F460264
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 532 | 305 | 532 | 186 |
Family's Representative Sequence
| Representative Sequence | 3300009553|Ga0105249_10498601|Ga0105249_104986012 |
| Length | 212 |
| Sequence | MSNSSVVVRLDHETWRSQMRKVHVFDNVSLDGYFTDAKNDMSWAHRQDEEWNAFAGGNASGDGELLFGRVTYEMMAAFWPTPQAAAMLPQVAAGMNRMRKSVFSRTLDSVSWQNTTLVKGDLVAEVEKMKRRPGPDLVIIGSGSIVSQLTEAGLIDEYQIVVNPLVLGKGRTLFETVQRKVGLTLTKTRAFKNGNVVLWYERASPRRGVDDA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886006 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 6 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 45 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 55 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 57 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 58 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 59 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 60 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 61 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 62 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 63 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 64 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 65 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 66 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 68 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 69 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 70 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 71 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 72 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 73 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 74 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 75 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 76 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 78 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 79 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 80 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 81 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 82 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 83 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 84 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 85 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 86 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 88 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 89 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 114 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 115 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 160 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 161 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 162 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 163 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 164 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 165 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 166 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 167 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 168 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 169 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 170 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 171 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 172 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 173 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 174 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 175 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 176 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 177 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 178 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 179 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 180 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 181 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 182 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 183 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 184 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 185 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 186 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 187 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 188 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 189 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 190 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 191 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 192 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 193 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 194 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 195 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 196 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 197 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 198 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 199 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 200 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 201 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 202 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 203 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 204 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 205 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 239 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 240 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 241 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 242 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 243 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 244 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 245 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 246 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 247 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 248 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 249 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 250 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 251 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 255 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 269 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 270 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 271 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 272 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 273 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 274 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 275 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 276 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 277 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 278 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 279 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 284 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 285 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 286 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 287 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 288 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 289 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 290 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 291 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 292 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 304 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 305 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.45 |
| Nodule | 0 |
| Rhizoplane | 1.32 |
| Rhizosphere | 90.23 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.01 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL3b_contig_3264281 | 2162886006 | Bacteria | 1661 |
| 2 | SwRhRL2b_contig_3588356 | 2162886007 | Bacteria | 998 |
| 3 | MBSR1b_contig_4902641 | 2162886012 | Bacteria | 1190 |
| 4 | MBSR1b_contig_5893965 | 2162886012 | Bacteria | 1162 |
| 5 | JGI24735J21928_10023417 | 3300002067 | Unclassified | 1873 |
| 6 | rootH1_10151850 | 3300003323 | Bacteria | 6623 |
| 7 | rootH1_10154437 | 3300003323 | Bacteria | 2551 |
| 8 | Ga0065712_10153151 | 3300005290 | Unclassified | 1354 |
| 9 | Ga0065715_10032149 | 3300005293 | Bacteria | 1716 |
| 10 | Ga0065715_10382309 | 3300005293 | Bacteria | 905 |
| 11 | Ga0065707_10092599 | 3300005295 | Unclassified | 3746 |
| 12 | Ga0065707_10121915 | 3300005295 | Bacteria | 2089 |
| 13 | Ga0065707_10305419 | 3300005295 | Bacteria | 995 |
| 14 | Ga0070658_10003308 | 3300005327 | Bacteria | 13297 |
| 15 | Ga0070658_10348609 | 3300005327 | Bacteria | 1267 |
| 16 | Ga0070683_100001155 | 3300005329 | Bacteria | 19993 |
| 17 | Ga0070683_100150815 | 3300005329 | Unclassified | 2204 |
| 18 | Ga0070683_100964488 | 3300005329 | Bacteria | 818 |
| 19 | Ga0070690_100360374 | 3300005330 | Bacteria | 1058 |
| 20 | Ga0070670_100304818 | 3300005331 | Bacteria | 1394 |
| 21 | Ga0068869_100316898 | 3300005334 | Unclassified | 1264 |
| 22 | Ga0070666_10077245 | 3300005335 | Bacteria | 2273 |
| 23 | Ga0070680_100025304 | 3300005336 | Unclassified | 4743 |
| 24 | Ga0070682_100013753 | 3300005337 | Unclassified | 4665 |
| 25 | Ga0068868_100902566 | 3300005338 | Unclassified | 803 |
| 26 | Ga0070660_100112134 | 3300005339 | Bacteria | 2171 |
| 27 | Ga0070689_100043820 | 3300005340 | Bacteria | 3441 |
| 28 | Ga0070661_100539050 | 3300005344 | Bacteria | 938 |
| 29 | Ga0070661_100610960 | 3300005344 | Unclassified | 882 |
| 30 | Ga0070661_100819941 | 3300005344 | Bacteria | 764 |
| 31 | Ga0070675_100296169 | 3300005354 | Bacteria | 1424 |
| 32 | Ga0070671_100229860 | 3300005355 | Bacteria | 1574 |
| 33 | Ga0070671_100313761 | 3300005355 | Bacteria | 1336 |
| 34 | Ga0070673_100004663 | 3300005364 | Bacteria | 8702 |
| 35 | Ga0070673_100441432 | 3300005364 | Bacteria | 1169 |
| 36 | Ga0070688_100008261 | 3300005365 | Bacteria | 5643 |
| 37 | Ga0070688_100420456 | 3300005365 | Bacteria | 993 |
| 38 | Ga0070667_100126902 | 3300005367 | Bacteria | 2224 |
| 39 | Ga0070667_100391371 | 3300005367 | Bacteria | 1264 |
| 40 | Ga0070709_10004567 | 3300005434 | Bacteria | 7476 |
| 41 | Ga0070714_100004779 | 3300005435 | Bacteria | 10264 |
| 42 | Ga0070714_100578636 | 3300005435 | Bacteria | 1077 |
| 43 | Ga0070713_100000888 | 3300005436 | Bacteria | 19171 |
| 44 | Ga0070701_10287637 | 3300005438 | Bacteria | 1006 |
| 45 | Ga0070701_10320998 | 3300005438 | Unclassified | 958 |
| 46 | Ga0070711_100000613 | 3300005439 | Bacteria | 18618 |
| 47 | Ga0070711_100103827 | 3300005439 | Bacteria | 2072 |
| 48 | Ga0070705_100030803 | 3300005440 | Bacteria | 2965 |
| 49 | Ga0070705_100033531 | 3300005440 | Bacteria | 2863 |
| 50 | Ga0070705_101234541 | 3300005440 | Unclassified | 617 |
| 51 | Ga0070700_100000215 | 3300005441 | Bacteria | 32331 |
| 52 | Ga0070694_100244512 | 3300005444 | Bacteria | 1355 |
| 53 | Ga0070708_100014475 | 3300005445 | Bacteria | 6491 |
| 54 | Ga0070708_100017244 | 3300005445 | Bacteria | 6016 |
| 55 | Ga0070708_100060060 | 3300005445 | Bacteria | 3392 |
| 56 | Ga0070708_100528251 | 3300005445 | Unclassified | 1113 |
| 57 | Ga0070708_100704760 | 3300005445 | Bacteria | 950 |
| 58 | Ga0070708_100876691 | 3300005445 | Unclassified | 843 |
| 59 | Ga0070681_10312779 | 3300005458 | Bacteria | 1480 |
| 60 | Ga0070685_10006672 | 3300005466 | Bacteria | 5893 |
| 61 | Ga0070706_100001047 | 3300005467 | Bacteria | 30011 |
| 62 | Ga0070706_100140078 | 3300005467 | Unclassified | 2258 |
| 63 | Ga0070706_100401463 | 3300005467 | Bacteria | 1276 |
| 64 | Ga0070707_100006636 | 3300005468 | Bacteria | 10730 |
| 65 | Ga0070707_100375095 | 3300005468 | Bacteria | 1382 |
| 66 | Ga0070698_100000010 | 3300005471 | Bacteria | 117353 |
| 67 | Ga0070698_100000531 | 3300005471 | Bacteria | 40650 |
| 68 | Ga0070698_100021945 | 3300005471 | Bacteria | 6684 |
| 69 | Ga0070698_100035737 | 3300005471 | Bacteria | 5135 |
| 70 | Ga0070698_100251670 | 3300005471 | Bacteria | 1699 |
| 71 | Ga0070698_100283485 | 3300005471 | Unclassified | 1588 |
| 72 | Ga0070698_100643720 | 3300005471 | Bacteria | 1001 |
| 73 | Ga0070699_100003720 | 3300005518 | Bacteria | 13482 |
| 74 | Ga0070699_100004158 | 3300005518 | Bacteria | 12792 |
| 75 | Ga0070699_100074587 | 3300005518 | Bacteria | 2952 |
| 76 | Ga0070699_100093275 | 3300005518 | Bacteria | 2634 |
| 77 | Ga0070699_100460663 | 3300005518 | Bacteria | 1153 |
| 78 | Ga0070699_100510744 | 3300005518 | Bacteria | 1092 |
| 79 | Ga0070679_100037531 | 3300005530 | Bacteria | 4814 |
| 80 | Ga0070679_100053696 | 3300005530 | Unclassified | 4011 |
| 81 | Ga0070679_100204752 | 3300005530 | Bacteria | 1938 |
| 82 | Ga0070679_100226404 | 3300005530 | Bacteria | 1830 |
| 83 | Ga0070684_100226566 | 3300005535 | Bacteria | 1706 |
| 84 | Ga0070684_100402541 | 3300005535 | Unclassified | 1262 |
| 85 | Ga0070684_101235926 | 3300005535 | Bacteria | 703 |
| 86 | Ga0070697_101067065 | 3300005536 | Unclassified | 719 |
| 87 | Ga0068853_100068238 | 3300005539 | Bacteria | 3091 |
| 88 | Ga0068853_100553694 | 3300005539 | Bacteria | 1090 |
| 89 | Ga0070672_100226053 | 3300005543 | Bacteria | 1571 |
| 90 | Ga0070672_100783595 | 3300005543 | Unclassified | 838 |
| 91 | Ga0070686_100056717 | 3300005544 | Bacteria | 2513 |
| 92 | Ga0070695_100285552 | 3300005545 | Unclassified | 1214 |
| 93 | Ga0070696_100013343 | 3300005546 | Bacteria | 5513 |
| 94 | Ga0070696_100740788 | 3300005546 | Unclassified | 804 |
| 95 | Ga0070693_100183325 | 3300005547 | Bacteria | 1349 |
| 96 | Ga0070693_100183382 | 3300005547 | Bacteria | 1349 |
| 97 | Ga0070693_100300506 | 3300005547 | Bacteria | 1082 |
| 98 | Ga0070665_100021880 | 3300005548 | Bacteria | 6431 |
| 99 | Ga0070665_100047801 | 3300005548 | Bacteria | 4294 |
| 100 | Ga0070665_100100503 | 3300005548 | Bacteria | 2896 |
| 101 | Ga0070665_100312664 | 3300005548 | Bacteria | 1575 |
| 102 | Ga0070665_100839814 | 3300005548 | Bacteria | 932 |
| 103 | Ga0070704_100000386 | 3300005549 | Bacteria | 20145 |
| 104 | Ga0070704_100056073 | 3300005549 | Bacteria | 2797 |
| 105 | Ga0070704_100743122 | 3300005549 | Bacteria | 873 |
| 106 | Ga0070704_101314828 | 3300005549 | Unclassified | 662 |
| 107 | Ga0068855_100134458 | 3300005563 | Bacteria | 2821 |
| 108 | Ga0068855_100409189 | 3300005563 | Bacteria | 1485 |
| 109 | Ga0070664_100118589 | 3300005564 | Bacteria | 2315 |
| 110 | Ga0070664_100411668 | 3300005564 | Bacteria | 1237 |
| 111 | Ga0070664_101478843 | 3300005564 | Unclassified | 643 |
| 112 | Ga0068856_100130276 | 3300005614 | Bacteria | 2520 |
| 113 | Ga0068856_100186576 | 3300005614 | Bacteria | 2088 |
| 114 | Ga0070702_100456099 | 3300005615 | Bacteria | 928 |
| 115 | Ga0070702_100662394 | 3300005615 | Bacteria | 791 |
| 116 | Ga0068852_100359833 | 3300005616 | Unclassified | 1423 |
| 117 | Ga0068852_100442241 | 3300005616 | Bacteria | 1286 |
| 118 | Ga0068852_100903948 | 3300005616 | Bacteria | 900 |
| 119 | Ga0068859_100383151 | 3300005617 | Bacteria | 1501 |
| 120 | Ga0068864_100017929 | 3300005618 | Bacteria | 5906 |
| 121 | Ga0068861_100040505 | 3300005719 | Bacteria | 3485 |
| 122 | Ga0068851_10041190 | 3300005834 | Bacteria | 2322 |
| 123 | Ga0068863_100089907 | 3300005841 | Bacteria | 2912 |
| 124 | Ga0068863_100966132 | 3300005841 | Bacteria | 854 |
| 125 | Ga0068858_100796122 | 3300005842 | Bacteria | 922 |
| 126 | Ga0068858_101267145 | 3300005842 | Unclassified | 725 |
| 127 | Ga0068860_100054096 | 3300005843 | Bacteria | 3816 |
| 128 | Ga0068860_100520276 | 3300005843 | Unclassified | 1190 |
| 129 | Ga0068862_100150821 | 3300005844 | Bacteria | 2069 |
| 130 | Ga0068862_100526708 | 3300005844 | Bacteria | 1125 |
| 131 | Ga0081455_10145659 | 3300005937 | Bacteria | 1833 |
| 132 | Ga0070717_10148098 | 3300006028 | Bacteria | 2029 |
| 133 | Ga0075365_10005358 | 3300006038 | Bacteria | 6911 |
| 134 | Ga0075365_10448745 | 3300006038 | Bacteria | 911 |
| 135 | Ga0075368_10018728 | 3300006042 | Bacteria | 2605 |
| 136 | Ga0075363_100149199 | 3300006048 | Bacteria | 1319 |
| 137 | Ga0075364_10009806 | 3300006051 | Bacteria | 5759 |
| 138 | Ga0075364_10149987 | 3300006051 | Bacteria | 1571 |
| 139 | Ga0070716_100000911 | 3300006173 | Bacteria | 12772 |
| 140 | Ga0070716_100630526 | 3300006173 | Bacteria | 810 |
| 141 | Ga0070712_100000065 | 3300006175 | Bacteria | 53344 |
| 142 | Ga0070712_100009069 | 3300006175 | Bacteria | 6264 |
| 143 | Ga0075362_10163960 | 3300006177 | Bacteria | 1071 |
| 144 | Ga0075367_10040194 | 3300006178 | Bacteria | 2730 |
| 145 | Ga0075367_10041329 | 3300006178 | Unclassified | 2695 |
| 146 | Ga0075367_10122875 | 3300006178 | Bacteria | 1600 |
| 147 | Ga0075367_10202439 | 3300006178 | Bacteria | 1240 |
| 148 | Ga0075366_10036564 | 3300006195 | Bacteria | 2895 |
| 149 | Ga0075366_10141629 | 3300006195 | Bacteria | 1454 |
| 150 | Ga0097621_100095098 | 3300006237 | Bacteria | 2498 |
| 151 | Ga0097621_100232488 | 3300006237 | Bacteria | 1610 |
| 152 | Ga0075370_10004635 | 3300006353 | Bacteria | 6710 |
| 153 | Ga0075370_10056087 | 3300006353 | Bacteria | 2238 |
| 154 | Ga0075370_10094668 | 3300006353 | Unclassified | 1725 |
| 155 | Ga0075370_10282682 | 3300006353 | Bacteria | 986 |
| 156 | Ga0068871_100135177 | 3300006358 | Bacteria | 2094 |
| 157 | Ga0068871_100170481 | 3300006358 | Bacteria | 1865 |
| 158 | Ga0075428_100131138 | 3300006844 | Unclassified | 2726 |
| 159 | Ga0075428_100172899 | 3300006844 | Unclassified | 2341 |
| 160 | Ga0075428_100237482 | 3300006844 | Bacteria | 1967 |
| 161 | Ga0075428_100253049 | 3300006844 | Bacteria | 1898 |
| 162 | Ga0075428_101347078 | 3300006844 | Bacteria | 750 |
| 163 | Ga0075428_101565571 | 3300006844 | Bacteria | 689 |
| 164 | Ga0075430_100010571 | 3300006846 | Bacteria | 7815 |
| 165 | Ga0075430_100044744 | 3300006846 | Bacteria | 3742 |
| 166 | Ga0075430_101043219 | 3300006846 | Unclassified | 673 |
| 167 | Ga0075431_100005349 | 3300006847 | Bacteria | 12669 |
| 168 | Ga0075431_100224139 | 3300006847 | Unclassified | 1917 |
| 169 | Ga0075431_100739407 | 3300006847 | Bacteria | 959 |
| 170 | Ga0075431_100864289 | 3300006847 | Unclassified | 875 |
| 171 | Ga0075431_101295895 | 3300006847 | Unclassified | 689 |
| 172 | Ga0075433_10001869 | 3300006852 | Bacteria | 15820 |
| 173 | Ga0075433_10053790 | 3300006852 | Bacteria | 3511 |
| 174 | Ga0075433_10587059 | 3300006852 | Bacteria | 978 |
| 175 | Ga0075434_100000316 | 3300006871 | Bacteria | 34532 |
| 176 | Ga0075434_100018537 | 3300006871 | Bacteria | 6725 |
| 177 | Ga0075434_100037503 | 3300006871 | Bacteria | 4798 |
| 178 | Ga0075434_100206787 | 3300006871 | Bacteria | 1983 |
| 179 | Ga0075429_100010861 | 3300006880 | Bacteria | 7875 |
| 180 | Ga0075429_100355669 | 3300006880 | Unclassified | 1282 |
| 181 | Ga0075429_100535283 | 3300006880 | Bacteria | 1027 |
| 182 | Ga0075436_100011111 | 3300006914 | Bacteria | 6174 |
| 183 | Ga0097620_100383166 | 3300006931 | Bacteria | 1501 |
| 184 | Ga0075435_100020135 | 3300007076 | Bacteria | 5105 |
| 185 | Ga0075435_100045521 | 3300007076 | Bacteria | 3518 |
| 186 | Ga0075435_100110188 | 3300007076 | Bacteria | 2289 |
| 187 | Ga0099795_10289491 | 3300007788 | Bacteria | 717 |
| 188 | Ga0105240_10006679 | 3300009093 | Bacteria | 16914 |
| 189 | Ga0105240_10061165 | 3300009093 | Bacteria | 4693 |
| 190 | Ga0105240_10105617 | 3300009093 | Bacteria | 3418 |
| 191 | Ga0105240_10118364 | 3300009093 | Bacteria | 3192 |
| 192 | Ga0105240_10170560 | 3300009093 | Bacteria | 2578 |
| 193 | Ga0105240_10620165 | 3300009093 | Unclassified | 1189 |
| 194 | Ga0105240_11406433 | 3300009093 | Unclassified | 733 |
| 195 | Ga0111539_10071221 | 3300009094 | Bacteria | 4102 |
| 196 | Ga0111539_10199748 | 3300009094 | Bacteria | 2332 |
| 197 | Ga0105245_10148203 | 3300009098 | Bacteria | 2216 |
| 198 | Ga0105245_10151334 | 3300009098 | Bacteria | 2194 |
| 199 | Ga0105245_10379086 | 3300009098 | Bacteria | 1408 |
| 200 | Ga0105245_10672920 | 3300009098 | Unclassified | 1066 |
| 201 | Ga0105247_10517416 | 3300009101 | Bacteria | 872 |
| 202 | Ga0114129_10060019 | 3300009147 | Bacteria | 5317 |
| 203 | Ga0114129_10061053 | 3300009147 | Bacteria | 5268 |
| 204 | Ga0114129_10067019 | 3300009147 | Bacteria | 5006 |
| 205 | Ga0114129_10490437 | 3300009147 | Unclassified | 1606 |
| 206 | Ga0114129_10882321 | 3300009147 | Bacteria | 1135 |
| 207 | Ga0105241_10081993 | 3300009174 | Bacteria | 2528 |
| 208 | Ga0105241_10124225 | 3300009174 | Bacteria | 2082 |
| 209 | Ga0105241_10258470 | 3300009174 | Bacteria | 1479 |
| 210 | Ga0105241_11090491 | 3300009174 | Bacteria | 751 |
| 211 | Ga0105242_10361690 | 3300009176 | Bacteria | 1343 |
| 212 | Ga0105242_10959463 | 3300009176 | Unclassified | 860 |
| 213 | Ga0105248_10003792 | 3300009177 | Bacteria | 16746 |
| 214 | Ga0105248_10038222 | 3300009177 | Bacteria | 5371 |
| 215 | Ga0105248_10279953 | 3300009177 | Bacteria | 1878 |
| 216 | Ga0105248_10803189 | 3300009177 | Bacteria | 1062 |
| 217 | Ga0105237_10001004 | 3300009545 | Bacteria | 37992 |
| 218 | Ga0105237_10328683 | 3300009545 | Bacteria | 1533 |
| 219 | Ga0105237_10510401 | 3300009545 | Bacteria | 1209 |
| 220 | Ga0105237_10885263 | 3300009545 | Bacteria | 900 |
| 221 | Ga0105238_10031933 | 3300009551 | Bacteria | 5358 |
| 222 | Ga0105238_10090501 | 3300009551 | Bacteria | 3047 |
| 223 | Ga0105238_10161213 | 3300009551 | Bacteria | 2218 |
| 224 | Ga0105238_10251953 | 3300009551 | Bacteria | 1744 |
| 225 | Ga0105249_10035688 | 3300009553 | Unclassified | 4509 |
| 226 | Ga0105249_10113174 | 3300009553 | Bacteria | 2567 |
| 227 | Ga0105249_10498601 | 3300009553 | Bacteria | 1262 |
| 228 | Ga0105239_10224405 | 3300010375 | Bacteria | 2107 |
| 229 | Ga0105239_10318067 | 3300010375 | Bacteria | 1755 |
| 230 | Ga0105239_10507286 | 3300010375 | Bacteria | 1372 |
| 231 | Ga0105246_10120145 | 3300011119 | Bacteria | 1946 |
| 232 | Ga0105246_10618620 | 3300011119 | Bacteria | 938 |
| 233 | Ga0157370_10105121 | 3300013104 | Bacteria | 2643 |
| 234 | Ga0157369_10066490 | 3300013105 | Bacteria | 3878 |
| 235 | Ga0157369_10303264 | 3300013105 | Bacteria | 1661 |
| 236 | Ga0157369_11707676 | 3300013105 | Unclassified | 640 |
| 237 | Ga0157374_10796614 | 3300013296 | Unclassified | 961 |
| 238 | Ga0157378_10001849 | 3300013297 | Bacteria | 19009 |
| 239 | Ga0157378_10031792 | 3300013297 | Bacteria | 4661 |
| 240 | Ga0157378_10154932 | 3300013297 | Bacteria | 2138 |
| 241 | Ga0157378_10667767 | 3300013297 | Bacteria | 1056 |
| 242 | Ga0157378_10667768 | 3300013297 | Bacteria | 1056 |
| 243 | Ga0163162_10089873 | 3300013306 | Bacteria | 3152 |
| 244 | Ga0157372_10231226 | 3300013307 | Bacteria | 2144 |
| 245 | Ga0157372_10697428 | 3300013307 | Bacteria | 1181 |
| 246 | Ga0157372_10739700 | 3300013307 | Bacteria | 1144 |
| 247 | Ga0157375_10428306 | 3300013308 | Bacteria | 1489 |
| 248 | Ga0157375_10525965 | 3300013308 | Bacteria | 1346 |
| 249 | Ga0163163_10125979 | 3300014325 | Bacteria | 2599 |
| 250 | Ga0163163_10189892 | 3300014325 | Bacteria | 2103 |
| 251 | Ga0163163_10763991 | 3300014325 | Bacteria | 1030 |
| 252 | Ga0157380_10001299 | 3300014326 | Bacteria | 16242 |
| 253 | Ga0157380_10850999 | 3300014326 | Unclassified | 934 |
| 254 | Ga0157380_11089808 | 3300014326 | Bacteria | 837 |
| 255 | Ga0157380_11510325 | 3300014326 | Unclassified | 725 |
| 256 | Ga0157379_10034327 | 3300014968 | Bacteria | 4523 |
| 257 | Ga0157379_10139467 | 3300014968 | Bacteria | 2185 |
| 258 | Ga0157376_10286370 | 3300014969 | Bacteria | 1554 |
| 259 | Ga0157376_10295725 | 3300014969 | Bacteria | 1531 |
| 260 | Ga0157376_11641127 | 3300014969 | Bacteria | 677 |
| 261 | Ga0213876_10015050 | 3300021384 | Bacteria | 4100 |
| 262 | Ga0213875_10067415 | 3300021388 | Bacteria | 1672 |
| 263 | Ga0209758_1083880 | 3300025297 | Bacteria | 954 |
| 264 | Ga0207653_10031777 | 3300025885 | Bacteria | 1706 |
| 265 | Ga0207692_10211911 | 3300025898 | Unclassified | 1144 |
| 266 | Ga0207680_10033812 | 3300025903 | Bacteria | 2920 |
| 267 | Ga0207685_10081314 | 3300025905 | Bacteria | 1341 |
| 268 | Ga0207699_10001465 | 3300025906 | Bacteria | 11204 |
| 269 | Ga0207699_10013464 | 3300025906 | Bacteria | 4188 |
| 270 | Ga0207645_10247689 | 3300025907 | Bacteria | 1178 |
| 271 | Ga0207705_10006442 | 3300025909 | Bacteria | 8695 |
| 272 | Ga0207705_10312076 | 3300025909 | Bacteria | 1207 |
| 273 | Ga0207705_10526009 | 3300025909 | Bacteria | 919 |
| 274 | Ga0207684_10001044 | 3300025910 | Bacteria | 30953 |
| 275 | Ga0207684_10118351 | 3300025910 | Unclassified | 2270 |
| 276 | Ga0207707_10403414 | 3300025912 | Bacteria | 1173 |
| 277 | Ga0207695_10013238 | 3300025913 | Bacteria | 9843 |
| 278 | Ga0207695_10059332 | 3300025913 | Bacteria | 3968 |
| 279 | Ga0207695_10158453 | 3300025913 | Bacteria | 2197 |
| 280 | Ga0207671_10029691 | 3300025914 | Bacteria | 4081 |
| 281 | Ga0207671_10267986 | 3300025914 | Bacteria | 1345 |
| 282 | Ga0207671_10342339 | 3300025914 | Bacteria | 1185 |
| 283 | Ga0207671_10386259 | 3300025914 | Bacteria | 1112 |
| 284 | Ga0207693_10000022 | 3300025915 | Bacteria | 127887 |
| 285 | Ga0207693_10011601 | 3300025915 | Bacteria | 7129 |
| 286 | Ga0207663_10028718 | 3300025916 | Unclassified | 3259 |
| 287 | Ga0207660_10003669 | 3300025917 | Bacteria | 10008 |
| 288 | Ga0207657_10010276 | 3300025919 | Bacteria | 9344 |
| 289 | Ga0207649_10541206 | 3300025920 | Unclassified | 890 |
| 290 | Ga0207646_10008150 | 3300025922 | Bacteria | 10540 |
| 291 | Ga0207646_10375782 | 3300025922 | Bacteria | 1284 |
| 292 | Ga0207694_10000741 | 3300025924 | Bacteria | 29353 |
| 293 | Ga0207694_10048867 | 3300025924 | Bacteria | 3274 |
| 294 | Ga0207694_10459624 | 3300025924 | Bacteria | 1063 |
| 295 | Ga0207659_10691245 | 3300025926 | Bacteria | 873 |
| 296 | Ga0207659_10720566 | 3300025926 | Bacteria | 855 |
| 297 | Ga0207687_10444066 | 3300025927 | Bacteria | 1075 |
| 298 | Ga0207700_10000056 | 3300025928 | Bacteria | 71553 |
| 299 | Ga0207664_10007547 | 3300025929 | Bacteria | 7545 |
| 300 | Ga0207664_10629395 | 3300025929 | Bacteria | 964 |
| 301 | Ga0207665_10000385 | 3300025939 | Bacteria | 30257 |
| 302 | Ga0207711_10004950 | 3300025941 | Bacteria | 11309 |
| 303 | Ga0207711_10275865 | 3300025941 | Bacteria | 1547 |
| 304 | Ga0207711_10618500 | 3300025941 | Unclassified | 1011 |
| 305 | Ga0207661_10011512 | 3300025944 | Bacteria | 6413 |
| 306 | Ga0207661_10072701 | 3300025944 | Bacteria | 2814 |
| 307 | Ga0207661_10187855 | 3300025944 | Unclassified | 1810 |
| 308 | Ga0207661_10877382 | 3300025944 | Bacteria | 826 |
| 309 | Ga0207679_10105811 | 3300025945 | Bacteria | 2210 |
| 310 | Ga0207679_10973138 | 3300025945 | Unclassified | 777 |
| 311 | Ga0207651_10403096 | 3300025960 | Bacteria | 1164 |
| 312 | Ga0207640_10669992 | 3300025981 | Bacteria | 886 |
| 313 | Ga0207658_10075425 | 3300025986 | Bacteria | 2566 |
| 314 | Ga0207658_10131569 | 3300025986 | Bacteria | 2011 |
| 315 | Ga0207658_10807001 | 3300025986 | Unclassified | 852 |
| 316 | Ga0207677_11219902 | 3300026023 | Bacteria | 689 |
| 317 | Ga0207639_10364894 | 3300026041 | Bacteria | 1293 |
| 318 | Ga0207639_10378068 | 3300026041 | Bacteria | 1271 |
| 319 | Ga0207639_10534793 | 3300026041 | Unclassified | 1074 |
| 320 | Ga0207708_10000126 | 3300026075 | Bacteria | 59505 |
| 321 | Ga0207641_10459299 | 3300026088 | Bacteria | 1232 |
| 322 | Ga0207641_10505860 | 3300026088 | Bacteria | 1174 |
| 323 | Ga0207676_10066942 | 3300026095 | Bacteria | 2867 |
| 324 | Ga0207675_100031989 | 3300026118 | Bacteria | 4901 |
| 325 | Ga0207683_10045779 | 3300026121 | Bacteria | 3826 |
| 326 | Ga0207698_10053339 | 3300026142 | Bacteria | 3103 |
| 327 | Ga0207698_10265422 | 3300026142 | Bacteria | 1579 |
| 328 | Ga0207698_10302953 | 3300026142 | Bacteria | 1488 |
| 329 | Ga0210002_1002786 | 3300027617 | Bacteria | 2539 |
| 330 | Ga0209998_10004255 | 3300027717 | Bacteria | 3051 |
| 331 | Ga0209998_10028256 | 3300027717 | Bacteria | 1232 |
| 332 | Ga0209974_10000290 | 3300027876 | Bacteria | 16397 |
| 333 | Ga0209974_10031326 | 3300027876 | Bacteria | 1761 |
| 334 | Ga0268266_10059589 | 3300028379 | Bacteria | 3289 |
| 335 | Ga0268266_10417185 | 3300028379 | Bacteria | 1271 |
| 336 | Ga0268266_10721193 | 3300028379 | Bacteria | 961 |
| 337 | Ga0268265_10155182 | 3300028380 | Bacteria | 1936 |
| 338 | Ga0268264_10590675 | 3300028381 | Unclassified | 1093 |
| 339 | Ga0265318_10170618 | 3300028577 | Bacteria | 797 |
| 340 | Ga0307515_10000018 | 3300028794 | Bacteria | 424853 |
| 341 | Ga0265338_10141799 | 3300028800 | Bacteria | 1881 |
| 342 | Ga0265338_10195712 | 3300028800 | Bacteria | 1528 |
| 343 | Ga0265338_10535449 | 3300028800 | Unclassified | 821 |
| 344 | Ga0265325_10026933 | 3300031241 | Bacteria | 3111 |
| 345 | Ga0265325_10097809 | 3300031241 | Unclassified | 1440 |
| 346 | Ga0265340_10382931 | 3300031247 | Unclassified | 621 |
| 347 | Ga0265339_10021647 | 3300031249 | Bacteria | 3736 |
| 348 | Ga0265339_10062547 | 3300031249 | Bacteria | 2001 |
| 349 | Ga0265339_10337556 | 3300031249 | Unclassified | 712 |
| 350 | Ga0307408_100004179 | 3300031548 | Bacteria | 9841 |
| 351 | Ga0307508_10000120 | 3300031616 | Bacteria | 93316 |
| 352 | Ga0307508_10100203 | 3300031616 | Bacteria | 2492 |
| 353 | Ga0265314_10032642 | 3300031711 | Bacteria | 3827 |
| 354 | Ga0307405_10002374 | 3300031731 | Bacteria | 8290 |
| 355 | Ga0307413_10031519 | 3300031824 | Bacteria | 2993 |
| 356 | Ga0307406_11116806 | 3300031901 | Bacteria | 681 |
| 357 | Ga0307407_10074380 | 3300031903 | Bacteria | 2033 |
| 358 | Ga0307407_10203494 | 3300031903 | Unclassified | 1328 |
| 359 | Ga0307414_10042551 | 3300032004 | Unclassified | 3087 |
| 360 | Ga0307415_100057000 | 3300032126 | Bacteria | 2682 |
| 361 | Ga0373959_0033445 | 3300034820 | Bacteria | 1049 |
| 362 | Ga0373926_0027645 | 3300035083 | Unclassified | 1989 |
| 363 | Ga0373934_0103577 | 3300035086 | Bacteria | 1151 |
| 364 | Ga0373944_0047092 | 3300035089 | Unclassified | 1350 |
| 365 | Ga0373923_0059597 | 3300035111 | Unclassified | 1619 |
| 366 | Ga0373936_0010571 | 3300035113 | Unclassified | 3484 |
| 367 | Ga0373939_0071960 | 3300035114 | Bacteria | 1128 |
| 368 | Ga0373956_0481568 | 3300035119 | Bacteria | 592 |
| 369 | Ga0373943_0269354 | 3300035170 | Archaea | 960 |
| 370 | Ga0373946_0038492 | 3300035171 | Unclassified | 1948 |
| 371 | Ga0373955_0022208 | 3300035172 | Bacteria | 3216 |
| 372 | Ga0373931_0293963 | 3300035691 | Bacteria | 1001 |
| 373 | Ga0373935_0022427 | 3300035692 | Bacteria | 3872 |
| 374 | Ga0373935_0177858 | 3300035692 | Bacteria | 1459 |
| 375 | Ga0373933_0032336 | 3300035724 | Bacteria | 3041 |
| 376 | Ga0373947_0016057 | 3300035725 | Unclassified | 4303 |
| 377 | Ga0373947_0022255 | 3300035725 | Bacteria | 3674 |
| 378 | Ga0373937_0309292 | 3300036401 | Bacteria | 1494 |
| 379 | Ga0373937_0602170 | 3300036401 | Bacteria | 1043 |
| 380 | Ga0373937_0639626 | 3300036401 | Bacteria | 1009 |
| 381 | Ga0373925_0013285 | 3300037068 | Bacteria | 5960 |
| 382 | Ga0395898_0758644 | 3300037466 | Unclassified | 911 |
| 383 | Ga0395898_0836142 | 3300037466 | Bacteria | 860 |
| 384 | Ga0395898_0978218 | 3300037466 | Bacteria | 783 |
| 385 | Ga0395905_0025350 | 3300037471 | Bacteria | 5592 |
| 386 | Ga0395905_0525315 | 3300037471 | Bacteria | 1084 |
| 387 | Ga0436364_0528381 | 3300037853 | Bacteria | 1991 |
| 388 | Ga0395901_0292222 | 3300038443 | Unclassified | 1691 |
| 389 | Ga0395901_0536371 | 3300038443 | Bacteria | 1187 |
| 390 | Ga0436365_0910109 | 3300039437 | Bacteria | 7067 |
| 391 | Ga0436362_0414753 | 3300039453 | Unclassified | 575 |
| 392 | Ga0439455_0008349 | 3300042012 | Unclassified | 2217 |
| 393 | Ga0439458_0006193 | 3300042157 | Unclassified | 2669 |
| 394 | Ga0439440_0065125 | 3300042993 | Bacteria | 938 |
| 395 | Ga0453684_0014979 | 3300044712 | Bacteria | 12316 |
| 396 | Ga0466968_0499969 | 3300044735 | Unclassified | 606 |
| 397 | Ga0466957_0529767 | 3300044842 | Bacteria | 819 |
| 398 | Ga0451576_0681968 | 3300045051 | Bacteria | 1080 |
| 399 | Ga0466967_0691356 | 3300045976 | Bacteria | 1010 |
| 400 | Ga0495592_0068850 | 3300046454 | Bacteria | 2582 |
| 401 | Ga0495629_0154438 | 3300046459 | Archaea | 1595 |
| 402 | Ga0495638_0027229 | 3300046460 | Bacteria | 3701 |
| 403 | Ga0495638_0040965 | 3300046460 | Bacteria | 2933 |
| 404 | Ga0495651_0119240 | 3300046462 | Bacteria | 1941 |
| 405 | Ga0495580_0000523 | 3300046472 | Bacteria | 32397 |
| 406 | Ga0495582_0001022 | 3300046473 | Bacteria | 15658 |
| 407 | Ga0495582_0038559 | 3300046473 | Bacteria | 2630 |
| 408 | Ga0495662_0362573 | 3300046476 | Unclassified | 712 |
| 409 | Ga0495664_0198404 | 3300046477 | Unclassified | 1216 |
| 410 | Ga0495596_0195110 | 3300046500 | Bacteria | 787 |
| 411 | Ga0495608_0005145 | 3300046511 | Bacteria | 9348 |
| 412 | Ga0495618_0019975 | 3300046514 | Bacteria | 4123 |
| 413 | Ga0495628_0050339 | 3300046516 | Bacteria | 3295 |
| 414 | Ga0495630_0002908 | 3300046517 | Bacteria | 11899 |
| 415 | Ga0495630_0077911 | 3300046517 | Unclassified | 2499 |
| 416 | Ga0495643_0058561 | 3300046522 | Bacteria | 2050 |
| 417 | Ga0495586_0541918 | 3300046535 | Unclassified | 672 |
| 418 | Ga0495587_0130618 | 3300046536 | Bacteria | 1435 |
| 419 | Ga0495609_0026507 | 3300046538 | Bacteria | 2654 |
| 420 | Ga0495645_0098531 | 3300046543 | Bacteria | 2080 |
| 421 | Ga0495667_0008465 | 3300046559 | Bacteria | 6984 |
| 422 | Ga0495667_0156819 | 3300046559 | Unclassified | 1465 |
| 423 | Ga0495656_0211561 | 3300046615 | Bacteria | 966 |
| 424 | Ga0495634_0193831 | 3300046642 | Bacteria | 1266 |
| 425 | Ga0495599_0063826 | 3300046678 | Bacteria | 2301 |
| 426 | Ga0495658_0084823 | 3300046683 | Bacteria | 1866 |
| 427 | Ga0495613_0000975 | 3300046689 | Bacteria | 21818 |
| 428 | Ga0495649_0108491 | 3300046694 | Bacteria | 1473 |
| 429 | Ga0495649_0186360 | 3300046694 | Bacteria | 1081 |
| 430 | Ga0495581_0249319 | 3300047315 | Archaea | 1038 |
| 431 | Ga0495604_0006118 | 3300047317 | Bacteria | 9552 |
| 432 | Ga0495674_0004353 | 3300047319 | Bacteria | 13610 |
| 433 | Ga0495672_0005369 | 3300047320 | Bacteria | 10190 |
| 434 | Ga0495675_0165720 | 3300047444 | Bacteria | 1359 |
| 435 | Ga0495684_0000140 | 3300047471 | Bacteria | 53062 |
| 436 | Ga0495684_0573532 | 3300047471 | Unclassified | 765 |
| 437 | Ga0495602_0207571 | 3300048088 | Bacteria | 1490 |
| 438 | Ga0495614_0251677 | 3300048089 | Archaea | 808 |
| 439 | Ga0496105_0156533 | 3300048908 | Bacteria | 1871 |
| 440 | Ga0496106_0003995 | 3300048909 | Bacteria | 11023 |
| 441 | Ga0496108_0279390 | 3300048911 | Unclassified | 1454 |
| 442 | Ga0496110_0017935 | 3300048913 | Bacteria | 5928 |
| 443 | Ga0496113_0082844 | 3300048916 | Bacteria | 2461 |
| 444 | Ga0496114_0067860 | 3300048917 | Unclassified | 2993 |
| 445 | Ga0496115_0007463 | 3300048918 | Bacteria | 8047 |
| 446 | Ga0496117_0016272 | 3300048920 | Bacteria | 6284 |
| 447 | Ga0496118_0002345 | 3300048921 | Bacteria | 25686 |
| 448 | Ga0496119_0436642 | 3300048922 | Bacteria | 619 |
| 449 | Ga0496121_0003002 | 3300048924 | Bacteria | 24518 |
| 450 | Ga0496124_0005039 | 3300048927 | Bacteria | 15096 |
| 451 | Ga0496126_0019777 | 3300048929 | Bacteria | 6624 |
| 452 | Ga0496126_0025870 | 3300048929 | Bacteria | 5637 |
| 453 | Ga0495682_0036877 | 3300049460 | Bacteria | 1799 |
| 454 | Ga0501032_0167902 | 3300049569 | Bacteria | 1439 |
| 455 | Ga0501033_0674139 | 3300049570 | Bacteria | 705 |
| 456 | Ga0501038_0190066 | 3300049574 | Bacteria | 1653 |
| 457 | Ga0501039_0089418 | 3300049575 | Bacteria | 2400 |
| 458 | Ga0501041_0159852 | 3300049577 | Bacteria | 1408 |
| 459 | Ga0501042_0001234 | 3300049578 | Bacteria | 14883 |
| 460 | Ga0501043_0489228 | 3300049579 | Bacteria | 920 |
| 461 | Ga0501047_0188624 | 3300049581 | Bacteria | 1926 |
| 462 | Ga0501048_0025864 | 3300049582 | Bacteria | 4276 |
| 463 | Ga0501070_0225233 | 3300049586 | Unclassified | 1537 |
| 464 | Ga0501070_0316570 | 3300049586 | Bacteria | 1270 |
| 465 | Ga0501071_0029971 | 3300049587 | Bacteria | 3845 |
| 466 | Ga0501072_0270015 | 3300049588 | Bacteria | 1353 |
| 467 | Ga0501073_0108136 | 3300049589 | Bacteria | 1930 |
| 468 | Ga0501073_0544812 | 3300049589 | Unclassified | 802 |
| 469 | Ga0501074_0321340 | 3300049590 | Bacteria | 1099 |
| 470 | Ga0501075_0027550 | 3300049591 | Bacteria | 4189 |
| 471 | Ga0501076_0004492 | 3300049592 | Bacteria | 9938 |
| 472 | Ga0501198_002323 | 3300049649 | Unclassified | 2554 |
| 473 | Ga0501207_006153 | 3300049654 | Archaea | 1678 |
| 474 | Ga0501216_000538 | 3300049660 | Bacteria | 4548 |
| 475 | Ga0501217_000298 | 3300049661 | Bacteria | 7813 |
| 476 | Ga0501223_004753 | 3300049663 | Bacteria | 2890 |
| 477 | Ga0501227_030920 | 3300049665 | Unclassified | 1284 |
| 478 | Ga0501233_001316 | 3300049668 | Bacteria | 4247 |
| 479 | Ga0501236_001630 | 3300049670 | Bacteria | 2552 |
| 480 | Ga0501243_002617 | 3300049675 | Unclassified | 2643 |
| 481 | Ga0501257_041123 | 3300049686 | Unclassified | 1135 |
| 482 | Ga0501225_0004531 | 3300049705 | Archaea | 4134 |
| 483 | Ga0501079_0068983 | 3300049741 | Bacteria | 2729 |
| 484 | Ga0501080_0493986 | 3300049742 | Bacteria | 1094 |
| 485 | Ga0501080_0790174 | 3300049742 | Bacteria | 833 |
| 486 | Ga0501081_0657131 | 3300049743 | Bacteria | 786 |
| 487 | Ga0501044_0170182 | 3300049823 | Bacteria | 2150 |
| 488 | Ga0501226_002004 | 3300049853 | Bacteria | 2533 |
| 489 | nmdc:mga03683_54381_c1 | 3300050489 | Bacteria | 1678 |
| 490 | nmdc:mga03n38_145079_c1 | 3300050490 | Bacteria | 1189 |
| 491 | nmdc:mga00v17_132754_c1 | 3300050491 | Bacteria | 1592 |
| 492 | nmdc:mga0yw44_459043_c1 | 3300050492 | Bacteria | 863 |
| 493 | nmdc:mga0k408_87254_c1 | 3300050493 | Unclassified | 1832 |
| 494 | nmdc:mga0k408_91651_c1 | 3300050493 | Bacteria | 1785 |
| 495 | nmdc:mga06z11_4577_c1 | 3300050494 | Bacteria | 5454 |
| 496 | nmdc:mga06z11_64566_c2 | 3300050494 | Bacteria | 652 |
| 497 | nmdc:mga04h51_82267_c1 | 3300050495 | Bacteria | 1145 |
| 498 | nmdc:mga07m45_103136_c1 | 3300050496 | Unclassified | 1639 |
| 499 | nmdc:mga05p37_1022670_c1 | 3300050507 | Unclassified | 875 |
| 500 | nmdc:mga05p37_1086803_c1 | 3300050507 | Bacteria | 839 |
| 501 | nmdc:mga05p37_109575_c1 | 3300050507 | Unclassified | 3397 |
| 502 | nmdc:mga05p37_115525_c1 | 3300050507 | Bacteria | 3299 |
| 503 | nmdc:mga09592_132559_c1 | 3300050508 | Bacteria | 2145 |
| 504 | nmdc:mga09592_271153_c1 | 3300050508 | Unclassified | 1472 |
| 505 | nmdc:mga09592_330253_c1 | 3300050508 | Unclassified | 1320 |
| 506 | nmdc:mga09592_9463_c1 | 3300050508 | Bacteria | 7918 |
| 507 | nmdc:mga0qj67_100824_c1 | 3300050509 | Unclassified | 2328 |
| 508 | nmdc:mga0qj67_103413_c1 | 3300050509 | Bacteria | 2298 |
| 509 | nmdc:mga0qj67_13572_c1 | 3300050509 | Bacteria | 6144 |
| 510 | nmdc:mga0qj67_45088_c1 | 3300050509 | Bacteria | 3478 |
| 511 | nmdc:mga0qj67_8203_c1 | 3300050509 | Bacteria | 7743 |
| 512 | nmdc:mga06r32_16653_c1 | 3300050510 | Bacteria | 6699 |
| 513 | nmdc:mga06r32_1992_c1 | 3300050510 | Bacteria | 18250 |
| 514 | nmdc:mga06r32_406635_c1 | 3300050510 | Bacteria | 1343 |
| 515 | nmdc:mga06r32_41201_c1 | 3300050510 | Bacteria | 4386 |
| 516 | nmdc:mga06r32_845947_c1 | 3300050510 | Unclassified | 874 |
| 517 | nmdc:mga06r32_850233_c1 | 3300050510 | Bacteria | 871 |
| 518 | nmdc:mga08y16_974340_c1 | 3300050511 | Bacteria | 830 |
| 519 | nmdc:mga0n895_5259_c1 | 3300050512 | Bacteria | 10785 |
| 520 | nmdc:mga0n895_86840_c1 | 3300050512 | Bacteria | 3125 |
| 521 | nmdc:mga0n895_96349_c1 | 3300050512 | Bacteria | 2964 |
| 522 | nmdc:mga0rr50_22551_c2 | 3300050513 | Bacteria | 3517 |
| 523 | nmdc:mga0rr50_67600_c1 | 3300050513 | Bacteria | 2715 |
| 524 | nmdc:mga08x19_3394_c1 | 3300050514 | Bacteria | 9499 |
| 525 | nmdc:mga0a205_29616_c1 | 3300050515 | Bacteria | 5240 |
| 526 | nmdc:mga0a205_64052_c1 | 3300050515 | Bacteria | 3551 |
| 527 | Ga0495601_0001321 | 3300053077 | Bacteria | 13614 |
| 528 | Ga0495619_0013156 | 3300053085 | Bacteria | 5214 |
| 529 | Ga0500573_0000003 | 3300053140 | Bacteria | 355643 |
| 530 | Ga0501084_0163182 | 3300054114 | Bacteria | 1880 |
| 531 | Ga0501082_0089085 | 3300060353 | Bacteria | 2664 |
| 532 | Ga0501082_0287323 | 3300060353 | Bacteria | 1432 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300044735 | Ga0466968_0499969 | Ga0466968_0499969_68_568 | 158 |
| 2 | 3300049823 | Ga0501044_0170182 | Ga0501044_0170182_1631_2125 | 163 |
| 3 | 3300006847 | Ga0075431_100864289 | Ga0075431_1008642892 | 165 |
| 4 | 3300009147 | Ga0114129_10882321 | Ga0114129_108823212 | 165 |
| 5 | 3300005344 | Ga0070661_100610960 | Ga0070661_1006109602 | 169 |
| 6 | 3300005535 | Ga0070684_100402541 | Ga0070684_1004025413 | 169 |
| 7 | 3300005564 | Ga0070664_100118589 | Ga0070664_1001185893 | 169 |
| 8 | 3300025920 | Ga0207649_10541206 | Ga0207649_105412061 | 169 |
| 9 | 3300025945 | Ga0207679_10105811 | Ga0207679_101058112 | 169 |
| 10 | 3300005327 | Ga0070658_10003308 | Ga0070658_100033088 | 170 |
| 11 | 3300025909 | Ga0207705_10006442 | Ga0207705_100064424 | 170 |
| 12 | 3300039453 | Ga0436362_0414753 | Ga0436362_0414753_18_557 | 171 |
| 13 | 3300050510 | nmdc:mga06r32_845947_c1 | nmdc:mga06r32_845947_c1_322_843 | 173 |
| 14 | 3300046522 | Ga0495643_0058561 | Ga0495643_0058561_754_1317 | 174 |
| 15 | 3300046694 | Ga0495649_0186360 | Ga0495649_0186360_18_581 | 174 |
| 16 | 3300005471 | Ga0070698_100035737 | Ga0070698_1000357373 | 175 |
| 17 | 3300005843 | Ga0068860_100054096 | Ga0068860_1000540966 | 178 |
| 18 | 3300005844 | Ga0068862_100526708 | Ga0068862_1005267082 | 179 |
| 19 | 3300009174 | Ga0105241_10258470 | Ga0105241_102584702 | 179 |
| 20 | 3300013307 | Ga0157372_10697428 | Ga0157372_106974282 | 179 |
| 21 | 3300045976 | Ga0466967_0691356 | Ga0466967_0691356_133_678 | 179 |
| 22 | 3300005445 | Ga0070708_100876691 | Ga0070708_1008766912 | 180 |
| 23 | 3300005467 | Ga0070706_100001047 | Ga0070706_10000104711 | 180 |
| 24 | 3300005468 | Ga0070707_100006636 | Ga0070707_1000066368 | 180 |
| 25 | 3300005471 | Ga0070698_100000531 | Ga0070698_10000053132 | 180 |
| 26 | 3300005518 | Ga0070699_100003720 | Ga0070699_10000372012 | 180 |
| 27 | 3300006028 | Ga0070717_10148098 | Ga0070717_101480982 | 180 |
| 28 | 3300009093 | Ga0105240_10105617 | Ga0105240_101056175 | 180 |
| 29 | 3300009093 | Ga0105240_10170560 | Ga0105240_101705602 | 180 |
| 30 | 3300009101 | Ga0105247_10517416 | Ga0105247_105174162 | 180 |
| 31 | 3300009174 | Ga0105241_10081993 | Ga0105241_100819933 | 180 |
| 32 | 3300009174 | Ga0105241_10124225 | Ga0105241_101242252 | 180 |
| 33 | 3300009545 | Ga0105237_10328683 | Ga0105237_103286832 | 180 |
| 34 | 3300009545 | Ga0105237_10510401 | Ga0105237_105104012 | 180 |
| 35 | 3300009545 | Ga0105237_10885263 | Ga0105237_108852632 | 180 |
| 36 | 3300009551 | Ga0105238_10161213 | Ga0105238_101612132 | 180 |
| 37 | 3300009551 | Ga0105238_10251953 | Ga0105238_102519533 | 180 |
| 38 | 3300010375 | Ga0105239_10224405 | Ga0105239_102244052 | 180 |
| 39 | 3300010375 | Ga0105239_10318067 | Ga0105239_103180672 | 180 |
| 40 | 3300010375 | Ga0105239_10507286 | Ga0105239_105072862 | 180 |
| 41 | 3300011119 | Ga0105246_10120145 | Ga0105246_101201452 | 180 |
| 42 | 3300013105 | Ga0157369_10066490 | Ga0157369_100664904 | 180 |
| 43 | 3300013105 | Ga0157369_10303264 | Ga0157369_103032642 | 180 |
| 44 | 3300013105 | Ga0157369_11707676 | Ga0157369_117076761 | 180 |
| 45 | 3300013307 | Ga0157372_10231226 | Ga0157372_102312262 | 180 |
| 46 | 3300014325 | Ga0163163_10189892 | Ga0163163_101898922 | 180 |
| 47 | 3300014325 | Ga0163163_10763991 | Ga0163163_107639911 | 180 |
| 48 | 3300014968 | Ga0157379_10034327 | Ga0157379_100343274 | 180 |
| 49 | 3300021388 | Ga0213875_10067415 | Ga0213875_100674151 | 180 |
| 50 | 3300025910 | Ga0207684_10001044 | Ga0207684_1000104420 | 180 |
| 51 | 3300025922 | Ga0207646_10008150 | Ga0207646_100081506 | 180 |
| 52 | 3300037466 | Ga0395898_0836142 | Ga0395898_0836142_68_613 | 180 |
| 53 | 3300037853 | Ga0436364_0528381 | Ga0436364_0528381_138_704 | 180 |
| 54 | 3300046694 | Ga0495649_0108491 | Ga0495649_0108491_408_953 | 180 |
| 55 | 3300049586 | Ga0501070_0225233 | Ga0501070_0225233_359_904 | 180 |
| 56 | 3300049589 | Ga0501073_0544812 | Ga0501073_0544812_155_700 | 180 |
| 57 | 3300053140 | Ga0500573_0000003 | Ga0500573_0000003_72273_72818 | 180 |
| 58 | 3300009098 | Ga0105245_10148203 | Ga0105245_101482032 | 181 |
| 59 | 3300009098 | Ga0105245_10379086 | Ga0105245_103790862 | 181 |
| 60 | 3300009147 | Ga0114129_10490437 | Ga0114129_104904372 | 181 |
| 61 | 3300009177 | Ga0105248_10003792 | Ga0105248_100037927 | 181 |
| 62 | 3300013307 | Ga0157372_10739700 | Ga0157372_107397002 | 181 |
| 63 | 3300037466 | Ga0395898_0758644 | Ga0395898_0758644_205_753 | 181 |
| 64 | 3300038443 | Ga0395901_0292222 | Ga0395901_0292222_193_741 | 181 |
| 65 | 3300049649 | Ga0501198_002323 | Ga0501198_002323_1897_2445 | 181 |
| 66 | 3300049654 | Ga0501207_006153 | Ga0501207_006153_318_866 | 181 |
| 67 | 3300049660 | Ga0501216_000538 | Ga0501216_000538_151_699 | 181 |
| 68 | 3300049661 | Ga0501217_000298 | Ga0501217_000298_50_598 | 181 |
| 69 | 3300049663 | Ga0501223_004753 | Ga0501223_004753_2251_2799 | 181 |
| 70 | 3300049665 | Ga0501227_030920 | Ga0501227_030920_627_1175 | 181 |
| 71 | 3300049668 | Ga0501233_001316 | Ga0501233_001316_3650_4198 | 181 |
| 72 | 3300049670 | Ga0501236_001630 | Ga0501236_001630_1918_2466 | 181 |
| 73 | 3300049675 | Ga0501243_002617 | Ga0501243_002617_1966_2514 | 181 |
| 74 | 3300049686 | Ga0501257_041123 | Ga0501257_041123_546_1094 | 181 |
| 75 | 3300049705 | Ga0501225_0004531 | Ga0501225_0004531_1321_1869 | 181 |
| 76 | 3300049853 | Ga0501226_002004 | Ga0501226_002004_1309_1857 | 181 |
| 77 | 3300050493 | nmdc:mga0k408_91651_c1 | nmdc:mga0k408_91651_c1_470_1015 | 181 |
| 78 | 3300050494 | nmdc:mga06z11_64566_c2 | nmdc:mga06z11_64566_c2_47_592 | 181 |
| 79 | 3300050495 | nmdc:mga04h51_82267_c1 | nmdc:mga04h51_82267_c1_98_643 | 181 |
| 80 | 3300046500 | Ga0495596_0195110 | Ga0495596_0195110_200_751 | 182 |
| 81 | 3300005440 | Ga0070705_100030803 | Ga0070705_1000308033 | 183 |
| 82 | 3300005440 | Ga0070705_100033531 | Ga0070705_1000335313 | 183 |
| 83 | 3300005444 | Ga0070694_100244512 | Ga0070694_1002445122 | 183 |
| 84 | 3300005467 | Ga0070706_100401463 | Ga0070706_1004014633 | 183 |
| 85 | 3300005518 | Ga0070699_100074587 | Ga0070699_1000745873 | 183 |
| 86 | 3300005518 | Ga0070699_100510744 | Ga0070699_1005107442 | 183 |
| 87 | 3300005544 | Ga0070686_100056717 | Ga0070686_1000567173 | 183 |
| 88 | 3300005546 | Ga0070696_100013343 | Ga0070696_1000133436 | 183 |
| 89 | 3300005549 | Ga0070704_100000386 | Ga0070704_10000038613 | 183 |
| 90 | 3300005549 | Ga0070704_100056073 | Ga0070704_1000560732 | 183 |
| 91 | 3300005937 | Ga0081455_10145659 | Ga0081455_101456593 | 183 |
| 92 | 3300006353 | Ga0075370_10282682 | Ga0075370_102826822 | 183 |
| 93 | 3300006844 | Ga0075428_101347078 | Ga0075428_1013470781 | 183 |
| 94 | 3300009177 | Ga0105248_10038222 | Ga0105248_100382222 | 183 |
| 95 | 3300014326 | Ga0157380_10001299 | Ga0157380_100012996 | 183 |
| 96 | 3300014969 | Ga0157376_10295725 | Ga0157376_102957252 | 183 |
| 97 | 3300025941 | Ga0207711_10618500 | Ga0207711_106185002 | 183 |
| 98 | 3300031903 | Ga0307407_10074380 | Ga0307407_100743801 | 183 |
| 99 | 3300035119 | Ga0373956_0481568 | Ga0373956_0481568_21_578 | 183 |
| 100 | 3300035172 | Ga0373955_0022208 | Ga0373955_0022208_1573_2130 | 183 |
| 101 | 3300035692 | Ga0373935_0177858 | Ga0373935_0177858_45_602 | 183 |
| 102 | 3300035725 | Ga0373947_0022255 | Ga0373947_0022255_425_982 | 183 |
| 103 | 3300036401 | Ga0373937_0602170 | Ga0373937_0602170_135_692 | 183 |
| 104 | 3300036401 | Ga0373937_0639626 | Ga0373937_0639626_119_676 | 183 |
| 105 | 3300037068 | Ga0373925_0013285 | Ga0373925_0013285_4264_4821 | 183 |
| 106 | 3300042993 | Ga0439440_0065125 | Ga0439440_0065125_48_608 | 183 |
| 107 | 3300046454 | Ga0495592_0068850 | Ga0495592_0068850_695_1252 | 183 |
| 108 | 3300046462 | Ga0495651_0119240 | Ga0495651_0119240_832_1389 | 183 |
| 109 | 3300046473 | Ga0495582_0038559 | Ga0495582_0038559_421_978 | 183 |
| 110 | 3300046476 | Ga0495662_0362573 | Ga0495662_0362573_93_650 | 183 |
| 111 | 3300046511 | Ga0495608_0005145 | Ga0495608_0005145_6853_7410 | 183 |
| 112 | 3300046514 | Ga0495618_0019975 | Ga0495618_0019975_3298_3855 | 183 |
| 113 | 3300046516 | Ga0495628_0050339 | Ga0495628_0050339_2347_2904 | 183 |
| 114 | 3300046517 | Ga0495630_0002908 | Ga0495630_0002908_7674_8231 | 183 |
| 115 | 3300046535 | Ga0495586_0541918 | Ga0495586_0541918_51_608 | 183 |
| 116 | 3300046536 | Ga0495587_0130618 | Ga0495587_0130618_479_1036 | 183 |
| 117 | 3300046543 | Ga0495645_0098531 | Ga0495645_0098531_454_1011 | 183 |
| 118 | 3300046559 | Ga0495667_0008465 | Ga0495667_0008465_3704_4261 | 183 |
| 119 | 3300046642 | Ga0495634_0193831 | Ga0495634_0193831_415_972 | 183 |
| 120 | 3300046678 | Ga0495599_0063826 | Ga0495599_0063826_680_1237 | 183 |
| 121 | 3300046683 | Ga0495658_0084823 | Ga0495658_0084823_721_1278 | 183 |
| 122 | 3300046689 | Ga0495613_0000975 | Ga0495613_0000975_10521_11078 | 183 |
| 123 | 3300047317 | Ga0495604_0006118 | Ga0495604_0006118_726_1283 | 183 |
| 124 | 3300047444 | Ga0495675_0165720 | Ga0495675_0165720_352_909 | 183 |
| 125 | 3300047471 | Ga0495684_0000140 | Ga0495684_0000140_3721_4278 | 183 |
| 126 | 3300048088 | Ga0495602_0207571 | Ga0495602_0207571_156_713 | 183 |
| 127 | 3300050510 | nmdc:mga06r32_406635_c1 | nmdc:mga06r32_406635_c1_22_579 | 183 |
| 128 | 3300050510 | nmdc:mga06r32_850233_c1 | nmdc:mga06r32_850233_c1_73_630 | 183 |
| 129 | 3300053077 | Ga0495601_0001321 | Ga0495601_0001321_5143_5700 | 183 |
| 130 | 3300053085 | Ga0495619_0013156 | Ga0495619_0013156_194_751 | 183 |
| 131 | 2162886012 | MBSR1b_contig_4902641 | MBSR1b_0412.00005810 | 184 |
| 132 | 2162886012 | MBSR1b_contig_5893965 | MBSR1b_0854.00005340 | 184 |
| 133 | 3300005293 | Ga0065715_10382309 | Ga0065715_103823092 | 184 |
| 134 | 3300005330 | Ga0070690_100360374 | Ga0070690_1003603742 | 184 |
| 135 | 3300005334 | Ga0068869_100316898 | Ga0068869_1003168982 | 184 |
| 136 | 3300005336 | Ga0070680_100025304 | Ga0070680_1000253045 | 184 |
| 137 | 3300005337 | Ga0070682_100013753 | Ga0070682_1000137535 | 184 |
| 138 | 3300005354 | Ga0070675_100296169 | Ga0070675_1002961693 | 184 |
| 139 | 3300005355 | Ga0070671_100313761 | Ga0070671_1003137612 | 184 |
| 140 | 3300005364 | Ga0070673_100441432 | Ga0070673_1004414322 | 184 |
| 141 | 3300005365 | Ga0070688_100420456 | Ga0070688_1004204561 | 184 |
| 142 | 3300005367 | Ga0070667_100126902 | Ga0070667_1001269023 | 184 |
| 143 | 3300005530 | Ga0070679_100053696 | Ga0070679_1000536961 | 184 |
| 144 | 3300005539 | Ga0068853_100068238 | Ga0068853_1000682383 | 184 |
| 145 | 3300005547 | Ga0070693_100183325 | Ga0070693_1001833252 | 184 |
| 146 | 3300005547 | Ga0070693_100183382 | Ga0070693_1001833822 | 184 |
| 147 | 3300005564 | Ga0070664_100411668 | Ga0070664_1004116682 | 184 |
| 148 | 3300005614 | Ga0068856_100186576 | Ga0068856_1001865762 | 184 |
| 149 | 3300005615 | Ga0070702_100456099 | Ga0070702_1004560992 | 184 |
| 150 | 3300005616 | Ga0068852_100359833 | Ga0068852_1003598332 | 184 |
| 151 | 3300005617 | Ga0068859_100383151 | Ga0068859_1003831512 | 184 |
| 152 | 3300005618 | Ga0068864_100017929 | Ga0068864_1000179293 | 184 |
| 153 | 3300005834 | Ga0068851_10041190 | Ga0068851_100411903 | 184 |
| 154 | 3300005843 | Ga0068860_100520276 | Ga0068860_1005202762 | 184 |
| 155 | 3300006175 | Ga0070712_100009069 | Ga0070712_1000090695 | 184 |
| 156 | 3300006237 | Ga0097621_100232488 | Ga0097621_1002324882 | 184 |
| 157 | 3300006358 | Ga0068871_100170481 | Ga0068871_1001704812 | 184 |
| 158 | 3300006844 | Ga0075428_101565571 | Ga0075428_1015655712 | 184 |
| 159 | 3300006846 | Ga0075430_101043219 | Ga0075430_1010432191 | 184 |
| 160 | 3300006847 | Ga0075431_100739407 | Ga0075431_1007394072 | 184 |
| 161 | 3300006931 | Ga0097620_100383166 | Ga0097620_1003831662 | 184 |
| 162 | 3300009093 | Ga0105240_10061165 | Ga0105240_100611654 | 184 |
| 163 | 3300009177 | Ga0105248_10279953 | Ga0105248_102799531 | 184 |
| 164 | 3300013296 | Ga0157374_10796614 | Ga0157374_107966142 | 184 |
| 165 | 3300013297 | Ga0157378_10154932 | Ga0157378_101549323 | 184 |
| 166 | 3300013306 | Ga0163162_10089873 | Ga0163162_100898732 | 184 |
| 167 | 3300013308 | Ga0157375_10525965 | Ga0157375_105259651 | 184 |
| 168 | 3300014325 | Ga0163163_10125979 | Ga0163163_101259792 | 184 |
| 169 | 3300014969 | Ga0157376_10286370 | Ga0157376_102863701 | 184 |
| 170 | 3300025898 | Ga0207692_10211911 | Ga0207692_102119112 | 184 |
| 171 | 3300025913 | Ga0207695_10059332 | Ga0207695_100593326 | 184 |
| 172 | 3300025915 | Ga0207693_10011601 | Ga0207693_100116014 | 184 |
| 173 | 3300025916 | Ga0207663_10028718 | Ga0207663_100287184 | 184 |
| 174 | 3300025917 | Ga0207660_10003669 | Ga0207660_100036694 | 184 |
| 175 | 3300025926 | Ga0207659_10691245 | Ga0207659_106912451 | 184 |
| 176 | 3300025927 | Ga0207687_10444066 | Ga0207687_104440661 | 184 |
| 177 | 3300025941 | Ga0207711_10275865 | Ga0207711_102758652 | 184 |
| 178 | 3300025945 | Ga0207679_10973138 | Ga0207679_109731381 | 184 |
| 179 | 3300025960 | Ga0207651_10403096 | Ga0207651_104030962 | 184 |
| 180 | 3300025986 | Ga0207658_10075425 | Ga0207658_100754254 | 184 |
| 181 | 3300026095 | Ga0207676_10066942 | Ga0207676_100669423 | 184 |
| 182 | 3300026142 | Ga0207698_10302953 | Ga0207698_103029532 | 184 |
| 183 | 3300027617 | Ga0210002_1002786 | Ga0210002_10027862 | 184 |
| 184 | 3300027717 | Ga0209998_10004255 | Ga0209998_100042552 | 184 |
| 185 | 3300027876 | Ga0209974_10000290 | Ga0209974_100002906 | 184 |
| 186 | 3300028381 | Ga0268264_10590675 | Ga0268264_105906751 | 184 |
| 187 | 3300037466 | Ga0395898_0978218 | Ga0395898_0978218_210_767 | 184 |
| 188 | 3300037471 | Ga0395905_0025350 | Ga0395905_0025350_3184_3741 | 184 |
| 189 | 3300038443 | Ga0395901_0536371 | Ga0395901_0536371_534_1091 | 184 |
| 190 | 3300044842 | Ga0466957_0529767 | Ga0466957_0529767_98_658 | 184 |
| 191 | 3300050509 | nmdc:mga0qj67_103413_c1 | nmdc:mga0qj67_103413_c1_52_606 | 184 |
| 192 | 3300003323 | rootH1_10151850 | rootH1_101518504 | 185 |
| 193 | 3300003323 | rootH1_10154437 | rootH1_101544373 | 185 |
| 194 | 3300005295 | Ga0065707_10305419 | Ga0065707_103054191 | 185 |
| 195 | 3300005329 | Ga0070683_100001155 | Ga0070683_1000011558 | 185 |
| 196 | 3300005329 | Ga0070683_100964488 | Ga0070683_1009644882 | 185 |
| 197 | 3300005331 | Ga0070670_100304818 | Ga0070670_1003048182 | 185 |
| 198 | 3300005335 | Ga0070666_10077245 | Ga0070666_100772452 | 185 |
| 199 | 3300005338 | Ga0068868_100902566 | Ga0068868_1009025661 | 185 |
| 200 | 3300005339 | Ga0070660_100112134 | Ga0070660_1001121342 | 185 |
| 201 | 3300005340 | Ga0070689_100043820 | Ga0070689_1000438202 | 185 |
| 202 | 3300005344 | Ga0070661_100539050 | Ga0070661_1005390502 | 185 |
| 203 | 3300005344 | Ga0070661_100819941 | Ga0070661_1008199411 | 185 |
| 204 | 3300005355 | Ga0070671_100229860 | Ga0070671_1002298602 | 185 |
| 205 | 3300005364 | Ga0070673_100004663 | Ga0070673_1000046637 | 185 |
| 206 | 3300005365 | Ga0070688_100008261 | Ga0070688_1000082613 | 185 |
| 207 | 3300005367 | Ga0070667_100391371 | Ga0070667_1003913712 | 185 |
| 208 | 3300005438 | Ga0070701_10320998 | Ga0070701_103209982 | 185 |
| 209 | 3300005440 | Ga0070705_101234541 | Ga0070705_1012345411 | 185 |
| 210 | 3300005441 | Ga0070700_100000215 | Ga0070700_10000021511 | 185 |
| 211 | 3300005466 | Ga0070685_10006672 | Ga0070685_100066723 | 185 |
| 212 | 3300005471 | Ga0070698_100021945 | Ga0070698_1000219458 | 185 |
| 213 | 3300005518 | Ga0070699_100004158 | Ga0070699_1000041588 | 185 |
| 214 | 3300005530 | Ga0070679_100037531 | Ga0070679_1000375314 | 185 |
| 215 | 3300005530 | Ga0070679_100204752 | Ga0070679_1002047522 | 185 |
| 216 | 3300005535 | Ga0070684_100226566 | Ga0070684_1002265662 | 185 |
| 217 | 3300005535 | Ga0070684_101235926 | Ga0070684_1012359261 | 185 |
| 218 | 3300005536 | Ga0070697_101067065 | Ga0070697_1010670651 | 185 |
| 219 | 3300005539 | Ga0068853_100553694 | Ga0068853_1005536942 | 185 |
| 220 | 3300005543 | Ga0070672_100226053 | Ga0070672_1002260532 | 185 |
| 221 | 3300005543 | Ga0070672_100783595 | Ga0070672_1007835952 | 185 |
| 222 | 3300005547 | Ga0070693_100300506 | Ga0070693_1003005062 | 185 |
| 223 | 3300005548 | Ga0070665_100021880 | Ga0070665_1000218802 | 185 |
| 224 | 3300005548 | Ga0070665_100047801 | Ga0070665_1000478014 | 185 |
| 225 | 3300005548 | Ga0070665_100100503 | Ga0070665_1001005035 | 185 |
| 226 | 3300005548 | Ga0070665_100312664 | Ga0070665_1003126642 | 185 |
| 227 | 3300005548 | Ga0070665_100839814 | Ga0070665_1008398142 | 185 |
| 228 | 3300005563 | Ga0068855_100134458 | Ga0068855_1001344585 | 185 |
| 229 | 3300005563 | Ga0068855_100409189 | Ga0068855_1004091893 | 185 |
| 230 | 3300005564 | Ga0070664_101478843 | Ga0070664_1014788431 | 185 |
| 231 | 3300005614 | Ga0068856_100130276 | Ga0068856_1001302762 | 185 |
| 232 | 3300005615 | Ga0070702_100662394 | Ga0070702_1006623941 | 185 |
| 233 | 3300005616 | Ga0068852_100442241 | Ga0068852_1004422412 | 185 |
| 234 | 3300005719 | Ga0068861_100040505 | Ga0068861_1000405053 | 185 |
| 235 | 3300005841 | Ga0068863_100089907 | Ga0068863_1000899073 | 185 |
| 236 | 3300005841 | Ga0068863_100966132 | Ga0068863_1009661322 | 185 |
| 237 | 3300005842 | Ga0068858_100796122 | Ga0068858_1007961221 | 185 |
| 238 | 3300005842 | Ga0068858_101267145 | Ga0068858_1012671451 | 185 |
| 239 | 3300006038 | Ga0075365_10005358 | Ga0075365_100053583 | 185 |
| 240 | 3300006038 | Ga0075365_10448745 | Ga0075365_104487452 | 185 |
| 241 | 3300006042 | Ga0075368_10018728 | Ga0075368_100187283 | 185 |
| 242 | 3300006048 | Ga0075363_100149199 | Ga0075363_1001491992 | 185 |
| 243 | 3300006051 | Ga0075364_10009806 | Ga0075364_100098064 | 185 |
| 244 | 3300006051 | Ga0075364_10149987 | Ga0075364_101499872 | 185 |
| 245 | 3300006177 | Ga0075362_10163960 | Ga0075362_101639602 | 185 |
| 246 | 3300006178 | Ga0075367_10040194 | Ga0075367_100401943 | 185 |
| 247 | 3300006178 | Ga0075367_10122875 | Ga0075367_101228751 | 185 |
| 248 | 3300006178 | Ga0075367_10202439 | Ga0075367_102024392 | 185 |
| 249 | 3300006195 | Ga0075366_10036564 | Ga0075366_100365641 | 185 |
| 250 | 3300006195 | Ga0075366_10141629 | Ga0075366_101416293 | 185 |
| 251 | 3300006237 | Ga0097621_100095098 | Ga0097621_1000950985 | 185 |
| 252 | 3300006353 | Ga0075370_10004635 | Ga0075370_100046354 | 185 |
| 253 | 3300006353 | Ga0075370_10056087 | Ga0075370_100560872 | 185 |
| 254 | 3300006358 | Ga0068871_100135177 | Ga0068871_1001351772 | 185 |
| 255 | 3300006844 | Ga0075428_100131138 | Ga0075428_1001311383 | 185 |
| 256 | 3300006844 | Ga0075428_100172899 | Ga0075428_1001728992 | 185 |
| 257 | 3300006846 | Ga0075430_100044744 | Ga0075430_1000447442 | 185 |
| 258 | 3300006847 | Ga0075431_100224139 | Ga0075431_1002241393 | 185 |
| 259 | 3300006852 | Ga0075433_10587059 | Ga0075433_105870592 | 185 |
| 260 | 3300006871 | Ga0075434_100037503 | Ga0075434_1000375034 | 185 |
| 261 | 3300006880 | Ga0075429_100010861 | Ga0075429_1000108618 | 185 |
| 262 | 3300006880 | Ga0075429_100535283 | Ga0075429_1005352832 | 185 |
| 263 | 3300009093 | Ga0105240_10118364 | Ga0105240_101183642 | 185 |
| 264 | 3300009093 | Ga0105240_10620165 | Ga0105240_106201652 | 185 |
| 265 | 3300009093 | Ga0105240_11406433 | Ga0105240_114064331 | 185 |
| 266 | 3300009094 | Ga0111539_10199748 | Ga0111539_101997482 | 185 |
| 267 | 3300009147 | Ga0114129_10060019 | Ga0114129_100600194 | 185 |
| 268 | 3300009147 | Ga0114129_10067019 | Ga0114129_100670196 | 185 |
| 269 | 3300009176 | Ga0105242_10361690 | Ga0105242_103616902 | 185 |
| 270 | 3300009176 | Ga0105242_10959463 | Ga0105242_109594631 | 185 |
| 271 | 3300011119 | Ga0105246_10618620 | Ga0105246_106186202 | 185 |
| 272 | 3300013104 | Ga0157370_10105121 | Ga0157370_101051215 | 185 |
| 273 | 3300014968 | Ga0157379_10139467 | Ga0157379_101394673 | 185 |
| 274 | 3300025297 | Ga0209758_1083880 | Ga0209758_10838802 | 185 |
| 275 | 3300025903 | Ga0207680_10033812 | Ga0207680_100338123 | 185 |
| 276 | 3300025907 | Ga0207645_10247689 | Ga0207645_102476891 | 185 |
| 277 | 3300025909 | Ga0207705_10312076 | Ga0207705_103120762 | 185 |
| 278 | 3300025913 | Ga0207695_10158453 | Ga0207695_101584533 | 185 |
| 279 | 3300025914 | Ga0207671_10267986 | Ga0207671_102679862 | 185 |
| 280 | 3300025914 | Ga0207671_10342339 | Ga0207671_103423392 | 185 |
| 281 | 3300025914 | Ga0207671_10386259 | Ga0207671_103862592 | 185 |
| 282 | 3300025919 | Ga0207657_10010276 | Ga0207657_100102765 | 185 |
| 283 | 3300025924 | Ga0207694_10459624 | Ga0207694_104596241 | 185 |
| 284 | 3300025941 | Ga0207711_10004950 | Ga0207711_100049507 | 185 |
| 285 | 3300025944 | Ga0207661_10011512 | Ga0207661_100115123 | 185 |
| 286 | 3300025944 | Ga0207661_10072701 | Ga0207661_100727014 | 185 |
| 287 | 3300025944 | Ga0207661_10877382 | Ga0207661_108773822 | 185 |
| 288 | 3300025981 | Ga0207640_10669992 | Ga0207640_106699921 | 185 |
| 289 | 3300025986 | Ga0207658_10131569 | Ga0207658_101315692 | 185 |
| 290 | 3300025986 | Ga0207658_10807001 | Ga0207658_108070012 | 185 |
| 291 | 3300026023 | Ga0207677_11219902 | Ga0207677_112199022 | 185 |
| 292 | 3300026041 | Ga0207639_10364894 | Ga0207639_103648942 | 185 |
| 293 | 3300026041 | Ga0207639_10378068 | Ga0207639_103780682 | 185 |
| 294 | 3300026041 | Ga0207639_10534793 | Ga0207639_105347931 | 185 |
| 295 | 3300026075 | Ga0207708_10000126 | Ga0207708_100001263 | 185 |
| 296 | 3300026088 | Ga0207641_10459299 | Ga0207641_104592992 | 185 |
| 297 | 3300026088 | Ga0207641_10505860 | Ga0207641_105058602 | 185 |
| 298 | 3300026118 | Ga0207675_100031989 | Ga0207675_1000319893 | 185 |
| 299 | 3300026121 | Ga0207683_10045779 | Ga0207683_100457794 | 185 |
| 300 | 3300026142 | Ga0207698_10053339 | Ga0207698_100533396 | 185 |
| 301 | 3300026142 | Ga0207698_10265422 | Ga0207698_102654222 | 185 |
| 302 | 3300028379 | Ga0268266_10059589 | Ga0268266_100595892 | 185 |
| 303 | 3300028379 | Ga0268266_10417185 | Ga0268266_104171853 | 185 |
| 304 | 3300028379 | Ga0268266_10721193 | Ga0268266_107211932 | 185 |
| 305 | 3300028794 | Ga0307515_10000018 | Ga0307515_10000018331 | 185 |
| 306 | 3300031548 | Ga0307408_100004179 | Ga0307408_1000041797 | 185 |
| 307 | 3300031731 | Ga0307405_10002374 | Ga0307405_100023742 | 185 |
| 308 | 3300031824 | Ga0307413_10031519 | Ga0307413_100315192 | 185 |
| 309 | 3300031901 | Ga0307406_11116806 | Ga0307406_111168061 | 185 |
| 310 | 3300031903 | Ga0307407_10203494 | Ga0307407_102034942 | 185 |
| 311 | 3300032004 | Ga0307414_10042551 | Ga0307414_100425512 | 185 |
| 312 | 3300032126 | Ga0307415_100057000 | Ga0307415_1000570002 | 185 |
| 313 | 3300042012 | Ga0439455_0008349 | Ga0439455_0008349_1432_1992 | 185 |
| 314 | 3300042157 | Ga0439458_0006193 | Ga0439458_0006193_1302_1862 | 185 |
| 315 | 3300046460 | Ga0495638_0027229 | Ga0495638_0027229_294_851 | 185 |
| 316 | 3300046538 | Ga0495609_0026507 | Ga0495609_0026507_1384_1950 | 185 |
| 317 | 3300047320 | Ga0495672_0005369 | Ga0495672_0005369_444_1001 | 185 |
| 318 | 3300049569 | Ga0501032_0167902 | Ga0501032_0167902_51_608 | 185 |
| 319 | 3300049570 | Ga0501033_0674139 | Ga0501033_0674139_68_625 | 185 |
| 320 | 3300049574 | Ga0501038_0190066 | Ga0501038_0190066_89_649 | 185 |
| 321 | 3300049575 | Ga0501039_0089418 | Ga0501039_0089418_645_1202 | 185 |
| 322 | 3300049577 | Ga0501041_0159852 | Ga0501041_0159852_127_684 | 185 |
| 323 | 3300049578 | Ga0501042_0001234 | Ga0501042_0001234_13050_13607 | 185 |
| 324 | 3300049579 | Ga0501043_0489228 | Ga0501043_0489228_64_624 | 185 |
| 325 | 3300049581 | Ga0501047_0188624 | Ga0501047_0188624_797_1357 | 185 |
| 326 | 3300049582 | Ga0501048_0025864 | Ga0501048_0025864_3443_4000 | 185 |
| 327 | 3300049586 | Ga0501070_0316570 | Ga0501070_0316570_595_1155 | 185 |
| 328 | 3300049587 | Ga0501071_0029971 | Ga0501071_0029971_1596_2153 | 185 |
| 329 | 3300049588 | Ga0501072_0270015 | Ga0501072_0270015_708_1265 | 185 |
| 330 | 3300049589 | Ga0501073_0108136 | Ga0501073_0108136_51_608 | 185 |
| 331 | 3300049591 | Ga0501075_0027550 | Ga0501075_0027550_1191_1748 | 185 |
| 332 | 3300049592 | Ga0501076_0004492 | Ga0501076_0004492_1069_1626 | 185 |
| 333 | 3300049741 | Ga0501079_0068983 | Ga0501079_0068983_1907_2464 | 185 |
| 334 | 3300049742 | Ga0501080_0493986 | Ga0501080_0493986_135_692 | 185 |
| 335 | 3300050489 | nmdc:mga03683_54381_c1 | nmdc:mga03683_54381_c1_878_1435 | 185 |
| 336 | 3300050490 | nmdc:mga03n38_145079_c1 | nmdc:mga03n38_145079_c1_387_944 | 185 |
| 337 | 3300050491 | nmdc:mga00v17_132754_c1 | nmdc:mga00v17_132754_c1_284_841 | 185 |
| 338 | 3300050492 | nmdc:mga0yw44_459043_c1 | nmdc:mga0yw44_459043_c1_43_600 | 185 |
| 339 | 3300050493 | nmdc:mga0k408_87254_c1 | nmdc:mga0k408_87254_c1_85_642 | 185 |
| 340 | 3300050494 | nmdc:mga06z11_4577_c1 | nmdc:mga06z11_4577_c1_3242_3799 | 185 |
| 341 | 3300050507 | nmdc:mga05p37_1022670_c1 | nmdc:mga05p37_1022670_c1_144_701 | 185 |
| 342 | 3300050507 | nmdc:mga05p37_109575_c1 | nmdc:mga05p37_109575_c1_2075_2632 | 185 |
| 343 | 3300050508 | nmdc:mga09592_271153_c1 | nmdc:mga09592_271153_c1_105_662 | 185 |
| 344 | 3300050508 | nmdc:mga09592_9463_c1 | nmdc:mga09592_9463_c1_7091_7651 | 185 |
| 345 | 3300050509 | nmdc:mga0qj67_100824_c1 | nmdc:mga0qj67_100824_c1_480_1037 | 185 |
| 346 | 3300050509 | nmdc:mga0qj67_8203_c1 | nmdc:mga0qj67_8203_c1_6324_6881 | 185 |
| 347 | 3300050510 | nmdc:mga06r32_16653_c1 | nmdc:mga06r32_16653_c1_599_1156 | 185 |
| 348 | 3300050512 | nmdc:mga0n895_96349_c1 | nmdc:mga0n895_96349_c1_2312_2872 | 185 |
| 349 | 3300050515 | nmdc:mga0a205_29616_c1 | nmdc:mga0a205_29616_c1_3695_4255 | 185 |
| 350 | 3300054114 | Ga0501084_0163182 | Ga0501084_0163182_1014_1571 | 185 |
| 351 | 3300060353 | Ga0501082_0089085 | Ga0501082_0089085_1601_2158 | 185 |
| 352 | 3300002067 | JGI24735J21928_10023417 | JGI24735J21928_100234172 | 186 |
| 353 | 3300005290 | Ga0065712_10153151 | Ga0065712_101531512 | 186 |
| 354 | 3300005293 | Ga0065715_10032149 | Ga0065715_100321492 | 186 |
| 355 | 3300005295 | Ga0065707_10092599 | Ga0065707_100925994 | 186 |
| 356 | 3300005295 | Ga0065707_10121915 | Ga0065707_101219153 | 186 |
| 357 | 3300005327 | Ga0070658_10348609 | Ga0070658_103486092 | 186 |
| 358 | 3300005329 | Ga0070683_100150815 | Ga0070683_1001508153 | 186 |
| 359 | 3300005435 | Ga0070714_100578636 | Ga0070714_1005786361 | 186 |
| 360 | 3300005438 | Ga0070701_10287637 | Ga0070701_102876372 | 186 |
| 361 | 3300005439 | Ga0070711_100103827 | Ga0070711_1001038274 | 186 |
| 362 | 3300005445 | Ga0070708_100017244 | Ga0070708_1000172442 | 186 |
| 363 | 3300005445 | Ga0070708_100528251 | Ga0070708_1005282512 | 186 |
| 364 | 3300005445 | Ga0070708_100704760 | Ga0070708_1007047601 | 186 |
| 365 | 3300005458 | Ga0070681_10312779 | Ga0070681_103127792 | 186 |
| 366 | 3300005471 | Ga0070698_100000010 | Ga0070698_10000001047 | 186 |
| 367 | 3300005471 | Ga0070698_100251670 | Ga0070698_1002516702 | 186 |
| 368 | 3300005471 | Ga0070698_100283485 | Ga0070698_1002834852 | 186 |
| 369 | 3300005471 | Ga0070698_100643720 | Ga0070698_1006437202 | 186 |
| 370 | 3300005518 | Ga0070699_100093275 | Ga0070699_1000932752 | 186 |
| 371 | 3300005518 | Ga0070699_100460663 | Ga0070699_1004606632 | 186 |
| 372 | 3300005530 | Ga0070679_100226404 | Ga0070679_1002264042 | 186 |
| 373 | 3300005545 | Ga0070695_100285552 | Ga0070695_1002855522 | 186 |
| 374 | 3300005546 | Ga0070696_100740788 | Ga0070696_1007407881 | 186 |
| 375 | 3300005549 | Ga0070704_100743122 | Ga0070704_1007431221 | 186 |
| 376 | 3300005549 | Ga0070704_101314828 | Ga0070704_1013148281 | 186 |
| 377 | 3300005844 | Ga0068862_100150821 | Ga0068862_1001508212 | 186 |
| 378 | 3300006173 | Ga0070716_100000911 | Ga0070716_1000009119 | 186 |
| 379 | 3300006173 | Ga0070716_100630526 | Ga0070716_1006305262 | 186 |
| 380 | 3300006178 | Ga0075367_10041329 | Ga0075367_100413293 | 186 |
| 381 | 3300006353 | Ga0075370_10094668 | Ga0075370_100946683 | 186 |
| 382 | 3300006846 | Ga0075430_100010571 | Ga0075430_1000105714 | 186 |
| 383 | 3300006847 | Ga0075431_101295895 | Ga0075431_1012958951 | 186 |
| 384 | 3300006852 | Ga0075433_10053790 | Ga0075433_100537902 | 186 |
| 385 | 3300006871 | Ga0075434_100000316 | Ga0075434_10000031625 | 186 |
| 386 | 3300006880 | Ga0075429_100355669 | Ga0075429_1003556692 | 186 |
| 387 | 3300006914 | Ga0075436_100011111 | Ga0075436_10001111110 | 186 |
| 388 | 3300007076 | Ga0075435_100045521 | Ga0075435_1000455213 | 186 |
| 389 | 3300007076 | Ga0075435_100110188 | Ga0075435_1001101885 | 186 |
| 390 | 3300009093 | Ga0105240_10006679 | Ga0105240_100066797 | 186 |
| 391 | 3300009094 | Ga0111539_10071221 | Ga0111539_100712214 | 186 |
| 392 | 3300009098 | Ga0105245_10672920 | Ga0105245_106729202 | 186 |
| 393 | 3300009174 | Ga0105241_11090491 | Ga0105241_110904911 | 186 |
| 394 | 3300009545 | Ga0105237_10001004 | Ga0105237_100010047 | 186 |
| 395 | 3300009551 | Ga0105238_10031933 | Ga0105238_100319334 | 186 |
| 396 | 3300009551 | Ga0105238_10090501 | Ga0105238_100905012 | 186 |
| 397 | 3300009553 | Ga0105249_10035688 | Ga0105249_100356885 | 186 |
| 398 | 3300013297 | Ga0157378_10001849 | Ga0157378_1000184914 | 186 |
| 399 | 3300013297 | Ga0157378_10667767 | Ga0157378_106677672 | 186 |
| 400 | 3300013297 | Ga0157378_10667768 | Ga0157378_106677682 | 186 |
| 401 | 3300014326 | Ga0157380_10850999 | Ga0157380_108509992 | 186 |
| 402 | 3300014326 | Ga0157380_11089808 | Ga0157380_110898081 | 186 |
| 403 | 3300014326 | Ga0157380_11510325 | Ga0157380_115103251 | 186 |
| 404 | 3300021384 | Ga0213876_10015050 | Ga0213876_100150504 | 186 |
| 405 | 3300025885 | Ga0207653_10031777 | Ga0207653_100317771 | 186 |
| 406 | 3300025906 | Ga0207699_10001465 | Ga0207699_100014655 | 186 |
| 407 | 3300025909 | Ga0207705_10526009 | Ga0207705_105260092 | 186 |
| 408 | 3300025912 | Ga0207707_10403414 | Ga0207707_104034142 | 186 |
| 409 | 3300025913 | Ga0207695_10013238 | Ga0207695_100132386 | 186 |
| 410 | 3300025914 | Ga0207671_10029691 | Ga0207671_100296914 | 186 |
| 411 | 3300025924 | Ga0207694_10000741 | Ga0207694_1000074118 | 186 |
| 412 | 3300025924 | Ga0207694_10048867 | Ga0207694_100488672 | 186 |
| 413 | 3300025926 | Ga0207659_10720566 | Ga0207659_107205661 | 186 |
| 414 | 3300025929 | Ga0207664_10629395 | Ga0207664_106293952 | 186 |
| 415 | 3300025939 | Ga0207665_10000385 | Ga0207665_1000038528 | 186 |
| 416 | 3300025944 | Ga0207661_10187855 | Ga0207661_101878552 | 186 |
| 417 | 3300027717 | Ga0209998_10028256 | Ga0209998_100282562 | 186 |
| 418 | 3300027876 | Ga0209974_10031326 | Ga0209974_100313262 | 186 |
| 419 | 3300028380 | Ga0268265_10155182 | Ga0268265_101551823 | 186 |
| 420 | 3300028577 | Ga0265318_10170618 | Ga0265318_101706182 | 186 |
| 421 | 3300031616 | Ga0307508_10000120 | Ga0307508_1000012037 | 186 |
| 422 | 3300031616 | Ga0307508_10100203 | Ga0307508_101002033 | 186 |
| 423 | 3300034820 | Ga0373959_0033445 | Ga0373959_0033445_84_650 | 186 |
| 424 | 3300035114 | Ga0373939_0071960 | Ga0373939_0071960_170_736 | 186 |
| 425 | 3300035691 | Ga0373931_0293963 | Ga0373931_0293963_280_846 | 186 |
| 426 | 3300039437 | Ga0436365_0910109 | Ga0436365_0910109_4123_4689 | 186 |
| 427 | 3300044712 | Ga0453684_0014979 | Ga0453684_0014979_8984_9550 | 186 |
| 428 | 3300045051 | Ga0451576_0681968 | Ga0451576_0681968_94_660 | 186 |
| 429 | 3300046615 | Ga0495656_0211561 | Ga0495656_0211561_317_877 | 186 |
| 430 | 3300048911 | Ga0496108_0279390 | Ga0496108_0279390_681_1265 | 186 |
| 431 | 3300048913 | Ga0496110_0017935 | Ga0496110_0017935_4486_5058 | 186 |
| 432 | 3300048916 | Ga0496113_0082844 | Ga0496113_0082844_373_957 | 186 |
| 433 | 3300048929 | Ga0496126_0019777 | Ga0496126_0019777_974_1534 | 186 |
| 434 | 3300049590 | Ga0501074_0321340 | Ga0501074_0321340_320_886 | 186 |
| 435 | 3300049742 | Ga0501080_0790174 | Ga0501080_0790174_162_731 | 186 |
| 436 | 3300049743 | Ga0501081_0657131 | Ga0501081_0657131_35_601 | 186 |
| 437 | 3300050507 | nmdc:mga05p37_1086803_c1 | nmdc:mga05p37_1086803_c1_75_638 | 186 |
| 438 | 3300050508 | nmdc:mga09592_330253_c1 | nmdc:mga09592_330253_c1_642_1205 | 186 |
| 439 | 3300050509 | nmdc:mga0qj67_13572_c1 | nmdc:mga0qj67_13572_c1_1989_2552 | 186 |
| 440 | 3300050510 | nmdc:mga06r32_41201_c1 | nmdc:mga06r32_41201_c1_3743_4306 | 186 |
| 441 | 3300050512 | nmdc:mga0n895_5259_c1 | nmdc:mga0n895_5259_c1_3073_3633 | 186 |
| 442 | 3300050513 | nmdc:mga0rr50_22551_c2 | nmdc:mga0rr50_22551_c2_1704_2264 | 186 |
| 443 | 3300050514 | nmdc:mga08x19_3394_c1 | nmdc:mga08x19_3394_c1_667_1233 | 186 |
| 444 | 3300050515 | nmdc:mga0a205_64052_c1 | nmdc:mga0a205_64052_c1_2200_2760 | 186 |
| 445 | 3300060353 | Ga0501082_0287323 | Ga0501082_0287323_153_719 | 186 |
| 446 | 3300005434 | Ga0070709_10004567 | Ga0070709_100045673 | 187 |
| 447 | 3300005435 | Ga0070714_100004779 | Ga0070714_1000047795 | 187 |
| 448 | 3300005436 | Ga0070713_100000888 | Ga0070713_10000088812 | 187 |
| 449 | 3300005439 | Ga0070711_100000613 | Ga0070711_1000006135 | 187 |
| 450 | 3300005445 | Ga0070708_100014475 | Ga0070708_1000144757 | 187 |
| 451 | 3300005445 | Ga0070708_100060060 | Ga0070708_1000600605 | 187 |
| 452 | 3300005467 | Ga0070706_100140078 | Ga0070706_1001400782 | 187 |
| 453 | 3300005468 | Ga0070707_100375095 | Ga0070707_1003750952 | 187 |
| 454 | 3300005616 | Ga0068852_100903948 | Ga0068852_1009039482 | 187 |
| 455 | 3300006175 | Ga0070712_100000065 | Ga0070712_10000006548 | 187 |
| 456 | 3300006844 | Ga0075428_100237482 | Ga0075428_1002374822 | 187 |
| 457 | 3300006844 | Ga0075428_100253049 | Ga0075428_1002530492 | 187 |
| 458 | 3300006847 | Ga0075431_100005349 | Ga0075431_1000053496 | 187 |
| 459 | 3300006852 | Ga0075433_10001869 | Ga0075433_1000186921 | 187 |
| 460 | 3300006871 | Ga0075434_100018537 | Ga0075434_1000185373 | 187 |
| 461 | 3300006871 | Ga0075434_100206787 | Ga0075434_1002067872 | 187 |
| 462 | 3300007076 | Ga0075435_100020135 | Ga0075435_1000201353 | 187 |
| 463 | 3300007788 | Ga0099795_10289491 | Ga0099795_102894912 | 187 |
| 464 | 3300009147 | Ga0114129_10061053 | Ga0114129_100610532 | 187 |
| 465 | 3300009177 | Ga0105248_10803189 | Ga0105248_108031892 | 187 |
| 466 | 3300013297 | Ga0157378_10031792 | Ga0157378_100317922 | 187 |
| 467 | 3300013308 | Ga0157375_10428306 | Ga0157375_104283062 | 187 |
| 468 | 3300025905 | Ga0207685_10081314 | Ga0207685_100813143 | 187 |
| 469 | 3300025906 | Ga0207699_10013464 | Ga0207699_100134645 | 187 |
| 470 | 3300025910 | Ga0207684_10118351 | Ga0207684_101183512 | 187 |
| 471 | 3300025915 | Ga0207693_10000022 | Ga0207693_1000002282 | 187 |
| 472 | 3300025922 | Ga0207646_10375782 | Ga0207646_103757822 | 187 |
| 473 | 3300025928 | Ga0207700_10000056 | Ga0207700_100000568 | 187 |
| 474 | 3300025929 | Ga0207664_10007547 | Ga0207664_100075474 | 187 |
| 475 | 3300028800 | Ga0265338_10141799 | Ga0265338_101417992 | 187 |
| 476 | 3300028800 | Ga0265338_10195712 | Ga0265338_101957122 | 187 |
| 477 | 3300028800 | Ga0265338_10535449 | Ga0265338_105354491 | 187 |
| 478 | 3300031241 | Ga0265325_10026933 | Ga0265325_100269333 | 187 |
| 479 | 3300031241 | Ga0265325_10097809 | Ga0265325_100978091 | 187 |
| 480 | 3300031247 | Ga0265340_10382931 | Ga0265340_103829311 | 187 |
| 481 | 3300031249 | Ga0265339_10021647 | Ga0265339_100216474 | 187 |
| 482 | 3300031249 | Ga0265339_10062547 | Ga0265339_100625472 | 187 |
| 483 | 3300031249 | Ga0265339_10337556 | Ga0265339_103375561 | 187 |
| 484 | 3300031711 | Ga0265314_10032642 | Ga0265314_100326424 | 187 |
| 485 | 3300035086 | Ga0373934_0103577 | Ga0373934_0103577_100_666 | 187 |
| 486 | 3300035089 | Ga0373944_0047092 | Ga0373944_0047092_104_670 | 187 |
| 487 | 3300035111 | Ga0373923_0059597 | Ga0373923_0059597_1014_1580 | 187 |
| 488 | 3300035113 | Ga0373936_0010571 | Ga0373936_0010571_2133_2699 | 187 |
| 489 | 3300035171 | Ga0373946_0038492 | Ga0373946_0038492_337_903 | 187 |
| 490 | 3300035692 | Ga0373935_0022427 | Ga0373935_0022427_1719_2285 | 187 |
| 491 | 3300035724 | Ga0373933_0032336 | Ga0373933_0032336_1493_2059 | 187 |
| 492 | 3300036401 | Ga0373937_0309292 | Ga0373937_0309292_312_878 | 187 |
| 493 | 3300046460 | Ga0495638_0040965 | Ga0495638_0040965_469_1032 | 187 |
| 494 | 3300046477 | Ga0495664_0198404 | Ga0495664_0198404_381_947 | 187 |
| 495 | 3300046517 | Ga0495630_0077911 | Ga0495630_0077911_980_1546 | 187 |
| 496 | 3300046559 | Ga0495667_0156819 | Ga0495667_0156819_481_1047 | 187 |
| 497 | 3300047319 | Ga0495674_0004353 | Ga0495674_0004353_3869_4435 | 187 |
| 498 | 3300047471 | Ga0495684_0573532 | Ga0495684_0573532_117_683 | 187 |
| 499 | 3300048908 | Ga0496105_0156533 | Ga0496105_0156533_1092_1658 | 187 |
| 500 | 3300048917 | Ga0496114_0067860 | Ga0496114_0067860_880_1446 | 187 |
| 501 | 3300048918 | Ga0496115_0007463 | Ga0496115_0007463_2243_2809 | 187 |
| 502 | 3300049460 | Ga0495682_0036877 | Ga0495682_0036877_377_940 | 187 |
| 503 | 3300050496 | nmdc:mga07m45_103136_c1 | nmdc:mga07m45_103136_c1_785_1351 | 187 |
| 504 | 3300050507 | nmdc:mga05p37_115525_c1 | nmdc:mga05p37_115525_c1_2003_2572 | 187 |
| 505 | 3300050509 | nmdc:mga0qj67_45088_c1 | nmdc:mga0qj67_45088_c1_2080_2670 | 187 |
| 506 | 3300050510 | nmdc:mga06r32_1992_c1 | nmdc:mga06r32_1992_c1_7734_8303 | 187 |
| 507 | 3300050512 | nmdc:mga0n895_86840_c1 | nmdc:mga0n895_86840_c1_1849_2412 | 187 |
| 508 | 3300050513 | nmdc:mga0rr50_67600_c1 | nmdc:mga0rr50_67600_c1_1531_2094 | 187 |
| 509 | 3300009098 | Ga0105245_10151334 | Ga0105245_101513343 | 188 |
| 510 | 3300009553 | Ga0105249_10498601 | Ga0105249_104986012 | 188 |
| 511 | 3300014969 | Ga0157376_11641127 | Ga0157376_116411271 | 188 |
| 512 | 3300048909 | Ga0496106_0003995 | Ga0496106_0003995_510_1076 | 188 |
| 513 | 3300048920 | Ga0496117_0016272 | Ga0496117_0016272_1100_1666 | 188 |
| 514 | 3300048921 | Ga0496118_0002345 | Ga0496118_0002345_9735_10301 | 188 |
| 515 | 3300048922 | Ga0496119_0436642 | Ga0496119_0436642_28_594 | 188 |
| 516 | 3300048924 | Ga0496121_0003002 | Ga0496121_0003002_9824_10390 | 188 |
| 517 | 3300048927 | Ga0496124_0005039 | Ga0496124_0005039_4955_5521 | 188 |
| 518 | 3300048929 | Ga0496126_0025870 | Ga0496126_0025870_187_753 | 188 |
| 519 | 2162886006 | SwRhRL3b_contig_3264281 | SwRhRL3b_0188.00000370 | 189 |
| 520 | 2162886007 | SwRhRL2b_contig_3588356 | SwRhRL2b_0044.00005490 | 189 |
| 521 | 3300009553 | Ga0105249_10113174 | Ga0105249_101131743 | 189 |
| 522 | 3300035083 | Ga0373926_0027645 | Ga0373926_0027645_1147_1740 | 189 |
| 523 | 3300035170 | Ga0373943_0269354 | Ga0373943_0269354_245_838 | 189 |
| 524 | 3300035725 | Ga0373947_0016057 | Ga0373947_0016057_961_1545 | 189 |
| 525 | 3300037471 | Ga0395905_0525315 | Ga0395905_0525315_326_952 | 189 |
| 526 | 3300046459 | Ga0495629_0154438 | Ga0495629_0154438_607_1200 | 189 |
| 527 | 3300046472 | Ga0495580_0000523 | Ga0495580_0000523_5716_6309 | 189 |
| 528 | 3300046473 | Ga0495582_0001022 | Ga0495582_0001022_1816_2409 | 189 |
| 529 | 3300047315 | Ga0495581_0249319 | Ga0495581_0249319_124_717 | 189 |
| 530 | 3300048089 | Ga0495614_0251677 | Ga0495614_0251677_190_783 | 189 |
| 531 | 3300050508 | nmdc:mga09592_132559_c1 | nmdc:mga09592_132559_c1_778_1347 | 189 |
| 532 | 3300050511 | nmdc:mga08y16_974340_c1 | nmdc:mga08y16_974340_c1_106_675 | 189 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3jtw-assembly1.cif.gz_A-2 | crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution | 0.8276 | 4 | 188 |
| 1d1g-assembly1.cif.gz_B | dihydrofolate reductase from thermotoga maritima | 0.8256 | 5 | 188 |
| 3jtw-assembly1.cif.gz_A-2 | crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution | 0.8188 | 4 | 188 |
| 3ky8-assembly1.cif.gz_B | crystal structure of putative riboflavin biosynthesis protein (yp_001092907.1) from shewanella sp. pv-4 at 2.12 a resolution | 0.8167 | 5 | 189 |
| 1d1g-assembly1.cif.gz_B | dihydrofolate reductase from thermotoga maritima | 0.8164 | 5 | 188 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3ky8B01 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.8427 | 6 | 186 | 3.40.430.10 |
| 3ky8B01 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.8292 | 6 | 186 | 3.40.430.10 |
| 1cz3B00 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.8129 | 5 | 189 | 3.40.430.10 |
| 2gd9B01 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.8088 | 4 | 185 | 3.40.430.10 |
| 2gd9B01 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.8042 | 4 | 185 | 3.40.430.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Y5G0Q8-F1-model_v4 | Dihydrofolate reductase | 0.9961 | 3 | 189 |
GO:0008703
GO:0009231 |
| AF-A0A7Y5G0Q8-F1-model_v4 | Dihydrofolate reductase | 0.9908 | 3 | 189 |
GO:0008703
GO:0009231 |
| AF-A0A1B9SPR1-F1-model_v4 | Bacterial bifunctional deaminase-reductase C-terminal domain-containing protein | 0.984 | 3 | 188 |
GO:0008703
GO:0009231 |
| AF-Q6MQX9-F1-model_v4 | Putative secreted protein | 0.9813 | 1 | 188 |
GO:0008703
GO:0009231 |
| AF-A0A1B9SPR1-F1-model_v4 | Bacterial bifunctional deaminase-reductase C-terminal domain-containing protein | 0.9787 | 3 | 188 |
GO:0008703
GO:0009231 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar