F461113
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 539 | 334 | 531 | 121 |
Family's Representative Sequence
| Representative Sequence | 3300005466|Ga0070685_11287305|Ga0070685_112873051 |
| Length | 137 |
| Sequence | MARVKRGVAAHARHKKVLDQAKGYYGGRRKLIKTAKQAVEKANQYAYRDRKNRKRNFRALWIQRINAASRGLGLTYGRLIDGLARAGIEVDRKVLSDLAIREPAAFAALVEQAKGALAYLKEKTPGEFEKAAGEKAS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2526164512 | Azovibrio restrictus DSM 23866 | Isolate | Unclassified |
| 2 | 2574179768 | Azoarcus communis DSM 12120 | Isolate | Unclassified |
| 3 | 2599185359 | Sphingomonas sp. NFR04 | Isolate | Rhizoplane |
| 4 | 2818991466 | Sphingomonas trueperi 1152a | Isolate | Unclassified |
| 5 | 2879163058 | Sphingomonas pokkalii L3B27 | Isolate | Rhizosphere |
| 6 | 2891633521 | Azoarcus rhizosphaerae CC-YHH848 | Isolate | Rhizosphere |
| 7 | 2928968154 | Sphingomonas trueperi 1075 | Isolate | Unclassified |
| 8 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 9 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 10 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 11 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 12 | 3300003162 | Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 13 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 14 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 15 | 3300003305 | Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 16 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 17 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 18 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 19 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 20 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 21 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 22 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 53 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 58 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 60 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 65 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 66 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 67 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 68 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 69 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 70 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 71 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 72 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 73 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 74 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 75 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 78 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 79 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 80 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 81 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 82 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 83 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 85 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300012480 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 | Metagenome | Rhizosphere |
| 97 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 98 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 99 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 111 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 114 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 115 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 116 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 165 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 169 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 170 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 171 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 172 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 173 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 174 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 175 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 176 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 177 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 178 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 179 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 180 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 181 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 182 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 183 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 184 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 185 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 186 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 187 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 188 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 189 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 190 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 191 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 192 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 193 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 194 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 195 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 196 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 197 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 198 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 199 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 200 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 201 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 202 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 203 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 204 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 205 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 206 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 207 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 208 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 209 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 210 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 211 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 212 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 213 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 214 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 215 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 216 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 217 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 218 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 219 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 220 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 221 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 222 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 223 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 224 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 225 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 226 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 227 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 228 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 229 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 230 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 231 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 243 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 244 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 245 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 246 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 247 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 248 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 249 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 250 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 251 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 252 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 253 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 254 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 255 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 256 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 257 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 258 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 259 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 260 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 261 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 262 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 263 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 264 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 265 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 284 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 288 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 289 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 290 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 295 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 296 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 300 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 301 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 302 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 303 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 308 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 310 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 311 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 312 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 313 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 314 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 315 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 316 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 317 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 318 | 3300059627 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 319 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 320 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 321 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 322 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 323 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 324 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 325 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 326 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 327 | 3300059654 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 328 | 3300059660 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 329 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 330 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 331 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 333 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 334 | 639633007 | Azoarcus olearius BH72 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.09 |
| Metatranscriptomes | 7.42 |
| Isolates | 1.48 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.04 |
| Nodule | 0 |
| Rhizoplane | 3.53 |
| Rhizosphere | 88.13 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.31 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10001505 | 3300001989 | Bacteria | 8790 |
| 2 | JGI24737J22298_10001228 | 3300001990 | Bacteria | 9043 |
| 3 | JGI24735J21928_10020058 | 3300002067 | Bacteria | 2050 |
| 4 | JGI24738J21930_10007469 | 3300002075 | Bacteria | 2520 |
| 5 | Ga0006778J45830_1035605 | 3300003162 | Bacteria | 1495 |
| 6 | Ga0006778J45830_1075563 | 3300003162 | Bacteria | 737 |
| 7 | Ga0006759J45824_1027411 | 3300003163 | Bacteria | 1502 |
| 8 | JGI25406J46586_10051452 | 3300003203 | Bacteria | 1378 |
| 9 | Ga0006770J48903_1039900 | 3300003305 | Bacteria | 803 |
| 10 | Ga0007410J51695_1035445 | 3300003574 | Bacteria | 1032 |
| 11 | Ga0007416J51690_1018437 | 3300003577 | Bacteria | 1602 |
| 12 | Ga0007429J51699_1035293 | 3300003579 | Bacteria | 1510 |
| 13 | Ga0032354_1063990 | 3300003693 | Bacteria | 640 |
| 14 | Ga0065165_1002628 | 3300005262 | Bacteria | 14624 |
| 15 | Ga0065704_10288503 | 3300005289 | Bacteria | 908 |
| 16 | Ga0065707_10521373 | 3300005295 | Bacteria | 742 |
| 17 | Ga0070658_10000177 | 3300005327 | Bacteria | 56043 |
| 18 | Ga0070658_10257732 | 3300005327 | Bacteria | 1481 |
| 19 | Ga0070658_10271077 | 3300005327 | Bacteria | 1443 |
| 20 | Ga0070683_100001495 | 3300005329 | Bacteria | 18043 |
| 21 | Ga0070690_100458459 | 3300005330 | Bacteria | 947 |
| 22 | Ga0070690_100677617 | 3300005330 | Bacteria | 790 |
| 23 | Ga0070677_10492624 | 3300005333 | Bacteria | 663 |
| 24 | Ga0070666_10002272 | 3300005335 | Bacteria | 11611 |
| 25 | Ga0070682_100605758 | 3300005337 | Bacteria | 866 |
| 26 | Ga0070660_100000065 | 3300005339 | Bacteria | 61999 |
| 27 | Ga0070660_100001988 | 3300005339 | Bacteria | 14107 |
| 28 | Ga0070689_100548807 | 3300005340 | Bacteria | 995 |
| 29 | Ga0070689_101995570 | 3300005340 | Bacteria | 530 |
| 30 | Ga0070691_10258314 | 3300005341 | Bacteria | 937 |
| 31 | Ga0070661_100000084 | 3300005344 | Bacteria | 74971 |
| 32 | Ga0070661_100017729 | 3300005344 | Bacteria | 5054 |
| 33 | Ga0070692_10946453 | 3300005345 | Bacteria | 599 |
| 34 | Ga0070668_100000007 | 3300005347 | Bacteria | 150621 |
| 35 | Ga0070668_100739891 | 3300005347 | Bacteria | 870 |
| 36 | Ga0070669_100190232 | 3300005353 | Bacteria | 1610 |
| 37 | Ga0070671_100000068 | 3300005355 | Bacteria | 70220 |
| 38 | Ga0070671_100002759 | 3300005355 | Bacteria | 13636 |
| 39 | Ga0070671_100729436 | 3300005355 | Bacteria | 860 |
| 40 | Ga0070674_100354791 | 3300005356 | Bacteria | 1186 |
| 41 | Ga0070673_100362563 | 3300005364 | Bacteria | 1289 |
| 42 | Ga0070673_101933801 | 3300005364 | Bacteria | 559 |
| 43 | Ga0070688_101128514 | 3300005365 | Bacteria | 628 |
| 44 | Ga0070659_100000067 | 3300005366 | Bacteria | 81723 |
| 45 | Ga0070659_100014861 | 3300005366 | Bacteria | 5822 |
| 46 | Ga0070667_100135390 | 3300005367 | Bacteria | 2154 |
| 47 | Ga0070667_100967785 | 3300005367 | Bacteria | 793 |
| 48 | Ga0070700_100491934 | 3300005441 | Bacteria | 942 |
| 49 | Ga0070663_100000149 | 3300005455 | Bacteria | 34310 |
| 50 | Ga0070663_100056593 | 3300005455 | Bacteria | 2810 |
| 51 | Ga0070662_100000017 | 3300005457 | Bacteria | 105478 |
| 52 | Ga0070662_100863402 | 3300005457 | Bacteria | 771 |
| 53 | Ga0068867_100380423 | 3300005459 | Bacteria | 1185 |
| 54 | Ga0070685_11287305 | 3300005466 | Bacteria | 558 |
| 55 | Ga0070707_100190468 | 3300005468 | Bacteria | 2000 |
| 56 | Ga0070699_100072315 | 3300005518 | Bacteria | 3000 |
| 57 | Ga0070679_100035325 | 3300005530 | Bacteria | 4958 |
| 58 | Ga0070679_100745160 | 3300005530 | Bacteria | 922 |
| 59 | Ga0070684_100053830 | 3300005535 | Bacteria | 3505 |
| 60 | Ga0070697_100272162 | 3300005536 | Bacteria | 1452 |
| 61 | Ga0070697_100998297 | 3300005536 | Bacteria | 744 |
| 62 | Ga0068853_100000784 | 3300005539 | Bacteria | 22095 |
| 63 | Ga0068853_100014615 | 3300005539 | Bacteria | 6438 |
| 64 | Ga0070696_100008619 | 3300005546 | Bacteria | 6822 |
| 65 | Ga0070693_100001717 | 3300005547 | Bacteria | 9961 |
| 66 | Ga0070693_100157034 | 3300005547 | Bacteria | 1446 |
| 67 | Ga0070693_100553350 | 3300005547 | Bacteria | 824 |
| 68 | Ga0070665_100010650 | 3300005548 | Bacteria | 9310 |
| 69 | Ga0070665_100045641 | 3300005548 | Bacteria | 4401 |
| 70 | Ga0070665_101190845 | 3300005548 | Bacteria | 773 |
| 71 | Ga0070704_100717982 | 3300005549 | Bacteria | 888 |
| 72 | Ga0068855_100000194 | 3300005563 | Bacteria | 78505 |
| 73 | Ga0068855_100304790 | 3300005563 | Bacteria | 1763 |
| 74 | Ga0070664_100000098 | 3300005564 | Bacteria | 55907 |
| 75 | Ga0070664_101153376 | 3300005564 | Bacteria | 730 |
| 76 | Ga0068857_100067311 | 3300005577 | Bacteria | 3188 |
| 77 | Ga0068854_100414383 | 3300005578 | Bacteria | 1118 |
| 78 | Ga0068854_100724549 | 3300005578 | Bacteria | 860 |
| 79 | Ga0068854_101528393 | 3300005578 | Bacteria | 607 |
| 80 | Ga0068856_100000098 | 3300005614 | Bacteria | 83221 |
| 81 | Ga0068856_101378873 | 3300005614 | Bacteria | 720 |
| 82 | Ga0070702_100276113 | 3300005615 | Bacteria | 1151 |
| 83 | Ga0068852_100008502 | 3300005616 | Bacteria | 7570 |
| 84 | Ga0068852_100028855 | 3300005616 | Bacteria | 4547 |
| 85 | Ga0068852_101474771 | 3300005616 | Bacteria | 702 |
| 86 | Ga0068859_100020056 | 3300005617 | Bacteria | 6713 |
| 87 | Ga0068859_100588898 | 3300005617 | Bacteria | 1206 |
| 88 | Ga0068859_101251150 | 3300005617 | Bacteria | 818 |
| 89 | Ga0068864_100057029 | 3300005618 | Bacteria | 3375 |
| 90 | Ga0068861_100029893 | 3300005719 | Bacteria | 3989 |
| 91 | Ga0068861_100230096 | 3300005719 | Bacteria | 1571 |
| 92 | Ga0068861_100608619 | 3300005719 | Bacteria | 1004 |
| 93 | Ga0068851_10244100 | 3300005834 | Bacteria | 1017 |
| 94 | Ga0068863_100000027 | 3300005841 | Bacteria | 181884 |
| 95 | Ga0068863_100821485 | 3300005841 | Bacteria | 927 |
| 96 | Ga0068863_101674291 | 3300005841 | Bacteria | 646 |
| 97 | Ga0068858_100007312 | 3300005842 | Bacteria | 10696 |
| 98 | Ga0068858_100372905 | 3300005842 | Bacteria | 1369 |
| 99 | Ga0068860_100162244 | 3300005843 | Bacteria | 2155 |
| 100 | Ga0068860_101238833 | 3300005843 | Bacteria | 767 |
| 101 | Ga0068862_100184213 | 3300005844 | Bacteria | 1876 |
| 102 | Ga0081540_1072081 | 3300005983 | Bacteria | 1593 |
| 103 | Ga0081539_10014655 | 3300005985 | Bacteria | 5772 |
| 104 | Ga0075364_10322049 | 3300006051 | Bacteria | 1053 |
| 105 | Ga0070712_100010353 | 3300006175 | Bacteria | 5881 |
| 106 | Ga0097621_100129378 | 3300006237 | Bacteria | 2148 |
| 107 | Ga0097621_100311796 | 3300006237 | Bacteria | 1392 |
| 108 | Ga0075370_10058862 | 3300006353 | Bacteria | 2186 |
| 109 | Ga0075370_10124864 | 3300006353 | Bacteria | 1500 |
| 110 | Ga0068871_102384922 | 3300006358 | Bacteria | 504 |
| 111 | Ga0075428_101876012 | 3300006844 | Bacteria | 623 |
| 112 | Ga0075430_100240522 | 3300006846 | Bacteria | 1500 |
| 113 | Ga0075434_100092914 | 3300006871 | Bacteria | 3020 |
| 114 | Ga0075434_100397279 | 3300006871 | Bacteria | 1399 |
| 115 | Ga0075434_100709224 | 3300006871 | Bacteria | 1023 |
| 116 | Ga0075436_100054843 | 3300006914 | Bacteria | 2752 |
| 117 | Ga0097620_100020056 | 3300006931 | Bacteria | 6713 |
| 118 | Ga0097620_100588929 | 3300006931 | Bacteria | 1206 |
| 119 | Ga0097620_101251181 | 3300006931 | Bacteria | 818 |
| 120 | Ga0075435_100364507 | 3300007076 | Bacteria | 1240 |
| 121 | Ga0105240_11168809 | 3300009093 | Bacteria | 816 |
| 122 | Ga0111539_10782110 | 3300009094 | Bacteria | 1111 |
| 123 | Ga0105245_10493023 | 3300009098 | Bacteria | 1240 |
| 124 | Ga0114129_13225328 | 3300009147 | Bacteria | 530 |
| 125 | Ga0105241_10042711 | 3300009174 | Bacteria | 3432 |
| 126 | Ga0105242_10384200 | 3300009176 | Bacteria | 1306 |
| 127 | Ga0105248_10000444 | 3300009177 | Bacteria | 47003 |
| 128 | Ga0105248_10428943 | 3300009177 | Bacteria | 1489 |
| 129 | Ga0105237_10097989 | 3300009545 | Bacteria | 2923 |
| 130 | Ga0105238_10152367 | 3300009551 | Bacteria | 2287 |
| 131 | Ga0105238_10371070 | 3300009551 | Bacteria | 1421 |
| 132 | Ga0105249_10037179 | 3300009553 | Bacteria | 4419 |
| 133 | Ga0105249_11237313 | 3300009553 | Bacteria | 818 |
| 134 | Ga0105239_11049457 | 3300010375 | Bacteria | 938 |
| 135 | Ga0157346_1005557 | 3300012480 | Bacteria | 785 |
| 136 | Ga0157315_1000883 | 3300012508 | Bacteria | 1516 |
| 137 | Ga0157316_1036661 | 3300012510 | Bacteria | 621 |
| 138 | Ga0157373_10557478 | 3300013100 | Bacteria | 831 |
| 139 | Ga0157371_10008677 | 3300013102 | Bacteria | 8074 |
| 140 | Ga0157371_10569875 | 3300013102 | Bacteria | 840 |
| 141 | Ga0157370_10009361 | 3300013104 | Bacteria | 10480 |
| 142 | Ga0157370_10243476 | 3300013104 | Bacteria | 1664 |
| 143 | Ga0157369_10468984 | 3300013105 | Bacteria | 1303 |
| 144 | Ga0157369_10534193 | 3300013105 | Bacteria | 1213 |
| 145 | Ga0157369_12210767 | 3300013105 | Bacteria | 558 |
| 146 | Ga0157374_10297119 | 3300013296 | Bacteria | 1597 |
| 147 | Ga0157374_11285940 | 3300013296 | Bacteria | 753 |
| 148 | Ga0157378_11347387 | 3300013297 | Bacteria | 756 |
| 149 | Ga0163162_10790802 | 3300013306 | Bacteria | 1066 |
| 150 | Ga0157372_10158880 | 3300013307 | Bacteria | 2611 |
| 151 | Ga0157372_11345490 | 3300013307 | Bacteria | 824 |
| 152 | Ga0157372_13372385 | 3300013307 | Bacteria | 508 |
| 153 | Ga0157375_10168385 | 3300013308 | Bacteria | 2337 |
| 154 | Ga0157375_11911214 | 3300013308 | Bacteria | 705 |
| 155 | Ga0163163_10000169 | 3300014325 | Bacteria | 68481 |
| 156 | Ga0163163_11841664 | 3300014325 | Bacteria | 665 |
| 157 | Ga0157380_10522484 | 3300014326 | Bacteria | 1158 |
| 158 | Ga0157380_10666270 | 3300014326 | Bacteria | 1040 |
| 159 | Ga0157380_11064079 | 3300014326 | Bacteria | 846 |
| 160 | Ga0182008_10193538 | 3300014497 | Bacteria | 1032 |
| 161 | Ga0157379_10227355 | 3300014968 | Bacteria | 1691 |
| 162 | Ga0163161_10461584 | 3300017792 | Bacteria | 1028 |
| 163 | Ga0206353_11304491 | 3300020082 | Bacteria | 637 |
| 164 | Ga0154015_1329609 | 3300020610 | Bacteria | 523 |
| 165 | Ga0213876_10017463 | 3300021384 | Bacteria | 3789 |
| 166 | Ga0207682_10198570 | 3300025893 | Bacteria | 922 |
| 167 | Ga0207645_10026414 | 3300025907 | Bacteria | 3753 |
| 168 | Ga0207705_10000137 | 3300025909 | Bacteria | 79174 |
| 169 | Ga0207705_10241058 | 3300025909 | Bacteria | 1377 |
| 170 | Ga0207705_10253149 | 3300025909 | Bacteria | 1343 |
| 171 | Ga0207695_11001145 | 3300025913 | Bacteria | 715 |
| 172 | Ga0207671_10008208 | 3300025914 | Bacteria | 8895 |
| 173 | Ga0207693_10024195 | 3300025915 | Bacteria | 4822 |
| 174 | Ga0207660_10081523 | 3300025917 | Bacteria | 2378 |
| 175 | Ga0207662_10909101 | 3300025918 | Bacteria | 623 |
| 176 | Ga0207657_10000569 | 3300025919 | Bacteria | 39174 |
| 177 | Ga0207657_10534748 | 3300025919 | Bacteria | 917 |
| 178 | Ga0207649_10002487 | 3300025920 | Bacteria | 10297 |
| 179 | Ga0207649_10003403 | 3300025920 | Bacteria | 8695 |
| 180 | Ga0207652_10020269 | 3300025921 | Bacteria | 5475 |
| 181 | Ga0207646_10183865 | 3300025922 | Bacteria | 1888 |
| 182 | Ga0207681_11591423 | 3300025923 | Bacteria | 547 |
| 183 | Ga0207694_10082187 | 3300025924 | Bacteria | 2532 |
| 184 | Ga0207694_11036418 | 3300025924 | Unclassified | 694 |
| 185 | Ga0207650_10233607 | 3300025925 | Bacteria | 1484 |
| 186 | Ga0207659_10311358 | 3300025926 | Bacteria | 1296 |
| 187 | Ga0207687_10323245 | 3300025927 | Bacteria | 1249 |
| 188 | Ga0207644_10000111 | 3300025931 | Bacteria | 60737 |
| 189 | Ga0207644_10112704 | 3300025931 | Bacteria | 2059 |
| 190 | Ga0207644_10205084 | 3300025931 | Bacteria | 1556 |
| 191 | Ga0207690_10000108 | 3300025932 | Bacteria | 67599 |
| 192 | Ga0207690_10151435 | 3300025932 | Bacteria | 1720 |
| 193 | Ga0207706_10000571 | 3300025933 | Bacteria | 39174 |
| 194 | Ga0207706_10027711 | 3300025933 | Bacteria | 5065 |
| 195 | Ga0207686_10184019 | 3300025934 | Bacteria | 1484 |
| 196 | Ga0207686_11202710 | 3300025934 | Bacteria | 620 |
| 197 | Ga0207686_11473349 | 3300025934 | Bacteria | 561 |
| 198 | Ga0207709_10387774 | 3300025935 | Bacteria | 1065 |
| 199 | Ga0207670_10566213 | 3300025936 | Bacteria | 930 |
| 200 | Ga0207670_11049973 | 3300025936 | Bacteria | 687 |
| 201 | Ga0207669_10285388 | 3300025937 | Bacteria | 1247 |
| 202 | Ga0207704_10283785 | 3300025938 | Bacteria | 1260 |
| 203 | Ga0207691_10367838 | 3300025940 | Bacteria | 1228 |
| 204 | Ga0207711_10001099 | 3300025941 | Bacteria | 25801 |
| 205 | Ga0207711_10054097 | 3300025941 | Bacteria | 3443 |
| 206 | Ga0207711_10925870 | 3300025941 | Bacteria | 810 |
| 207 | Ga0207689_10004796 | 3300025942 | Bacteria | 12196 |
| 208 | Ga0207689_10449848 | 3300025942 | Bacteria | 1076 |
| 209 | Ga0207661_10048903 | 3300025944 | Bacteria | 3363 |
| 210 | Ga0207679_10000191 | 3300025945 | Bacteria | 49174 |
| 211 | Ga0207679_10004260 | 3300025945 | Bacteria | 8887 |
| 212 | Ga0207679_10078308 | 3300025945 | Bacteria | 2518 |
| 213 | Ga0207667_10001635 | 3300025949 | Bacteria | 28222 |
| 214 | Ga0207667_10376949 | 3300025949 | Bacteria | 1446 |
| 215 | Ga0207667_10515728 | 3300025949 | Bacteria | 1211 |
| 216 | Ga0207667_10582141 | 3300025949 | Bacteria | 1130 |
| 217 | Ga0207667_11067096 | 3300025949 | Bacteria | 792 |
| 218 | Ga0207651_10048249 | 3300025960 | Bacteria | 2877 |
| 219 | Ga0207651_10269249 | 3300025960 | Bacteria | 1402 |
| 220 | Ga0207651_11406181 | 3300025960 | Bacteria | 628 |
| 221 | Ga0207712_10326356 | 3300025961 | Bacteria | 1268 |
| 222 | Ga0207712_11002823 | 3300025961 | Bacteria | 741 |
| 223 | Ga0207668_10000054 | 3300025972 | Bacteria | 95426 |
| 224 | Ga0207640_10967481 | 3300025981 | Bacteria | 747 |
| 225 | Ga0207640_10996013 | 3300025981 | Bacteria | 737 |
| 226 | Ga0207640_11102655 | 3300025981 | Bacteria | 702 |
| 227 | Ga0207640_12046453 | 3300025981 | Bacteria | 519 |
| 228 | Ga0207703_10005107 | 3300026035 | Bacteria | 10616 |
| 229 | Ga0207703_10035530 | 3300026035 | Bacteria | 3960 |
| 230 | Ga0207703_10327654 | 3300026035 | Bacteria | 1404 |
| 231 | Ga0207639_10004731 | 3300026041 | Bacteria | 9171 |
| 232 | Ga0207639_10110566 | 3300026041 | Bacteria | 2238 |
| 233 | Ga0207678_10001788 | 3300026067 | Bacteria | 19681 |
| 234 | Ga0207678_10040341 | 3300026067 | Bacteria | 4049 |
| 235 | Ga0207678_10147030 | 3300026067 | Bacteria | 2012 |
| 236 | Ga0207702_10005964 | 3300026078 | Bacteria | 10581 |
| 237 | Ga0207641_10000045 | 3300026088 | Bacteria | 181882 |
| 238 | Ga0207641_10227800 | 3300026088 | Bacteria | 1731 |
| 239 | Ga0207641_11576980 | 3300026088 | Bacteria | 658 |
| 240 | Ga0207648_10170179 | 3300026089 | Bacteria | 1926 |
| 241 | Ga0207648_10175332 | 3300026089 | Bacteria | 1896 |
| 242 | Ga0207676_10130349 | 3300026095 | Bacteria | 2137 |
| 243 | Ga0207674_10082281 | 3300026116 | Bacteria | 3221 |
| 244 | Ga0207675_100141195 | 3300026118 | Bacteria | 2288 |
| 245 | Ga0207675_100828716 | 3300026118 | Bacteria | 939 |
| 246 | Ga0207683_10186584 | 3300026121 | Bacteria | 1882 |
| 247 | Ga0207698_10003214 | 3300026142 | Bacteria | 9817 |
| 248 | Ga0207698_10073455 | 3300026142 | Bacteria | 2724 |
| 249 | Ga0209970_1052658 | 3300027614 | Bacteria | 738 |
| 250 | Ga0209974_10234295 | 3300027876 | Bacteria | 687 |
| 251 | Ga0207428_10910406 | 3300027907 | Bacteria | 621 |
| 252 | Ga0268266_10021401 | 3300028379 | Bacteria | 5509 |
| 253 | Ga0268266_10060472 | 3300028379 | Bacteria | 3266 |
| 254 | Ga0268266_11042988 | 3300028379 | Bacteria | 791 |
| 255 | Ga0268266_12054540 | 3300028379 | Bacteria | 544 |
| 256 | Ga0268265_10018719 | 3300028380 | Bacteria | 4803 |
| 257 | Ga0268265_10086147 | 3300028380 | Bacteria | 2496 |
| 258 | Ga0268264_10001183 | 3300028381 | Bacteria | 25301 |
| 259 | Ga0268264_10138094 | 3300028381 | Bacteria | 2170 |
| 260 | Ga0268264_12133131 | 3300028381 | Bacteria | 569 |
| 261 | Ga0265328_10064822 | 3300031239 | Bacteria | 1342 |
| 262 | Ga0265331_10010482 | 3300031250 | Bacteria | 5127 |
| 263 | Ga0265331_10031026 | 3300031250 | Bacteria | 2658 |
| 264 | Ga0265327_10001005 | 3300031251 | Bacteria | 40015 |
| 265 | Ga0265316_10164246 | 3300031344 | Bacteria | 1659 |
| 266 | Ga0307408_100047713 | 3300031548 | Bacteria | 3068 |
| 267 | Ga0307408_100334146 | 3300031548 | Bacteria | 1280 |
| 268 | Ga0307408_101847095 | 3300031548 | Bacteria | 578 |
| 269 | Ga0316576_10043504 | 3300031727 | Bacteria | 3240 |
| 270 | Ga0316576_10307680 | 3300031727 | Bacteria | 1184 |
| 271 | Ga0316576_10602122 | 3300031727 | Bacteria | 802 |
| 272 | Ga0316578_10575799 | 3300031728 | Bacteria | 660 |
| 273 | Ga0316578_10879557 | 3300031728 | Bacteria | 518 |
| 274 | Ga0307405_10079596 | 3300031731 | Bacteria | 2136 |
| 275 | Ga0307405_10253111 | 3300031731 | Bacteria | 1311 |
| 276 | Ga0316577_10810101 | 3300031733 | Bacteria | 531 |
| 277 | Ga0307413_10038061 | 3300031824 | Bacteria | 2784 |
| 278 | Ga0307413_11455665 | 3300031824 | Bacteria | 604 |
| 279 | Ga0307410_10244746 | 3300031852 | Bacteria | 1391 |
| 280 | Ga0307410_10557236 | 3300031852 | Bacteria | 950 |
| 281 | Ga0307410_10920365 | 3300031852 | Bacteria | 750 |
| 282 | Ga0307410_11168083 | 3300031852 | Bacteria | 669 |
| 283 | Ga0307406_10211989 | 3300031901 | Bacteria | 1433 |
| 284 | Ga0307406_11749120 | 3300031901 | Bacteria | 552 |
| 285 | Ga0307406_11795647 | 3300031901 | Bacteria | 545 |
| 286 | Ga0307407_10170296 | 3300031903 | Bacteria | 1433 |
| 287 | Ga0307407_10506792 | 3300031903 | Bacteria | 885 |
| 288 | Ga0307407_10594761 | 3300031903 | Bacteria | 823 |
| 289 | Ga0307412_10000104 | 3300031911 | Bacteria | 67823 |
| 290 | Ga0307412_10115288 | 3300031911 | Bacteria | 1925 |
| 291 | Ga0307412_10408549 | 3300031911 | Bacteria | 1107 |
| 292 | Ga0307409_100280582 | 3300031995 | Bacteria | 1539 |
| 293 | Ga0307409_100830468 | 3300031995 | Bacteria | 933 |
| 294 | Ga0307416_100525221 | 3300032002 | Bacteria | 1252 |
| 295 | Ga0307416_100618807 | 3300032002 | Bacteria | 1164 |
| 296 | Ga0307416_101196970 | 3300032002 | Bacteria | 865 |
| 297 | Ga0307416_101553151 | 3300032002 | Bacteria | 767 |
| 298 | Ga0307416_102190249 | 3300032002 | Bacteria | 654 |
| 299 | Ga0307414_10194187 | 3300032004 | Bacteria | 1645 |
| 300 | Ga0307414_10310798 | 3300032004 | Bacteria | 1337 |
| 301 | Ga0307414_10517435 | 3300032004 | Bacteria | 1058 |
| 302 | Ga0307414_10589631 | 3300032004 | Bacteria | 995 |
| 303 | Ga0307411_10026047 | 3300032005 | Bacteria | 3514 |
| 304 | Ga0307411_10297036 | 3300032005 | Bacteria | 1293 |
| 305 | Ga0307411_10432703 | 3300032005 | Bacteria | 1096 |
| 306 | Ga0307411_10823465 | 3300032005 | Bacteria | 819 |
| 307 | Ga0307415_100012981 | 3300032126 | Bacteria | 4843 |
| 308 | Ga0307415_100033012 | 3300032126 | Bacteria | 3355 |
| 309 | Ga0307415_100881889 | 3300032126 | Bacteria | 823 |
| 310 | Ga0316583_10002571 | 3300032133 | Bacteria | 6326 |
| 311 | Ga0316593_10281444 | 3300032168 | Bacteria | 627 |
| 312 | Ga0316596_1141841 | 3300033541 | Bacteria | 658 |
| 313 | Ga0373930_0079067 | 3300034816 | Bacteria | 758 |
| 314 | Ga0373952_0069674 | 3300035092 | Bacteria | 877 |
| 315 | Ga0373923_0068125 | 3300035111 | Bacteria | 1524 |
| 316 | Ga0373932_0101173 | 3300035112 | Bacteria | 938 |
| 317 | Ga0373939_0149126 | 3300035114 | Bacteria | 850 |
| 318 | Ga0373960_0356388 | 3300035121 | Bacteria | 556 |
| 319 | Ga0373942_0110672 | 3300035207 | Bacteria | 849 |
| 320 | Ga0373961_0182851 | 3300035241 | Bacteria | 731 |
| 321 | Ga0373961_0225226 | 3300035241 | Bacteria | 670 |
| 322 | Ga0316574_0025505 | 3300035398 | Bacteria | 3549 |
| 323 | Ga0316574_0133130 | 3300035398 | Bacteria | 1600 |
| 324 | Ga0316574_0714367 | 3300035398 | Bacteria | 614 |
| 325 | Ga0373931_0006745 | 3300035691 | Bacteria | 5388 |
| 326 | Ga0373931_0161834 | 3300035691 | Bacteria | 1313 |
| 327 | Ga0373931_0733705 | 3300035691 | Bacteria | 655 |
| 328 | Ga0373937_0254378 | 3300036401 | Bacteria | 1656 |
| 329 | Ga0316582_0372145 | 3300036647 | Bacteria | 983 |
| 330 | Ga0316582_0397049 | 3300036647 | Bacteria | 950 |
| 331 | Ga0316584_0057443 | 3300036712 | Bacteria | 2913 |
| 332 | Ga0316584_0203642 | 3300036712 | Bacteria | 1459 |
| 333 | Ga0395899_0010483 | 3300037312 | Bacteria | 7097 |
| 334 | Ga0395900_0174138 | 3300037418 | Bacteria | 2189 |
| 335 | Ga0395905_0017633 | 3300037471 | Bacteria | 6777 |
| 336 | Ga0395905_1454681 | 3300037471 | Bacteria | 589 |
| 337 | Ga0395901_0229964 | 3300038443 | Bacteria | 1936 |
| 338 | Ga0395901_0524470 | 3300038443 | Bacteria | 1203 |
| 339 | Ga0237819_00270 | 3300038705 | Bacteria | 18995 |
| 340 | Ga0400490_06488 | 3300038726 | Bacteria | 5318 |
| 341 | Ga0400491_12863 | 3300038727 | Bacteria | 4796 |
| 342 | Ga0400485_22349 | 3300038735 | Bacteria | 174815 |
| 343 | Ga0400488_14279 | 3300038741 | Bacteria | 13772 |
| 344 | Ga0400488_39077 | 3300038741 | Bacteria | 3117 |
| 345 | Ga0400486_10036 | 3300038742 | Bacteria | 65877 |
| 346 | Ga0400483_031139 | 3300039062 | Bacteria | 8639 |
| 347 | Ga0400483_195212 | 3300039062 | Bacteria | 1372 |
| 348 | Ga0400483_255852 | 3300039062 | Bacteria | 2006 |
| 349 | Ga0400487_51847 | 3300039110 | Bacteria | 54060 |
| 350 | Ga0436365_0363342 | 3300039437 | Bacteria | 1830 |
| 351 | Ga0436365_0754658 | 3300039437 | Bacteria | 771 |
| 352 | Ga0436365_1506208 | 3300039437 | Bacteria | 4114 |
| 353 | Ga0436363_1114653 | 3300039450 | Bacteria | 1888 |
| 354 | Ga0451802_1529159 | 3300041460 | Bacteria | 591 |
| 355 | Ga0451849_0748450 | 3300041505 | Bacteria | 528 |
| 356 | Ga0451855_1831405 | 3300041511 | Bacteria | 508 |
| 357 | Ga0439437_064155 | 3300042000 | Bacteria | 502 |
| 358 | Ga0439454_104898 | 3300042011 | Bacteria | 535 |
| 359 | Ga0439435_0019976 | 3300042436 | Bacteria | 1723 |
| 360 | Ga0439464_0101505 | 3300042439 | Bacteria | 875 |
| 361 | Ga0451577_0288840 | 3300042876 | Bacteria | 1486 |
| 362 | Ga0466966_0041285 | 3300044684 | Bacteria | 2965 |
| 363 | Ga0466966_0093875 | 3300044684 | Bacteria | 1860 |
| 364 | Ga0466964_0087902 | 3300044706 | Bacteria | 1347 |
| 365 | Ga0466957_0019667 | 3300044842 | Bacteria | 3972 |
| 366 | Ga0466957_0169511 | 3300044842 | Bacteria | 1421 |
| 367 | Ga0466959_0262172 | 3300045049 | Bacteria | 1189 |
| 368 | Ga0451576_0002721 | 3300045051 | Bacteria | 25669 |
| 369 | Ga0466958_0008204 | 3300045836 | Bacteria | 5784 |
| 370 | Ga0495639_0302897 | 3300046475 | Bacteria | 797 |
| 371 | Ga0495642_0516059 | 3300046528 | Bacteria | 529 |
| 372 | Ga0495598_0012305 | 3300046537 | Bacteria | 2097 |
| 373 | Ga0495621_0016331 | 3300046539 | Bacteria | 2381 |
| 374 | Ga0495621_0018478 | 3300046539 | Bacteria | 2264 |
| 375 | Ga0495625_0234157 | 3300046660 | Bacteria | 1198 |
| 376 | Ga0495659_0462027 | 3300046664 | Bacteria | 553 |
| 377 | Ga0495588_0399035 | 3300046674 | Bacteria | 722 |
| 378 | Ga0495658_0122859 | 3300046683 | Bacteria | 1572 |
| 379 | Ga0495649_0641169 | 3300046694 | Bacteria | 523 |
| 380 | Ga0495687_027680 | 3300047443 | Bacteria | 2649 |
| 381 | Ga0495615_0129473 | 3300048090 | Bacteria | 737 |
| 382 | Ga0496100_0271183 | 3300048903 | Bacteria | 1262 |
| 383 | Ga0496100_0557247 | 3300048903 | Bacteria | 887 |
| 384 | Ga0496101_0208476 | 3300048904 | Bacteria | 1513 |
| 385 | Ga0496102_0018594 | 3300048905 | Bacteria | 6110 |
| 386 | Ga0496103_0204622 | 3300048906 | Bacteria | 1269 |
| 387 | Ga0496104_0314819 | 3300048907 | Bacteria | 1478 |
| 388 | Ga0496105_0292783 | 3300048908 | Bacteria | 1310 |
| 389 | Ga0496105_0513428 | 3300048908 | Bacteria | 939 |
| 390 | Ga0496106_1486326 | 3300048909 | Bacteria | 521 |
| 391 | Ga0496108_0180233 | 3300048911 | Bacteria | 1829 |
| 392 | Ga0496109_0077499 | 3300048912 | Bacteria | 3059 |
| 393 | Ga0496109_1511433 | 3300048912 | Bacteria | 606 |
| 394 | Ga0496110_0023752 | 3300048913 | Bacteria | 5217 |
| 395 | Ga0496112_0665696 | 3300048915 | Bacteria | 970 |
| 396 | Ga0496114_0441592 | 3300048917 | Bacteria | 1152 |
| 397 | Ga0496114_0471283 | 3300048917 | Bacteria | 1111 |
| 398 | Ga0496114_1529666 | 3300048917 | Bacteria | 555 |
| 399 | Ga0496116_0309622 | 3300048919 | Bacteria | 746 |
| 400 | Ga0496120_0233957 | 3300048923 | Bacteria | 871 |
| 401 | Ga0496122_0013576 | 3300048925 | Bacteria | 7955 |
| 402 | Ga0496122_0317192 | 3300048925 | Bacteria | 831 |
| 403 | Ga0496123_0017741 | 3300048926 | Bacteria | 5706 |
| 404 | Ga0496123_0021349 | 3300048926 | Bacteria | 5036 |
| 405 | Ga0496123_0303744 | 3300048926 | Bacteria | 760 |
| 406 | Ga0496124_0005643 | 3300048927 | Bacteria | 13989 |
| 407 | Ga0496124_0006985 | 3300048927 | Bacteria | 12109 |
| 408 | Ga0496125_0193334 | 3300048928 | Bacteria | 1341 |
| 409 | Ga0496126_0032343 | 3300048929 | Bacteria | 4929 |
| 410 | Ga0501306_094208 | 3300049127 | Bacteria | 529 |
| 411 | Ga0501317_034921 | 3300049533 | Bacteria | 746 |
| 412 | Ga0501319_003520 | 3300049535 | Bacteria | 1050 |
| 413 | Ga0501325_020931 | 3300049541 | Bacteria | 689 |
| 414 | Ga0501031_0124225 | 3300049568 | Bacteria | 1686 |
| 415 | Ga0501031_1048803 | 3300049568 | Bacteria | 521 |
| 416 | Ga0501032_0336573 | 3300049569 | Bacteria | 973 |
| 417 | Ga0501032_0653762 | 3300049569 | Bacteria | 667 |
| 418 | Ga0501034_0248954 | 3300049571 | Bacteria | 1722 |
| 419 | Ga0501034_0312579 | 3300049571 | Bacteria | 1505 |
| 420 | Ga0501036_0233657 | 3300049572 | Bacteria | 1543 |
| 421 | Ga0501036_0330810 | 3300049572 | Bacteria | 1273 |
| 422 | Ga0501036_0381835 | 3300049572 | Bacteria | 1176 |
| 423 | Ga0501036_0448243 | 3300049572 | Bacteria | 1075 |
| 424 | Ga0501036_0762060 | 3300049572 | Bacteria | 798 |
| 425 | Ga0501037_1042382 | 3300049573 | Bacteria | 531 |
| 426 | Ga0501038_0192764 | 3300049574 | Bacteria | 1639 |
| 427 | Ga0501038_1008156 | 3300049574 | Bacteria | 611 |
| 428 | Ga0501039_0510620 | 3300049575 | Bacteria | 944 |
| 429 | Ga0501039_1199820 | 3300049575 | Bacteria | 587 |
| 430 | Ga0501040_0096981 | 3300049576 | Bacteria | 2053 |
| 431 | Ga0501040_0274408 | 3300049576 | Bacteria | 1204 |
| 432 | Ga0501041_0053545 | 3300049577 | Bacteria | 2461 |
| 433 | Ga0501041_0286486 | 3300049577 | Bacteria | 1037 |
| 434 | Ga0501041_0492239 | 3300049577 | Bacteria | 780 |
| 435 | Ga0501042_0437558 | 3300049578 | Bacteria | 948 |
| 436 | Ga0501042_0502836 | 3300049578 | Bacteria | 880 |
| 437 | Ga0501042_0583532 | 3300049578 | Bacteria | 813 |
| 438 | Ga0501046_0506322 | 3300049580 | Bacteria | 864 |
| 439 | Ga0501047_0138116 | 3300049581 | Bacteria | 2317 |
| 440 | Ga0501047_0363263 | 3300049581 | Bacteria | 1283 |
| 441 | Ga0501048_0463690 | 3300049582 | Bacteria | 908 |
| 442 | Ga0501048_0917625 | 3300049582 | Bacteria | 630 |
| 443 | Ga0501048_0936429 | 3300049582 | Bacteria | 623 |
| 444 | Ga0501068_0111786 | 3300049584 | Bacteria | 1699 |
| 445 | Ga0501068_0383906 | 3300049584 | Bacteria | 905 |
| 446 | Ga0501068_1009984 | 3300049584 | Bacteria | 549 |
| 447 | Ga0501070_0088988 | 3300049586 | Bacteria | 2555 |
| 448 | Ga0501071_0541175 | 3300049587 | Bacteria | 894 |
| 449 | Ga0501071_0778425 | 3300049587 | Bacteria | 737 |
| 450 | Ga0501072_0018484 | 3300049588 | Bacteria | 5369 |
| 451 | Ga0501072_0098293 | 3300049588 | Bacteria | 2327 |
| 452 | Ga0501072_0579826 | 3300049588 | Bacteria | 885 |
| 453 | Ga0501072_0955209 | 3300049588 | Bacteria | 669 |
| 454 | Ga0501072_1318492 | 3300049588 | Bacteria | 559 |
| 455 | Ga0501072_1404417 | 3300049588 | Bacteria | 540 |
| 456 | Ga0501073_0089700 | 3300049589 | Bacteria | 2137 |
| 457 | Ga0501074_0003779 | 3300049590 | Bacteria | 10761 |
| 458 | Ga0501074_0141020 | 3300049590 | Bacteria | 1724 |
| 459 | Ga0501074_0397617 | 3300049590 | Bacteria | 977 |
| 460 | Ga0501075_0009440 | 3300049591 | Bacteria | 6824 |
| 461 | Ga0501075_0444534 | 3300049591 | Bacteria | 989 |
| 462 | Ga0501076_0031666 | 3300049592 | Bacteria | 4126 |
| 463 | Ga0501076_0389667 | 3300049592 | Bacteria | 1145 |
| 464 | Ga0501076_0480278 | 3300049592 | Bacteria | 1024 |
| 465 | Ga0501077_0051808 | 3300049593 | Bacteria | 2608 |
| 466 | Ga0501077_0695423 | 3300049593 | Bacteria | 653 |
| 467 | Ga0501202_112769 | 3300049652 | Bacteria | 675 |
| 468 | Ga0501243_050530 | 3300049675 | Bacteria | 750 |
| 469 | Ga0501247_030541 | 3300049677 | Bacteria | 734 |
| 470 | Ga0501079_0035825 | 3300049741 | Bacteria | 3820 |
| 471 | Ga0501079_0764523 | 3300049741 | Bacteria | 761 |
| 472 | Ga0501080_0095691 | 3300049742 | Bacteria | 2757 |
| 473 | Ga0501080_0242068 | 3300049742 | Bacteria | 1646 |
| 474 | Ga0501081_0102919 | 3300049743 | Bacteria | 2020 |
| 475 | Ga0501081_0302654 | 3300049743 | Bacteria | 1173 |
| 476 | Ga0501081_0420674 | 3300049743 | Bacteria | 991 |
| 477 | Ga0501081_1133245 | 3300049743 | Bacteria | 592 |
| 478 | Ga0501083_0117959 | 3300049744 | Bacteria | 1741 |
| 479 | Ga0501083_1152077 | 3300049744 | Bacteria | 505 |
| 480 | Ga0501241_132876 | 3300049758 | Bacteria | 562 |
| 481 | Ga0501268_009889 | 3300049765 | Bacteria | 1474 |
| 482 | Ga0501035_0987476 | 3300049822 | Bacteria | 663 |
| 483 | Ga0501035_1062563 | 3300049822 | Bacteria | 634 |
| 484 | Ga0501044_0048649 | 3300049823 | Bacteria | 4379 |
| 485 | Ga0501044_0338477 | 3300049823 | Bacteria | 1426 |
| 486 | Ga0501045_0427606 | 3300049824 | Bacteria | 985 |
| 487 | Ga0501045_0849988 | 3300049824 | Bacteria | 671 |
| 488 | nmdc:mga00v17_115338_c1 | 3300050491 | Bacteria | 1707 |
| 489 | nmdc:mga0k408_19929_c1 | 3300050493 | Bacteria | 3754 |
| 490 | nmdc:mga06z11_119743_c1 | 3300050494 | Bacteria | 1467 |
| 491 | nmdc:mga07m45_22808_c1 | 3300050496 | Bacteria | 3419 |
| 492 | nmdc:mga07m45_283056_c1 | 3300050496 | Bacteria | 964 |
| 493 | nmdc:mga08y16_389652_c1 | 3300050511 | Bacteria | 1427 |
| 494 | nmdc:mga08y16_738532_c1 | 3300050511 | Bacteria | 981 |
| 495 | nmdc:mga0n895_80475_c1 | 3300050512 | Bacteria | 3246 |
| 496 | nmdc:mga0n895_83320_c1 | 3300050512 | Bacteria | 3189 |
| 497 | nmdc:mga0rr50_580677_c1 | 3300050513 | Bacteria | 955 |
| 498 | nmdc:mga0rr50_670735_c1 | 3300050513 | Bacteria | 885 |
| 499 | nmdc:mga08x19_300618_c1 | 3300050514 | Bacteria | 1115 |
| 500 | Ga0500643_002853 | 3300053087 | Bacteria | 8611 |
| 501 | Ga0500643_032102 | 3300053087 | Bacteria | 1596 |
| 502 | Ga0501084_0071839 | 3300054114 | Bacteria | 2898 |
| 503 | Ga0587093_009736 | 3300059478 | Bacteria | 1122 |
| 504 | Ga0587066_023684 | 3300059490 | Bacteria | 1039 |
| 505 | Ga0587070_043143 | 3300059491 | Bacteria | 871 |
| 506 | Ga0587077_021444 | 3300059493 | Bacteria | 1146 |
| 507 | Ga0587082_005480 | 3300059504 | Bacteria | 1653 |
| 508 | Ga0587083_0194940 | 3300059505 | Bacteria | 575 |
| 509 | Ga0587091_118317 | 3300059511 | Bacteria | 641 |
| 510 | Ga0587106_107277 | 3300059605 | Bacteria | 577 |
| 511 | Ga0587101_001201 | 3300059623 | Bacteria | 2158 |
| 512 | Ga0587117_005293 | 3300059627 | Bacteria | 1389 |
| 513 | Ga0587128_067460 | 3300059630 | Bacteria | 690 |
| 514 | Ga0587068_030371 | 3300059641 | Bacteria | 934 |
| 515 | Ga0587069_022689 | 3300059642 | Bacteria | 955 |
| 516 | Ga0587072_105033 | 3300059643 | Bacteria | 638 |
| 517 | Ga0587076_024310 | 3300059645 | Bacteria | 1027 |
| 518 | Ga0587078_002952 | 3300059646 | Bacteria | 1683 |
| 519 | Ga0587079_021532 | 3300059647 | Bacteria | 1161 |
| 520 | Ga0587079_029102 | 3300059647 | Bacteria | 1050 |
| 521 | Ga0587102_005950 | 3300059649 | Bacteria | 1094 |
| 522 | Ga0587102_010470 | 3300059649 | Bacteria | 917 |
| 523 | Ga0587110_013564 | 3300059654 | Bacteria | 854 |
| 524 | Ga0587124_001856 | 3300059660 | Bacteria | 1427 |
| 525 | Ga0587071_005959 | 3300060344 | Bacteria | 1887 |
| 526 | Ga0587111_0002620 | 3300060346 | Bacteria | 2433 |
| 527 | Ga0501082_0731916 | 3300060353 | Bacteria | 866 |
| 528 | Ga0501082_0908268 | 3300060353 | Bacteria | 770 |
| 529 | Ga0501082_2002128 | 3300060353 | Bacteria | 505 |
| 530 | Ga0466962_0054164 | 3300061719 | Bacteria | 1917 |
| 531 | Ga0530510_0440201 | 3300061734 | Bacteria | 985 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049127 | Ga0501306_094208 | Ga0501306_094208_14_349 | 111 |
| 2 | 3300046539 | Ga0495621_0018478 | Ga0495621_0018478_246_584 | 112 |
| 3 | 3300025926 | Ga0207659_10311358 | Ga0207659_103113584 | 113 |
| 4 | 3300025934 | Ga0207686_11202710 | Ga0207686_112027102 | 113 |
| 5 | 3300025938 | Ga0207704_10283785 | Ga0207704_102837852 | 113 |
| 6 | 3300025940 | Ga0207691_10367838 | Ga0207691_103678382 | 113 |
| 7 | 3300025941 | Ga0207711_10054097 | Ga0207711_100540974 | 113 |
| 8 | 3300025942 | Ga0207689_10004796 | Ga0207689_1000479612 | 113 |
| 9 | 3300025960 | Ga0207651_10048249 | Ga0207651_100482494 | 113 |
| 10 | 3300025981 | Ga0207640_12046453 | Ga0207640_120464532 | 113 |
| 11 | 3300026035 | Ga0207703_10035530 | Ga0207703_100355302 | 113 |
| 12 | 3300026088 | Ga0207641_11576980 | Ga0207641_115769802 | 113 |
| 13 | 3300026089 | Ga0207648_10175332 | Ga0207648_101753322 | 113 |
| 14 | 3300026095 | Ga0207676_10130349 | Ga0207676_101303492 | 113 |
| 15 | 3300026118 | Ga0207675_100141195 | Ga0207675_1001411954 | 113 |
| 16 | 3300026121 | Ga0207683_10186584 | Ga0207683_101865842 | 113 |
| 17 | 3300028379 | Ga0268266_12054540 | Ga0268266_120545401 | 113 |
| 18 | 3300028380 | Ga0268265_10018719 | Ga0268265_100187193 | 113 |
| 19 | 3300028381 | Ga0268264_10138094 | Ga0268264_101380942 | 113 |
| 20 | 3300035121 | Ga0373960_0356388 | Ga0373960_0356388_22_381 | 113 |
| 21 | iso_pu_bacteria | 2526164512 | 2526211550 | 115 |
| 22 | iso_pu_bacteria | 2574179768 | 2574430992 | 115 |
| 23 | iso_pu_bacteria | 2891633521 | 2891634037 | 115 |
| 24 | iso_pu_bacteria | 639633007 | 639786212 | 115 |
| 25 | 3300020082 | Ga0206353_11304491 | Ga0206353_113044912 | 116 |
| 26 | 3300025924 | Ga0207694_11036418 | Ga0207694_110364182 | 117 |
| 27 | 3300035398 | Ga0316574_0025505 | Ga0316574_0025505_239_592 | 117 |
| 28 | 3300048903 | Ga0496100_0271183 | Ga0496100_0271183_526_879 | 117 |
| 29 | 3300049578 | Ga0501042_0502836 | Ga0501042_0502836_260_613 | 117 |
| 30 | iso_pu_bacteria | 2599185359 | 2600228371 | 117 |
| 31 | iso_pu_bacteria | 2818991466 | 2819715167 | 117 |
| 32 | iso_pu_bacteria | 2879163058 | 2879163948 | 117 |
| 33 | iso_pu_bacteria | 2928968154 | 2928971401 | 117 |
| 34 | 3300005347 | Ga0070668_100739891 | Ga0070668_1007398912 | 118 |
| 35 | 3300005548 | Ga0070665_101190845 | Ga0070665_1011908451 | 118 |
| 36 | 3300005983 | Ga0081540_1072081 | Ga0081540_10720812 | 118 |
| 37 | 3300006844 | Ga0075428_101876012 | Ga0075428_1018760121 | 118 |
| 38 | 3300007076 | Ga0075435_100364507 | Ga0075435_1003645073 | 118 |
| 39 | 3300009553 | Ga0105249_11237313 | Ga0105249_112373132 | 118 |
| 40 | 3300013297 | Ga0157378_11347387 | Ga0157378_113473872 | 118 |
| 41 | 3300014326 | Ga0157380_10522484 | Ga0157380_105224842 | 118 |
| 42 | 3300014326 | Ga0157380_10666270 | Ga0157380_106662702 | 118 |
| 43 | 3300025942 | Ga0207689_10449848 | Ga0207689_104498482 | 118 |
| 44 | 3300028379 | Ga0268266_11042988 | Ga0268266_110429881 | 118 |
| 45 | 3300031727 | Ga0316576_10043504 | Ga0316576_100435043 | 118 |
| 46 | 3300031728 | Ga0316578_10575799 | Ga0316578_105757992 | 118 |
| 47 | 3300032002 | Ga0307416_101196970 | Ga0307416_1011969702 | 118 |
| 48 | 3300033541 | Ga0316596_1141841 | Ga0316596_11418412 | 118 |
| 49 | 3300035691 | Ga0373931_0733705 | Ga0373931_0733705_262_618 | 118 |
| 50 | 3300036647 | Ga0316582_0372145 | Ga0316582_0372145_604_963 | 118 |
| 51 | 3300036647 | Ga0316582_0397049 | Ga0316582_0397049_388_750 | 118 |
| 52 | 3300036712 | Ga0316584_0203642 | Ga0316584_0203642_264_626 | 118 |
| 53 | 3300039062 | Ga0400483_195212 | Ga0400483_195212_179_541 | 118 |
| 54 | 3300039450 | Ga0436363_1114653 | Ga0436363_1114653_1003_1380 | 118 |
| 55 | 3300041511 | Ga0451855_1831405 | Ga0451855_1831405_47_412 | 118 |
| 56 | 3300048909 | Ga0496106_1486326 | Ga0496106_1486326_122_478 | 118 |
| 57 | 3300049568 | Ga0501031_1048803 | Ga0501031_1048803_76_441 | 118 |
| 58 | 3300049572 | Ga0501036_0330810 | Ga0501036_0330810_98_454 | 118 |
| 59 | 3300049575 | Ga0501039_0510620 | Ga0501039_0510620_497_859 | 118 |
| 60 | 3300049575 | Ga0501039_1199820 | Ga0501039_1199820_16_378 | 118 |
| 61 | 3300049576 | Ga0501040_0274408 | Ga0501040_0274408_493_849 | 118 |
| 62 | 3300049584 | Ga0501068_1009984 | Ga0501068_1009984_47_409 | 118 |
| 63 | 3300049587 | Ga0501071_0541175 | Ga0501071_0541175_17_382 | 118 |
| 64 | 3300049588 | Ga0501072_0579826 | Ga0501072_0579826_318_680 | 118 |
| 65 | 3300049588 | Ga0501072_0955209 | Ga0501072_0955209_213_569 | 118 |
| 66 | 3300049588 | Ga0501072_1404417 | Ga0501072_1404417_94_456 | 118 |
| 67 | 3300049592 | Ga0501076_0389667 | Ga0501076_0389667_765_1121 | 118 |
| 68 | 3300049592 | Ga0501076_0480278 | Ga0501076_0480278_134_496 | 118 |
| 69 | 3300049743 | Ga0501081_1133245 | Ga0501081_1133245_191_553 | 118 |
| 70 | 3300049744 | Ga0501083_1152077 | Ga0501083_1152077_128_484 | 118 |
| 71 | 3300049824 | Ga0501045_0849988 | Ga0501045_0849988_212_577 | 118 |
| 72 | 3300050513 | nmdc:mga0rr50_670735_c1 | nmdc:mga0rr50_670735_c1_481_837 | 118 |
| 73 | 3300060353 | Ga0501082_2002128 | Ga0501082_2002128_29_391 | 118 |
| 74 | 3300061734 | Ga0530510_0440201 | Ga0530510_0440201_439_795 | 118 |
| 75 | 3300003162 | Ga0006778J45830_1035605 | Ga0006778J45830_10356054 | 119 |
| 76 | 3300003162 | Ga0006778J45830_1075563 | Ga0006778J45830_10755632 | 119 |
| 77 | 3300003163 | Ga0006759J45824_1027411 | Ga0006759J45824_10274114 | 119 |
| 78 | 3300003305 | Ga0006770J48903_1039900 | Ga0006770J48903_10399002 | 119 |
| 79 | 3300003574 | Ga0007410J51695_1035445 | Ga0007410J51695_10354453 | 119 |
| 80 | 3300003577 | Ga0007416J51690_1018437 | Ga0007416J51690_10184374 | 119 |
| 81 | 3300003579 | Ga0007429J51699_1035293 | Ga0007429J51699_10352934 | 119 |
| 82 | 3300003693 | Ga0032354_1063990 | Ga0032354_10639901 | 119 |
| 83 | 3300005289 | Ga0065704_10288503 | Ga0065704_102885032 | 119 |
| 84 | 3300005295 | Ga0065707_10521373 | Ga0065707_105213731 | 119 |
| 85 | 3300005327 | Ga0070658_10271077 | Ga0070658_102710773 | 119 |
| 86 | 3300005330 | Ga0070690_100458459 | Ga0070690_1004584592 | 119 |
| 87 | 3300005330 | Ga0070690_100677617 | Ga0070690_1006776172 | 119 |
| 88 | 3300005333 | Ga0070677_10492624 | Ga0070677_104926241 | 119 |
| 89 | 3300005339 | Ga0070660_100001988 | Ga0070660_1000019885 | 119 |
| 90 | 3300005340 | Ga0070689_100548807 | Ga0070689_1005488071 | 119 |
| 91 | 3300005340 | Ga0070689_101995570 | Ga0070689_1019955701 | 119 |
| 92 | 3300005341 | Ga0070691_10258314 | Ga0070691_102583141 | 119 |
| 93 | 3300005344 | Ga0070661_100017729 | Ga0070661_1000177295 | 119 |
| 94 | 3300005345 | Ga0070692_10946453 | Ga0070692_109464532 | 119 |
| 95 | 3300005353 | Ga0070669_100190232 | Ga0070669_1001902322 | 119 |
| 96 | 3300005356 | Ga0070674_100354791 | Ga0070674_1003547912 | 119 |
| 97 | 3300005365 | Ga0070688_101128514 | Ga0070688_1011285142 | 119 |
| 98 | 3300005366 | Ga0070659_100014861 | Ga0070659_1000148613 | 119 |
| 99 | 3300005441 | Ga0070700_100491934 | Ga0070700_1004919341 | 119 |
| 100 | 3300005457 | Ga0070662_100863402 | Ga0070662_1008634022 | 119 |
| 101 | 3300005459 | Ga0068867_100380423 | Ga0068867_1003804234 | 119 |
| 102 | 3300005468 | Ga0070707_100190468 | Ga0070707_1001904683 | 119 |
| 103 | 3300005518 | Ga0070699_100072315 | Ga0070699_1000723153 | 119 |
| 104 | 3300005530 | Ga0070679_100035325 | Ga0070679_1000353253 | 119 |
| 105 | 3300005536 | Ga0070697_100272162 | Ga0070697_1002721622 | 119 |
| 106 | 3300005546 | Ga0070696_100008619 | Ga0070696_1000086194 | 119 |
| 107 | 3300005547 | Ga0070693_100553350 | Ga0070693_1005533503 | 119 |
| 108 | 3300005549 | Ga0070704_100717982 | Ga0070704_1007179822 | 119 |
| 109 | 3300005563 | Ga0068855_100304790 | Ga0068855_1003047903 | 119 |
| 110 | 3300005564 | Ga0070664_101153376 | Ga0070664_1011533762 | 119 |
| 111 | 3300005578 | Ga0068854_100414383 | Ga0068854_1004143833 | 119 |
| 112 | 3300005615 | Ga0070702_100276113 | Ga0070702_1002761132 | 119 |
| 113 | 3300005616 | Ga0068852_100008502 | Ga0068852_1000085025 | 119 |
| 114 | 3300005617 | Ga0068859_100588898 | Ga0068859_1005888983 | 119 |
| 115 | 3300005719 | Ga0068861_100029893 | Ga0068861_1000298931 | 119 |
| 116 | 3300005719 | Ga0068861_100230096 | Ga0068861_1002300962 | 119 |
| 117 | 3300005841 | Ga0068863_101674291 | Ga0068863_1016742912 | 119 |
| 118 | 3300005842 | Ga0068858_100372905 | Ga0068858_1003729052 | 119 |
| 119 | 3300005844 | Ga0068862_100184213 | Ga0068862_1001842133 | 119 |
| 120 | 3300006051 | Ga0075364_10322049 | Ga0075364_103220491 | 119 |
| 121 | 3300006237 | Ga0097621_100311796 | Ga0097621_1003117963 | 119 |
| 122 | 3300006353 | Ga0075370_10124864 | Ga0075370_101248642 | 119 |
| 123 | 3300006358 | Ga0068871_102384922 | Ga0068871_1023849221 | 119 |
| 124 | 3300006846 | Ga0075430_100240522 | Ga0075430_1002405223 | 119 |
| 125 | 3300006871 | Ga0075434_100397279 | Ga0075434_1003972792 | 119 |
| 126 | 3300006871 | Ga0075434_100709224 | Ga0075434_1007092242 | 119 |
| 127 | 3300006914 | Ga0075436_100054843 | Ga0075436_1000548431 | 119 |
| 128 | 3300006931 | Ga0097620_100588929 | Ga0097620_1005889293 | 119 |
| 129 | 3300009093 | Ga0105240_11168809 | Ga0105240_111688092 | 119 |
| 130 | 3300009094 | Ga0111539_10782110 | Ga0111539_107821102 | 119 |
| 131 | 3300009098 | Ga0105245_10493023 | Ga0105245_104930232 | 119 |
| 132 | 3300009147 | Ga0114129_13225328 | Ga0114129_132253282 | 119 |
| 133 | 3300009176 | Ga0105242_10384200 | Ga0105242_103842003 | 119 |
| 134 | 3300012508 | Ga0157315_1000883 | Ga0157315_10008832 | 119 |
| 135 | 3300013102 | Ga0157371_10569875 | Ga0157371_105698752 | 119 |
| 136 | 3300013104 | Ga0157370_10009361 | Ga0157370_100093612 | 119 |
| 137 | 3300013104 | Ga0157370_10243476 | Ga0157370_102434761 | 119 |
| 138 | 3300013105 | Ga0157369_12210767 | Ga0157369_122107672 | 119 |
| 139 | 3300013306 | Ga0163162_10790802 | Ga0163162_107908023 | 119 |
| 140 | 3300013307 | Ga0157372_10158880 | Ga0157372_101588803 | 119 |
| 141 | 3300013307 | Ga0157372_13372385 | Ga0157372_133723852 | 119 |
| 142 | 3300013308 | Ga0157375_10168385 | Ga0157375_101683853 | 119 |
| 143 | 3300013308 | Ga0157375_11911214 | Ga0157375_119112141 | 119 |
| 144 | 3300014326 | Ga0157380_11064079 | Ga0157380_110640793 | 119 |
| 145 | 3300017792 | Ga0163161_10461584 | Ga0163161_104615841 | 119 |
| 146 | 3300025893 | Ga0207682_10198570 | Ga0207682_101985701 | 119 |
| 147 | 3300025909 | Ga0207705_10241058 | Ga0207705_102410582 | 119 |
| 148 | 3300025913 | Ga0207695_11001145 | Ga0207695_110011452 | 119 |
| 149 | 3300025918 | Ga0207662_10909101 | Ga0207662_109091012 | 119 |
| 150 | 3300025920 | Ga0207649_10003403 | Ga0207649_100034033 | 119 |
| 151 | 3300025921 | Ga0207652_10020269 | Ga0207652_100202694 | 119 |
| 152 | 3300025922 | Ga0207646_10183865 | Ga0207646_101838653 | 119 |
| 153 | 3300025927 | Ga0207687_10323245 | Ga0207687_103232452 | 119 |
| 154 | 3300025932 | Ga0207690_10151435 | Ga0207690_101514352 | 119 |
| 155 | 3300025934 | Ga0207686_11473349 | Ga0207686_114733491 | 119 |
| 156 | 3300025935 | Ga0207709_10387774 | Ga0207709_103877742 | 119 |
| 157 | 3300025936 | Ga0207670_10566213 | Ga0207670_105662133 | 119 |
| 158 | 3300025936 | Ga0207670_11049973 | Ga0207670_110499731 | 119 |
| 159 | 3300025937 | Ga0207669_10285388 | Ga0207669_102853883 | 119 |
| 160 | 3300025945 | Ga0207679_10004260 | Ga0207679_100042607 | 119 |
| 161 | 3300025945 | Ga0207679_10078308 | Ga0207679_100783084 | 119 |
| 162 | 3300025949 | Ga0207667_10376949 | Ga0207667_103769493 | 119 |
| 163 | 3300025949 | Ga0207667_10515728 | Ga0207667_105157282 | 119 |
| 164 | 3300025949 | Ga0207667_10582141 | Ga0207667_105821412 | 119 |
| 165 | 3300025960 | Ga0207651_11406181 | Ga0207651_114061812 | 119 |
| 166 | 3300025961 | Ga0207712_11002823 | Ga0207712_110028231 | 119 |
| 167 | 3300025981 | Ga0207640_10967481 | Ga0207640_109674812 | 119 |
| 168 | 3300026035 | Ga0207703_10327654 | Ga0207703_103276542 | 119 |
| 169 | 3300026067 | Ga0207678_10147030 | Ga0207678_101470303 | 119 |
| 170 | 3300026089 | Ga0207648_10170179 | Ga0207648_101701794 | 119 |
| 171 | 3300026118 | Ga0207675_100828716 | Ga0207675_1008287162 | 119 |
| 172 | 3300026142 | Ga0207698_10073455 | Ga0207698_100734552 | 119 |
| 173 | 3300027876 | Ga0209974_10234295 | Ga0209974_102342952 | 119 |
| 174 | 3300027907 | Ga0207428_10910406 | Ga0207428_109104061 | 119 |
| 175 | 3300028380 | Ga0268265_10086147 | Ga0268265_100861473 | 119 |
| 176 | 3300031239 | Ga0265328_10064822 | Ga0265328_100648223 | 119 |
| 177 | 3300031250 | Ga0265331_10010482 | Ga0265331_100104823 | 119 |
| 178 | 3300031250 | Ga0265331_10031026 | Ga0265331_100310263 | 119 |
| 179 | 3300031251 | Ga0265327_10001005 | Ga0265327_100010059 | 119 |
| 180 | 3300031344 | Ga0265316_10164246 | Ga0265316_101642462 | 119 |
| 181 | 3300031727 | Ga0316576_10307680 | Ga0316576_103076801 | 119 |
| 182 | 3300031733 | Ga0316577_10810101 | Ga0316577_108101011 | 119 |
| 183 | 3300031852 | Ga0307410_10920365 | Ga0307410_109203652 | 119 |
| 184 | 3300031901 | Ga0307406_11749120 | Ga0307406_117491202 | 119 |
| 185 | 3300031901 | Ga0307406_11795647 | Ga0307406_117956471 | 119 |
| 186 | 3300031903 | Ga0307407_10594761 | Ga0307407_105947613 | 119 |
| 187 | 3300032002 | Ga0307416_102190249 | Ga0307416_1021902491 | 119 |
| 188 | 3300032005 | Ga0307411_10432703 | Ga0307411_104327032 | 119 |
| 189 | 3300032126 | Ga0307415_100881889 | Ga0307415_1008818892 | 119 |
| 190 | 3300032133 | Ga0316583_10002571 | Ga0316583_100025718 | 119 |
| 191 | 3300032168 | Ga0316593_10281444 | Ga0316593_102814441 | 119 |
| 192 | 3300035114 | Ga0373939_0149126 | Ga0373939_0149126_311_670 | 119 |
| 193 | 3300035241 | Ga0373961_0182851 | Ga0373961_0182851_134_493 | 119 |
| 194 | 3300035691 | Ga0373931_0161834 | Ga0373931_0161834_114_473 | 119 |
| 195 | 3300036401 | Ga0373937_0254378 | Ga0373937_0254378_520_879 | 119 |
| 196 | 3300036712 | Ga0316584_0057443 | Ga0316584_0057443_1517_1876 | 119 |
| 197 | 3300037312 | Ga0395899_0010483 | Ga0395899_0010483_5867_6226 | 119 |
| 198 | 3300037418 | Ga0395900_0174138 | Ga0395900_0174138_1766_2125 | 119 |
| 199 | 3300038726 | Ga0400490_06488 | Ga0400490_06488_4449_4808 | 119 |
| 200 | 3300038727 | Ga0400491_12863 | Ga0400491_12863_11_370 | 119 |
| 201 | 3300038735 | Ga0400485_22349 | Ga0400485_22349_23491_23850 | 119 |
| 202 | 3300038741 | Ga0400488_14279 | Ga0400488_14279_602_961 | 119 |
| 203 | 3300038741 | Ga0400488_39077 | Ga0400488_39077_233_592 | 119 |
| 204 | 3300038742 | Ga0400486_10036 | Ga0400486_10036_23524_23883 | 119 |
| 205 | 3300039062 | Ga0400483_031139 | Ga0400483_031139_799_1158 | 119 |
| 206 | 3300039062 | Ga0400483_255852 | Ga0400483_255852_1564_1923 | 119 |
| 207 | 3300039110 | Ga0400487_51847 | Ga0400487_51847_30178_30537 | 119 |
| 208 | 3300042000 | Ga0439437_064155 | Ga0439437_064155_46_405 | 119 |
| 209 | 3300042876 | Ga0451577_0288840 | Ga0451577_0288840_882_1241 | 119 |
| 210 | 3300044684 | Ga0466966_0041285 | Ga0466966_0041285_636_995 | 119 |
| 211 | 3300044684 | Ga0466966_0093875 | Ga0466966_0093875_299_658 | 119 |
| 212 | 3300044842 | Ga0466957_0169511 | Ga0466957_0169511_469_828 | 119 |
| 213 | 3300045049 | Ga0466959_0262172 | Ga0466959_0262172_488_847 | 119 |
| 214 | 3300045051 | Ga0451576_0002721 | Ga0451576_0002721_16585_16944 | 119 |
| 215 | 3300045836 | Ga0466958_0008204 | Ga0466958_0008204_5303_5662 | 119 |
| 216 | 3300046475 | Ga0495639_0302897 | Ga0495639_0302897_203_562 | 119 |
| 217 | 3300046528 | Ga0495642_0516059 | Ga0495642_0516059_60_419 | 119 |
| 218 | 3300046537 | Ga0495598_0012305 | Ga0495598_0012305_1662_2021 | 119 |
| 219 | 3300046539 | Ga0495621_0016331 | Ga0495621_0016331_216_575 | 119 |
| 220 | 3300046660 | Ga0495625_0234157 | Ga0495625_0234157_416_775 | 119 |
| 221 | 3300046664 | Ga0495659_0462027 | Ga0495659_0462027_181_540 | 119 |
| 222 | 3300046674 | Ga0495588_0399035 | Ga0495588_0399035_223_582 | 119 |
| 223 | 3300046683 | Ga0495658_0122859 | Ga0495658_0122859_122_481 | 119 |
| 224 | 3300047443 | Ga0495687_027680 | Ga0495687_027680_2160_2519 | 119 |
| 225 | 3300048903 | Ga0496100_0557247 | Ga0496100_0557247_511_870 | 119 |
| 226 | 3300048904 | Ga0496101_0208476 | Ga0496101_0208476_242_601 | 119 |
| 227 | 3300048905 | Ga0496102_0018594 | Ga0496102_0018594_3456_3815 | 119 |
| 228 | 3300048906 | Ga0496103_0204622 | Ga0496103_0204622_254_613 | 119 |
| 229 | 3300048907 | Ga0496104_0314819 | Ga0496104_0314819_177_536 | 119 |
| 230 | 3300048908 | Ga0496105_0292783 | Ga0496105_0292783_356_715 | 119 |
| 231 | 3300048911 | Ga0496108_0180233 | Ga0496108_0180233_452_811 | 119 |
| 232 | 3300048912 | Ga0496109_0077499 | Ga0496109_0077499_2082_2441 | 119 |
| 233 | 3300048913 | Ga0496110_0023752 | Ga0496110_0023752_1911_2270 | 119 |
| 234 | 3300048915 | Ga0496112_0665696 | Ga0496112_0665696_282_641 | 119 |
| 235 | 3300048917 | Ga0496114_0471283 | Ga0496114_0471283_109_468 | 119 |
| 236 | 3300048925 | Ga0496122_0013576 | Ga0496122_0013576_3116_3475 | 119 |
| 237 | 3300048926 | Ga0496123_0021349 | Ga0496123_0021349_4198_4557 | 119 |
| 238 | 3300049533 | Ga0501317_034921 | Ga0501317_034921_138_497 | 119 |
| 239 | 3300049535 | Ga0501319_003520 | Ga0501319_003520_72_431 | 119 |
| 240 | 3300049541 | Ga0501325_020931 | Ga0501325_020931_83_442 | 119 |
| 241 | 3300049568 | Ga0501031_0124225 | Ga0501031_0124225_322_681 | 119 |
| 242 | 3300049569 | Ga0501032_0336573 | Ga0501032_0336573_475_834 | 119 |
| 243 | 3300049569 | Ga0501032_0653762 | Ga0501032_0653762_16_375 | 119 |
| 244 | 3300049572 | Ga0501036_0381835 | Ga0501036_0381835_214_573 | 119 |
| 245 | 3300049572 | Ga0501036_0448243 | Ga0501036_0448243_235_594 | 119 |
| 246 | 3300049573 | Ga0501037_1042382 | Ga0501037_1042382_109_468 | 119 |
| 247 | 3300049574 | Ga0501038_1008156 | Ga0501038_1008156_220_579 | 119 |
| 248 | 3300049577 | Ga0501041_0286486 | Ga0501041_0286486_17_376 | 119 |
| 249 | 3300049578 | Ga0501042_0437558 | Ga0501042_0437558_268_627 | 119 |
| 250 | 3300049578 | Ga0501042_0583532 | Ga0501042_0583532_258_617 | 119 |
| 251 | 3300049582 | Ga0501048_0463690 | Ga0501048_0463690_358_717 | 119 |
| 252 | 3300049584 | Ga0501068_0383906 | Ga0501068_0383906_456_815 | 119 |
| 253 | 3300049588 | Ga0501072_0098293 | Ga0501072_0098293_331_690 | 119 |
| 254 | 3300049588 | Ga0501072_1318492 | Ga0501072_1318492_65_424 | 119 |
| 255 | 3300049590 | Ga0501074_0003779 | Ga0501074_0003779_122_481 | 119 |
| 256 | 3300049591 | Ga0501075_0444534 | Ga0501075_0444534_374_733 | 119 |
| 257 | 3300049743 | Ga0501081_0420674 | Ga0501081_0420674_299_658 | 119 |
| 258 | 3300049822 | Ga0501035_1062563 | Ga0501035_1062563_261_620 | 119 |
| 259 | 3300049823 | Ga0501044_0338477 | Ga0501044_0338477_259_618 | 119 |
| 260 | 3300050491 | nmdc:mga00v17_115338_c1 | nmdc:mga00v17_115338_c1_1217_1576 | 119 |
| 261 | 3300050493 | nmdc:mga0k408_19929_c1 | nmdc:mga0k408_19929_c1_1929_2288 | 119 |
| 262 | 3300050494 | nmdc:mga06z11_119743_c1 | nmdc:mga06z11_119743_c1_55_414 | 119 |
| 263 | 3300050496 | nmdc:mga07m45_283056_c1 | nmdc:mga07m45_283056_c1_112_471 | 119 |
| 264 | 3300050511 | nmdc:mga08y16_738532_c1 | nmdc:mga08y16_738532_c1_560_919 | 119 |
| 265 | 3300050512 | nmdc:mga0n895_80475_c1 | nmdc:mga0n895_80475_c1_2269_2628 | 119 |
| 266 | 3300050513 | nmdc:mga0rr50_580677_c1 | nmdc:mga0rr50_580677_c1_226_585 | 119 |
| 267 | 3300050514 | nmdc:mga08x19_300618_c1 | nmdc:mga08x19_300618_c1_70_429 | 119 |
| 268 | 3300059478 | Ga0587093_009736 | Ga0587093_009736_538_897 | 119 |
| 269 | 3300059490 | Ga0587066_023684 | Ga0587066_023684_202_561 | 119 |
| 270 | 3300059491 | Ga0587070_043143 | Ga0587070_043143_212_571 | 119 |
| 271 | 3300059493 | Ga0587077_021444 | Ga0587077_021444_435_794 | 119 |
| 272 | 3300059504 | Ga0587082_005480 | Ga0587082_005480_161_520 | 119 |
| 273 | 3300059505 | Ga0587083_0194940 | Ga0587083_0194940_149_508 | 119 |
| 274 | 3300059511 | Ga0587091_118317 | Ga0587091_118317_215_574 | 119 |
| 275 | 3300059605 | Ga0587106_107277 | Ga0587106_107277_169_528 | 119 |
| 276 | 3300059623 | Ga0587101_001201 | Ga0587101_001201_1518_1877 | 119 |
| 277 | 3300059627 | Ga0587117_005293 | Ga0587117_005293_240_599 | 119 |
| 278 | 3300059630 | Ga0587128_067460 | Ga0587128_067460_18_377 | 119 |
| 279 | 3300059641 | Ga0587068_030371 | Ga0587068_030371_301_660 | 119 |
| 280 | 3300059642 | Ga0587069_022689 | Ga0587069_022689_215_574 | 119 |
| 281 | 3300059643 | Ga0587072_105033 | Ga0587072_105033_68_427 | 119 |
| 282 | 3300059645 | Ga0587076_024310 | Ga0587076_024310_287_646 | 119 |
| 283 | 3300059646 | Ga0587078_002952 | Ga0587078_002952_189_548 | 119 |
| 284 | 3300059647 | Ga0587079_021532 | Ga0587079_021532_589_948 | 119 |
| 285 | 3300059647 | Ga0587079_029102 | Ga0587079_029102_524_883 | 119 |
| 286 | 3300059649 | Ga0587102_005950 | Ga0587102_005950_216_575 | 119 |
| 287 | 3300059649 | Ga0587102_010470 | Ga0587102_010470_176_535 | 119 |
| 288 | 3300059654 | Ga0587110_013564 | Ga0587110_013564_470_829 | 119 |
| 289 | 3300059660 | Ga0587124_001856 | Ga0587124_001856_190_549 | 119 |
| 290 | 3300060344 | Ga0587071_005959 | Ga0587071_005959_392_751 | 119 |
| 291 | 3300060346 | Ga0587111_0002620 | Ga0587111_0002620_948_1307 | 119 |
| 292 | 3300061719 | Ga0466962_0054164 | Ga0466962_0054164_30_389 | 119 |
| 293 | 3300005536 | Ga0070697_100998297 | Ga0070697_1009982971 | 120 |
| 294 | 3300025934 | Ga0207686_10184019 | Ga0207686_101840193 | 120 |
| 295 | 3300027614 | Ga0209970_1052658 | Ga0209970_10526582 | 120 |
| 296 | 3300032002 | Ga0307416_101553151 | Ga0307416_1015531512 | 120 |
| 297 | 3300032004 | Ga0307414_10194187 | Ga0307414_101941874 | 120 |
| 298 | 3300032004 | Ga0307414_10589631 | Ga0307414_105896311 | 120 |
| 299 | 3300032005 | Ga0307411_10823465 | Ga0307411_108234652 | 120 |
| 300 | 3300035398 | Ga0316574_0133130 | Ga0316574_0133130_1114_1476 | 120 |
| 301 | 3300035398 | Ga0316574_0714367 | Ga0316574_0714367_209_571 | 120 |
| 302 | 3300041460 | Ga0451802_1529159 | Ga0451802_1529159_40_402 | 120 |
| 303 | 3300042011 | Ga0439454_104898 | Ga0439454_104898_19_381 | 120 |
| 304 | 3300046694 | Ga0495649_0641169 | Ga0495649_0641169_103_468 | 120 |
| 305 | 3300048090 | Ga0495615_0129473 | Ga0495615_0129473_281_643 | 120 |
| 306 | 3300048917 | Ga0496114_0441592 | Ga0496114_0441592_89_451 | 120 |
| 307 | 3300049571 | Ga0501034_0312579 | Ga0501034_0312579_34_396 | 120 |
| 308 | 3300049572 | Ga0501036_0233657 | Ga0501036_0233657_273_635 | 120 |
| 309 | 3300049572 | Ga0501036_0762060 | Ga0501036_0762060_22_384 | 120 |
| 310 | 3300049576 | Ga0501040_0096981 | Ga0501040_0096981_1645_2007 | 120 |
| 311 | 3300049577 | Ga0501041_0053545 | Ga0501041_0053545_350_712 | 120 |
| 312 | 3300049577 | Ga0501041_0492239 | Ga0501041_0492239_292_654 | 120 |
| 313 | 3300049580 | Ga0501046_0506322 | Ga0501046_0506322_208_570 | 120 |
| 314 | 3300049582 | Ga0501048_0917625 | Ga0501048_0917625_192_554 | 120 |
| 315 | 3300049582 | Ga0501048_0936429 | Ga0501048_0936429_170_532 | 120 |
| 316 | 3300049584 | Ga0501068_0111786 | Ga0501068_0111786_438_800 | 120 |
| 317 | 3300049587 | Ga0501071_0778425 | Ga0501071_0778425_267_629 | 120 |
| 318 | 3300049588 | Ga0501072_0018484 | Ga0501072_0018484_362_724 | 120 |
| 319 | 3300049590 | Ga0501074_0397617 | Ga0501074_0397617_147_509 | 120 |
| 320 | 3300049591 | Ga0501075_0009440 | Ga0501075_0009440_3708_4070 | 120 |
| 321 | 3300049592 | Ga0501076_0031666 | Ga0501076_0031666_2862_3224 | 120 |
| 322 | 3300049593 | Ga0501077_0051808 | Ga0501077_0051808_2138_2500 | 120 |
| 323 | 3300049593 | Ga0501077_0695423 | Ga0501077_0695423_182_544 | 120 |
| 324 | 3300049741 | Ga0501079_0035825 | Ga0501079_0035825_956_1318 | 120 |
| 325 | 3300049742 | Ga0501080_0095691 | Ga0501080_0095691_311_673 | 120 |
| 326 | 3300049743 | Ga0501081_0102919 | Ga0501081_0102919_487_849 | 120 |
| 327 | 3300049743 | Ga0501081_0302654 | Ga0501081_0302654_600_962 | 120 |
| 328 | 3300049744 | Ga0501083_0117959 | Ga0501083_0117959_133_495 | 120 |
| 329 | 3300049824 | Ga0501045_0427606 | Ga0501045_0427606_540_902 | 120 |
| 330 | 3300050511 | nmdc:mga08y16_389652_c1 | nmdc:mga08y16_389652_c1_74_439 | 120 |
| 331 | 3300054114 | Ga0501084_0071839 | Ga0501084_0071839_2180_2542 | 120 |
| 332 | 3300060353 | Ga0501082_0731916 | Ga0501082_0731916_166_528 | 120 |
| 333 | 3300060353 | Ga0501082_0908268 | Ga0501082_0908268_260_622 | 120 |
| 334 | 3300003203 | JGI25406J46586_10051452 | JGI25406J46586_100514521 | 121 |
| 335 | 3300005262 | Ga0065165_1002628 | Ga0065165_100262812 | 121 |
| 336 | 3300005347 | Ga0070668_100000007 | Ga0070668_10000000763 | 121 |
| 337 | 3300005355 | Ga0070671_100000068 | Ga0070671_1000000684 | 121 |
| 338 | 3300005539 | Ga0068853_100014615 | Ga0068853_1000146155 | 121 |
| 339 | 3300005548 | Ga0070665_100010650 | Ga0070665_1000106509 | 121 |
| 340 | 3300005577 | Ga0068857_100067311 | Ga0068857_1000673112 | 121 |
| 341 | 3300005578 | Ga0068854_101528393 | Ga0068854_1015283931 | 121 |
| 342 | 3300005617 | Ga0068859_100020056 | Ga0068859_1000200563 | 121 |
| 343 | 3300005841 | Ga0068863_100000027 | Ga0068863_10000002765 | 121 |
| 344 | 3300005843 | Ga0068860_100162244 | Ga0068860_1001622442 | 121 |
| 345 | 3300005985 | Ga0081539_10014655 | Ga0081539_100146555 | 121 |
| 346 | 3300006353 | Ga0075370_10058862 | Ga0075370_100588623 | 121 |
| 347 | 3300006871 | Ga0075434_100092914 | Ga0075434_1000929143 | 121 |
| 348 | 3300006931 | Ga0097620_100020056 | Ga0097620_1000200564 | 121 |
| 349 | 3300009177 | Ga0105248_10428943 | Ga0105248_104289432 | 121 |
| 350 | 3300009545 | Ga0105237_10097989 | Ga0105237_100979893 | 121 |
| 351 | 3300009551 | Ga0105238_10371070 | Ga0105238_103710702 | 121 |
| 352 | 3300009553 | Ga0105249_10037179 | Ga0105249_100371791 | 121 |
| 353 | 3300010375 | Ga0105239_11049457 | Ga0105239_110494572 | 121 |
| 354 | 3300013105 | Ga0157369_10468984 | Ga0157369_104689841 | 121 |
| 355 | 3300013105 | Ga0157369_10534193 | Ga0157369_105341933 | 121 |
| 356 | 3300013307 | Ga0157372_11345490 | Ga0157372_113454902 | 121 |
| 357 | 3300021384 | Ga0213876_10017463 | Ga0213876_100174634 | 121 |
| 358 | 3300025914 | Ga0207671_10008208 | Ga0207671_100082088 | 121 |
| 359 | 3300025923 | Ga0207681_11591423 | Ga0207681_115914231 | 121 |
| 360 | 3300025925 | Ga0207650_10233607 | Ga0207650_102336072 | 121 |
| 361 | 3300025931 | Ga0207644_10000111 | Ga0207644_1000011121 | 121 |
| 362 | 3300025941 | Ga0207711_10925870 | Ga0207711_109258702 | 121 |
| 363 | 3300025961 | Ga0207712_10326356 | Ga0207712_103263561 | 121 |
| 364 | 3300025972 | Ga0207668_10000054 | Ga0207668_1000005437 | 121 |
| 365 | 3300026041 | Ga0207639_10110566 | Ga0207639_101105662 | 121 |
| 366 | 3300026088 | Ga0207641_10000045 | Ga0207641_10000045111 | 121 |
| 367 | 3300026116 | Ga0207674_10082281 | Ga0207674_100822811 | 121 |
| 368 | 3300028379 | Ga0268266_10021401 | Ga0268266_100214015 | 121 |
| 369 | 3300028381 | Ga0268264_10001183 | Ga0268264_1000118323 | 121 |
| 370 | 3300031911 | Ga0307412_10000104 | Ga0307412_1000010418 | 121 |
| 371 | 3300035111 | Ga0373923_0068125 | Ga0373923_0068125_805_1170 | 121 |
| 372 | 3300038705 | Ga0237819_00270 | Ga0237819_00270_3276_3641 | 121 |
| 373 | 3300039437 | Ga0436365_0754658 | Ga0436365_0754658_253_618 | 121 |
| 374 | 3300039437 | Ga0436365_1506208 | Ga0436365_1506208_3178_3543 | 121 |
| 375 | 3300041505 | Ga0451849_0748450 | Ga0451849_0748450_28_393 | 121 |
| 376 | 3300048919 | Ga0496116_0309622 | Ga0496116_0309622_318_683 | 121 |
| 377 | 3300048923 | Ga0496120_0233957 | Ga0496120_0233957_152_517 | 121 |
| 378 | 3300048925 | Ga0496122_0317192 | Ga0496122_0317192_229_594 | 121 |
| 379 | 3300048926 | Ga0496123_0017741 | Ga0496123_0017741_4499_4864 | 121 |
| 380 | 3300048926 | Ga0496123_0303744 | Ga0496123_0303744_171_536 | 121 |
| 381 | 3300048927 | Ga0496124_0005643 | Ga0496124_0005643_12032_12397 | 121 |
| 382 | 3300048927 | Ga0496124_0006985 | Ga0496124_0006985_1630_1995 | 121 |
| 383 | 3300048928 | Ga0496125_0193334 | Ga0496125_0193334_691_1056 | 121 |
| 384 | 3300048929 | Ga0496126_0032343 | Ga0496126_0032343_769_1134 | 121 |
| 385 | 3300049581 | Ga0501047_0138116 | Ga0501047_0138116_1662_2027 | 121 |
| 386 | 3300049822 | Ga0501035_0987476 | Ga0501035_0987476_288_653 | 121 |
| 387 | 3300050496 | nmdc:mga07m45_22808_c1 | nmdc:mga07m45_22808_c1_1994_2359 | 121 |
| 388 | 3300050512 | nmdc:mga0n895_83320_c1 | nmdc:mga0n895_83320_c1_551_916 | 121 |
| 389 | 3300053087 | Ga0500643_002853 | Ga0500643_002853_8003_8368 | 121 |
| 390 | 3300053087 | Ga0500643_032102 | Ga0500643_032102_766_1131 | 121 |
| 391 | 3300001989 | JGI24739J22299_10001505 | JGI24739J22299_100015057 | 122 |
| 392 | 3300001990 | JGI24737J22298_10001228 | JGI24737J22298_100012287 | 122 |
| 393 | 3300002067 | JGI24735J21928_10020058 | JGI24735J21928_100200583 | 122 |
| 394 | 3300002075 | JGI24738J21930_10007469 | JGI24738J21930_100074692 | 122 |
| 395 | 3300005327 | Ga0070658_10000177 | Ga0070658_1000017755 | 122 |
| 396 | 3300005327 | Ga0070658_10257732 | Ga0070658_102577321 | 122 |
| 397 | 3300005329 | Ga0070683_100001495 | Ga0070683_1000014959 | 122 |
| 398 | 3300005335 | Ga0070666_10002272 | Ga0070666_100022726 | 122 |
| 399 | 3300005337 | Ga0070682_100605758 | Ga0070682_1006057582 | 122 |
| 400 | 3300005339 | Ga0070660_100000065 | Ga0070660_10000006554 | 122 |
| 401 | 3300005344 | Ga0070661_100000084 | Ga0070661_10000008436 | 122 |
| 402 | 3300005355 | Ga0070671_100002759 | Ga0070671_1000027592 | 122 |
| 403 | 3300005355 | Ga0070671_100729436 | Ga0070671_1007294361 | 122 |
| 404 | 3300005364 | Ga0070673_100362563 | Ga0070673_1003625632 | 122 |
| 405 | 3300005364 | Ga0070673_101933801 | Ga0070673_1019338011 | 122 |
| 406 | 3300005366 | Ga0070659_100000067 | Ga0070659_10000006772 | 122 |
| 407 | 3300005367 | Ga0070667_100135390 | Ga0070667_1001353904 | 122 |
| 408 | 3300005367 | Ga0070667_100967785 | Ga0070667_1009677852 | 122 |
| 409 | 3300005455 | Ga0070663_100000149 | Ga0070663_10000014912 | 122 |
| 410 | 3300005455 | Ga0070663_100056593 | Ga0070663_1000565934 | 122 |
| 411 | 3300005457 | Ga0070662_100000017 | Ga0070662_10000001739 | 122 |
| 412 | 3300005466 | Ga0070685_11287305 | Ga0070685_112873051 | 122 |
| 413 | 3300005530 | Ga0070679_100745160 | Ga0070679_1007451601 | 122 |
| 414 | 3300005535 | Ga0070684_100053830 | Ga0070684_1000538305 | 122 |
| 415 | 3300005539 | Ga0068853_100000784 | Ga0068853_10000078418 | 122 |
| 416 | 3300005547 | Ga0070693_100001717 | Ga0070693_1000017174 | 122 |
| 417 | 3300005547 | Ga0070693_100157034 | Ga0070693_1001570343 | 122 |
| 418 | 3300005548 | Ga0070665_100045641 | Ga0070665_1000456414 | 122 |
| 419 | 3300005563 | Ga0068855_100000194 | Ga0068855_10000019483 | 122 |
| 420 | 3300005564 | Ga0070664_100000098 | Ga0070664_10000009854 | 122 |
| 421 | 3300005578 | Ga0068854_100724549 | Ga0068854_1007245492 | 122 |
| 422 | 3300005614 | Ga0068856_100000098 | Ga0068856_10000009837 | 122 |
| 423 | 3300005614 | Ga0068856_101378873 | Ga0068856_1013788731 | 122 |
| 424 | 3300005616 | Ga0068852_100028855 | Ga0068852_1000288556 | 122 |
| 425 | 3300005616 | Ga0068852_101474771 | Ga0068852_1014747712 | 122 |
| 426 | 3300005617 | Ga0068859_101251150 | Ga0068859_1012511501 | 122 |
| 427 | 3300005618 | Ga0068864_100057029 | Ga0068864_1000570295 | 122 |
| 428 | 3300005719 | Ga0068861_100608619 | Ga0068861_1006086192 | 122 |
| 429 | 3300005834 | Ga0068851_10244100 | Ga0068851_102441002 | 122 |
| 430 | 3300005841 | Ga0068863_100821485 | Ga0068863_1008214852 | 122 |
| 431 | 3300005842 | Ga0068858_100007312 | Ga0068858_1000073125 | 122 |
| 432 | 3300005843 | Ga0068860_101238833 | Ga0068860_1012388332 | 122 |
| 433 | 3300006175 | Ga0070712_100010353 | Ga0070712_1000103533 | 122 |
| 434 | 3300006237 | Ga0097621_100129378 | Ga0097621_1001293785 | 122 |
| 435 | 3300006931 | Ga0097620_101251181 | Ga0097620_1012511811 | 122 |
| 436 | 3300009174 | Ga0105241_10042711 | Ga0105241_100427112 | 122 |
| 437 | 3300009177 | Ga0105248_10000444 | Ga0105248_1000044433 | 122 |
| 438 | 3300009551 | Ga0105238_10152367 | Ga0105238_101523672 | 122 |
| 439 | 3300012480 | Ga0157346_1005557 | Ga0157346_10055572 | 122 |
| 440 | 3300012510 | Ga0157316_1036661 | Ga0157316_10366612 | 122 |
| 441 | 3300013100 | Ga0157373_10557478 | Ga0157373_105574782 | 122 |
| 442 | 3300013102 | Ga0157371_10008677 | Ga0157371_100086772 | 122 |
| 443 | 3300013296 | Ga0157374_10297119 | Ga0157374_102971192 | 122 |
| 444 | 3300013296 | Ga0157374_11285940 | Ga0157374_112859402 | 122 |
| 445 | 3300014325 | Ga0163163_10000169 | Ga0163163_1000016938 | 122 |
| 446 | 3300014325 | Ga0163163_11841664 | Ga0163163_118416641 | 122 |
| 447 | 3300014497 | Ga0182008_10193538 | Ga0182008_101935382 | 122 |
| 448 | 3300014968 | Ga0157379_10227355 | Ga0157379_102273553 | 122 |
| 449 | 3300020610 | Ga0154015_1329609 | Ga0154015_13296091 | 122 |
| 450 | 3300025907 | Ga0207645_10026414 | Ga0207645_100264142 | 122 |
| 451 | 3300025909 | Ga0207705_10000137 | Ga0207705_1000013770 | 122 |
| 452 | 3300025909 | Ga0207705_10253149 | Ga0207705_102531491 | 122 |
| 453 | 3300025915 | Ga0207693_10024195 | Ga0207693_100241955 | 122 |
| 454 | 3300025917 | Ga0207660_10081523 | Ga0207660_100815232 | 122 |
| 455 | 3300025919 | Ga0207657_10000569 | Ga0207657_1000056911 | 122 |
| 456 | 3300025919 | Ga0207657_10534748 | Ga0207657_105347482 | 122 |
| 457 | 3300025920 | Ga0207649_10002487 | Ga0207649_1000248712 | 122 |
| 458 | 3300025924 | Ga0207694_10082187 | Ga0207694_100821872 | 122 |
| 459 | 3300025931 | Ga0207644_10112704 | Ga0207644_101127042 | 122 |
| 460 | 3300025931 | Ga0207644_10205084 | Ga0207644_102050842 | 122 |
| 461 | 3300025932 | Ga0207690_10000108 | Ga0207690_1000010841 | 122 |
| 462 | 3300025933 | Ga0207706_10000571 | Ga0207706_1000057111 | 122 |
| 463 | 3300025933 | Ga0207706_10027711 | Ga0207706_100277115 | 122 |
| 464 | 3300025941 | Ga0207711_10001099 | Ga0207711_1000109924 | 122 |
| 465 | 3300025944 | Ga0207661_10048903 | Ga0207661_100489035 | 122 |
| 466 | 3300025945 | Ga0207679_10000191 | Ga0207679_100001915 | 122 |
| 467 | 3300025949 | Ga0207667_10001635 | Ga0207667_1000163530 | 122 |
| 468 | 3300025949 | Ga0207667_11067096 | Ga0207667_110670961 | 122 |
| 469 | 3300025960 | Ga0207651_10269249 | Ga0207651_102692492 | 122 |
| 470 | 3300025981 | Ga0207640_10996013 | Ga0207640_109960131 | 122 |
| 471 | 3300025981 | Ga0207640_11102655 | Ga0207640_111026552 | 122 |
| 472 | 3300026035 | Ga0207703_10005107 | Ga0207703_100051079 | 122 |
| 473 | 3300026041 | Ga0207639_10004731 | Ga0207639_100047314 | 122 |
| 474 | 3300026067 | Ga0207678_10001788 | Ga0207678_1000178811 | 122 |
| 475 | 3300026067 | Ga0207678_10040341 | Ga0207678_100403412 | 122 |
| 476 | 3300026078 | Ga0207702_10005964 | Ga0207702_100059648 | 122 |
| 477 | 3300026088 | Ga0207641_10227800 | Ga0207641_102278002 | 122 |
| 478 | 3300026142 | Ga0207698_10003214 | Ga0207698_100032143 | 122 |
| 479 | 3300028379 | Ga0268266_10060472 | Ga0268266_100604724 | 122 |
| 480 | 3300028381 | Ga0268264_12133131 | Ga0268264_121331311 | 122 |
| 481 | 3300031548 | Ga0307408_100047713 | Ga0307408_1000477132 | 122 |
| 482 | 3300031548 | Ga0307408_100334146 | Ga0307408_1003341462 | 122 |
| 483 | 3300031548 | Ga0307408_101847095 | Ga0307408_1018470952 | 122 |
| 484 | 3300031727 | Ga0316576_10602122 | Ga0316576_106021222 | 122 |
| 485 | 3300031728 | Ga0316578_10879557 | Ga0316578_108795571 | 122 |
| 486 | 3300031731 | Ga0307405_10079596 | Ga0307405_100795962 | 122 |
| 487 | 3300031731 | Ga0307405_10253111 | Ga0307405_102531112 | 122 |
| 488 | 3300031824 | Ga0307413_10038061 | Ga0307413_100380615 | 122 |
| 489 | 3300031824 | Ga0307413_11455665 | Ga0307413_114556651 | 122 |
| 490 | 3300031852 | Ga0307410_10244746 | Ga0307410_102447462 | 122 |
| 491 | 3300031852 | Ga0307410_10557236 | Ga0307410_105572362 | 122 |
| 492 | 3300031852 | Ga0307410_11168083 | Ga0307410_111680831 | 122 |
| 493 | 3300031901 | Ga0307406_10211989 | Ga0307406_102119892 | 122 |
| 494 | 3300031903 | Ga0307407_10170296 | Ga0307407_101702962 | 122 |
| 495 | 3300031903 | Ga0307407_10506792 | Ga0307407_105067922 | 122 |
| 496 | 3300031911 | Ga0307412_10115288 | Ga0307412_101152882 | 122 |
| 497 | 3300031911 | Ga0307412_10408549 | Ga0307412_104085492 | 122 |
| 498 | 3300031995 | Ga0307409_100280582 | Ga0307409_1002805822 | 122 |
| 499 | 3300031995 | Ga0307409_100830468 | Ga0307409_1008304682 | 122 |
| 500 | 3300032002 | Ga0307416_100525221 | Ga0307416_1005252212 | 122 |
| 501 | 3300032002 | Ga0307416_100618807 | Ga0307416_1006188072 | 122 |
| 502 | 3300032004 | Ga0307414_10310798 | Ga0307414_103107982 | 122 |
| 503 | 3300032004 | Ga0307414_10517435 | Ga0307414_105174352 | 122 |
| 504 | 3300032005 | Ga0307411_10026047 | Ga0307411_100260474 | 122 |
| 505 | 3300032005 | Ga0307411_10297036 | Ga0307411_102970362 | 122 |
| 506 | 3300032126 | Ga0307415_100012981 | Ga0307415_1000129816 | 122 |
| 507 | 3300032126 | Ga0307415_100033012 | Ga0307415_1000330125 | 122 |
| 508 | 3300034816 | Ga0373930_0079067 | Ga0373930_0079067_282_650 | 122 |
| 509 | 3300035092 | Ga0373952_0069674 | Ga0373952_0069674_108_476 | 122 |
| 510 | 3300035112 | Ga0373932_0101173 | Ga0373932_0101173_233_601 | 122 |
| 511 | 3300035207 | Ga0373942_0110672 | Ga0373942_0110672_207_575 | 122 |
| 512 | 3300035241 | Ga0373961_0225226 | Ga0373961_0225226_27_395 | 122 |
| 513 | 3300035691 | Ga0373931_0006745 | Ga0373931_0006745_4821_5189 | 122 |
| 514 | 3300037471 | Ga0395905_0017633 | Ga0395905_0017633_2191_2568 | 122 |
| 515 | 3300037471 | Ga0395905_1454681 | Ga0395905_1454681_78_455 | 122 |
| 516 | 3300038443 | Ga0395901_0229964 | Ga0395901_0229964_1476_1853 | 122 |
| 517 | 3300038443 | Ga0395901_0524470 | Ga0395901_0524470_28_405 | 122 |
| 518 | 3300039437 | Ga0436365_0363342 | Ga0436365_0363342_799_1212 | 122 |
| 519 | 3300042436 | Ga0439435_0019976 | Ga0439435_0019976_727_1131 | 122 |
| 520 | 3300042439 | Ga0439464_0101505 | Ga0439464_0101505_67_471 | 122 |
| 521 | 3300044706 | Ga0466964_0087902 | Ga0466964_0087902_335_703 | 122 |
| 522 | 3300044842 | Ga0466957_0019667 | Ga0466957_0019667_2040_2408 | 122 |
| 523 | 3300048908 | Ga0496105_0513428 | Ga0496105_0513428_408_776 | 122 |
| 524 | 3300048912 | Ga0496109_1511433 | Ga0496109_1511433_102_470 | 122 |
| 525 | 3300048917 | Ga0496114_1529666 | Ga0496114_1529666_103_471 | 122 |
| 526 | 3300049571 | Ga0501034_0248954 | Ga0501034_0248954_608_1021 | 122 |
| 527 | 3300049574 | Ga0501038_0192764 | Ga0501038_0192764_112_525 | 122 |
| 528 | 3300049581 | Ga0501047_0363263 | Ga0501047_0363263_131_544 | 122 |
| 529 | 3300049586 | Ga0501070_0088988 | Ga0501070_0088988_1417_1830 | 122 |
| 530 | 3300049589 | Ga0501073_0089700 | Ga0501073_0089700_1473_1886 | 122 |
| 531 | 3300049590 | Ga0501074_0141020 | Ga0501074_0141020_258_671 | 122 |
| 532 | 3300049652 | Ga0501202_112769 | Ga0501202_112769_107_487 | 122 |
| 533 | 3300049675 | Ga0501243_050530 | Ga0501243_050530_130_510 | 122 |
| 534 | 3300049677 | Ga0501247_030541 | Ga0501247_030541_106_486 | 122 |
| 535 | 3300049741 | Ga0501079_0764523 | Ga0501079_0764523_335_748 | 122 |
| 536 | 3300049742 | Ga0501080_0242068 | Ga0501080_0242068_927_1340 | 122 |
| 537 | 3300049758 | Ga0501241_132876 | Ga0501241_132876_89_469 | 122 |
| 538 | 3300049765 | Ga0501268_009889 | Ga0501268_009889_486_866 | 122 |
| 539 | 3300049823 | Ga0501044_0048649 | Ga0501044_0048649_1968_2381 | 122 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1gyz-assembly1.cif.gz_A | bacterial ribosomal protein l20 from aquifex aeolicus | 0.9088 | 61 | 117 |
| 8apo-assembly1.cif.gz_Ao | structure of the mitochondrial ribosome from polytomella magna with trnas bound to the a and p sites | 0.8847 | 14 | 113 |
| 6z1p-assembly1.cif.gz_Au | structure of the mitochondrial ribosome from tetrahymena thermophila | 0.8829 | 15 | 118 |
| 7pkt-assembly1.cif.gz_o | large subunit of the chlamydomonas reinhardtii mitoribosome | 0.8801 | 14 | 114 |
| 4v48-assembly1.cif.gz_AO | real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the initiation-like state of e. coli 70s ribosome | 0.8617 | 51 | 116 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2ghjD02 | Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain | 0.9749 | 53 | 117 | 1.10.1900.20 |
| 2ghjB02 | Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain | 0.9175 | 58 | 118 | 1.10.1900.20 |
| 1gyzA00 | Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain | 0.9088 | 61 | 117 | 1.10.1900.20 |
| 2ghjD02 | Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain | 0.9058 | 53 | 117 | 1.10.1900.20 |
| 1gyzA00 | Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain | 0.8542 | 61 | 117 | 1.10.1900.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2N8FNS0-F1-model_v4 | deleted | 1.004 | 55 | 116 |
|
| AF-A0A7Z9XIZ9-F1-model_v4 | Large ribosomal subunit protein bL20 (50S ribosomal protein L20) | 0.9995 | 53 | 117 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A432PU90-F1-model_v4 | Large ribosomal subunit protein bL20 (50S ribosomal protein L20) | 0.9991 | 56 | 118 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A357L7L9-F1-model_v4 | Large ribosomal subunit protein bL20 (50S ribosomal protein L20) | 0.9946 | 61 | 118 |
GO:0003735
GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A7Y6I0T2-F1-model_v4 | deleted | 0.9941 | 54 | 116 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar