ga0105238_10371070 3300009551 Bacteria 1421
132 Ga0105249_10037179 3300009553 Bacteria 4419
133 Ga0105249_11237313 3300009553 Bacteria 818
134 Ga0105239_11049457 3300010375 Bacteria 938
135 Ga0157346_1005557 3300012480 Bacteria 785
136 Ga0157315_1000883 3300012508 Bacteria 1516
137 Ga0157316_1036661 3300012510 Bacteria 621
138 Ga0157373_10557478 3300013100 Bacteria 831
139 Ga0157371_10008677 3300013102 Bacteria 8074
140 Ga0157371_10569875 3300013102 Bacteria 840
141 Ga0157370_10009361 3300013104 Bacteria 10480
142 Ga0157370_10243476 3300013104 Bacteria 1664
143 Ga0157369_10468984 3300013105 Bacteria 1303
144 Ga0157369_10534193 3300013105 Bacteria 1213
145 Ga0157369_12210767 3300013105 Bacteria 558
146 Ga0157374_10297119 3300013296 Bacteria 1597
147 Ga0157374_11285940 3300013296 Bacteria 753
148 Ga0157378_11347387 3300013297 Bacteria 756
149 Ga0163162_10790802 3300013306 Bacteria 1066
150 Ga0157372_10158880 3300013307 Bacteria 2611
151 Ga0157372_11345490 3300013307 Bacteria 824
152 Ga0157372_13372385 3300013307 Bacteria 508
153 Ga0157375_10168385 3300013308 Bacteria 2337
154 Ga0157375_11911214 3300013308 Bacteria 705
155 Ga0163163_10000169 3300014325 Bacteria 68481
156 Ga0163163_11841664 3300014325 Bacteria 665
157 Ga0157380_10522484 3300014326 Bacteria 1158
158 Ga0157380_10666270 3300014326 Bacteria 1040
159 Ga0157380_11064079 3300014326 Bacteria 846
160 Ga0182008_10193538 3300014497 Bacteria 1032
161 Ga0157379_10227355 3300014968 Bacteria 1691
162 Ga0163161_10461584 3300017792 Bacteria 1028
163 Ga0206353_11304491 3300020082 Bacteria 637
164 Ga0154015_1329609 3300020610 Bacteria 523
165 Ga0213876_10017463 3300021384 Bacteria 3789
166 Ga0207682_10198570 3300025893 Bacteria 922
167 Ga0207645_10026414 3300025907 Bacteria 3753
168 Ga0207705_10000137 3300025909 Bacteria 79174
169 Ga0207705_10241058 3300025909 Bacteria 1377
170 Ga0207705_10253149 3300025909 Bacteria 1343
171 Ga0207695_11001145 3300025913 Bacteria 715
172 Ga0207671_10008208 3300025914 Bacteria 8895
173 Ga0207693_10024195 3300025915 Bacteria 4822
174 Ga0207660_10081523 3300025917 Bacteria 2378
175 Ga0207662_10909101 3300025918 Bacteria 623
176 Ga0207657_10000569 3300025919 Bacteria 39174
177 Ga0207657_10534748 3300025919 Bacteria 917
178 Ga0207649_10002487 3300025920 Bacteria 10297
179 Ga0207649_10003403 3300025920 Bacteria 8695
180 Ga0207652_10020269 3300025921 Bacteria 5475
181 Ga0207646_10183865 3300025922 Bacteria 1888
182 Ga0207681_11591423 3300025923 Bacteria 547
183 Ga0207694_10082187 3300025924 Bacteria 2532
184 Ga0207694_11036418 3300025924 Unclassified 694
185 Ga0207650_10233607 3300025925 Bacteria 1484
186 Ga0207659_10311358 3300025926 Bacteria 1296
187 Ga0207687_10323245 3300025927 Bacteria 1249
188 Ga0207644_10000111 3300025931 Bacteria 60737
189 Ga0207644_10112704 3300025931 Bacteria 2059
190 Ga0207644_10205084 3300025931 Bacteria 1556
191 Ga0207690_10000108 3300025932 Bacteria 67599
192 Ga0207690_10151435 3300025932 Bacteria 1720
193 Ga0207706_10000571 3300025933 Bacteria 39174
194 Ga0207706_10027711 3300025933 Bacteria 5065
195 Ga0207686_10184019 3300025934 Bacteria 1484
196 Ga0207686_11202710 3300025934 Bacteria 620
197 Ga0207686_11473349 3300025934 Bacteria 561
198 Ga0207709_10387774 3300025935 Bacteria 1065
199 Ga0207670_10566213 3300025936 Bacteria 930
200 Ga0207670_11049973 3300025936 Bacteria 687
201 Ga0207669_10285388 3300025937 Bacteria 1247
202 Ga0207704_10283785 3300025938 Bacteria 1260
203 Ga0207691_10367838 3300025940 Bacteria 1228
204 Ga0207711_10001099 3300025941 Bacteria 25801
205 Ga0207711_10054097 3300025941 Bacteria 3443
206 Ga0207711_10925870 3300025941 Bacteria 810
207 Ga0207689_10004796 3300025942 Bacteria 12196
208 Ga0207689_10449848 3300025942 Bacteria 1076
209 Ga0207661_10048903 3300025944 Bacteria 3363
210 Ga0207679_10000191 3300025945 Bacteria 49174
211 Ga0207679_10004260 3300025945 Bacteria 8887
212 Ga0207679_10078308 3300025945 Bacteria 2518
213 Ga0207667_10001635 3300025949 Bacteria 28222
214 Ga0207667_10376949 3300025949 Bacteria 1446
215 Ga0207667_10515728 3300025949 Bacteria 1211
216 Ga0207667_10582141 3300025949 Bacteria 1130
217 Ga0207667_11067096 3300025949 Bacteria 792
218 Ga0207651_10048249 3300025960 Bacteria 2877
219 Ga0207651_10269249 3300025960 Bacteria 1402
220 Ga0207651_11406181 3300025960 Bacteria 628
221 Ga0207712_10326356 3300025961 Bacteria 1268
222 Ga0207712_11002823 3300025961 Bacteria 741
223 Ga0207668_10000054 3300025972 Bacteria 95426
224 Ga0207640_10967481 3300025981 Bacteria 747
225 Ga0207640_10996013 3300025981 Bacteria 737
226 Ga0207640_11102655 3300025981 Bacteria 702
227 Ga0207640_12046453 3300025981 Bacteria 519
228 Ga0207703_10005107 3300026035 Bacteria 10616
229 Ga0207703_10035530 3300026035 Bacteria 3960
230 Ga0207703_10327654 3300026035 Bacteria 1404
231 Ga0207639_10004731 3300026041 Bacteria 9171
232 Ga0207639_10110566 3300026041 Bacteria 2238
233 Ga0207678_10001788 3300026067 Bacteria 19681
234 Ga0207678_10040341 3300026067 Bacteria 4049
235 Ga0207678_10147030 3300026067 Bacteria 2012
236 Ga0207702_10005964 3300026078 Bacteria 10581
237 Ga0207641_10000045 3300026088 Bacteria 181882
238 Ga0207641_10227800 3300026088 Bacteria 1731
239 Ga0207641_11576980 3300026088 Bacteria 658
240 Ga0207648_10170179 3300026089 Bacteria 1926
241 Ga0207648_10175332 3300026089 Bacteria 1896
242 Ga0207676_10130349 3300026095 Bacteria 2137
243 Ga0207674_10082281 3300026116 Bacteria 3221
244 Ga0207675_100141195 3300026118 Bacteria 2288
245 Ga0207675_100828716 3300026118 Bacteria 939
246 Ga0207683_10186584 3300026121 Bacteria 1882
247 Ga0207698_10003214 3300026142 Bacteria 9817
248 Ga0207698_10073455 3300026142 Bacteria 2724
249 Ga0209970_1052658 3300027614 Bacteria 738
250 Ga0209974_10234295 3300027876 Bacteria 687
251 Ga0207428_10910406 3300027907 Bacteria 621
252 Ga0268266_10021401 3300028379 Bacteria 5509
253 Ga0268266_10060472 3300028379 Bacteria 3266
254 Ga0268266_11042988 3300028379 Bacteria 791
255 Ga0268266_12054540 3300028379 Bacteria 544
256 Ga0268265_10018719 3300028380 Bacteria 4803
257 Ga0268265_10086147 3300028380 Bacteria 2496
258 Ga0268264_10001183 3300028381 Bacteria 25301
259 Ga0268264_10138094 3300028381 Bacteria 2170
260 Ga0268264_12133131 3300028381 Bacteria 569
261 Ga0265328_10064822 3300031239 Bacteria 1342
262 Ga0265331_10010482 3300031250 Bacteria 5127
263 Ga0265331_10031026 3300031250 Bacteria 2658
264 Ga0265327_10001005 3300031251 Bacteria 40015
265 Ga0265316_10164246 3300031344 Bacteria 1659
266 Ga0307408_100047713 3300031548 Bacteria 3068
267 Ga0307408_100334146 3300031548 Bacteria 1280
268 Ga0307408_101847095 3300031548 Bacteria 578
269 Ga0316576_10043504 3300031727 Bacteria 3240
270 Ga0316576_10307680 3300031727 Bacteria 1184
271 Ga0316576_10602122 3300031727 Bacteria 802
272 Ga0316578_10575799 3300031728 Bacteria 660
273 Ga0316578_10879557 3300031728 Bacteria 518
274 Ga0307405_10079596 3300031731 Bacteria 2136
275 Ga0307405_10253111 3300031731 Bacteria 1311
276 Ga0316577_10810101 3300031733 Bacteria 531
277 Ga0307413_10038061 3300031824 Bacteria 2784
278 Ga0307413_11455665 3300031824 Bacteria 604
279 Ga0307410_10244746 3300031852 Bacteria 1391
280 Ga0307410_10557236 3300031852 Bacteria 950
281 Ga0307410_10920365 3300031852 Bacteria 750
282 Ga0307410_11168083 3300031852 Bacteria 669
283 Ga0307406_10211989 3300031901 Bacteria 1433
284 Ga0307406_11749120 3300031901 Bacteria 552
285 Ga0307406_11795647 3300031901 Bacteria 545
286 Ga0307407_10170296 3300031903 Bacteria 1433
287 Ga0307407_10506792 3300031903 Bacteria 885
288 Ga0307407_10594761 3300031903 Bacteria 823
289 Ga0307412_10000104 3300031911 Bacteria 67823
290 Ga0307412_10115288 3300031911 Bacteria 1925
291 Ga0307412_10408549 3300031911 Bacteria 1107
292 Ga0307409_100280582 3300031995 Bacteria 1539
293 Ga0307409_100830468 3300031995 Bacteria 933
294 Ga0307416_100525221 3300032002 Bacteria 1252
295 Ga0307416_100618807 3300032002 Bacteria 1164
296 Ga0307416_101196970 3300032002 Bacteria 865
297 Ga0307416_101553151 3300032002 Bacteria 767
298 Ga0307416_102190249 3300032002 Bacteria 654
299 Ga0307414_10194187 3300032004 Bacteria 1645
300 Ga0307414_10310798 3300032004 Bacteria 1337
301 Ga0307414_10517435 3300032004 Bacteria 1058
302 Ga0307414_10589631 3300032004 Bacteria 995
303 Ga0307411_10026047 3300032005 Bacteria 3514
304 Ga0307411_10297036 3300032005 Bacteria 1293
305 Ga0307411_10432703 3300032005 Bacteria 1096
306 Ga0307411_10823465 3300032005 Bacteria 819
307 Ga0307415_100012981 3300032126 Bacteria 4843
308 Ga0307415_100033012 3300032126 Bacteria 3355
309 Ga0307415_100881889 3300032126 Bacteria 823
310 Ga0316583_10002571 3300032133 Bacteria 6326
311 Ga0316593_10281444 3300032168 Bacteria 627
312 Ga0316596_1141841 3300033541 Bacteria 658
313 Ga0373930_0079067 3300034816 Bacteria 758
314 Ga0373952_0069674 3300035092 Bacteria 877
315 Ga0373923_0068125 3300035111 Bacteria 1524
316 Ga0373932_0101173 3300035112 Bacteria 938
317 Ga0373939_0149126 3300035114 Bacteria 850
318 Ga0373960_0356388 3300035121 Bacteria 556
319 Ga0373942_0110672 3300035207 Bacteria 849
320 Ga0373961_0182851 3300035241 Bacteria 731
321 Ga0373961_0225226 3300035241 Bacteria 670
322 Ga0316574_0025505 3300035398 Bacteria 3549
323 Ga0316574_0133130 3300035398 Bacteria 1600
324 Ga0316574_0714367 3300035398 Bacteria 614
325 Ga0373931_0006745 3300035691 Bacteria 5388
326 Ga0373931_0161834 3300035691 Bacteria 1313
327 Ga0373931_0733705 3300035691 Bacteria 655
328 Ga0373937_0254378 3300036401 Bacteria 1656
329 Ga0316582_0372145 3300036647 Bacteria 983
330 Ga0316582_0397049 3300036647 Bacteria 950
331 Ga0316584_0057443 3300036712 Bacteria 2913
332 Ga0316584_0203642 3300036712 Bacteria 1459
333 Ga0395899_0010483 3300037312 Bacteria 7097
334 Ga0395900_0174138 3300037418 Bacteria 2189
335 Ga0395905_0017633 3300037471 Bacteria 6777
336 Ga0395905_1454681 3300037471 Bacteria 589
337 Ga0395901_0229964 3300038443 Bacteria 1936
338 Ga0395901_0524470 3300038443 Bacteria 1203
339 Ga0237819_00270 3300038705 Bacteria 18995
340 Ga0400490_06488 3300038726 Bacteria 5318
341 Ga0400491_12863 3300038727 Bacteria 4796
342 Ga0400485_22349 3300038735 Bacteria 174815
343 Ga0400488_14279 3300038741 Bacteria 13772
344 Ga0400488_39077 3300038741 Bacteria 3117
345 Ga0400486_10036 3300038742 Bacteria 65877
346 Ga0400483_031139 3300039062 Bacteria 8639
347 Ga0400483_195212 3300039062 Bacteria 1372
348 Ga0400483_255852 3300039062 Bacteria 2006
349 Ga0400487_51847 3300039110 Bacteria 54060
350 Ga0436365_0363342 3300039437 Bacteria 1830
351 Ga0436365_0754658 3300039437 Bacteria 771
352 Ga0436365_1506208 3300039437 Bacteria 4114
353 Ga0436363_1114653 3300039450 Bacteria 1888
354 Ga0451802_1529159 3300041460 Bacteria 591
355 Ga0451849_0748450 3300041505 Bacteria 528
356 Ga0451855_1831405 3300041511 Bacteria 508
357 Ga0439437_064155 3300042000 Bacteria 502
358 Ga0439454_104898 3300042011 Bacteria 535
359 Ga0439435_0019976 3300042436 Bacteria 1723
360 Ga0439464_0101505 3300042439 Bacteria 875
361 Ga0451577_0288840 3300042876 Bacteria 1486
362 Ga0466966_0041285 3300044684 Bacteria 2965
363 Ga0466966_0093875 3300044684 Bacteria 1860
364 Ga0466964_0087902 3300044706 Bacteria 1347
365 Ga0466957_0019667 3300044842 Bacteria 3972
366 Ga0466957_0169511 3300044842 Bacteria 1421
367 Ga0466959_0262172 3300045049 Bacteria 1189
368 Ga0451576_0002721 3300045051 Bacteria 25669
369 Ga0466958_0008204 3300045836 Bacteria 5784
370 Ga0495639_0302897 3300046475 Bacteria 797
371 Ga0495642_0516059 3300046528 Bacteria 529
372 Ga0495598_0012305 3300046537 Bacteria 2097
373 Ga0495621_0016331 3300046539 Bacteria 2381
374 Ga0495621_0018478 3300046539 Bacteria 2264
375 Ga0495625_0234157 3300046660 Bacteria 1198
376 Ga0495659_0462027 3300046664 Bacteria 553
377 Ga0495588_0399035 3300046674 Bacteria 722
378 Ga0495658_0122859 3300046683 Bacteria 1572
379 Ga0495649_0641169 3300046694 Bacteria 523
380 Ga0495687_027680 3300047443 Bacteria 2649
381 Ga0495615_0129473 3300048090 Bacteria 737
382 Ga0496100_0271183 3300048903 Bacteria 1262
383 Ga0496100_0557247 3300048903 Bacteria 887
384 Ga0496101_0208476 3300048904 Bacteria 1513
385 Ga0496102_0018594 3300048905 Bacteria 6110
386 Ga0496103_0204622 3300048906 Bacteria 1269
387 Ga0496104_0314819 3300048907 Bacteria 1478
388 Ga0496105_0292783 3300048908 Bacteria 1310
389 Ga0496105_0513428 3300048908 Bacteria 939
390 Ga0496106_1486326 3300048909 Bacteria 521
391 Ga0496108_0180233 3300048911 Bacteria 1829
392 Ga0496109_0077499 3300048912 Bacteria 3059
393 Ga0496109_1511433 3300048912 Bacteria 606
394 Ga0496110_0023752 3300048913 Bacteria 5217
395 Ga0496112_0665696 3300048915 Bacteria 970
396 Ga0496114_0441592 3300048917 Bacteria 1152
397 Ga0496114_0471283 3300048917 Bacteria 1111
398 Ga0496114_1529666 3300048917 Bacteria 555
399 Ga0496116_0309622 3300048919 Bacteria 746
400 Ga0496120_0233957 3300048923 Bacteria 871
401 Ga0496122_0013576 3300048925 Bacteria 7955
402 Ga0496122_0317192 3300048925 Bacteria 831
403 Ga0496123_0017741 3300048926 Bacteria 5706
404 Ga0496123_0021349 3300048926 Bacteria 5036
405 Ga0496123_0303744 3300048926 Bacteria 760
406 Ga0496124_0005643 3300048927 Bacteria 13989
407 Ga0496124_0006985 3300048927 Bacteria 12109
408 Ga0496125_0193334 3300048928 Bacteria 1341
409 Ga0496126_0032343 3300048929 Bacteria 4929
410 Ga0501306_094208 3300049127 Bacteria 529
411 Ga0501317_034921 3300049533 Bacteria 746
412 Ga0501319_003520 3300049535 Bacteria 1050
413 Ga0501325_020931 3300049541 Bacteria 689
414 Ga0501031_0124225 3300049568 Bacteria 1686
415 Ga0501031_1048803 3300049568 Bacteria 521
416 Ga0501032_0336573 3300049569 Bacteria 973
417 Ga0501032_0653762 3300049569 Bacteria 667
418 Ga0501034_0248954 3300049571 Bacteria 1722
419 Ga0501034_0312579 3300049571 Bacteria 1505
420 Ga0501036_0233657 3300049572 Bacteria 1543
421 Ga0501036_0330810 3300049572 Bacteria 1273
422 Ga0501036_0381835 3300049572 Bacteria 1176
423 Ga0501036_0448243 3300049572 Bacteria 1075
424 Ga0501036_0762060 3300049572 Bacteria 798
425 Ga0501037_1042382 3300049573 Bacteria 531
426 Ga0501038_0192764 3300049574 Bacteria 1639
427 Ga0501038_1008156 3300049574 Bacteria 611
428 Ga0501039_0510620 3300049575 Bacteria 944
429 Ga0501039_1199820 3300049575 Bacteria 587
430 Ga0501040_0096981 3300049576 Bacteria 2053
431 Ga0501040_0274408 3300049576 Bacteria 1204
432 Ga0501041_0053545 3300049577 Bacteria 2461
433 Ga0501041_0286486 3300049577 Bacteria 1037
434 Ga0501041_0492239 3300049577 Bacteria 780
435 Ga0501042_0437558 3300049578 Bacteria 948
436 Ga0501042_0502836 3300049578 Bacteria 880
437 Ga0501042_0583532 3300049578 Bacteria 813
438 Ga0501046_0506322 3300049580 Bacteria 864
439 Ga0501047_0138116 3300049581 Bacteria 2317
440 Ga0501047_0363263 3300049581 Bacteria 1283
441 Ga0501048_0463690 3300049582 Bacteria 908
442 Ga0501048_0917625 3300049582 Bacteria 630
443 Ga0501048_0936429 3300049582 Bacteria 623
444 Ga0501068_0111786 3300049584 Bacteria 1699
445 Ga0501068_0383906 3300049584 Bacteria 905
446 Ga0501068_1009984 3300049584 Bacteria 549
447 Ga0501070_0088988 3300049586 Bacteria 2555
448 Ga0501071_0541175 3300049587 Bacteria 894
449 Ga0501071_0778425 3300049587 Bacteria 737
450 Ga0501072_0018484 3300049588 Bacteria 5369
451 Ga0501072_0098293 3300049588 Bacteria 2327
452 Ga0501072_0579826 3300049588 Bacteria 885
453 Ga0501072_0955209 3300049588 Bacteria 669
454 Ga0501072_1318492 3300049588 Bacteria 559
455 Ga0501072_1404417 3300049588 Bacteria 540
456 Ga0501073_0089700 3300049589 Bacteria 2137
457 Ga0501074_0003779 3300049590 Bacteria 10761
458 Ga0501074_0141020 3300049590 Bacteria 1724
459 Ga0501074_0397617 3300049590 Bacteria 977
460 Ga0501075_0009440 3300049591 Bacteria 6824
461 Ga0501075_0444534 3300049591 Bacteria 989
462 Ga0501076_0031666 3300049592 Bacteria 4126
463 Ga0501076_0389667 3300049592 Bacteria 1145
464 Ga0501076_0480278 3300049592 Bacteria 1024
465 Ga0501077_0051808 3300049593 Bacteria 2608
466 Ga0501077_0695423 3300049593 Bacteria 653
467 Ga0501202_112769 3300049652 Bacteria 675
468 Ga0501243_050530 3300049675 Bacteria 750
469 Ga0501247_030541 3300049677 Bacteria 734
470 Ga0501079_0035825 3300049741 Bacteria 3820
471 Ga0501079_0764523 3300049741 Bacteria 761
472 Ga0501080_0095691 3300049742 Bacteria 2757
473 Ga0501080_0242068 3300049742 Bacteria 1646
474 Ga0501081_0102919 3300049743 Bacteria 2020
475 Ga0501081_0302654 3300049743 Bacteria 1173
476 Ga0501081_0420674 3300049743 Bacteria 991
477 Ga0501081_1133245 3300049743 Bacteria 592
478 Ga0501083_0117959 3300049744 Bacteria 1741
479 Ga0501083_1152077 3300049744 Bacteria 505
480 Ga0501241_132876 3300049758 Bacteria 562
481 Ga0501268_009889 3300049765 Bacteria 1474
482 Ga0501035_0987476 3300049822 Bacteria 663
483 Ga0501035_1062563 3300049822 Bacteria 634
484 Ga0501044_0048649 3300049823 Bacteria 4379
485 Ga0501044_0338477 3300049823 Bacteria 1426
486 Ga0501045_0427606 3300049824 Bacteria 985
487 Ga0501045_0849988 3300049824 Bacteria 671
488 nmdc:mga00v17_115338_c1 3300050491 Bacteria 1707
489 nmdc:mga0k408_19929_c1 3300050493 Bacteria 3754
490 nmdc:mga06z11_119743_c1 3300050494 Bacteria 1467
491 nmdc:mga07m45_22808_c1 3300050496 Bacteria 3419
492 nmdc:mga07m45_283056_c1 3300050496 Bacteria 964
493 nmdc:mga08y16_389652_c1 3300050511 Bacteria 1427
494 nmdc:mga08y16_738532_c1 3300050511 Bacteria 981
495 nmdc:mga0n895_80475_c1 3300050512 Bacteria 3246
496 nmdc:mga0n895_83320_c1 3300050512 Bacteria 3189
497 nmdc:mga0rr50_580677_c1 3300050513 Bacteria 955
498 nmdc:mga0rr50_670735_c1 3300050513 Bacteria 885
499 nmdc:mga08x19_300618_c1 3300050514 Bacteria 1115
500 Ga0500643_002853 3300053087 Bacteria 8611
501 Ga0500643_032102 3300053087 Bacteria 1596
502 Ga0501084_0071839 3300054114 Bacteria 2898
503 Ga0587093_009736 3300059478 Bacteria 1122
504 Ga0587066_023684 3300059490 Bacteria 1039
505 Ga0587070_043143 3300059491 Bacteria 871
506 Ga0587077_021444 3300059493 Bacteria 1146
507 Ga0587082_005480 3300059504 Bacteria 1653
508 Ga0587083_0194940 3300059505 Bacteria 575
509 Ga0587091_118317 3300059511 Bacteria 641
510 Ga0587106_107277 3300059605 Bacteria 577
511 Ga0587101_001201 3300059623 Bacteria 2158
512 Ga0587117_005293 3300059627 Bacteria 1389
513 Ga0587128_067460 3300059630 Bacteria 690
514 Ga0587068_030371 3300059641 Bacteria 934
515 Ga0587069_022689 3300059642 Bacteria 955
516 Ga0587072_105033 3300059643 Bacteria 638
517 Ga0587076_024310 3300059645 Bacteria 1027
518 Ga0587078_002952 3300059646 Bacteria 1683
519 Ga0587079_021532 3300059647 Bacteria 1161
520 Ga0587079_029102 3300059647 Bacteria 1050
521 Ga0587102_005950 3300059649 Bacteria 1094
522 Ga0587102_010470 3300059649 Bacteria 917
523 Ga0587110_013564 3300059654 Bacteria 854
524 Ga0587124_001856 3300059660 Bacteria 1427
525 Ga0587071_005959 3300060344 Bacteria 1887
526 Ga0587111_0002620 3300060346 Bacteria 2433
527 Ga0501082_0731916 3300060353 Bacteria 866
528 Ga0501082_0908268 3300060353 Bacteria 770
529 Ga0501082_2002128 3300060353 Bacteria 505
530 Ga0466962_0054164 3300061719 Bacteria 1917
531 Ga0530510_0440201 3300061734 Bacteria 985

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049127 Ga0501306_094208 Ga0501306_094208_14_349 111
2 3300046539 Ga0495621_0018478 Ga0495621_0018478_246_584 112
3 3300025926 Ga0207659_10311358 Ga0207659_103113584 113
4 3300025934 Ga0207686_11202710 Ga0207686_112027102 113
5 3300025938 Ga0207704_10283785 Ga0207704_102837852 113
6 3300025940 Ga0207691_10367838 Ga0207691_103678382 113
7 3300025941 Ga0207711_10054097 Ga0207711_100540974 113
8 3300025942 Ga0207689_10004796 Ga0207689_1000479612 113
9 3300025960 Ga0207651_10048249 Ga0207651_100482494 113
10 3300025981 Ga0207640_12046453 Ga0207640_120464532 113
11 3300026035 Ga0207703_10035530 Ga0207703_100355302 113
12 3300026088 Ga0207641_11576980 Ga0207641_115769802 113
13 3300026089 Ga0207648_10175332 Ga0207648_101753322 113
14 3300026095 Ga0207676_10130349 Ga0207676_101303492 113
15 3300026118 Ga0207675_100141195 Ga0207675_1001411954 113
16 3300026121 Ga0207683_10186584 Ga0207683_101865842 113
17 3300028379 Ga0268266_12054540 Ga0268266_120545401 113
18 3300028380 Ga0268265_10018719 Ga0268265_100187193 113
19 3300028381 Ga0268264_10138094 Ga0268264_101380942 113
20 3300035121 Ga0373960_0356388 Ga0373960_0356388_22_381 113
21 iso_pu_bacteria 2526164512 2526211550 115
22 iso_pu_bacteria 2574179768 2574430992 115
23 iso_pu_bacteria 2891633521 2891634037 115
24 iso_pu_bacteria 639633007 639786212 115
25 3300020082 Ga0206353_11304491 Ga0206353_113044912 116
26 3300025924 Ga0207694_11036418 Ga0207694_110364182 117
27 3300035398 Ga0316574_0025505 Ga0316574_0025505_239_592 117
28 3300048903 Ga0496100_0271183 Ga0496100_0271183_526_879 117
29 3300049578 Ga0501042_0502836 Ga0501042_0502836_260_613 117
30 iso_pu_bacteria 2599185359 2600228371 117
31 iso_pu_bacteria 2818991466 2819715167 117
32 iso_pu_bacteria 2879163058 2879163948 117
33 iso_pu_bacteria 2928968154 2928971401 117
34 3300005347 Ga0070668_100739891 Ga0070668_1007398912 118
35 3300005548 Ga0070665_101190845 Ga0070665_1011908451 118
36 3300005983 Ga0081540_1072081 Ga0081540_10720812 118
37 3300006844 Ga0075428_101876012 Ga0075428_1018760121 118
38 3300007076 Ga0075435_100364507 Ga0075435_1003645073 118
39 3300009553 Ga0105249_11237313 Ga0105249_112373132 118
40 3300013297 Ga0157378_11347387 Ga0157378_113473872 118
41 3300014326 Ga0157380_10522484 Ga0157380_105224842 118
42 3300014326 Ga0157380_10666270 Ga0157380_106662702 118
43 3300025942 Ga0207689_10449848 Ga0207689_104498482 118
44 3300028379 Ga0268266_11042988 Ga0268266_110429881 118
45 3300031727 Ga0316576_10043504 Ga0316576_100435043 118
46 3300031728 Ga0316578_10575799 Ga0316578_105757992 118
47 3300032002 Ga0307416_101196970 Ga0307416_1011969702 118
48 3300033541 Ga0316596_1141841 Ga0316596_11418412 118
49 3300035691 Ga0373931_0733705 Ga0373931_0733705_262_618 118
50 3300036647 Ga0316582_0372145 Ga0316582_0372145_604_963 118
51 3300036647 Ga0316582_0397049 Ga0316582_0397049_388_750 118
52 3300036712 Ga0316584_0203642 Ga0316584_0203642_264_626 118
53 3300039062 Ga0400483_195212 Ga0400483_195212_179_541 118
54 3300039450 Ga0436363_1114653 Ga0436363_1114653_1003_1380 118
55 3300041511 Ga0451855_1831405 Ga0451855_1831405_47_412 118
56 3300048909 Ga0496106_1486326 Ga0496106_1486326_122_478 118
57 3300049568 Ga0501031_1048803 Ga0501031_1048803_76_441 118
58 3300049572 Ga0501036_0330810 Ga0501036_0330810_98_454 118
59 3300049575 Ga0501039_0510620 Ga0501039_0510620_497_859 118
60 3300049575 Ga0501039_1199820 Ga0501039_1199820_16_378 118
61 3300049576 Ga0501040_0274408 Ga0501040_0274408_493_849 118
62 3300049584 Ga0501068_1009984 Ga0501068_1009984_47_409 118
63 3300049587 Ga0501071_0541175 Ga0501071_0541175_17_382 118
64 3300049588 Ga0501072_0579826 Ga0501072_0579826_318_680 118
65 3300049588 Ga0501072_0955209 Ga0501072_0955209_213_569 118
66 3300049588 Ga0501072_1404417 Ga0501072_1404417_94_456 118
67 3300049592 Ga0501076_0389667 Ga0501076_0389667_765_1121 118
68 3300049592 Ga0501076_0480278 Ga0501076_0480278_134_496 118
69 3300049743 Ga0501081_1133245 Ga0501081_1133245_191_553 118
70 3300049744 Ga0501083_1152077 Ga0501083_1152077_128_484 118
71 3300049824 Ga0501045_0849988 Ga0501045_0849988_212_577 118
72 3300050513 nmdc:mga0rr50_670735_c1 nmdc:mga0rr50_670735_c1_481_837 118
73 3300060353 Ga0501082_2002128 Ga0501082_2002128_29_391 118
74 3300061734 Ga0530510_0440201 Ga0530510_0440201_439_795 118
75 3300003162 Ga0006778J45830_1035605 Ga0006778J45830_10356054 119
76 3300003162 Ga0006778J45830_1075563 Ga0006778J45830_10755632 119
77 3300003163 Ga0006759J45824_1027411 Ga0006759J45824_10274114 119
78 3300003305 Ga0006770J48903_1039900 Ga0006770J48903_10399002 119
79 3300003574 Ga0007410J51695_1035445 Ga0007410J51695_10354453 119
80 3300003577 Ga0007416J51690_1018437 Ga0007416J51690_10184374 119
81 3300003579 Ga0007429J51699_1035293 Ga0007429J51699_10352934 119
82 3300003693 Ga0032354_1063990 Ga0032354_10639901 119
83 3300005289 Ga0065704_10288503 Ga0065704_102885032 119
84 3300005295 Ga0065707_10521373 Ga0065707_105213731 119
85 3300005327 Ga0070658_10271077 Ga0070658_102710773 119
86 3300005330 Ga0070690_100458459 Ga0070690_1004584592 119
87 3300005330 Ga0070690_100677617 Ga0070690_1006776172 119
88 3300005333 Ga0070677_10492624 Ga0070677_104926241 119
89 3300005339 Ga0070660_100001988 Ga0070660_1000019885 119
90 3300005340 Ga0070689_100548807 Ga0070689_1005488071 119
91 3300005340 Ga0070689_101995570 Ga0070689_1019955701 119
92 3300005341 Ga0070691_10258314 Ga0070691_102583141 119
93 3300005344 Ga0070661_100017729 Ga0070661_1000177295 119
94 3300005345 Ga0070692_10946453 Ga0070692_109464532 119
95 3300005353 Ga0070669_100190232 Ga0070669_1001902322 119
96 3300005356 Ga0070674_100354791 Ga0070674_1003547912 119
97 3300005365 Ga0070688_101128514 Ga0070688_1011285142 119
98 3300005366 Ga0070659_100014861 Ga0070659_1000148613 119
99 3300005441 Ga0070700_100491934 Ga0070700_1004919341 119
100 3300005457 Ga0070662_100863402 Ga0070662_1008634022 119
101 3300005459 Ga0068867_100380423 Ga0068867_1003804234 119
102 3300005468 Ga0070707_100190468 Ga0070707_1001904683 119
103 3300005518 Ga0070699_100072315 Ga0070699_1000723153 119
104 3300005530 Ga0070679_100035325 Ga0070679_1000353253 119
105 3300005536 Ga0070697_100272162 Ga0070697_1002721622 119
106 3300005546 Ga0070696_100008619 Ga0070696_1000086194 119
107 3300005547 Ga0070693_100553350 Ga0070693_1005533503 119
108 3300005549 Ga0070704_100717982 Ga0070704_1007179822 119
109 3300005563 Ga0068855_100304790 Ga0068855_1003047903 119
110 3300005564 Ga0070664_101153376 Ga0070664_1011533762 119
111 3300005578 Ga0068854_100414383 Ga0068854_1004143833 119
112 3300005615 Ga0070702_100276113 Ga0070702_1002761132 119
113 3300005616 Ga0068852_100008502 Ga0068852_1000085025 119
114 3300005617 Ga0068859_100588898 Ga0068859_1005888983 119
115 3300005719 Ga0068861_100029893 Ga0068861_1000298931 119
116 3300005719 Ga0068861_100230096 Ga0068861_1002300962 119
117 3300005841 Ga0068863_101674291 Ga0068863_1016742912 119
118 3300005842 Ga0068858_100372905 Ga0068858_1003729052 119
119 3300005844 Ga0068862_100184213 Ga0068862_1001842133 119
120 3300006051 Ga0075364_10322049 Ga0075364_103220491 119
121 3300006237 Ga0097621_100311796 Ga0097621_1003117963 119
122 3300006353 Ga0075370_10124864 Ga0075370_101248642 119
123 3300006358 Ga0068871_102384922 Ga0068871_1023849221 119
124 3300006846 Ga0075430_100240522 Ga0075430_1002405223 119
125 3300006871 Ga0075434_100397279 Ga0075434_1003972792 119
126 3300006871 Ga0075434_100709224 Ga0075434_1007092242 119
127 3300006914 Ga0075436_100054843 Ga0075436_1000548431 119
128 3300006931 Ga0097620_100588929 Ga0097620_1005889293 119
129 3300009093 Ga0105240_11168809 Ga0105240_111688092 119
130 3300009094 Ga0111539_10782110 Ga0111539_107821102 119
131 3300009098 Ga0105245_10493023 Ga0105245_104930232 119
132 3300009147 Ga0114129_13225328 Ga0114129_132253282 119
133 3300009176 Ga0105242_10384200 Ga0105242_103842003 119
134 3300012508 Ga0157315_1000883 Ga0157315_10008832 119
135 3300013102 Ga0157371_10569875 Ga0157371_105698752 119
136 3300013104 Ga0157370_10009361 Ga0157370_100093612 119
137 3300013104 Ga0157370_10243476 Ga0157370_102434761 119
138 3300013105 Ga0157369_12210767 Ga0157369_122107672 119
139 3300013306 Ga0163162_10790802 Ga0163162_107908023 119
140 3300013307 Ga0157372_10158880 Ga0157372_101588803 119
141 3300013307 Ga0157372_13372385 Ga0157372_133723852 119
142 3300013308 Ga0157375_10168385 Ga0157375_101683853 119
143 3300013308 Ga0157375_11911214 Ga0157375_119112141 119
144 3300014326 Ga0157380_11064079 Ga0157380_110640793 119
145 3300017792 Ga0163161_10461584 Ga0163161_104615841 119
146 3300025893 Ga0207682_10198570 Ga0207682_101985701 119
147 3300025909 Ga0207705_10241058 Ga0207705_102410582 119
148 3300025913 Ga0207695_11001145 Ga0207695_110011452 119
149 3300025918 Ga0207662_10909101 Ga0207662_109091012 119
150 3300025920 Ga0207649_10003403 Ga0207649_100034033 119
151 3300025921 Ga0207652_10020269 Ga0207652_100202694 119
152 3300025922 Ga0207646_10183865 Ga0207646_101838653 119
153 3300025927 Ga0207687_10323245 Ga0207687_103232452 119
154 3300025932 Ga0207690_10151435 Ga0207690_101514352 119
155 3300025934 Ga0207686_11473349 Ga0207686_114733491 119
156 3300025935 Ga0207709_10387774 Ga0207709_103877742 119
157 3300025936 Ga0207670_10566213 Ga0207670_105662133 119
158 3300025936 Ga0207670_11049973 Ga0207670_110499731 119
159 3300025937 Ga0207669_10285388 Ga0207669_102853883 119
160 3300025945 Ga0207679_10004260 Ga0207679_100042607 119
161 3300025945 Ga0207679_10078308 Ga0207679_100783084 119
162 3300025949 Ga0207667_10376949 Ga0207667_103769493 119
163 3300025949 Ga0207667_10515728 Ga0207667_105157282 119
164 3300025949 Ga0207667_10582141 Ga0207667_105821412 119
165 3300025960 Ga0207651_11406181 Ga0207651_114061812 119
166 3300025961 Ga0207712_11002823 Ga0207712_110028231 119
167 3300025981 Ga0207640_10967481 Ga0207640_109674812 119
168 3300026035 Ga0207703_10327654 Ga0207703_103276542 119
169 3300026067 Ga0207678_10147030 Ga0207678_101470303 119
170 3300026089 Ga0207648_10170179 Ga0207648_101701794 119
171 3300026118 Ga0207675_100828716 Ga0207675_1008287162 119
172 3300026142 Ga0207698_10073455 Ga0207698_100734552 119
173 3300027876 Ga0209974_10234295 Ga0209974_102342952 119
174 3300027907 Ga0207428_10910406 Ga0207428_109104061 119
175 3300028380 Ga0268265_10086147 Ga0268265_100861473 119
176 3300031239 Ga0265328_10064822 Ga0265328_100648223 119
177 3300031250 Ga0265331_10010482 Ga0265331_100104823 119
178 3300031250 Ga0265331_10031026 Ga0265331_100310263 119
179 3300031251 Ga0265327_10001005 Ga0265327_100010059 119
180 3300031344 Ga0265316_10164246 Ga0265316_101642462 119
181 3300031727 Ga0316576_10307680 Ga0316576_103076801 119
182 3300031733 Ga0316577_10810101 Ga0316577_108101011 119
183 3300031852 Ga0307410_10920365 Ga0307410_109203652 119
184 3300031901 Ga0307406_11749120 Ga0307406_117491202 119
185 3300031901 Ga0307406_11795647 Ga0307406_117956471 119
186 3300031903 Ga0307407_10594761 Ga0307407_105947613 119
187 3300032002 Ga0307416_102190249 Ga0307416_1021902491 119
188 3300032005 Ga0307411_10432703 Ga0307411_104327032 119
189 3300032126 Ga0307415_100881889 Ga0307415_1008818892 119
190 3300032133 Ga0316583_10002571 Ga0316583_100025718 119
191 3300032168 Ga0316593_10281444 Ga0316593_102814441 119
192 3300035114 Ga0373939_0149126 Ga0373939_0149126_311_670 119
193 3300035241 Ga0373961_0182851 Ga0373961_0182851_134_493 119
194 3300035691 Ga0373931_0161834 Ga0373931_0161834_114_473 119
195 3300036401 Ga0373937_0254378 Ga0373937_0254378_520_879 119
196 3300036712 Ga0316584_0057443 Ga0316584_0057443_1517_1876 119
197 3300037312 Ga0395899_0010483 Ga0395899_0010483_5867_6226 119
198 3300037418 Ga0395900_0174138 Ga0395900_0174138_1766_2125 119
199 3300038726 Ga0400490_06488 Ga0400490_06488_4449_4808 119
200 3300038727 Ga0400491_12863 Ga0400491_12863_11_370 119
201 3300038735 Ga0400485_22349 Ga0400485_22349_23491_23850 119
202 3300038741 Ga0400488_14279 Ga0400488_14279_602_961 119
203 3300038741 Ga0400488_39077 Ga0400488_39077_233_592 119
204 3300038742 Ga0400486_10036 Ga0400486_10036_23524_23883 119
205 3300039062 Ga0400483_031139 Ga0400483_031139_799_1158 119
206 3300039062 Ga0400483_255852 Ga0400483_255852_1564_1923 119
207 3300039110 Ga0400487_51847 Ga0400487_51847_30178_30537 119
208 3300042000 Ga0439437_064155 Ga0439437_064155_46_405 119
209 3300042876 Ga0451577_0288840 Ga0451577_0288840_882_1241 119
210 3300044684 Ga0466966_0041285 Ga0466966_0041285_636_995 119
211 3300044684 Ga0466966_0093875 Ga0466966_0093875_299_658 119
212 3300044842 Ga0466957_0169511 Ga0466957_0169511_469_828 119
213 3300045049 Ga0466959_0262172 Ga0466959_0262172_488_847 119
214 3300045051 Ga0451576_0002721 Ga0451576_0002721_16585_16944 119
215 3300045836 Ga0466958_0008204 Ga0466958_0008204_5303_5662 119
216 3300046475 Ga0495639_0302897 Ga0495639_0302897_203_562 119
217 3300046528 Ga0495642_0516059 Ga0495642_0516059_60_419 119
218 3300046537 Ga0495598_0012305 Ga0495598_0012305_1662_2021 119
219 3300046539 Ga0495621_0016331 Ga0495621_0016331_216_575 119
220 3300046660 Ga0495625_0234157 Ga0495625_0234157_416_775 119
221 3300046664 Ga0495659_0462027 Ga0495659_0462027_181_540 119
222 3300046674 Ga0495588_0399035 Ga0495588_0399035_223_582 119
223 3300046683 Ga0495658_0122859 Ga0495658_0122859_122_481 119
224 3300047443 Ga0495687_027680 Ga0495687_027680_2160_2519 119
225 3300048903 Ga0496100_0557247 Ga0496100_0557247_511_870 119
226 3300048904 Ga0496101_0208476 Ga0496101_0208476_242_601 119
227 3300048905 Ga0496102_0018594 Ga0496102_0018594_3456_3815 119
228 3300048906 Ga0496103_0204622 Ga0496103_0204622_254_613 119
229 3300048907 Ga0496104_0314819 Ga0496104_0314819_177_536 119
230 3300048908 Ga0496105_0292783 Ga0496105_0292783_356_715 119
231 3300048911 Ga0496108_0180233 Ga0496108_0180233_452_811 119
232 3300048912 Ga0496109_0077499 Ga0496109_0077499_2082_2441 119
233 3300048913 Ga0496110_0023752 Ga0496110_0023752_1911_2270 119
234 3300048915 Ga0496112_0665696 Ga0496112_0665696_282_641 119
235 3300048917 Ga0496114_0471283 Ga0496114_0471283_109_468 119
236 3300048925 Ga0496122_0013576 Ga0496122_0013576_3116_3475 119
237 3300048926 Ga0496123_0021349 Ga0496123_0021349_4198_4557 119
238 3300049533 Ga0501317_034921 Ga0501317_034921_138_497 119
239 3300049535 Ga0501319_003520 Ga0501319_003520_72_431 119
240 3300049541 Ga0501325_020931 Ga0501325_020931_83_442 119
241 3300049568 Ga0501031_0124225 Ga0501031_0124225_322_681 119
242 3300049569 Ga0501032_0336573 Ga0501032_0336573_475_834 119
243 3300049569 Ga0501032_0653762 Ga0501032_0653762_16_375 119
244 3300049572 Ga0501036_0381835 Ga0501036_0381835_214_573 119
245 3300049572 Ga0501036_0448243 Ga0501036_0448243_235_594 119
246 3300049573 Ga0501037_1042382 Ga0501037_1042382_109_468 119
247 3300049574 Ga0501038_1008156 Ga0501038_1008156_220_579 119
248 3300049577 Ga0501041_0286486 Ga0501041_0286486_17_376 119
249 3300049578 Ga0501042_0437558 Ga0501042_0437558_268_627 119
250 3300049578 Ga0501042_0583532 Ga0501042_0583532_258_617 119
251 3300049582 Ga0501048_0463690 Ga0501048_0463690_358_717 119
252 3300049584 Ga0501068_0383906 Ga0501068_0383906_456_815 119
253 3300049588 Ga0501072_0098293 Ga0501072_0098293_331_690 119
254 3300049588 Ga0501072_1318492 Ga0501072_1318492_65_424 119
255 3300049590 Ga0501074_0003779 Ga0501074_0003779_122_481 119
256 3300049591 Ga0501075_0444534 Ga0501075_0444534_374_733 119
257 3300049743 Ga0501081_0420674 Ga0501081_0420674_299_658 119
258 3300049822 Ga0501035_1062563 Ga0501035_1062563_261_620 119
259 3300049823 Ga0501044_0338477 Ga0501044_0338477_259_618 119
260 3300050491 nmdc:mga00v17_115338_c1 nmdc:mga00v17_115338_c1_1217_1576 119
261 3300050493 nmdc:mga0k408_19929_c1 nmdc:mga0k408_19929_c1_1929_2288 119
262 3300050494 nmdc:mga06z11_119743_c1 nmdc:mga06z11_119743_c1_55_414 119
263 3300050496 nmdc:mga07m45_283056_c1 nmdc:mga07m45_283056_c1_112_471 119
264 3300050511 nmdc:mga08y16_738532_c1 nmdc:mga08y16_738532_c1_560_919 119
265 3300050512 nmdc:mga0n895_80475_c1 nmdc:mga0n895_80475_c1_2269_2628 119
266 3300050513 nmdc:mga0rr50_580677_c1 nmdc:mga0rr50_580677_c1_226_585 119
267 3300050514 nmdc:mga08x19_300618_c1 nmdc:mga08x19_300618_c1_70_429 119
268 3300059478 Ga0587093_009736 Ga0587093_009736_538_897 119
269 3300059490 Ga0587066_023684 Ga0587066_023684_202_561 119
270 3300059491 Ga0587070_043143 Ga0587070_043143_212_571 119
271 3300059493 Ga0587077_021444 Ga0587077_021444_435_794 119
272 3300059504 Ga0587082_005480 Ga0587082_005480_161_520 119
273 3300059505 Ga0587083_0194940 Ga0587083_0194940_149_508 119
274 3300059511 Ga0587091_118317 Ga0587091_118317_215_574 119
275 3300059605 Ga0587106_107277 Ga0587106_107277_169_528 119
276 3300059623 Ga0587101_001201 Ga0587101_001201_1518_1877 119
277 3300059627 Ga0587117_005293 Ga0587117_005293_240_599 119
278 3300059630 Ga0587128_067460 Ga0587128_067460_18_377 119
279 3300059641 Ga0587068_030371 Ga0587068_030371_301_660 119
280 3300059642 Ga0587069_022689 Ga0587069_022689_215_574 119
281 3300059643 Ga0587072_105033 Ga0587072_105033_68_427 119
282 3300059645 Ga0587076_024310 Ga0587076_024310_287_646 119
283 3300059646 Ga0587078_002952 Ga0587078_002952_189_548 119
284 3300059647 Ga0587079_021532 Ga0587079_021532_589_948 119
285 3300059647 Ga0587079_029102 Ga0587079_029102_524_883 119
286 3300059649 Ga0587102_005950 Ga0587102_005950_216_575 119
287 3300059649 Ga0587102_010470 Ga0587102_010470_176_535 119
288 3300059654 Ga0587110_013564 Ga0587110_013564_470_829 119
289 3300059660 Ga0587124_001856 Ga0587124_001856_190_549 119
290 3300060344 Ga0587071_005959 Ga0587071_005959_392_751 119
291 3300060346 Ga0587111_0002620 Ga0587111_0002620_948_1307 119
292 3300061719 Ga0466962_0054164 Ga0466962_0054164_30_389 119
293 3300005536 Ga0070697_100998297 Ga0070697_1009982971 120
294 3300025934 Ga0207686_10184019 Ga0207686_101840193 120
295 3300027614 Ga0209970_1052658 Ga0209970_10526582 120
296 3300032002 Ga0307416_101553151 Ga0307416_1015531512 120
297 3300032004 Ga0307414_10194187 Ga0307414_101941874 120
298 3300032004 Ga0307414_10589631 Ga0307414_105896311 120
299 3300032005 Ga0307411_10823465 Ga0307411_108234652 120
300 3300035398 Ga0316574_0133130 Ga0316574_0133130_1114_1476 120
301 3300035398 Ga0316574_0714367 Ga0316574_0714367_209_571 120
302 3300041460 Ga0451802_1529159 Ga0451802_1529159_40_402 120
303 3300042011 Ga0439454_104898 Ga0439454_104898_19_381 120
304 3300046694 Ga0495649_0641169 Ga0495649_0641169_103_468 120
305 3300048090 Ga0495615_0129473 Ga0495615_0129473_281_643 120
306 3300048917 Ga0496114_0441592 Ga0496114_0441592_89_451 120
307 3300049571 Ga0501034_0312579 Ga0501034_0312579_34_396 120
308 3300049572 Ga0501036_0233657 Ga0501036_0233657_273_635 120
309 3300049572 Ga0501036_0762060 Ga0501036_0762060_22_384 120
310 3300049576 Ga0501040_0096981 Ga0501040_0096981_1645_2007 120
311 3300049577 Ga0501041_0053545 Ga0501041_0053545_350_712 120
312 3300049577 Ga0501041_0492239 Ga0501041_0492239_292_654 120
313 3300049580 Ga0501046_0506322 Ga0501046_0506322_208_570 120
314 3300049582 Ga0501048_0917625 Ga0501048_0917625_192_554 120
315 3300049582 Ga0501048_0936429 Ga0501048_0936429_170_532 120
316 3300049584 Ga0501068_0111786 Ga0501068_0111786_438_800 120
317 3300049587 Ga0501071_0778425 Ga0501071_0778425_267_629 120
318 3300049588 Ga0501072_0018484 Ga0501072_0018484_362_724 120
319 3300049590 Ga0501074_0397617 Ga0501074_0397617_147_509 120
320 3300049591 Ga0501075_0009440 Ga0501075_0009440_3708_4070 120
321 3300049592 Ga0501076_0031666 Ga0501076_0031666_2862_3224 120
322 3300049593 Ga0501077_0051808 Ga0501077_0051808_2138_2500 120
323 3300049593 Ga0501077_0695423 Ga0501077_0695423_182_544 120
324 3300049741 Ga0501079_0035825 Ga0501079_0035825_956_1318 120
325 3300049742 Ga0501080_0095691 Ga0501080_0095691_311_673 120
326 3300049743 Ga0501081_0102919 Ga0501081_0102919_487_849 120
327 3300049743 Ga0501081_0302654 Ga0501081_0302654_600_962 120
328 3300049744 Ga0501083_0117959 Ga0501083_0117959_133_495 120
329 3300049824 Ga0501045_0427606 Ga0501045_0427606_540_902 120
330 3300050511 nmdc:mga08y16_389652_c1 nmdc:mga08y16_389652_c1_74_439 120
331 3300054114 Ga0501084_0071839 Ga0501084_0071839_2180_2542 120
332 3300060353 Ga0501082_0731916 Ga0501082_0731916_166_528 120
333 3300060353 Ga0501082_0908268 Ga0501082_0908268_260_622 120
334 3300003203 JGI25406J46586_10051452 JGI25406J46586_100514521 121
335 3300005262 Ga0065165_1002628 Ga0065165_100262812 121
336 3300005347 Ga0070668_100000007 Ga0070668_10000000763 121
337 3300005355 Ga0070671_100000068 Ga0070671_1000000684 121
338 3300005539 Ga0068853_100014615 Ga0068853_1000146155 121
339 3300005548 Ga0070665_100010650 Ga0070665_1000106509 121
340 3300005577 Ga0068857_100067311 Ga0068857_1000673112 121
341 3300005578 Ga0068854_101528393 Ga0068854_1015283931 121
342 3300005617 Ga0068859_100020056 Ga0068859_1000200563 121
343 3300005841 Ga0068863_100000027 Ga0068863_10000002765 121
344 3300005843 Ga0068860_100162244 Ga0068860_1001622442 121
345 3300005985 Ga0081539_10014655 Ga0081539_100146555 121
346 3300006353 Ga0075370_10058862 Ga0075370_100588623 121
347 3300006871 Ga0075434_100092914 Ga0075434_1000929143 121
348 3300006931 Ga0097620_100020056 Ga0097620_1000200564 121
349 3300009177 Ga0105248_10428943 Ga0105248_104289432 121
350 3300009545 Ga0105237_10097989 Ga0105237_100979893 121
351 3300009551 Ga0105238_10371070 Ga0105238_103710702 121
352 3300009553 Ga0105249_10037179 Ga0105249_100371791 121
353 3300010375 Ga0105239_11049457 Ga0105239_110494572 121
354 3300013105 Ga0157369_10468984 Ga0157369_104689841 121
355 3300013105 Ga0157369_10534193 Ga0157369_105341933 121
356 3300013307 Ga0157372_11345490 Ga0157372_113454902 121
357 3300021384 Ga0213876_10017463 Ga0213876_100174634 121
358 3300025914 Ga0207671_10008208 Ga0207671_100082088 121
359 3300025923 Ga0207681_11591423 Ga0207681_115914231 121
360 3300025925 Ga0207650_10233607 Ga0207650_102336072 121
361 3300025931 Ga0207644_10000111 Ga0207644_1000011121 121
362 3300025941 Ga0207711_10925870 Ga0207711_109258702 121
363 3300025961 Ga0207712_10326356 Ga0207712_103263561 121
364 3300025972 Ga0207668_10000054 Ga0207668_1000005437 121
365 3300026041 Ga0207639_10110566 Ga0207639_101105662 121
366 3300026088 Ga0207641_10000045 Ga0207641_10000045111 121
367 3300026116 Ga0207674_10082281 Ga0207674_100822811 121
368 3300028379 Ga0268266_10021401 Ga0268266_100214015 121
369 3300028381 Ga0268264_10001183 Ga0268264_1000118323 121
370 3300031911 Ga0307412_10000104 Ga0307412_1000010418 121
371 3300035111 Ga0373923_0068125 Ga0373923_0068125_805_1170 121
372 3300038705 Ga0237819_00270 Ga0237819_00270_3276_3641 121
373 3300039437 Ga0436365_0754658 Ga0436365_0754658_253_618 121
374 3300039437 Ga0436365_1506208 Ga0436365_1506208_3178_3543 121
375 3300041505 Ga0451849_0748450 Ga0451849_0748450_28_393 121
376 3300048919 Ga0496116_0309622 Ga0496116_0309622_318_683 121
377 3300048923 Ga0496120_0233957 Ga0496120_0233957_152_517 121
378 3300048925 Ga0496122_0317192 Ga0496122_0317192_229_594 121
379 3300048926 Ga0496123_0017741 Ga0496123_0017741_4499_4864 121
380 3300048926 Ga0496123_0303744 Ga0496123_0303744_171_536 121
381 3300048927 Ga0496124_0005643 Ga0496124_0005643_12032_12397 121
382 3300048927 Ga0496124_0006985 Ga0496124_0006985_1630_1995 121
383 3300048928 Ga0496125_0193334 Ga0496125_0193334_691_1056 121
384 3300048929 Ga0496126_0032343 Ga0496126_0032343_769_1134 121
385 3300049581 Ga0501047_0138116 Ga0501047_0138116_1662_2027 121
386 3300049822 Ga0501035_0987476 Ga0501035_0987476_288_653 121
387 3300050496 nmdc:mga07m45_22808_c1 nmdc:mga07m45_22808_c1_1994_2359 121
388 3300050512 nmdc:mga0n895_83320_c1 nmdc:mga0n895_83320_c1_551_916 121
389 3300053087 Ga0500643_002853 Ga0500643_002853_8003_8368 121
390 3300053087 Ga0500643_032102 Ga0500643_032102_766_1131 121
391 3300001989 JGI24739J22299_10001505 JGI24739J22299_100015057 122
392 3300001990 JGI24737J22298_10001228 JGI24737J22298_100012287 122
393 3300002067 JGI24735J21928_10020058 JGI24735J21928_100200583 122
394 3300002075 JGI24738J21930_10007469 JGI24738J21930_100074692 122
395 3300005327 Ga0070658_10000177 Ga0070658_1000017755 122
396 3300005327 Ga0070658_10257732 Ga0070658_102577321 122
397 3300005329 Ga0070683_100001495 Ga0070683_1000014959 122
398 3300005335 Ga0070666_10002272 Ga0070666_100022726 122
399 3300005337 Ga0070682_100605758 Ga0070682_1006057582 122
400 3300005339 Ga0070660_100000065 Ga0070660_10000006554 122
401 3300005344 Ga0070661_100000084 Ga0070661_10000008436 122
402 3300005355 Ga0070671_100002759 Ga0070671_1000027592 122
403 3300005355 Ga0070671_100729436 Ga0070671_1007294361 122
404 3300005364 Ga0070673_100362563 Ga0070673_1003625632 122
405 3300005364 Ga0070673_101933801 Ga0070673_1019338011 122
406 3300005366 Ga0070659_100000067 Ga0070659_10000006772 122
407 3300005367 Ga0070667_100135390 Ga0070667_1001353904 122
408 3300005367 Ga0070667_100967785 Ga0070667_1009677852 122
409 3300005455 Ga0070663_100000149 Ga0070663_10000014912 122
410 3300005455 Ga0070663_100056593 Ga0070663_1000565934 122
411 3300005457 Ga0070662_100000017 Ga0070662_10000001739 122
412 3300005466 Ga0070685_11287305 Ga0070685_112873051 122
413 3300005530 Ga0070679_100745160 Ga0070679_1007451601 122
414 3300005535 Ga0070684_100053830 Ga0070684_1000538305 122
415 3300005539 Ga0068853_100000784 Ga0068853_10000078418 122
416 3300005547 Ga0070693_100001717 Ga0070693_1000017174 122
417 3300005547 Ga0070693_100157034 Ga0070693_1001570343 122
418 3300005548 Ga0070665_100045641 Ga0070665_1000456414 122
419 3300005563 Ga0068855_100000194 Ga0068855_10000019483 122
420 3300005564 Ga0070664_100000098 Ga0070664_10000009854 122
421 3300005578 Ga0068854_100724549 Ga0068854_1007245492 122
422 3300005614 Ga0068856_100000098 Ga0068856_10000009837 122
423 3300005614 Ga0068856_101378873 Ga0068856_1013788731 122
424 3300005616 Ga0068852_100028855 Ga0068852_1000288556 122
425 3300005616 Ga0068852_101474771 Ga0068852_1014747712 122
426 3300005617 Ga0068859_101251150 Ga0068859_1012511501 122
427 3300005618 Ga0068864_100057029 Ga0068864_1000570295 122
428 3300005719 Ga0068861_100608619 Ga0068861_1006086192 122
429 3300005834 Ga0068851_10244100 Ga0068851_102441002 122
430 3300005841 Ga0068863_100821485 Ga0068863_1008214852 122
431 3300005842 Ga0068858_100007312 Ga0068858_1000073125 122
432 3300005843 Ga0068860_101238833 Ga0068860_1012388332 122
433 3300006175 Ga0070712_100010353 Ga0070712_1000103533 122
434 3300006237 Ga0097621_100129378 Ga0097621_1001293785 122
435 3300006931 Ga0097620_101251181 Ga0097620_1012511811 122
436 3300009174 Ga0105241_10042711 Ga0105241_100427112 122
437 3300009177 Ga0105248_10000444 Ga0105248_1000044433 122
438 3300009551 Ga0105238_10152367 Ga0105238_101523672 122
439 3300012480 Ga0157346_1005557 Ga0157346_10055572 122
440 3300012510 Ga0157316_1036661 Ga0157316_10366612 122
441 3300013100 Ga0157373_10557478 Ga0157373_105574782 122
442 3300013102 Ga0157371_10008677 Ga0157371_100086772 122
443 3300013296 Ga0157374_10297119 Ga0157374_102971192 122
444 3300013296 Ga0157374_11285940 Ga0157374_112859402 122
445 3300014325 Ga0163163_10000169 Ga0163163_1000016938 122
446 3300014325 Ga0163163_11841664 Ga0163163_118416641 122
447 3300014497 Ga0182008_10193538 Ga0182008_101935382 122
448 3300014968 Ga0157379_10227355 Ga0157379_102273553 122
449 3300020610 Ga0154015_1329609 Ga0154015_13296091 122
450 3300025907 Ga0207645_10026414 Ga0207645_100264142 122
451 3300025909 Ga0207705_10000137 Ga0207705_1000013770 122
452 3300025909 Ga0207705_10253149 Ga0207705_102531491 122
453 3300025915 Ga0207693_10024195 Ga0207693_100241955 122
454 3300025917 Ga0207660_10081523 Ga0207660_100815232 122
455 3300025919 Ga0207657_10000569 Ga0207657_1000056911 122
456 3300025919 Ga0207657_10534748 Ga0207657_105347482 122
457 3300025920 Ga0207649_10002487 Ga0207649_1000248712 122
458 3300025924 Ga0207694_10082187 Ga0207694_100821872 122
459 3300025931 Ga0207644_10112704 Ga0207644_101127042 122
460 3300025931 Ga0207644_10205084 Ga0207644_102050842 122
461 3300025932 Ga0207690_10000108 Ga0207690_1000010841 122
462 3300025933 Ga0207706_10000571 Ga0207706_1000057111 122
463 3300025933 Ga0207706_10027711 Ga0207706_100277115 122
464 3300025941 Ga0207711_10001099 Ga0207711_1000109924 122
465 3300025944 Ga0207661_10048903 Ga0207661_100489035 122
466 3300025945 Ga0207679_10000191 Ga0207679_100001915 122
467 3300025949 Ga0207667_10001635 Ga0207667_1000163530 122
468 3300025949 Ga0207667_11067096 Ga0207667_110670961 122
469 3300025960 Ga0207651_10269249 Ga0207651_102692492 122
470 3300025981 Ga0207640_10996013 Ga0207640_109960131 122
471 3300025981 Ga0207640_11102655 Ga0207640_111026552 122
472 3300026035 Ga0207703_10005107 Ga0207703_100051079 122
473 3300026041 Ga0207639_10004731 Ga0207639_100047314 122
474 3300026067 Ga0207678_10001788 Ga0207678_1000178811 122
475 3300026067 Ga0207678_10040341 Ga0207678_100403412 122
476 3300026078 Ga0207702_10005964 Ga0207702_100059648 122
477 3300026088 Ga0207641_10227800 Ga0207641_102278002 122
478 3300026142 Ga0207698_10003214 Ga0207698_100032143 122
479 3300028379 Ga0268266_10060472 Ga0268266_100604724 122
480 3300028381 Ga0268264_12133131 Ga0268264_121331311 122
481 3300031548 Ga0307408_100047713 Ga0307408_1000477132 122
482 3300031548 Ga0307408_100334146 Ga0307408_1003341462 122
483 3300031548 Ga0307408_101847095 Ga0307408_1018470952 122
484 3300031727 Ga0316576_10602122 Ga0316576_106021222 122
485 3300031728 Ga0316578_10879557 Ga0316578_108795571 122
486 3300031731 Ga0307405_10079596 Ga0307405_100795962 122
487 3300031731 Ga0307405_10253111 Ga0307405_102531112 122
488 3300031824 Ga0307413_10038061 Ga0307413_100380615 122
489 3300031824 Ga0307413_11455665 Ga0307413_114556651 122
490 3300031852 Ga0307410_10244746 Ga0307410_102447462 122
491 3300031852 Ga0307410_10557236 Ga0307410_105572362 122
492 3300031852 Ga0307410_11168083 Ga0307410_111680831 122
493 3300031901 Ga0307406_10211989 Ga0307406_102119892 122
494 3300031903 Ga0307407_10170296 Ga0307407_101702962 122
495 3300031903 Ga0307407_10506792 Ga0307407_105067922 122
496 3300031911 Ga0307412_10115288 Ga0307412_101152882 122
497 3300031911 Ga0307412_10408549 Ga0307412_104085492 122
498 3300031995 Ga0307409_100280582 Ga0307409_1002805822 122
499 3300031995 Ga0307409_100830468 Ga0307409_1008304682 122
500 3300032002 Ga0307416_100525221 Ga0307416_1005252212 122
501 3300032002 Ga0307416_100618807 Ga0307416_1006188072 122
502 3300032004 Ga0307414_10310798 Ga0307414_103107982 122
503 3300032004 Ga0307414_10517435 Ga0307414_105174352 122
504 3300032005 Ga0307411_10026047 Ga0307411_100260474 122
505 3300032005 Ga0307411_10297036 Ga0307411_102970362 122
506 3300032126 Ga0307415_100012981 Ga0307415_1000129816 122
507 3300032126 Ga0307415_100033012 Ga0307415_1000330125 122
508 3300034816 Ga0373930_0079067 Ga0373930_0079067_282_650 122
509 3300035092 Ga0373952_0069674 Ga0373952_0069674_108_476 122
510 3300035112 Ga0373932_0101173 Ga0373932_0101173_233_601 122
511 3300035207 Ga0373942_0110672 Ga0373942_0110672_207_575 122
512 3300035241 Ga0373961_0225226 Ga0373961_0225226_27_395 122
513 3300035691 Ga0373931_0006745 Ga0373931_0006745_4821_5189 122
514 3300037471 Ga0395905_0017633 Ga0395905_0017633_2191_2568 122
515 3300037471 Ga0395905_1454681 Ga0395905_1454681_78_455 122
516 3300038443 Ga0395901_0229964 Ga0395901_0229964_1476_1853 122
517 3300038443 Ga0395901_0524470 Ga0395901_0524470_28_405 122
518 3300039437 Ga0436365_0363342 Ga0436365_0363342_799_1212 122
519 3300042436 Ga0439435_0019976 Ga0439435_0019976_727_1131 122
520 3300042439 Ga0439464_0101505 Ga0439464_0101505_67_471 122
521 3300044706 Ga0466964_0087902 Ga0466964_0087902_335_703 122
522 3300044842 Ga0466957_0019667 Ga0466957_0019667_2040_2408 122
523 3300048908 Ga0496105_0513428 Ga0496105_0513428_408_776 122
524 3300048912 Ga0496109_1511433 Ga0496109_1511433_102_470 122
525 3300048917 Ga0496114_1529666 Ga0496114_1529666_103_471 122
526 3300049571 Ga0501034_0248954 Ga0501034_0248954_608_1021 122
527 3300049574 Ga0501038_0192764 Ga0501038_0192764_112_525 122
528 3300049581 Ga0501047_0363263 Ga0501047_0363263_131_544 122
529 3300049586 Ga0501070_0088988 Ga0501070_0088988_1417_1830 122
530 3300049589 Ga0501073_0089700 Ga0501073_0089700_1473_1886 122
531 3300049590 Ga0501074_0141020 Ga0501074_0141020_258_671 122
532 3300049652 Ga0501202_112769 Ga0501202_112769_107_487 122
533 3300049675 Ga0501243_050530 Ga0501243_050530_130_510 122
534 3300049677 Ga0501247_030541 Ga0501247_030541_106_486 122
535 3300049741 Ga0501079_0764523 Ga0501079_0764523_335_748 122
536 3300049742 Ga0501080_0242068 Ga0501080_0242068_927_1340 122
537 3300049758 Ga0501241_132876 Ga0501241_132876_89_469 122
538 3300049765 Ga0501268_009889 Ga0501268_009889_486_866 122
539 3300049823 Ga0501044_0048649 Ga0501044_0048649_1968_2381 122

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00453

Ribosomal_L20

Ribosomal protein L20

3

109

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1gyz-assembly1.cif.gz_A bacterial ribosomal protein l20 from aquifex aeolicus 0.9088 61 117
8apo-assembly1.cif.gz_Ao structure of the mitochondrial ribosome from polytomella magna with trnas bound to the a and p sites 0.8847 14 113
6z1p-assembly1.cif.gz_Au structure of the mitochondrial ribosome from tetrahymena thermophila 0.8829 15 118
7pkt-assembly1.cif.gz_o large subunit of the chlamydomonas reinhardtii mitoribosome 0.8801 14 114
4v48-assembly1.cif.gz_AO real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the initiation-like state of e. coli 70s ribosome 0.8617 51 116
ID Description Score Start End Superfamily
2ghjD02 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain 0.9749 53 117 1.10.1900.20
2ghjB02 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain 0.9175 58 118 1.10.1900.20
1gyzA00 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain 0.9088 61 117 1.10.1900.20
2ghjD02 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain 0.9058 53 117 1.10.1900.20
1gyzA00 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain 0.8542 61 117 1.10.1900.20
ID Description Score Start End GO Terms
AF-A0A2N8FNS0-F1-model_v4 deleted 1.004 55 116
AF-A0A7Z9XIZ9-F1-model_v4 Large ribosomal subunit protein bL20 (50S ribosomal protein L20) 0.9995 53 117 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A432PU90-F1-model_v4 Large ribosomal subunit protein bL20 (50S ribosomal protein L20) 0.9991 56 118 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A357L7L9-F1-model_v4 Large ribosomal subunit protein bL20 (50S ribosomal protein L20) 0.9946 61 118 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A7Y6I0T2-F1-model_v4 deleted 0.9941 54 116

Feature Viewer

pLDDT pTM Quality
83.6 0.62 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map