F460264

General Info

Members Datasets Scaffolds Average Seq Length
532 305 532 186

Family's Representative Sequence

Representative Sequence 3300009553|Ga0105249_10498601|Ga0105249_104986012
Length 212
Sequence MSNSSVVVRLDHETWRSQMRKVHVFDNVSLDGYFTDAKNDMSWAHRQDEEWNAFAGGNASGDGELLFGRVTYEMMAAFWPTPQAAAMLPQVAAGMNRMRKSVFSRTLDSVSWQNTTLVKGDLVAEVEKMKRRPGPDLVIIGSGSIVSQLTEAGLIDEYQIVVNPLVLGKGRTLFETVQRKVGLTLTKTRAFKNGNVVLWYERASPRRGVDDA

Samples

Sample ID Description Type Environment
1 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
68 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
69 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
70 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
71 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
74 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
75 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
80 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
85 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
114 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
115 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
116 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
160 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
161 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
162 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
163 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
164 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
165 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
166 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
167 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
168 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
169 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
170 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
171 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
172 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
173 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
174 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
175 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
176 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
177 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
178 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
179 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
180 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
181 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
182 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
183 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
184 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
185 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
186 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
187 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
188 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
189 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
190 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
191 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
192 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
193 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
194 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
195 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
196 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
197 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
198 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
199 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
200 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
201 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
202 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
203 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
204 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
205 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
206 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
207 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
208 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
209 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
210 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
211 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
212 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
213 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
214 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
215 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
216 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
217 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
218 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
219 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
220 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
221 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
222 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
223 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
224 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
225 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
226 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
227 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
228 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
229 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
230 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
231 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
232 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
233 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
234 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
235 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
236 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
237 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
238 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
239 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
240 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
241 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
242 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
243 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
244 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
245 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
246 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
247 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
248 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
249 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
250 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
251 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
252 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
255 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
262 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
263 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
264 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
265 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
266 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
267 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
268 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
269 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
270 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
271 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
272 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
273 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
274 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
275 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
276 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
277 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
278 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
279 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
280 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
281 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
282 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
284 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
285 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
286 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
287 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
288 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
289 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
290 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
291 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
292 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
293 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
294 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
295 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
296 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
297 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
298 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
299 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
300 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
301 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
302 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
303 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
304 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
305 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.45
Nodule 0
Rhizoplane 1.32
Rhizosphere 90.23
Stem 0
Stem Tuber 0
Unclassified 3.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL3b_contig_3264281 2162886006 Bacteria 1661
2 SwRhRL2b_contig_3588356 2162886007 Bacteria 998
3 MBSR1b_contig_4902641 2162886012 Bacteria 1190
4 MBSR1b_contig_5893965 2162886012 Bacteria 1162
5 JGI24735J21928_10023417 3300002067 Unclassified 1873
6 rootH1_10151850 3300003323 Bacteria 6623
7 rootH1_10154437 3300003323 Bacteria 2551
8 Ga0065712_10153151 3300005290 Unclassified 1354
9 Ga0065715_10032149 3300005293 Bacteria 1716
10 Ga0065715_10382309 3300005293 Bacteria 905
11 Ga0065707_10092599 3300005295 Unclassified 3746
12 Ga0065707_10121915 3300005295 Bacteria 2089
13 Ga0065707_10305419 3300005295 Bacteria 995
14 Ga0070658_10003308 3300005327 Bacteria 13297
15 Ga0070658_10348609 3300005327 Bacteria 1267
16 Ga0070683_100001155 3300005329 Bacteria 19993
17 Ga0070683_100150815 3300005329 Unclassified 2204
18 Ga0070683_100964488 3300005329 Bacteria 818
19 Ga0070690_100360374 3300005330 Bacteria 1058
20 Ga0070670_100304818 3300005331 Bacteria 1394
21 Ga0068869_100316898 3300005334 Unclassified 1264
22 Ga0070666_10077245 3300005335 Bacteria 2273
23 Ga0070680_100025304 3300005336 Unclassified 4743
24 Ga0070682_100013753 3300005337 Unclassified 4665
25 Ga0068868_100902566 3300005338 Unclassified 803
26 Ga0070660_100112134 3300005339 Bacteria 2171
27 Ga0070689_100043820 3300005340 Bacteria 3441
28 Ga0070661_100539050 3300005344 Bacteria 938
29 Ga0070661_100610960 3300005344 Unclassified 882
30 Ga0070661_100819941 3300005344 Bacteria 764
31 Ga0070675_100296169 3300005354 Bacteria 1424
32 Ga0070671_100229860 3300005355 Bacteria 1574
33 Ga0070671_100313761 3300005355 Bacteria 1336
34 Ga0070673_100004663 3300005364 Bacteria 8702
35 Ga0070673_100441432 3300005364 Bacteria 1169
36 Ga0070688_100008261 3300005365 Bacteria 5643
37 Ga0070688_100420456 3300005365 Bacteria 993
38 Ga0070667_100126902 3300005367 Bacteria 2224
39 Ga0070667_100391371 3300005367 Bacteria 1264
40 Ga0070709_10004567 3300005434 Bacteria 7476
41 Ga0070714_100004779 3300005435 Bacteria 10264
42 Ga0070714_100578636 3300005435 Bacteria 1077
43 Ga0070713_100000888 3300005436 Bacteria 19171
44 Ga0070701_10287637 3300005438 Bacteria 1006
45 Ga0070701_10320998 3300005438 Unclassified 958
46 Ga0070711_100000613 3300005439 Bacteria 18618
47 Ga0070711_100103827 3300005439 Bacteria 2072
48 Ga0070705_100030803 3300005440 Bacteria 2965
49 Ga0070705_100033531 3300005440 Bacteria 2863
50 Ga0070705_101234541 3300005440 Unclassified 617
51 Ga0070700_100000215 3300005441 Bacteria 32331
52 Ga0070694_100244512 3300005444 Bacteria 1355
53 Ga0070708_100014475 3300005445 Bacteria 6491
54 Ga0070708_100017244 3300005445 Bacteria 6016
55 Ga0070708_100060060 3300005445 Bacteria 3392
56 Ga0070708_100528251 3300005445 Unclassified 1113
57 Ga0070708_100704760 3300005445 Bacteria 950
58 Ga0070708_100876691 3300005445 Unclassified 843
59 Ga0070681_10312779 3300005458 Bacteria 1480
60 Ga0070685_10006672 3300005466 Bacteria 5893
61 Ga0070706_100001047 3300005467 Bacteria 30011
62 Ga0070706_100140078 3300005467 Unclassified 2258
63 Ga0070706_100401463 3300005467 Bacteria 1276
64 Ga0070707_100006636 3300005468 Bacteria 10730
65 Ga0070707_100375095 3300005468 Bacteria 1382
66 Ga0070698_100000010 3300005471 Bacteria 117353
67 Ga0070698_100000531 3300005471 Bacteria 40650
68 Ga0070698_100021945 3300005471 Bacteria 6684
69 Ga0070698_100035737 3300005471 Bacteria 5135
70 Ga0070698_100251670 3300005471 Bacteria 1699
71 Ga0070698_100283485 3300005471 Unclassified 1588
72 Ga0070698_100643720 3300005471 Bacteria 1001
73 Ga0070699_100003720 3300005518 Bacteria 13482
74 Ga0070699_100004158 3300005518 Bacteria 12792
75 Ga0070699_100074587 3300005518 Bacteria 2952
76 Ga0070699_100093275 3300005518 Bacteria 2634
77 Ga0070699_100460663 3300005518 Bacteria 1153
78 Ga0070699_100510744 3300005518 Bacteria 1092
79 Ga0070679_100037531 3300005530 Bacteria 4814
80 Ga0070679_100053696 3300005530 Unclassified 4011
81 Ga0070679_100204752 3300005530 Bacteria 1938
82 Ga0070679_100226404 3300005530 Bacteria 1830
83 Ga0070684_100226566 3300005535 Bacteria 1706
84 Ga0070684_100402541 3300005535 Unclassified 1262
85 Ga0070684_101235926 3300005535 Bacteria 703
86 Ga0070697_101067065 3300005536 Unclassified 719
87 Ga0068853_100068238 3300005539 Bacteria 3091
88 Ga0068853_100553694 3300005539 Bacteria 1090
89 Ga0070672_100226053 3300005543 Bacteria 1571
90 Ga0070672_100783595 3300005543 Unclassified 838
91 Ga0070686_100056717 3300005544 Bacteria 2513
92 Ga0070695_100285552 3300005545 Unclassified 1214
93 Ga0070696_100013343 3300005546 Bacteria 5513
94 Ga0070696_100740788 3300005546 Unclassified 804
95 Ga0070693_100183325 3300005547 Bacteria 1349
96 Ga0070693_100183382 3300005547 Bacteria 1349
97 Ga0070693_100300506 3300005547 Bacteria 1082
98 Ga0070665_100021880 3300005548 Bacteria 6431
99 Ga0070665_100047801 3300005548 Bacteria 4294
100 Ga0070665_100100503 3300005548 Bacteria 2896
101 Ga0070665_100312664 3300005548 Bacteria 1575
102 Ga0070665_100839814 3300005548 Bacteria 932
103 Ga0070704_100000386 3300005549 Bacteria 20145
104 Ga0070704_100056073 3300005549 Bacteria 2797
105 Ga0070704_100743122 3300005549 Bacteria 873
106 Ga0070704_101314828 3300005549 Unclassified 662
107 Ga0068855_100134458 3300005563 Bacteria 2821
108 Ga0068855_100409189 3300005563 Bacteria 1485
109 Ga0070664_100118589 3300005564 Bacteria 2315
110 Ga0070664_100411668 3300005564 Bacteria 1237
111 Ga0070664_101478843 3300005564 Unclassified 643
112 Ga0068856_100130276 3300005614 Bacteria 2520
113 Ga0068856_100186576 3300005614 Bacteria 2088
114 Ga0070702_100456099 3300005615 Bacteria 928
115 Ga0070702_100662394 3300005615 Bacteria 791
116 Ga0068852_100359833 3300005616 Unclassified 1423
117 Ga0068852_100442241 3300005616 Bacteria 1286
118 Ga0068852_100903948 3300005616 Bacteria 900
119 Ga0068859_100383151 3300005617 Bacteria 1501
120 Ga0068864_100017929 3300005618 Bacteria 5906
121 Ga0068861_100040505 3300005719 Bacteria 3485
122 Ga0068851_10041190 3300005834 Bacteria 2322
123 Ga0068863_100089907 3300005841 Bacteria 2912
124 Ga0068863_100966132 3300005841 Bacteria 854
125 Ga0068858_100796122 3300005842 Bacteria 922
126 Ga0068858_101267145 3300005842 Unclassified 725
127 Ga0068860_100054096 3300005843 Bacteria 3816
128 Ga0068860_100520276 3300005843 Unclassified 1190
129 Ga0068862_100150821 3300005844 Bacteria 2069
130 Ga0068862_100526708 3300005844 Bacteria 1125
131 Ga0081455_10145659 3300005937 Bacteria 1833
132 Ga0070717_10148098 3300006028 Bacteria 2029
133 Ga0075365_10005358 3300006038 Bacteria 6911
134 Ga0075365_10448745 3300006038 Bacteria 911
135 Ga0075368_10018728 3300006042 Bacteria 2605
136 Ga0075363_100149199 3300006048 Bacteria 1319
137 Ga0075364_10009806 3300006051 Bacteria 5759
138 Ga0075364_10149987 3300006051 Bacteria 1571
139 Ga0070716_100000911 3300006173 Bacteria 12772
140 Ga0070716_100630526 3300006173 Bacteria 810
141 Ga0070712_100000065 3300006175 Bacteria 53344
142 Ga0070712_100009069 3300006175 Bacteria 6264
143 Ga0075362_10163960 3300006177 Bacteria 1071
144 Ga0075367_10040194 3300006178 Bacteria 2730
145 Ga0075367_10041329 3300006178 Unclassified 2695
146 Ga0075367_10122875 3300006178 Bacteria 1600
147 Ga0075367_10202439 3300006178 Bacteria 1240
148 Ga0075366_10036564 3300006195 Bacteria 2895
149 Ga0075366_10141629 3300006195 Bacteria 1454
150 Ga0097621_100095098 3300006237 Bacteria 2498
151 Ga0097621_100232488 3300006237 Bacteria 1610
152 Ga0075370_10004635 3300006353 Bacteria 6710
153 Ga0075370_10056087 3300006353 Bacteria 2238
154 Ga0075370_10094668 3300006353 Unclassified 1725
155 Ga0075370_10282682 3300006353 Bacteria 986
156 Ga0068871_100135177 3300006358 Bacteria 2094
157 Ga0068871_100170481 3300006358 Bacteria 1865
158 Ga0075428_100131138 3300006844 Unclassified 2726
159 Ga0075428_100172899 3300006844 Unclassified 2341
160 Ga0075428_100237482 3300006844 Bacteria 1967
161 Ga0075428_100253049 3300006844 Bacteria 1898
162 Ga0075428_101347078 3300006844 Bacteria 750
163 Ga0075428_101565571 3300006844 Bacteria 689
164 Ga0075430_100010571 3300006846 Bacteria 7815
165 Ga0075430_100044744 3300006846 Bacteria 3742
166 Ga0075430_101043219 3300006846 Unclassified 673
167 Ga0075431_100005349 3300006847 Bacteria 12669
168 Ga0075431_100224139 3300006847 Unclassified 1917
169 Ga0075431_100739407 3300006847 Bacteria 959
170 Ga0075431_100864289 3300006847 Unclassified 875
171 Ga0075431_101295895 3300006847 Unclassified 689
172 Ga0075433_10001869 3300006852 Bacteria 15820
173 Ga0075433_10053790 3300006852 Bacteria 3511
174 Ga0075433_10587059 3300006852 Bacteria 978
175 Ga0075434_100000316 3300006871 Bacteria 34532
176 Ga0075434_100018537 3300006871 Bacteria 6725
177 Ga0075434_100037503 3300006871 Bacteria 4798
178 Ga0075434_100206787 3300006871 Bacteria 1983
179 Ga0075429_100010861 3300006880 Bacteria 7875
180 Ga0075429_100355669 3300006880 Unclassified 1282
181 Ga0075429_100535283 3300006880 Bacteria 1027
182 Ga0075436_100011111 3300006914 Bacteria 6174
183 Ga0097620_100383166 3300006931 Bacteria 1501
184 Ga0075435_100020135 3300007076 Bacteria 5105
185 Ga0075435_100045521 3300007076 Bacteria 3518
186 Ga0075435_100110188 3300007076 Bacteria 2289
187 Ga0099795_10289491 3300007788 Bacteria 717
188 Ga0105240_10006679 3300009093 Bacteria 16914
189 Ga0105240_10061165 3300009093 Bacteria 4693
190 Ga0105240_10105617 3300009093 Bacteria 3418
191 Ga0105240_10118364 3300009093 Bacteria 3192
192 Ga0105240_10170560 3300009093 Bacteria 2578
193 Ga0105240_10620165 3300009093 Unclassified 1189
194 Ga0105240_11406433 3300009093 Unclassified 733
195 Ga0111539_10071221 3300009094 Bacteria 4102
196 Ga0111539_10199748 3300009094 Bacteria 2332
197 Ga0105245_10148203 3300009098 Bacteria 2216
198 Ga0105245_10151334 3300009098 Bacteria 2194
199 Ga0105245_10379086 3300009098 Bacteria 1408
200 Ga0105245_10672920 3300009098 Unclassified 1066
201 Ga0105247_10517416 3300009101 Bacteria 872
202 Ga0114129_10060019 3300009147 Bacteria 5317
203 Ga0114129_10061053 3300009147 Bacteria 5268
204 Ga0114129_10067019 3300009147 Bacteria 5006
205 Ga0114129_10490437 3300009147 Unclassified 1606
206 Ga0114129_10882321 3300009147 Bacteria 1135
207 Ga0105241_10081993 3300009174 Bacteria 2528
208 Ga0105241_10124225 3300009174 Bacteria 2082
209 Ga0105241_10258470 3300009174 Bacteria 1479
210 Ga0105241_11090491 3300009174 Bacteria 751
211 Ga0105242_10361690 3300009176 Bacteria 1343
212 Ga0105242_10959463 3300009176 Unclassified 860
213 Ga0105248_10003792 3300009177 Bacteria 16746
214 Ga0105248_10038222 3300009177 Bacteria 5371
215 Ga0105248_10279953 3300009177 Bacteria 1878
216 Ga0105248_10803189 3300009177 Bacteria 1062
217 Ga0105237_10001004 3300009545 Bacteria 37992
218 Ga0105237_10328683 3300009545 Bacteria 1533
219 Ga0105237_10510401 3300009545 Bacteria 1209
220 Ga0105237_10885263 3300009545 Bacteria 900
221 Ga0105238_10031933 3300009551 Bacteria 5358
222 Ga0105238_10090501 3300009551 Bacteria 3047
223 Ga0105238_10161213 3300009551 Bacteria 2218
224 Ga0105238_10251953 3300009551 Bacteria 1744
225 Ga0105249_10035688 3300009553 Unclassified 4509
226 Ga0105249_10113174 3300009553 Bacteria 2567
227 Ga0105249_10498601 3300009553 Bacteria 1262
228 Ga0105239_10224405 3300010375 Bacteria 2107
229 Ga0105239_10318067 3300010375 Bacteria 1755
230 Ga0105239_10507286 3300010375 Bacteria 1372
231 Ga0105246_10120145 3300011119 Bacteria 1946
232 Ga0105246_10618620 3300011119 Bacteria 938
233 Ga0157370_10105121 3300013104 Bacteria 2643
234 Ga0157369_10066490 3300013105 Bacteria 3878
235 Ga0157369_10303264 3300013105 Bacteria 1661
236 Ga0157369_11707676 3300013105 Unclassified 640
237 Ga0157374_10796614 3300013296 Unclassified 961
238 Ga0157378_10001849 3300013297 Bacteria 19009
239 Ga0157378_10031792 3300013297 Bacteria 4661
240 Ga0157378_10154932 3300013297 Bacteria 2138
241 Ga0157378_10667767 3300013297 Bacteria 1056
242 Ga0157378_10667768 3300013297 Bacteria 1056
243 Ga0163162_10089873 3300013306 Bacteria 3152
244 Ga0157372_10231226 3300013307 Bacteria 2144
245 Ga0157372_10697428 3300013307 Bacteria 1181
246 Ga0157372_10739700 3300013307 Bacteria 1144
247 Ga0157375_10428306 3300013308 Bacteria 1489
248 Ga0157375_10525965 3300013308 Bacteria 1346
249 Ga0163163_10125979 3300014325 Bacteria 2599
250 Ga0163163_10189892 3300014325 Bacteria 2103
251 Ga0163163_10763991 3300014325 Bacteria 1030
252 Ga0157380_10001299 3300014326 Bacteria 16242
253 Ga0157380_10850999 3300014326 Unclassified 934
254 Ga0157380_11089808 3300014326 Bacteria 837
255 Ga0157380_11510325 3300014326 Unclassified 725
256 Ga0157379_10034327 3300014968 Bacteria 4523
257 Ga0157379_10139467 3300014968 Bacteria 2185
258 Ga0157376_10286370 3300014969 Bacteria 1554
259 Ga0157376_10295725 3300014969 Bacteria 1531
260 Ga0157376_11641127 3300014969 Bacteria 677
261 Ga0213876_10015050 3300021384 Bacteria 4100
262 Ga0213875_10067415 3300021388 Bacteria 1672
263 Ga0209758_1083880 3300025297 Bacteria 954
264 Ga0207653_10031777 3300025885 Bacteria 1706
265 Ga0207692_10211911 3300025898 Unclassified 1144
266 Ga0207680_10033812 3300025903 Bacteria 2920
267 Ga0207685_10081314 3300025905 Bacteria 1341
268 Ga0207699_10001465 3300025906 Bacteria 11204
269 Ga0207699_10013464 3300025906 Bacteria 4188
270 Ga0207645_10247689 3300025907 Bacteria 1178
271 Ga0207705_10006442 3300025909 Bacteria 8695
272 Ga0207705_10312076 3300025909 Bacteria 1207
273 Ga0207705_10526009 3300025909 Bacteria 919
274 Ga0207684_10001044 3300025910 Bacteria 30953
275 Ga0207684_10118351 3300025910 Unclassified 2270
276 Ga0207707_10403414 3300025912 Bacteria 1173
277 Ga0207695_10013238 3300025913 Bacteria 9843
278 Ga0207695_10059332 3300025913 Bacteria 3968
279 Ga0207695_10158453 3300025913 Bacteria 2197
280 Ga0207671_10029691 3300025914 Bacteria 4081
281 Ga0207671_10267986 3300025914 Bacteria 1345
282 Ga0207671_10342339 3300025914 Bacteria 1185
283 Ga0207671_10386259 3300025914 Bacteria 1112
284 Ga0207693_10000022 3300025915 Bacteria 127887
285 Ga0207693_10011601 3300025915 Bacteria 7129
286 Ga0207663_10028718 3300025916 Unclassified 3259
287 Ga0207660_10003669 3300025917 Bacteria 10008
288 Ga0207657_10010276 3300025919 Bacteria 9344
289 Ga0207649_10541206 3300025920 Unclassified 890
290 Ga0207646_10008150 3300025922 Bacteria 10540
291 Ga0207646_10375782 3300025922 Bacteria 1284
292 Ga0207694_10000741 3300025924 Bacteria 29353
293 Ga0207694_10048867 3300025924 Bacteria 3274
294 Ga0207694_10459624 3300025924 Bacteria 1063
295 Ga0207659_10691245 3300025926 Bacteria 873
296 Ga0207659_10720566 3300025926 Bacteria 855
297 Ga0207687_10444066 3300025927 Bacteria 1075
298 Ga0207700_10000056 3300025928 Bacteria 71553
299 Ga0207664_10007547 3300025929 Bacteria 7545
300 Ga0207664_10629395 3300025929 Bacteria 964
301 Ga0207665_10000385 3300025939 Bacteria 30257
302 Ga0207711_10004950 3300025941 Bacteria 11309
303 Ga0207711_10275865 3300025941 Bacteria 1547
304 Ga0207711_10618500 3300025941 Unclassified 1011
305 Ga0207661_10011512 3300025944 Bacteria 6413
306 Ga0207661_10072701 3300025944 Bacteria 2814
307 Ga0207661_10187855 3300025944 Unclassified 1810
308 Ga0207661_10877382 3300025944 Bacteria 826
309 Ga0207679_10105811 3300025945 Bacteria 2210
310 Ga0207679_10973138 3300025945 Unclassified 777
311 Ga0207651_10403096 3300025960 Bacteria 1164
312 Ga0207640_10669992 3300025981 Bacteria 886
313 Ga0207658_10075425 3300025986 Bacteria 2566
314 Ga0207658_10131569 3300025986 Bacteria 2011
315 Ga0207658_10807001 3300025986 Unclassified 852
316 Ga0207677_11219902 3300026023 Bacteria 689
317 Ga0207639_10364894 3300026041 Bacteria 1293
318 Ga0207639_10378068 3300026041 Bacteria 1271
319 Ga0207639_10534793 3300026041 Unclassified 1074
320 Ga0207708_10000126 3300026075 Bacteria 59505
321 Ga0207641_10459299 3300026088 Bacteria 1232
322 Ga0207641_10505860 3300026088 Bacteria 1174
323 Ga0207676_10066942 3300026095 Bacteria 2867
324 Ga0207675_100031989 3300026118 Bacteria 4901
325 Ga0207683_10045779 3300026121 Bacteria 3826
326 Ga0207698_10053339 3300026142 Bacteria 3103
327 Ga0207698_10265422 3300026142 Bacteria 1579
328 Ga0207698_10302953 3300026142 Bacteria 1488
329 Ga0210002_1002786 3300027617 Bacteria 2539
330 Ga0209998_10004255 3300027717 Bacteria 3051
331 Ga0209998_10028256 3300027717 Bacteria 1232
332 Ga0209974_10000290 3300027876 Bacteria 16397
333 Ga0209974_10031326 3300027876 Bacteria 1761
334 Ga0268266_10059589 3300028379 Bacteria 3289
335 Ga0268266_10417185 3300028379 Bacteria 1271
336 Ga0268266_10721193 3300028379 Bacteria 961
337 Ga0268265_10155182 3300028380 Bacteria 1936
338 Ga0268264_10590675 3300028381 Unclassified 1093
339 Ga0265318_10170618 3300028577 Bacteria 797
340 Ga0307515_10000018 3300028794 Bacteria 424853
341 Ga0265338_10141799 3300028800 Bacteria 1881
342 Ga0265338_10195712 3300028800 Bacteria 1528
343 Ga0265338_10535449 3300028800 Unclassified 821
344 Ga0265325_10026933 3300031241 Bacteria 3111
345 Ga0265325_10097809 3300031241 Unclassified 1440
346 Ga0265340_10382931 3300031247 Unclassified 621
347 Ga0265339_10021647 3300031249 Bacteria 3736
348 Ga0265339_10062547 3300031249 Bacteria 2001
349 Ga0265339_10337556 3300031249 Unclassified 712
350 Ga0307408_100004179 3300031548 Bacteria 9841
351 Ga0307508_10000120 3300031616 Bacteria 93316
352 Ga0307508_10100203 3300031616 Bacteria 2492
353 Ga0265314_10032642 3300031711 Bacteria 3827
354 Ga0307405_10002374 3300031731 Bacteria 8290
355 Ga0307413_10031519 3300031824 Bacteria 2993
356 Ga0307406_11116806 3300031901 Bacteria 681
357 Ga0307407_10074380 3300031903 Bacteria 2033
358 Ga0307407_10203494 3300031903 Unclassified 1328
359 Ga0307414_10042551 3300032004 Unclassified 3087
360 Ga0307415_100057000 3300032126 Bacteria 2682
361 Ga0373959_0033445 3300034820 Bacteria 1049
362 Ga0373926_0027645 3300035083 Unclassified 1989
363 Ga0373934_0103577 3300035086 Bacteria 1151
364 Ga0373944_0047092 3300035089 Unclassified 1350
365 Ga0373923_0059597 3300035111 Unclassified 1619
366 Ga0373936_0010571 3300035113 Unclassified 3484
367 Ga0373939_0071960 3300035114 Bacteria 1128
368 Ga0373956_0481568 3300035119 Bacteria 592
369 Ga0373943_0269354 3300035170 Archaea 960
370 Ga0373946_0038492 3300035171 Unclassified 1948
371 Ga0373955_0022208 3300035172 Bacteria 3216
372 Ga0373931_0293963 3300035691 Bacteria 1001
373 Ga0373935_0022427 3300035692 Bacteria 3872
374 Ga0373935_0177858 3300035692 Bacteria 1459
375 Ga0373933_0032336 3300035724 Bacteria 3041
376 Ga0373947_0016057 3300035725 Unclassified 4303
377 Ga0373947_0022255 3300035725 Bacteria 3674
378 Ga0373937_0309292 3300036401 Bacteria 1494
379 Ga0373937_0602170 3300036401 Bacteria 1043
380 Ga0373937_0639626 3300036401 Bacteria 1009
381 Ga0373925_0013285 3300037068 Bacteria 5960
382 Ga0395898_0758644 3300037466 Unclassified 911
383 Ga0395898_0836142 3300037466 Bacteria 860
384 Ga0395898_0978218 3300037466 Bacteria 783
385 Ga0395905_0025350 3300037471 Bacteria 5592
386 Ga0395905_0525315 3300037471 Bacteria 1084
387 Ga0436364_0528381 3300037853 Bacteria 1991
388 Ga0395901_0292222 3300038443 Unclassified 1691
389 Ga0395901_0536371 3300038443 Bacteria 1187
390 Ga0436365_0910109 3300039437 Bacteria 7067
391 Ga0436362_0414753 3300039453 Unclassified 575
392 Ga0439455_0008349 3300042012 Unclassified 2217
393 Ga0439458_0006193 3300042157 Unclassified 2669
394 Ga0439440_0065125 3300042993 Bacteria 938
395 Ga0453684_0014979 3300044712 Bacteria 12316
396 Ga0466968_0499969 3300044735 Unclassified 606
397 Ga0466957_0529767 3300044842 Bacteria 819
398 Ga0451576_0681968 3300045051 Bacteria 1080
399 Ga0466967_0691356 3300045976 Bacteria 1010
400 Ga0495592_0068850 3300046454 Bacteria 2582
401 Ga0495629_0154438 3300046459 Archaea 1595
402 Ga0495638_0027229 3300046460 Bacteria 3701
403 Ga0495638_0040965 3300046460 Bacteria 2933
404 Ga0495651_0119240 3300046462 Bacteria 1941
405 Ga0495580_0000523 3300046472 Bacteria 32397
406 Ga0495582_0001022 3300046473 Bacteria 15658
407 Ga0495582_0038559 3300046473 Bacteria 2630
408 Ga0495662_0362573 3300046476 Unclassified 712
409 Ga0495664_0198404 3300046477 Unclassified 1216
410 Ga0495596_0195110 3300046500 Bacteria 787
411 Ga0495608_0005145 3300046511 Bacteria 9348
412 Ga0495618_0019975 3300046514 Bacteria 4123
413 Ga0495628_0050339 3300046516 Bacteria 3295
414 Ga0495630_0002908 3300046517 Bacteria 11899
415 Ga0495630_0077911 3300046517 Unclassified 2499
416 Ga0495643_0058561 3300046522 Bacteria 2050
417 Ga0495586_0541918 3300046535 Unclassified 672
418 Ga0495587_0130618 3300046536 Bacteria 1435
419 Ga0495609_0026507 3300046538 Bacteria 2654
420 Ga0495645_0098531 3300046543 Bacteria 2080
421 Ga0495667_0008465 3300046559 Bacteria 6984
422 Ga0495667_0156819 3300046559 Unclassified 1465
423 Ga0495656_0211561 3300046615 Bacteria 966
424 Ga0495634_0193831 3300046642 Bacteria 1266
425 Ga0495599_0063826 3300046678 Bacteria 2301
426 Ga0495658_0084823 3300046683 Bacteria 1866
427 Ga0495613_0000975 3300046689 Bacteria 21818
428 Ga0495649_0108491 3300046694 Bacteria 1473
429 Ga0495649_0186360 3300046694 Bacteria 1081
430 Ga0495581_0249319 3300047315 Archaea 1038
431 Ga0495604_0006118 3300047317 Bacteria 9552
432 Ga0495674_0004353 3300047319 Bacteria 13610
433 Ga0495672_0005369 3300047320 Bacteria 10190
434 Ga0495675_0165720 3300047444 Bacteria 1359
435 Ga0495684_0000140 3300047471 Bacteria 53062
436 Ga0495684_0573532 3300047471 Unclassified 765
437 Ga0495602_0207571 3300048088 Bacteria 1490
438 Ga0495614_0251677 3300048089 Archaea 808
439 Ga0496105_0156533 3300048908 Bacteria 1871
440 Ga0496106_0003995 3300048909 Bacteria 11023
441 Ga0496108_0279390 3300048911 Unclassified 1454
442 Ga0496110_0017935 3300048913 Bacteria 5928
443 Ga0496113_0082844 3300048916 Bacteria 2461
444 Ga0496114_0067860 3300048917 Unclassified 2993
445 Ga0496115_0007463 3300048918 Bacteria 8047
446 Ga0496117_0016272 3300048920 Bacteria 6284
447 Ga0496118_0002345 3300048921 Bacteria 25686
448 Ga0496119_0436642 3300048922 Bacteria 619
449 Ga0496121_0003002 3300048924 Bacteria 24518
450 Ga0496124_0005039 3300048927 Bacteria 15096
451 Ga0496126_0019777 3300048929 Bacteria 6624
452 Ga0496126_0025870 3300048929 Bacteria 5637
453 Ga0495682_0036877 3300049460 Bacteria 1799
454 Ga0501032_0167902 3300049569 Bacteria 1439
455 Ga0501033_0674139 3300049570 Bacteria 705
456 Ga0501038_0190066 3300049574 Bacteria 1653
457 Ga0501039_0089418 3300049575 Bacteria 2400
458 Ga0501041_0159852 3300049577 Bacteria 1408
459 Ga0501042_0001234 3300049578 Bacteria 14883
460 Ga0501043_0489228 3300049579 Bacteria 920
461 Ga0501047_0188624 3300049581 Bacteria 1926
462 Ga0501048_0025864 3300049582 Bacteria 4276
463 Ga0501070_0225233 3300049586 Unclassified 1537
464 Ga0501070_0316570 3300049586 Bacteria 1270
465 Ga0501071_0029971 3300049587 Bacteria 3845
466 Ga0501072_0270015 3300049588 Bacteria 1353
467 Ga0501073_0108136 3300049589 Bacteria 1930
468 Ga0501073_0544812 3300049589 Unclassified 802
469 Ga0501074_0321340 3300049590 Bacteria 1099
470 Ga0501075_0027550 3300049591 Bacteria 4189
471 Ga0501076_0004492 3300049592 Bacteria 9938
472 Ga0501198_002323 3300049649 Unclassified 2554
473 Ga0501207_006153 3300049654 Archaea 1678
474 Ga0501216_000538 3300049660 Bacteria 4548
475 Ga0501217_000298 3300049661 Bacteria 7813
476 Ga0501223_004753 3300049663 Bacteria 2890
477 Ga0501227_030920 3300049665 Unclassified 1284
478 Ga0501233_001316 3300049668 Bacteria 4247
479 Ga0501236_001630 3300049670 Bacteria 2552
480 Ga0501243_002617 3300049675 Unclassified 2643
481 Ga0501257_041123 3300049686 Unclassified 1135
482 Ga0501225_0004531 3300049705 Archaea 4134
483 Ga0501079_0068983 3300049741 Bacteria 2729
484 Ga0501080_0493986 3300049742 Bacteria 1094
485 Ga0501080_0790174 3300049742 Bacteria 833
486 Ga0501081_0657131 3300049743 Bacteria 786
487 Ga0501044_0170182 3300049823 Bacteria 2150
488 Ga0501226_002004 3300049853 Bacteria 2533
489 nmdc:mga03683_54381_c1 3300050489 Bacteria 1678
490 nmdc:mga03n38_145079_c1 3300050490 Bacteria 1189
491 nmdc:mga00v17_132754_c1 3300050491 Bacteria 1592
492 nmdc:mga0yw44_459043_c1 3300050492 Bacteria 863
493 nmdc:mga0k408_87254_c1 3300050493 Unclassified 1832
494 nmdc:mga0k408_91651_c1 3300050493 Bacteria 1785
495 nmdc:mga06z11_4577_c1 3300050494 Bacteria 5454
496 nmdc:mga06z11_64566_c2 3300050494 Bacteria 652
497 nmdc:mga04h51_82267_c1 3300050495 Bacteria 1145
498 nmdc:mga07m45_103136_c1 3300050496 Unclassified 1639
499 nmdc:mga05p37_1022670_c1 3300050507 Unclassified 875
500 nmdc:mga05p37_1086803_c1 3300050507 Bacteria 839
501 nmdc:mga05p37_109575_c1 3300050507 Unclassified 3397
502 nmdc:mga05p37_115525_c1 3300050507 Bacteria 3299
503 nmdc:mga09592_132559_c1 3300050508 Bacteria 2145
504 nmdc:mga09592_271153_c1 3300050508 Unclassified 1472
505 nmdc:mga09592_330253_c1 3300050508 Unclassified 1320
506 nmdc:mga09592_9463_c1 3300050508 Bacteria 7918
507 nmdc:mga0qj67_100824_c1 3300050509 Unclassified 2328
508 nmdc:mga0qj67_103413_c1 3300050509 Bacteria 2298
509 nmdc:mga0qj67_13572_c1 3300050509 Bacteria 6144
510 nmdc:mga0qj67_45088_c1 3300050509 Bacteria 3478
511 nmdc:mga0qj67_8203_c1 3300050509 Bacteria 7743
512 nmdc:mga06r32_16653_c1 3300050510 Bacteria 6699
513 nmdc:mga06r32_1992_c1 3300050510 Bacteria 18250
514 nmdc:mga06r32_406635_c1 3300050510 Bacteria 1343
515 nmdc:mga06r32_41201_c1 3300050510 Bacteria 4386
516 nmdc:mga06r32_845947_c1 3300050510 Unclassified 874
517 nmdc:mga06r32_850233_c1 3300050510 Bacteria 871
518 nmdc:mga08y16_974340_c1 3300050511 Bacteria 830
519 nmdc:mga0n895_5259_c1 3300050512 Bacteria 10785
520 nmdc:mga0n895_86840_c1 3300050512 Bacteria 3125
521 nmdc:mga0n895_96349_c1 3300050512 Bacteria 2964
522 nmdc:mga0rr50_22551_c2 3300050513 Bacteria 3517
523 nmdc:mga0rr50_67600_c1 3300050513 Bacteria 2715
524 nmdc:mga08x19_3394_c1 3300050514 Bacteria 9499
525 nmdc:mga0a205_29616_c1 3300050515 Bacteria 5240
526 nmdc:mga0a205_64052_c1 3300050515 Bacteria 3551
527 Ga0495601_0001321 3300053077 Bacteria 13614
528 Ga0495619_0013156 3300053085 Bacteria 5214
529 Ga0500573_0000003 3300053140 Bacteria 355643
530 Ga0501084_0163182 3300054114 Bacteria 1880
531 Ga0501082_0089085 3300060353 Bacteria 2664
532 Ga0501082_0287323 3300060353 Bacteria 1432

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044735 Ga0466968_0499969 Ga0466968_0499969_68_568 158
2 3300049823 Ga0501044_0170182 Ga0501044_0170182_1631_2125 163
3 3300006847 Ga0075431_100864289 Ga0075431_1008642892 165
4 3300009147 Ga0114129_10882321 Ga0114129_108823212 165
5 3300005344 Ga0070661_100610960 Ga0070661_1006109602 169
6 3300005535 Ga0070684_100402541 Ga0070684_1004025413 169
7 3300005564 Ga0070664_100118589 Ga0070664_1001185893 169
8 3300025920 Ga0207649_10541206 Ga0207649_105412061 169
9 3300025945 Ga0207679_10105811 Ga0207679_101058112 169
10 3300005327 Ga0070658_10003308 Ga0070658_100033088 170
11 3300025909 Ga0207705_10006442 Ga0207705_100064424 170
12 3300039453 Ga0436362_0414753 Ga0436362_0414753_18_557 171
13 3300050510 nmdc:mga06r32_845947_c1 nmdc:mga06r32_845947_c1_322_843 173
14 3300046522 Ga0495643_0058561 Ga0495643_0058561_754_1317 174
15 3300046694 Ga0495649_0186360 Ga0495649_0186360_18_581 174
16 3300005471 Ga0070698_100035737 Ga0070698_1000357373 175
17 3300005843 Ga0068860_100054096 Ga0068860_1000540966 178
18 3300005844 Ga0068862_100526708 Ga0068862_1005267082 179
19 3300009174 Ga0105241_10258470 Ga0105241_102584702 179
20 3300013307 Ga0157372_10697428 Ga0157372_106974282 179
21 3300045976 Ga0466967_0691356 Ga0466967_0691356_133_678 179
22 3300005445 Ga0070708_100876691 Ga0070708_1008766912 180
23 3300005467 Ga0070706_100001047 Ga0070706_10000104711 180
24 3300005468 Ga0070707_100006636 Ga0070707_1000066368 180
25 3300005471 Ga0070698_100000531 Ga0070698_10000053132 180
26 3300005518 Ga0070699_100003720 Ga0070699_10000372012 180
27 3300006028 Ga0070717_10148098 Ga0070717_101480982 180
28 3300009093 Ga0105240_10105617 Ga0105240_101056175 180
29 3300009093 Ga0105240_10170560 Ga0105240_101705602 180
30 3300009101 Ga0105247_10517416 Ga0105247_105174162 180
31 3300009174 Ga0105241_10081993 Ga0105241_100819933 180
32 3300009174 Ga0105241_10124225 Ga0105241_101242252 180
33 3300009545 Ga0105237_10328683 Ga0105237_103286832 180
34 3300009545 Ga0105237_10510401 Ga0105237_105104012 180
35 3300009545 Ga0105237_10885263 Ga0105237_108852632 180
36 3300009551 Ga0105238_10161213 Ga0105238_101612132 180
37 3300009551 Ga0105238_10251953 Ga0105238_102519533 180
38 3300010375 Ga0105239_10224405 Ga0105239_102244052 180
39 3300010375 Ga0105239_10318067 Ga0105239_103180672 180
40 3300010375 Ga0105239_10507286 Ga0105239_105072862 180
41 3300011119 Ga0105246_10120145 Ga0105246_101201452 180
42 3300013105 Ga0157369_10066490 Ga0157369_100664904 180
43 3300013105 Ga0157369_10303264 Ga0157369_103032642 180
44 3300013105 Ga0157369_11707676 Ga0157369_117076761 180
45 3300013307 Ga0157372_10231226 Ga0157372_102312262 180
46 3300014325 Ga0163163_10189892 Ga0163163_101898922 180
47 3300014325 Ga0163163_10763991 Ga0163163_107639911 180
48 3300014968 Ga0157379_10034327 Ga0157379_100343274 180
49 3300021388 Ga0213875_10067415 Ga0213875_100674151 180
50 3300025910 Ga0207684_10001044 Ga0207684_1000104420 180
51 3300025922 Ga0207646_10008150 Ga0207646_100081506 180
52 3300037466 Ga0395898_0836142 Ga0395898_0836142_68_613 180
53 3300037853 Ga0436364_0528381 Ga0436364_0528381_138_704 180
54 3300046694 Ga0495649_0108491 Ga0495649_0108491_408_953 180
55 3300049586 Ga0501070_0225233 Ga0501070_0225233_359_904 180
56 3300049589 Ga0501073_0544812 Ga0501073_0544812_155_700 180
57 3300053140 Ga0500573_0000003 Ga0500573_0000003_72273_72818 180
58 3300009098 Ga0105245_10148203 Ga0105245_101482032 181
59 3300009098 Ga0105245_10379086 Ga0105245_103790862 181
60 3300009147 Ga0114129_10490437 Ga0114129_104904372 181
61 3300009177 Ga0105248_10003792 Ga0105248_100037927 181
62 3300013307 Ga0157372_10739700 Ga0157372_107397002 181
63 3300037466 Ga0395898_0758644 Ga0395898_0758644_205_753 181
64 3300038443 Ga0395901_0292222 Ga0395901_0292222_193_741 181
65 3300049649 Ga0501198_002323 Ga0501198_002323_1897_2445 181
66 3300049654 Ga0501207_006153 Ga0501207_006153_318_866 181
67 3300049660 Ga0501216_000538 Ga0501216_000538_151_699 181
68 3300049661 Ga0501217_000298 Ga0501217_000298_50_598 181
69 3300049663 Ga0501223_004753 Ga0501223_004753_2251_2799 181
70 3300049665 Ga0501227_030920 Ga0501227_030920_627_1175 181
71 3300049668 Ga0501233_001316 Ga0501233_001316_3650_4198 181
72 3300049670 Ga0501236_001630 Ga0501236_001630_1918_2466 181
73 3300049675 Ga0501243_002617 Ga0501243_002617_1966_2514 181
74 3300049686 Ga0501257_041123 Ga0501257_041123_546_1094 181
75 3300049705 Ga0501225_0004531 Ga0501225_0004531_1321_1869 181
76 3300049853 Ga0501226_002004 Ga0501226_002004_1309_1857 181
77 3300050493 nmdc:mga0k408_91651_c1 nmdc:mga0k408_91651_c1_470_1015 181
78 3300050494 nmdc:mga06z11_64566_c2 nmdc:mga06z11_64566_c2_47_592 181
79 3300050495 nmdc:mga04h51_82267_c1 nmdc:mga04h51_82267_c1_98_643 181
80 3300046500 Ga0495596_0195110 Ga0495596_0195110_200_751 182
81 3300005440 Ga0070705_100030803 Ga0070705_1000308033 183
82 3300005440 Ga0070705_100033531 Ga0070705_1000335313 183
83 3300005444 Ga0070694_100244512 Ga0070694_1002445122 183
84 3300005467 Ga0070706_100401463 Ga0070706_1004014633 183
85 3300005518 Ga0070699_100074587 Ga0070699_1000745873 183
86 3300005518 Ga0070699_100510744 Ga0070699_1005107442 183
87 3300005544 Ga0070686_100056717 Ga0070686_1000567173 183
88 3300005546 Ga0070696_100013343 Ga0070696_1000133436 183
89 3300005549 Ga0070704_100000386 Ga0070704_10000038613 183
90 3300005549 Ga0070704_100056073 Ga0070704_1000560732 183
91 3300005937 Ga0081455_10145659 Ga0081455_101456593 183
92 3300006353 Ga0075370_10282682 Ga0075370_102826822 183
93 3300006844 Ga0075428_101347078 Ga0075428_1013470781 183
94 3300009177 Ga0105248_10038222 Ga0105248_100382222 183
95 3300014326 Ga0157380_10001299 Ga0157380_100012996 183
96 3300014969 Ga0157376_10295725 Ga0157376_102957252 183
97 3300025941 Ga0207711_10618500 Ga0207711_106185002 183
98 3300031903 Ga0307407_10074380 Ga0307407_100743801 183
99 3300035119 Ga0373956_0481568 Ga0373956_0481568_21_578 183
100 3300035172 Ga0373955_0022208 Ga0373955_0022208_1573_2130 183
101 3300035692 Ga0373935_0177858 Ga0373935_0177858_45_602 183
102 3300035725 Ga0373947_0022255 Ga0373947_0022255_425_982 183
103 3300036401 Ga0373937_0602170 Ga0373937_0602170_135_692 183
104 3300036401 Ga0373937_0639626 Ga0373937_0639626_119_676 183
105 3300037068 Ga0373925_0013285 Ga0373925_0013285_4264_4821 183
106 3300042993 Ga0439440_0065125 Ga0439440_0065125_48_608 183
107 3300046454 Ga0495592_0068850 Ga0495592_0068850_695_1252 183
108 3300046462 Ga0495651_0119240 Ga0495651_0119240_832_1389 183
109 3300046473 Ga0495582_0038559 Ga0495582_0038559_421_978 183
110 3300046476 Ga0495662_0362573 Ga0495662_0362573_93_650 183
111 3300046511 Ga0495608_0005145 Ga0495608_0005145_6853_7410 183
112 3300046514 Ga0495618_0019975 Ga0495618_0019975_3298_3855 183
113 3300046516 Ga0495628_0050339 Ga0495628_0050339_2347_2904 183
114 3300046517 Ga0495630_0002908 Ga0495630_0002908_7674_8231 183
115 3300046535 Ga0495586_0541918 Ga0495586_0541918_51_608 183
116 3300046536 Ga0495587_0130618 Ga0495587_0130618_479_1036 183
117 3300046543 Ga0495645_0098531 Ga0495645_0098531_454_1011 183
118 3300046559 Ga0495667_0008465 Ga0495667_0008465_3704_4261 183
119 3300046642 Ga0495634_0193831 Ga0495634_0193831_415_972 183
120 3300046678 Ga0495599_0063826 Ga0495599_0063826_680_1237 183
121 3300046683 Ga0495658_0084823 Ga0495658_0084823_721_1278 183
122 3300046689 Ga0495613_0000975 Ga0495613_0000975_10521_11078 183
123 3300047317 Ga0495604_0006118 Ga0495604_0006118_726_1283 183
124 3300047444 Ga0495675_0165720 Ga0495675_0165720_352_909 183
125 3300047471 Ga0495684_0000140 Ga0495684_0000140_3721_4278 183
126 3300048088 Ga0495602_0207571 Ga0495602_0207571_156_713 183
127 3300050510 nmdc:mga06r32_406635_c1 nmdc:mga06r32_406635_c1_22_579 183
128 3300050510 nmdc:mga06r32_850233_c1 nmdc:mga06r32_850233_c1_73_630 183
129 3300053077 Ga0495601_0001321 Ga0495601_0001321_5143_5700 183
130 3300053085 Ga0495619_0013156 Ga0495619_0013156_194_751 183
131 2162886012 MBSR1b_contig_4902641 MBSR1b_0412.00005810 184
132 2162886012 MBSR1b_contig_5893965 MBSR1b_0854.00005340 184
133 3300005293 Ga0065715_10382309 Ga0065715_103823092 184
134 3300005330 Ga0070690_100360374 Ga0070690_1003603742 184
135 3300005334 Ga0068869_100316898 Ga0068869_1003168982 184
136 3300005336 Ga0070680_100025304 Ga0070680_1000253045 184
137 3300005337 Ga0070682_100013753 Ga0070682_1000137535 184
138 3300005354 Ga0070675_100296169 Ga0070675_1002961693 184
139 3300005355 Ga0070671_100313761 Ga0070671_1003137612 184
140 3300005364 Ga0070673_100441432 Ga0070673_1004414322 184
141 3300005365 Ga0070688_100420456 Ga0070688_1004204561 184
142 3300005367 Ga0070667_100126902 Ga0070667_1001269023 184
143 3300005530 Ga0070679_100053696 Ga0070679_1000536961 184
144 3300005539 Ga0068853_100068238 Ga0068853_1000682383 184
145 3300005547 Ga0070693_100183325 Ga0070693_1001833252 184
146 3300005547 Ga0070693_100183382 Ga0070693_1001833822 184
147 3300005564 Ga0070664_100411668 Ga0070664_1004116682 184
148 3300005614 Ga0068856_100186576 Ga0068856_1001865762 184
149 3300005615 Ga0070702_100456099 Ga0070702_1004560992 184
150 3300005616 Ga0068852_100359833 Ga0068852_1003598332 184
151 3300005617 Ga0068859_100383151 Ga0068859_1003831512 184
152 3300005618 Ga0068864_100017929 Ga0068864_1000179293 184
153 3300005834 Ga0068851_10041190 Ga0068851_100411903 184
154 3300005843 Ga0068860_100520276 Ga0068860_1005202762 184
155 3300006175 Ga0070712_100009069 Ga0070712_1000090695 184
156 3300006237 Ga0097621_100232488 Ga0097621_1002324882 184
157 3300006358 Ga0068871_100170481 Ga0068871_1001704812 184
158 3300006844 Ga0075428_101565571 Ga0075428_1015655712 184
159 3300006846 Ga0075430_101043219 Ga0075430_1010432191 184
160 3300006847 Ga0075431_100739407 Ga0075431_1007394072 184
161 3300006931 Ga0097620_100383166 Ga0097620_1003831662 184
162 3300009093 Ga0105240_10061165 Ga0105240_100611654 184
163 3300009177 Ga0105248_10279953 Ga0105248_102799531 184
164 3300013296 Ga0157374_10796614 Ga0157374_107966142 184
165 3300013297 Ga0157378_10154932 Ga0157378_101549323 184
166 3300013306 Ga0163162_10089873 Ga0163162_100898732 184
167 3300013308 Ga0157375_10525965 Ga0157375_105259651 184
168 3300014325 Ga0163163_10125979 Ga0163163_101259792 184
169 3300014969 Ga0157376_10286370 Ga0157376_102863701 184
170 3300025898 Ga0207692_10211911 Ga0207692_102119112 184
171 3300025913 Ga0207695_10059332 Ga0207695_100593326 184
172 3300025915 Ga0207693_10011601 Ga0207693_100116014 184
173 3300025916 Ga0207663_10028718 Ga0207663_100287184 184
174 3300025917 Ga0207660_10003669 Ga0207660_100036694 184
175 3300025926 Ga0207659_10691245 Ga0207659_106912451 184
176 3300025927 Ga0207687_10444066 Ga0207687_104440661 184
177 3300025941 Ga0207711_10275865 Ga0207711_102758652 184
178 3300025945 Ga0207679_10973138 Ga0207679_109731381 184
179 3300025960 Ga0207651_10403096 Ga0207651_104030962 184
180 3300025986 Ga0207658_10075425 Ga0207658_100754254 184
181 3300026095 Ga0207676_10066942 Ga0207676_100669423 184
182 3300026142 Ga0207698_10302953 Ga0207698_103029532 184
183 3300027617 Ga0210002_1002786 Ga0210002_10027862 184
184 3300027717 Ga0209998_10004255 Ga0209998_100042552 184
185 3300027876 Ga0209974_10000290 Ga0209974_100002906 184
186 3300028381 Ga0268264_10590675 Ga0268264_105906751 184
187 3300037466 Ga0395898_0978218 Ga0395898_0978218_210_767 184
188 3300037471 Ga0395905_0025350 Ga0395905_0025350_3184_3741 184
189 3300038443 Ga0395901_0536371 Ga0395901_0536371_534_1091 184
190 3300044842 Ga0466957_0529767 Ga0466957_0529767_98_658 184
191 3300050509 nmdc:mga0qj67_103413_c1 nmdc:mga0qj67_103413_c1_52_606 184
192 3300003323 rootH1_10151850 rootH1_101518504 185
193 3300003323 rootH1_10154437 rootH1_101544373 185
194 3300005295 Ga0065707_10305419 Ga0065707_103054191 185
195 3300005329 Ga0070683_100001155 Ga0070683_1000011558 185
196 3300005329 Ga0070683_100964488 Ga0070683_1009644882 185
197 3300005331 Ga0070670_100304818 Ga0070670_1003048182 185
198 3300005335 Ga0070666_10077245 Ga0070666_100772452 185
199 3300005338 Ga0068868_100902566 Ga0068868_1009025661 185
200 3300005339 Ga0070660_100112134 Ga0070660_1001121342 185
201 3300005340 Ga0070689_100043820 Ga0070689_1000438202 185
202 3300005344 Ga0070661_100539050 Ga0070661_1005390502 185
203 3300005344 Ga0070661_100819941 Ga0070661_1008199411 185
204 3300005355 Ga0070671_100229860 Ga0070671_1002298602 185
205 3300005364 Ga0070673_100004663 Ga0070673_1000046637 185
206 3300005365 Ga0070688_100008261 Ga0070688_1000082613 185
207 3300005367 Ga0070667_100391371 Ga0070667_1003913712 185
208 3300005438 Ga0070701_10320998 Ga0070701_103209982 185
209 3300005440 Ga0070705_101234541 Ga0070705_1012345411 185
210 3300005441 Ga0070700_100000215 Ga0070700_10000021511 185
211 3300005466 Ga0070685_10006672 Ga0070685_100066723 185
212 3300005471 Ga0070698_100021945 Ga0070698_1000219458 185
213 3300005518 Ga0070699_100004158 Ga0070699_1000041588 185
214 3300005530 Ga0070679_100037531 Ga0070679_1000375314 185
215 3300005530 Ga0070679_100204752 Ga0070679_1002047522 185
216 3300005535 Ga0070684_100226566 Ga0070684_1002265662 185
217 3300005535 Ga0070684_101235926 Ga0070684_1012359261 185
218 3300005536 Ga0070697_101067065 Ga0070697_1010670651 185
219 3300005539 Ga0068853_100553694 Ga0068853_1005536942 185
220 3300005543 Ga0070672_100226053 Ga0070672_1002260532 185
221 3300005543 Ga0070672_100783595 Ga0070672_1007835952 185
222 3300005547 Ga0070693_100300506 Ga0070693_1003005062 185
223 3300005548 Ga0070665_100021880 Ga0070665_1000218802 185
224 3300005548 Ga0070665_100047801 Ga0070665_1000478014 185
225 3300005548 Ga0070665_100100503 Ga0070665_1001005035 185
226 3300005548 Ga0070665_100312664 Ga0070665_1003126642 185
227 3300005548 Ga0070665_100839814 Ga0070665_1008398142 185
228 3300005563 Ga0068855_100134458 Ga0068855_1001344585 185
229 3300005563 Ga0068855_100409189 Ga0068855_1004091893 185
230 3300005564 Ga0070664_101478843 Ga0070664_1014788431 185
231 3300005614 Ga0068856_100130276 Ga0068856_1001302762 185
232 3300005615 Ga0070702_100662394 Ga0070702_1006623941 185
233 3300005616 Ga0068852_100442241 Ga0068852_1004422412 185
234 3300005719 Ga0068861_100040505 Ga0068861_1000405053 185
235 3300005841 Ga0068863_100089907 Ga0068863_1000899073 185
236 3300005841 Ga0068863_100966132 Ga0068863_1009661322 185
237 3300005842 Ga0068858_100796122 Ga0068858_1007961221 185
238 3300005842 Ga0068858_101267145 Ga0068858_1012671451 185
239 3300006038 Ga0075365_10005358 Ga0075365_100053583 185
240 3300006038 Ga0075365_10448745 Ga0075365_104487452 185
241 3300006042 Ga0075368_10018728 Ga0075368_100187283 185
242 3300006048 Ga0075363_100149199 Ga0075363_1001491992 185
243 3300006051 Ga0075364_10009806 Ga0075364_100098064 185
244 3300006051 Ga0075364_10149987 Ga0075364_101499872 185
245 3300006177 Ga0075362_10163960 Ga0075362_101639602 185
246 3300006178 Ga0075367_10040194 Ga0075367_100401943 185
247 3300006178 Ga0075367_10122875 Ga0075367_101228751 185
248 3300006178 Ga0075367_10202439 Ga0075367_102024392 185
249 3300006195 Ga0075366_10036564 Ga0075366_100365641 185
250 3300006195 Ga0075366_10141629 Ga0075366_101416293 185
251 3300006237 Ga0097621_100095098 Ga0097621_1000950985 185
252 3300006353 Ga0075370_10004635 Ga0075370_100046354 185
253 3300006353 Ga0075370_10056087 Ga0075370_100560872 185
254 3300006358 Ga0068871_100135177 Ga0068871_1001351772 185
255 3300006844 Ga0075428_100131138 Ga0075428_1001311383 185
256 3300006844 Ga0075428_100172899 Ga0075428_1001728992 185
257 3300006846 Ga0075430_100044744 Ga0075430_1000447442 185
258 3300006847 Ga0075431_100224139 Ga0075431_1002241393 185
259 3300006852 Ga0075433_10587059 Ga0075433_105870592 185
260 3300006871 Ga0075434_100037503 Ga0075434_1000375034 185
261 3300006880 Ga0075429_100010861 Ga0075429_1000108618 185
262 3300006880 Ga0075429_100535283 Ga0075429_1005352832 185
263 3300009093 Ga0105240_10118364 Ga0105240_101183642 185
264 3300009093 Ga0105240_10620165 Ga0105240_106201652 185
265 3300009093 Ga0105240_11406433 Ga0105240_114064331 185
266 3300009094 Ga0111539_10199748 Ga0111539_101997482 185
267 3300009147 Ga0114129_10060019 Ga0114129_100600194 185
268 3300009147 Ga0114129_10067019 Ga0114129_100670196 185
269 3300009176 Ga0105242_10361690 Ga0105242_103616902 185
270 3300009176 Ga0105242_10959463 Ga0105242_109594631 185
271 3300011119 Ga0105246_10618620 Ga0105246_106186202 185
272 3300013104 Ga0157370_10105121 Ga0157370_101051215 185
273 3300014968 Ga0157379_10139467 Ga0157379_101394673 185
274 3300025297 Ga0209758_1083880 Ga0209758_10838802 185
275 3300025903 Ga0207680_10033812 Ga0207680_100338123 185
276 3300025907 Ga0207645_10247689 Ga0207645_102476891 185
277 3300025909 Ga0207705_10312076 Ga0207705_103120762 185
278 3300025913 Ga0207695_10158453 Ga0207695_101584533 185
279 3300025914 Ga0207671_10267986 Ga0207671_102679862 185
280 3300025914 Ga0207671_10342339 Ga0207671_103423392 185
281 3300025914 Ga0207671_10386259 Ga0207671_103862592 185
282 3300025919 Ga0207657_10010276 Ga0207657_100102765 185
283 3300025924 Ga0207694_10459624 Ga0207694_104596241 185
284 3300025941 Ga0207711_10004950 Ga0207711_100049507 185
285 3300025944 Ga0207661_10011512 Ga0207661_100115123 185
286 3300025944 Ga0207661_10072701 Ga0207661_100727014 185
287 3300025944 Ga0207661_10877382 Ga0207661_108773822 185
288 3300025981 Ga0207640_10669992 Ga0207640_106699921 185
289 3300025986 Ga0207658_10131569 Ga0207658_101315692 185
290 3300025986 Ga0207658_10807001 Ga0207658_108070012 185
291 3300026023 Ga0207677_11219902 Ga0207677_112199022 185
292 3300026041 Ga0207639_10364894 Ga0207639_103648942 185
293 3300026041 Ga0207639_10378068 Ga0207639_103780682 185
294 3300026041 Ga0207639_10534793 Ga0207639_105347931 185
295 3300026075 Ga0207708_10000126 Ga0207708_100001263 185
296 3300026088 Ga0207641_10459299 Ga0207641_104592992 185
297 3300026088 Ga0207641_10505860 Ga0207641_105058602 185
298 3300026118 Ga0207675_100031989 Ga0207675_1000319893 185
299 3300026121 Ga0207683_10045779 Ga0207683_100457794 185
300 3300026142 Ga0207698_10053339 Ga0207698_100533396 185
301 3300026142 Ga0207698_10265422 Ga0207698_102654222 185
302 3300028379 Ga0268266_10059589 Ga0268266_100595892 185
303 3300028379 Ga0268266_10417185 Ga0268266_104171853 185
304 3300028379 Ga0268266_10721193 Ga0268266_107211932 185
305 3300028794 Ga0307515_10000018 Ga0307515_10000018331 185
306 3300031548 Ga0307408_100004179 Ga0307408_1000041797 185
307 3300031731 Ga0307405_10002374 Ga0307405_100023742 185
308 3300031824 Ga0307413_10031519 Ga0307413_100315192 185
309 3300031901 Ga0307406_11116806 Ga0307406_111168061 185
310 3300031903 Ga0307407_10203494 Ga0307407_102034942 185
311 3300032004 Ga0307414_10042551 Ga0307414_100425512 185
312 3300032126 Ga0307415_100057000 Ga0307415_1000570002 185
313 3300042012 Ga0439455_0008349 Ga0439455_0008349_1432_1992 185
314 3300042157 Ga0439458_0006193 Ga0439458_0006193_1302_1862 185
315 3300046460 Ga0495638_0027229 Ga0495638_0027229_294_851 185
316 3300046538 Ga0495609_0026507 Ga0495609_0026507_1384_1950 185
317 3300047320 Ga0495672_0005369 Ga0495672_0005369_444_1001 185
318 3300049569 Ga0501032_0167902 Ga0501032_0167902_51_608 185
319 3300049570 Ga0501033_0674139 Ga0501033_0674139_68_625 185
320 3300049574 Ga0501038_0190066 Ga0501038_0190066_89_649 185
321 3300049575 Ga0501039_0089418 Ga0501039_0089418_645_1202 185
322 3300049577 Ga0501041_0159852 Ga0501041_0159852_127_684 185
323 3300049578 Ga0501042_0001234 Ga0501042_0001234_13050_13607 185
324 3300049579 Ga0501043_0489228 Ga0501043_0489228_64_624 185
325 3300049581 Ga0501047_0188624 Ga0501047_0188624_797_1357 185
326 3300049582 Ga0501048_0025864 Ga0501048_0025864_3443_4000 185
327 3300049586 Ga0501070_0316570 Ga0501070_0316570_595_1155 185
328 3300049587 Ga0501071_0029971 Ga0501071_0029971_1596_2153 185
329 3300049588 Ga0501072_0270015 Ga0501072_0270015_708_1265 185
330 3300049589 Ga0501073_0108136 Ga0501073_0108136_51_608 185
331 3300049591 Ga0501075_0027550 Ga0501075_0027550_1191_1748 185
332 3300049592 Ga0501076_0004492 Ga0501076_0004492_1069_1626 185
333 3300049741 Ga0501079_0068983 Ga0501079_0068983_1907_2464 185
334 3300049742 Ga0501080_0493986 Ga0501080_0493986_135_692 185
335 3300050489 nmdc:mga03683_54381_c1 nmdc:mga03683_54381_c1_878_1435 185
336 3300050490 nmdc:mga03n38_145079_c1 nmdc:mga03n38_145079_c1_387_944 185
337 3300050491 nmdc:mga00v17_132754_c1 nmdc:mga00v17_132754_c1_284_841 185
338 3300050492 nmdc:mga0yw44_459043_c1 nmdc:mga0yw44_459043_c1_43_600 185
339 3300050493 nmdc:mga0k408_87254_c1 nmdc:mga0k408_87254_c1_85_642 185
340 3300050494 nmdc:mga06z11_4577_c1 nmdc:mga06z11_4577_c1_3242_3799 185
341 3300050507 nmdc:mga05p37_1022670_c1 nmdc:mga05p37_1022670_c1_144_701 185
342 3300050507 nmdc:mga05p37_109575_c1 nmdc:mga05p37_109575_c1_2075_2632 185
343 3300050508 nmdc:mga09592_271153_c1 nmdc:mga09592_271153_c1_105_662 185
344 3300050508 nmdc:mga09592_9463_c1 nmdc:mga09592_9463_c1_7091_7651 185
345 3300050509 nmdc:mga0qj67_100824_c1 nmdc:mga0qj67_100824_c1_480_1037 185
346 3300050509 nmdc:mga0qj67_8203_c1 nmdc:mga0qj67_8203_c1_6324_6881 185
347 3300050510 nmdc:mga06r32_16653_c1 nmdc:mga06r32_16653_c1_599_1156 185
348 3300050512 nmdc:mga0n895_96349_c1 nmdc:mga0n895_96349_c1_2312_2872 185
349 3300050515 nmdc:mga0a205_29616_c1 nmdc:mga0a205_29616_c1_3695_4255 185
350 3300054114 Ga0501084_0163182 Ga0501084_0163182_1014_1571 185
351 3300060353 Ga0501082_0089085 Ga0501082_0089085_1601_2158 185
352 3300002067 JGI24735J21928_10023417 JGI24735J21928_100234172 186
353 3300005290 Ga0065712_10153151 Ga0065712_101531512 186
354 3300005293 Ga0065715_10032149 Ga0065715_100321492 186
355 3300005295 Ga0065707_10092599 Ga0065707_100925994 186
356 3300005295 Ga0065707_10121915 Ga0065707_101219153 186
357 3300005327 Ga0070658_10348609 Ga0070658_103486092 186
358 3300005329 Ga0070683_100150815 Ga0070683_1001508153 186
359 3300005435 Ga0070714_100578636 Ga0070714_1005786361 186
360 3300005438 Ga0070701_10287637 Ga0070701_102876372 186
361 3300005439 Ga0070711_100103827 Ga0070711_1001038274 186
362 3300005445 Ga0070708_100017244 Ga0070708_1000172442 186
363 3300005445 Ga0070708_100528251 Ga0070708_1005282512 186
364 3300005445 Ga0070708_100704760 Ga0070708_1007047601 186
365 3300005458 Ga0070681_10312779 Ga0070681_103127792 186
366 3300005471 Ga0070698_100000010 Ga0070698_10000001047 186
367 3300005471 Ga0070698_100251670 Ga0070698_1002516702 186
368 3300005471 Ga0070698_100283485 Ga0070698_1002834852 186
369 3300005471 Ga0070698_100643720 Ga0070698_1006437202 186
370 3300005518 Ga0070699_100093275 Ga0070699_1000932752 186
371 3300005518 Ga0070699_100460663 Ga0070699_1004606632 186
372 3300005530 Ga0070679_100226404 Ga0070679_1002264042 186
373 3300005545 Ga0070695_100285552 Ga0070695_1002855522 186
374 3300005546 Ga0070696_100740788 Ga0070696_1007407881 186
375 3300005549 Ga0070704_100743122 Ga0070704_1007431221 186
376 3300005549 Ga0070704_101314828 Ga0070704_1013148281 186
377 3300005844 Ga0068862_100150821 Ga0068862_1001508212 186
378 3300006173 Ga0070716_100000911 Ga0070716_1000009119 186
379 3300006173 Ga0070716_100630526 Ga0070716_1006305262 186
380 3300006178 Ga0075367_10041329 Ga0075367_100413293 186
381 3300006353 Ga0075370_10094668 Ga0075370_100946683 186
382 3300006846 Ga0075430_100010571 Ga0075430_1000105714 186
383 3300006847 Ga0075431_101295895 Ga0075431_1012958951 186
384 3300006852 Ga0075433_10053790 Ga0075433_100537902 186
385 3300006871 Ga0075434_100000316 Ga0075434_10000031625 186
386 3300006880 Ga0075429_100355669 Ga0075429_1003556692 186
387 3300006914 Ga0075436_100011111 Ga0075436_10001111110 186
388 3300007076 Ga0075435_100045521 Ga0075435_1000455213 186
389 3300007076 Ga0075435_100110188 Ga0075435_1001101885 186
390 3300009093 Ga0105240_10006679 Ga0105240_100066797 186
391 3300009094 Ga0111539_10071221 Ga0111539_100712214 186
392 3300009098 Ga0105245_10672920 Ga0105245_106729202 186
393 3300009174 Ga0105241_11090491 Ga0105241_110904911 186
394 3300009545 Ga0105237_10001004 Ga0105237_100010047 186
395 3300009551 Ga0105238_10031933 Ga0105238_100319334 186
396 3300009551 Ga0105238_10090501 Ga0105238_100905012 186
397 3300009553 Ga0105249_10035688 Ga0105249_100356885 186
398 3300013297 Ga0157378_10001849 Ga0157378_1000184914 186
399 3300013297 Ga0157378_10667767 Ga0157378_106677672 186
400 3300013297 Ga0157378_10667768 Ga0157378_106677682 186
401 3300014326 Ga0157380_10850999 Ga0157380_108509992 186
402 3300014326 Ga0157380_11089808 Ga0157380_110898081 186
403 3300014326 Ga0157380_11510325 Ga0157380_115103251 186
404 3300021384 Ga0213876_10015050 Ga0213876_100150504 186
405 3300025885 Ga0207653_10031777 Ga0207653_100317771 186
406 3300025906 Ga0207699_10001465 Ga0207699_100014655 186
407 3300025909 Ga0207705_10526009 Ga0207705_105260092 186
408 3300025912 Ga0207707_10403414 Ga0207707_104034142 186
409 3300025913 Ga0207695_10013238 Ga0207695_100132386 186
410 3300025914 Ga0207671_10029691 Ga0207671_100296914 186
411 3300025924 Ga0207694_10000741 Ga0207694_1000074118 186
412 3300025924 Ga0207694_10048867 Ga0207694_100488672 186
413 3300025926 Ga0207659_10720566 Ga0207659_107205661 186
414 3300025929 Ga0207664_10629395 Ga0207664_106293952 186
415 3300025939 Ga0207665_10000385 Ga0207665_1000038528 186
416 3300025944 Ga0207661_10187855 Ga0207661_101878552 186
417 3300027717 Ga0209998_10028256 Ga0209998_100282562 186
418 3300027876 Ga0209974_10031326 Ga0209974_100313262 186
419 3300028380 Ga0268265_10155182 Ga0268265_101551823 186
420 3300028577 Ga0265318_10170618 Ga0265318_101706182 186
421 3300031616 Ga0307508_10000120 Ga0307508_1000012037 186
422 3300031616 Ga0307508_10100203 Ga0307508_101002033 186
423 3300034820 Ga0373959_0033445 Ga0373959_0033445_84_650 186
424 3300035114 Ga0373939_0071960 Ga0373939_0071960_170_736 186
425 3300035691 Ga0373931_0293963 Ga0373931_0293963_280_846 186
426 3300039437 Ga0436365_0910109 Ga0436365_0910109_4123_4689 186
427 3300044712 Ga0453684_0014979 Ga0453684_0014979_8984_9550 186
428 3300045051 Ga0451576_0681968 Ga0451576_0681968_94_660 186
429 3300046615 Ga0495656_0211561 Ga0495656_0211561_317_877 186
430 3300048911 Ga0496108_0279390 Ga0496108_0279390_681_1265 186
431 3300048913 Ga0496110_0017935 Ga0496110_0017935_4486_5058 186
432 3300048916 Ga0496113_0082844 Ga0496113_0082844_373_957 186
433 3300048929 Ga0496126_0019777 Ga0496126_0019777_974_1534 186
434 3300049590 Ga0501074_0321340 Ga0501074_0321340_320_886 186
435 3300049742 Ga0501080_0790174 Ga0501080_0790174_162_731 186
436 3300049743 Ga0501081_0657131 Ga0501081_0657131_35_601 186
437 3300050507 nmdc:mga05p37_1086803_c1 nmdc:mga05p37_1086803_c1_75_638 186
438 3300050508 nmdc:mga09592_330253_c1 nmdc:mga09592_330253_c1_642_1205 186
439 3300050509 nmdc:mga0qj67_13572_c1 nmdc:mga0qj67_13572_c1_1989_2552 186
440 3300050510 nmdc:mga06r32_41201_c1 nmdc:mga06r32_41201_c1_3743_4306 186
441 3300050512 nmdc:mga0n895_5259_c1 nmdc:mga0n895_5259_c1_3073_3633 186
442 3300050513 nmdc:mga0rr50_22551_c2 nmdc:mga0rr50_22551_c2_1704_2264 186
443 3300050514 nmdc:mga08x19_3394_c1 nmdc:mga08x19_3394_c1_667_1233 186
444 3300050515 nmdc:mga0a205_64052_c1 nmdc:mga0a205_64052_c1_2200_2760 186
445 3300060353 Ga0501082_0287323 Ga0501082_0287323_153_719 186
446 3300005434 Ga0070709_10004567 Ga0070709_100045673 187
447 3300005435 Ga0070714_100004779 Ga0070714_1000047795 187
448 3300005436 Ga0070713_100000888 Ga0070713_10000088812 187
449 3300005439 Ga0070711_100000613 Ga0070711_1000006135 187
450 3300005445 Ga0070708_100014475 Ga0070708_1000144757 187
451 3300005445 Ga0070708_100060060 Ga0070708_1000600605 187
452 3300005467 Ga0070706_100140078 Ga0070706_1001400782 187
453 3300005468 Ga0070707_100375095 Ga0070707_1003750952 187
454 3300005616 Ga0068852_100903948 Ga0068852_1009039482 187
455 3300006175 Ga0070712_100000065 Ga0070712_10000006548 187
456 3300006844 Ga0075428_100237482 Ga0075428_1002374822 187
457 3300006844 Ga0075428_100253049 Ga0075428_1002530492 187
458 3300006847 Ga0075431_100005349 Ga0075431_1000053496 187
459 3300006852 Ga0075433_10001869 Ga0075433_1000186921 187
460 3300006871 Ga0075434_100018537 Ga0075434_1000185373 187
461 3300006871 Ga0075434_100206787 Ga0075434_1002067872 187
462 3300007076 Ga0075435_100020135 Ga0075435_1000201353 187
463 3300007788 Ga0099795_10289491 Ga0099795_102894912 187
464 3300009147 Ga0114129_10061053 Ga0114129_100610532 187
465 3300009177 Ga0105248_10803189 Ga0105248_108031892 187
466 3300013297 Ga0157378_10031792 Ga0157378_100317922 187
467 3300013308 Ga0157375_10428306 Ga0157375_104283062 187
468 3300025905 Ga0207685_10081314 Ga0207685_100813143 187
469 3300025906 Ga0207699_10013464 Ga0207699_100134645 187
470 3300025910 Ga0207684_10118351 Ga0207684_101183512 187
471 3300025915 Ga0207693_10000022 Ga0207693_1000002282 187
472 3300025922 Ga0207646_10375782 Ga0207646_103757822 187
473 3300025928 Ga0207700_10000056 Ga0207700_100000568 187
474 3300025929 Ga0207664_10007547 Ga0207664_100075474 187
475 3300028800 Ga0265338_10141799 Ga0265338_101417992 187
476 3300028800 Ga0265338_10195712 Ga0265338_101957122 187
477 3300028800 Ga0265338_10535449 Ga0265338_105354491 187
478 3300031241 Ga0265325_10026933 Ga0265325_100269333 187
479 3300031241 Ga0265325_10097809 Ga0265325_100978091 187
480 3300031247 Ga0265340_10382931 Ga0265340_103829311 187
481 3300031249 Ga0265339_10021647 Ga0265339_100216474 187
482 3300031249 Ga0265339_10062547 Ga0265339_100625472 187
483 3300031249 Ga0265339_10337556 Ga0265339_103375561 187
484 3300031711 Ga0265314_10032642 Ga0265314_100326424 187
485 3300035086 Ga0373934_0103577 Ga0373934_0103577_100_666 187
486 3300035089 Ga0373944_0047092 Ga0373944_0047092_104_670 187
487 3300035111 Ga0373923_0059597 Ga0373923_0059597_1014_1580 187
488 3300035113 Ga0373936_0010571 Ga0373936_0010571_2133_2699 187
489 3300035171 Ga0373946_0038492 Ga0373946_0038492_337_903 187
490 3300035692 Ga0373935_0022427 Ga0373935_0022427_1719_2285 187
491 3300035724 Ga0373933_0032336 Ga0373933_0032336_1493_2059 187
492 3300036401 Ga0373937_0309292 Ga0373937_0309292_312_878 187
493 3300046460 Ga0495638_0040965 Ga0495638_0040965_469_1032 187
494 3300046477 Ga0495664_0198404 Ga0495664_0198404_381_947 187
495 3300046517 Ga0495630_0077911 Ga0495630_0077911_980_1546 187
496 3300046559 Ga0495667_0156819 Ga0495667_0156819_481_1047 187
497 3300047319 Ga0495674_0004353 Ga0495674_0004353_3869_4435 187
498 3300047471 Ga0495684_0573532 Ga0495684_0573532_117_683 187
499 3300048908 Ga0496105_0156533 Ga0496105_0156533_1092_1658 187
500 3300048917 Ga0496114_0067860 Ga0496114_0067860_880_1446 187
501 3300048918 Ga0496115_0007463 Ga0496115_0007463_2243_2809 187
502 3300049460 Ga0495682_0036877 Ga0495682_0036877_377_940 187
503 3300050496 nmdc:mga07m45_103136_c1 nmdc:mga07m45_103136_c1_785_1351 187
504 3300050507 nmdc:mga05p37_115525_c1 nmdc:mga05p37_115525_c1_2003_2572 187
505 3300050509 nmdc:mga0qj67_45088_c1 nmdc:mga0qj67_45088_c1_2080_2670 187
506 3300050510 nmdc:mga06r32_1992_c1 nmdc:mga06r32_1992_c1_7734_8303 187
507 3300050512 nmdc:mga0n895_86840_c1 nmdc:mga0n895_86840_c1_1849_2412 187
508 3300050513 nmdc:mga0rr50_67600_c1 nmdc:mga0rr50_67600_c1_1531_2094 187
509 3300009098 Ga0105245_10151334 Ga0105245_101513343 188
510 3300009553 Ga0105249_10498601 Ga0105249_104986012 188
511 3300014969 Ga0157376_11641127 Ga0157376_116411271 188
512 3300048909 Ga0496106_0003995 Ga0496106_0003995_510_1076 188
513 3300048920 Ga0496117_0016272 Ga0496117_0016272_1100_1666 188
514 3300048921 Ga0496118_0002345 Ga0496118_0002345_9735_10301 188
515 3300048922 Ga0496119_0436642 Ga0496119_0436642_28_594 188
516 3300048924 Ga0496121_0003002 Ga0496121_0003002_9824_10390 188
517 3300048927 Ga0496124_0005039 Ga0496124_0005039_4955_5521 188
518 3300048929 Ga0496126_0025870 Ga0496126_0025870_187_753 188
519 2162886006 SwRhRL3b_contig_3264281 SwRhRL3b_0188.00000370 189
520 2162886007 SwRhRL2b_contig_3588356 SwRhRL2b_0044.00005490 189
521 3300009553 Ga0105249_10113174 Ga0105249_101131743 189
522 3300035083 Ga0373926_0027645 Ga0373926_0027645_1147_1740 189
523 3300035170 Ga0373943_0269354 Ga0373943_0269354_245_838 189
524 3300035725 Ga0373947_0016057 Ga0373947_0016057_961_1545 189
525 3300037471 Ga0395905_0525315 Ga0395905_0525315_326_952 189
526 3300046459 Ga0495629_0154438 Ga0495629_0154438_607_1200 189
527 3300046472 Ga0495580_0000523 Ga0495580_0000523_5716_6309 189
528 3300046473 Ga0495582_0001022 Ga0495582_0001022_1816_2409 189
529 3300047315 Ga0495581_0249319 Ga0495581_0249319_124_717 189
530 3300048089 Ga0495614_0251677 Ga0495614_0251677_190_783 189
531 3300050508 nmdc:mga09592_132559_c1 nmdc:mga09592_132559_c1_778_1347 189
532 3300050511 nmdc:mga08y16_974340_c1 nmdc:mga08y16_974340_c1_106_675 189

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

20

197

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3jtw-assembly1.cif.gz_A-2 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.8276 4 188
1d1g-assembly1.cif.gz_B dihydrofolate reductase from thermotoga maritima 0.8256 5 188
3jtw-assembly1.cif.gz_A-2 crystal structure of putative dihydrofolate reductase (yp_805003.1) from pediococcus pentosaceus atcc 25745 at 1.90 a resolution 0.8188 4 188
3ky8-assembly1.cif.gz_B crystal structure of putative riboflavin biosynthesis protein (yp_001092907.1) from shewanella sp. pv-4 at 2.12 a resolution 0.8167 5 189
1d1g-assembly1.cif.gz_B dihydrofolate reductase from thermotoga maritima 0.8164 5 188
ID Description Score Start End Superfamily
3ky8B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8427 6 186 3.40.430.10
3ky8B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8292 6 186 3.40.430.10
1cz3B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8129 5 189 3.40.430.10
2gd9B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8088 4 185 3.40.430.10
2gd9B01 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.8042 4 185 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A7Y5G0Q8-F1-model_v4 Dihydrofolate reductase 0.9961 3 189 GO:0008703
GO:0009231
AF-A0A7Y5G0Q8-F1-model_v4 Dihydrofolate reductase 0.9908 3 189 GO:0008703
GO:0009231
AF-A0A1B9SPR1-F1-model_v4 Bacterial bifunctional deaminase-reductase C-terminal domain-containing protein 0.984 3 188 GO:0008703
GO:0009231
AF-Q6MQX9-F1-model_v4 Putative secreted protein 0.9813 1 188 GO:0008703
GO:0009231
AF-A0A1B9SPR1-F1-model_v4 Bacterial bifunctional deaminase-reductase C-terminal domain-containing protein 0.9787 3 188 GO:0008703
GO:0009231

Feature Viewer

pLDDT pTM Quality
94.05 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map