F460258

General Info

Members Datasets Scaffolds Average Seq Length
532 292 1064 164

Family's Representative Sequence

Representative Sequence 3300009101|Ga0105247_10489691|Ga0105247_104896912
Length 187
Sequence VKEPNAQEYRKDKRRNSYMSATNPTRTQPQPQKITTFLWFDNNAEEAVNFYVSVFKNSRIVGTSHYSDAGPGPKGSVMTIEFELDGERFTALNGGPTFKFTEAISLVVHCETQQEVDYFWEKLSEGGQKVECGWLKDKFGLAWQIVPNFLLELLTSGDNAKTDRVMRAVMSMKKLEIDDLKRAAAGN

Samples

Sample ID Description Type Environment
1 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
68 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
69 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
70 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
71 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
74 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
75 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300009835 Sorghum rhizosphere soil microbial communities under drought stress in Albany, CA - sample B Metatranscriptome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
116 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
117 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
169 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
173 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
174 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
175 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
176 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
177 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
178 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
179 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
180 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
181 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
182 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
183 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
184 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
185 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
186 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
187 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
188 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
189 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
190 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
191 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
192 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
193 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
194 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
195 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
196 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
197 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
198 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
199 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
200 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
201 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
202 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
203 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
204 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
205 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
206 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
207 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
208 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
209 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
210 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
211 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
212 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
213 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
214 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
215 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
216 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
217 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
218 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
219 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
220 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
221 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
222 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
223 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
224 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
225 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
226 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
227 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
228 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
229 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
230 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
231 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
232 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
240 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
241 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
242 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
243 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
244 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
245 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
246 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
247 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
248 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
249 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
250 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
251 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
252 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
253 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
254 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
255 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
256 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
257 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
258 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
259 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
260 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
261 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
262 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
263 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
264 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
265 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
266 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
267 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
269 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
270 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
271 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
272 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
273 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
274 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
275 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
276 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
277 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
278 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
279 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
280 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
281 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
282 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
283 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
284 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
285 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
286 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
287 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
288 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
289 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
290 2867475112 Streptomyces sp. TM32 Isolate Unclassified
291 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
292 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.68
Metatranscriptomes 0.75
Isolates 0.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.76
Nodule 0
Rhizoplane 1.13
Rhizosphere 94.36
Stem 0
Stem Tuber 0
Unclassified 15.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105247_10489691 3300009101 Unclassified 894
2 MBSR1b_contig_5328574 2162886012 Bacteria 1221
3 JGI24748J21848_1000012 3300002074 Bacteria 152599
4 JGI24034J26672_10000003 3300002239 Bacteria 501747
5 rootH1_10113251 3300003316 Bacteria 1621
6 rootL2_10264034 3300003322 Bacteria 1698
7 Ga0065714_10048958 3300005288 Unclassified 652
8 Ga0065704_10109913 3300005289 Unclassified 1992
9 Ga0065715_10117905 3300005293 Bacteria 2322
10 Ga0065715_10167280 3300005293 Bacteria 1576
11 Ga0065715_10598368 3300005293 Unclassified 709
12 Ga0065707_10100365 3300005295 Unclassified 2936
13 Ga0065707_10303000 3300005295 Bacteria 1000
14 Ga0065707_10664180 3300005295 Bacteria 656
15 Ga0070690_100036264 3300005330 Bacteria 3098
16 Ga0070670_100000364 3300005331 Bacteria 37748
17 Ga0070670_100770499 3300005331 Bacteria 868
18 Ga0068869_100034586 3300005334 Bacteria 3575
19 Ga0068869_100067015 3300005334 Bacteria 2647
20 Ga0068869_100302007 3300005334 Bacteria 1293
21 Ga0068869_100345215 3300005334 Bacteria 1212
22 Ga0070666_10002313 3300005335 Bacteria 11524
23 Ga0070680_100133393 3300005336 Bacteria 2079
24 Ga0070682_100000599 3300005337 Bacteria 21932
25 Ga0068868_100045325 3300005338 Bacteria 3440
26 Ga0068868_100071905 3300005338 Bacteria 2759
27 Ga0068868_100176642 3300005338 Bacteria 1770
28 Ga0070660_100276972 3300005339 Bacteria 1372
29 Ga0070689_100001207 3300005340 Bacteria 16357
30 Ga0070691_10003282 3300005341 Bacteria 7252
31 Ga0070687_100047776 3300005343 Bacteria 2197
32 Ga0070687_100754785 3300005343 Bacteria 685
33 Ga0070687_100983764 3300005343 Unclassified 610
34 Ga0070692_10231829 3300005345 Bacteria 1096
35 Ga0070668_100516581 3300005347 Unclassified 1036
36 Ga0070671_100523374 3300005355 Unclassified 1021
37 Ga0070674_100963241 3300005356 Bacteria 747
38 Ga0070673_100093365 3300005364 Bacteria 2464
39 Ga0070688_100448674 3300005365 Bacteria 964
40 Ga0070688_100572675 3300005365 Bacteria 861
41 Ga0070659_100000197 3300005366 Bacteria 46446
42 Ga0070659_100299768 3300005366 Bacteria 1340
43 Ga0070667_100005503 3300005367 Bacteria 10576
44 Ga0070709_10146542 3300005434 Bacteria 1627
45 Ga0070701_10375360 3300005438 Bacteria 895
46 Ga0070705_100040434 3300005440 Bacteria 2651
47 Ga0070705_100221115 3300005440 Bacteria 1311
48 Ga0070700_100000142 3300005441 Bacteria 42548
49 Ga0070700_100063941 3300005441 Bacteria 2329
50 Ga0070694_100019730 3300005444 Bacteria 4289
51 Ga0070694_100395450 3300005444 Bacteria 1081
52 Ga0070694_100423901 3300005444 Bacteria 1046
53 Ga0070694_100631730 3300005444 Unclassified 865
54 Ga0070708_100623743 3300005445 Bacteria 1016
55 Ga0070708_101239801 3300005445 Bacteria 697
56 Ga0070678_101156142 3300005456 Bacteria 716
57 Ga0070662_100048364 3300005457 Bacteria 3064
58 Ga0070662_100787629 3300005457 Bacteria 808
59 Ga0070681_10036355 3300005458 Bacteria 4945
60 Ga0070681_11278988 3300005458 Bacteria 656
61 Ga0068867_100277031 3300005459 Bacteria 1374
62 Ga0068867_100568921 3300005459 Archaea 984
63 Ga0070706_100000358 3300005467 Bacteria 55073
64 Ga0070706_100135725 3300005467 Bacteria 2297
65 Ga0070706_100348505 3300005467 Bacteria 1380
66 Ga0070707_100334021 3300005468 Bacteria 1472
67 Ga0070707_100427314 3300005468 Bacteria 1285
68 Ga0070707_101480994 3300005468 Bacteria 645
69 Ga0070698_100131074 3300005471 Unclassified 2462
70 Ga0070698_100197820 3300005471 Unclassified 1946
71 Ga0070699_100002881 3300005518 Bacteria 15333
72 Ga0070699_100346910 3300005518 Bacteria 1337
73 Ga0070684_100438895 3300005535 Bacteria 1206
74 Ga0070697_100004457 3300005536 Bacteria 10763
75 Ga0070697_100879257 3300005536 Bacteria 794
76 Ga0068853_101392095 3300005539 Bacteria 678
77 Ga0070686_100014523 3300005544 Bacteria 4543
78 Ga0070695_100007419 3300005545 Bacteria 6506
79 Ga0070695_100029105 3300005545 Bacteria 3431
80 Ga0070695_100391841 3300005545 Unclassified 1051
81 Ga0070696_100150566 3300005546 Bacteria 1707
82 Ga0070696_100212164 3300005546 Bacteria 1450
83 Ga0070693_100137221 3300005547 Bacteria 1535
84 Ga0070693_100266498 3300005547 Bacteria 1142
85 Ga0070704_100044544 3300005549 Bacteria 3084
86 Ga0070704_100113963 3300005549 Unclassified 2063
87 Ga0070704_100149338 3300005549 Bacteria 1835
88 Ga0070704_100226998 3300005549 Bacteria 1521
89 Ga0070704_100332277 3300005549 Unclassified 1277
90 Ga0068855_100052729 3300005563 Bacteria 4787
91 Ga0070664_101745888 3300005564 Bacteria 590
92 Ga0068854_100649080 3300005578 Bacteria 906
93 Ga0068854_100717273 3300005578 Bacteria 865
94 Ga0068856_100086773 3300005614 Bacteria 3110
95 Ga0070702_100133965 3300005615 Bacteria 1569
96 Ga0070702_100174868 3300005615 Archaea 1400
97 Ga0068859_100024551 3300005617 Bacteria 6047
98 Ga0068859_100043670 3300005617 Bacteria 4505
99 Ga0068859_100123198 3300005617 Bacteria 2660
100 Ga0068859_100502437 3300005617 Bacteria 1308
101 Ga0068864_100032588 3300005618 Bacteria 4428
102 Ga0068866_10095825 3300005718 Bacteria 1626
103 Ga0068861_100001492 3300005719 Bacteria 14848
104 Ga0068861_100079297 3300005719 Bacteria 2566
105 Ga0068861_100359878 3300005719 Bacteria 1279
106 Ga0068861_100457520 3300005719 Bacteria 1145
107 Ga0068863_100013976 3300005841 Bacteria 7738
108 Ga0068863_100084458 3300005841 Bacteria 3009
109 Ga0068863_100174242 3300005841 Bacteria 2064
110 Ga0068863_101086731 3300005841 Bacteria 804
111 Ga0068858_100000468 3300005842 Bacteria 42170
112 Ga0068858_100006519 3300005842 Bacteria 11360
113 Ga0068860_100252132 3300005843 Bacteria 1719
114 Ga0068860_100398143 3300005843 Bacteria 1362
115 Ga0068860_101935686 3300005843 Unclassified 611
116 Ga0068862_100030818 3300005844 Unclassified 4522
117 Ga0068862_101182271 3300005844 Bacteria 763
118 Ga0081455_10000124 3300005937 Bacteria 89174
119 Ga0081539_10052572 3300005985 Unclassified 2286
120 Ga0075365_10533077 3300006038 Bacteria 830
121 Ga0075368_10006328 3300006042 Bacteria 4130
122 Ga0075363_100043677 3300006048 Bacteria 2372
123 Ga0075364_10198901 3300006051 Bacteria 1358
124 Ga0070715_10000030 3300006163 Bacteria 88060
125 Ga0070712_100833014 3300006175 Bacteria 793
126 Ga0070712_101373277 3300006175 Bacteria 616
127 Ga0075367_10047413 3300006178 Bacteria 2527
128 Ga0075369_10047323 3300006186 Bacteria 1854
129 Ga0075366_10401049 3300006195 Bacteria 844
130 Ga0097621_100001360 3300006237 Bacteria 16810
131 Ga0097621_100194999 3300006237 Bacteria 1756
132 Ga0097621_100450704 3300006237 Bacteria 1159
133 Ga0097621_101101887 3300006237 Unclassified 745
134 Ga0068871_100003480 3300006358 Bacteria 10818
135 Ga0075428_100501031 3300006844 Bacteria 1299
136 Ga0075428_100676515 3300006844 Bacteria 1100
137 Ga0075430_100009783 3300006846 Bacteria 8109
138 Ga0075430_100486970 3300006846 Bacteria 1018
139 Ga0075431_100006302 3300006847 Bacteria 11785
140 Ga0075431_100035201 3300006847 Bacteria 5155
141 Ga0075431_101754518 3300006847 Bacteria 577
142 Ga0075433_10031699 3300006852 Bacteria 4520
143 Ga0075433_10104309 3300006852 Bacteria 2512
144 Ga0075433_10761998 3300006852 Bacteria 846
145 Ga0075434_100000279 3300006871 Bacteria 36373
146 Ga0075434_100046196 3300006871 Bacteria 4321
147 Ga0075434_100212685 3300006871 Bacteria 1953
148 Ga0075434_100236706 3300006871 Bacteria 1846
149 Ga0075434_100269422 3300006871 Bacteria 1722
150 Ga0075434_100918415 3300006871 Bacteria 890
151 Ga0075429_100008668 3300006880 Bacteria 8845
152 Ga0075429_100039775 3300006880 Bacteria 4092
153 Ga0075429_100485721 3300006880 Bacteria 1082
154 Ga0075436_100739938 3300006914 Bacteria 730
155 Ga0097620_100024551 3300006931 Bacteria 6047
156 Ga0097620_100043670 3300006931 Bacteria 4505
157 Ga0097620_100123194 3300006931 Bacteria 2660
158 Ga0097620_100502395 3300006931 Bacteria 1308
159 Ga0075435_100035491 3300007076 Bacteria 3957
160 Ga0075435_100239671 3300007076 Bacteria 1542
161 Ga0105251_10032657 3300009011 Bacteria 2591
162 Ga0105240_10104283 3300009093 Bacteria 3444
163 Ga0105240_10145527 3300009093 Bacteria 2828
164 Ga0105240_10730140 3300009093 Bacteria 1078
165 Ga0111539_10524916 3300009094 Unclassified 1379
166 Ga0111539_10657888 3300009094 Bacteria 1220
167 Ga0111539_10756940 3300009094 Bacteria 1131
168 Ga0105245_10004743 3300009098 Bacteria 12005
169 Ga0105245_10469140 3300009098 Unclassified 1270
170 Ga0105247_10643752 3300009101 Bacteria 791
171 Ga0105247_10944137 3300009101 Bacteria 669
172 Ga0114129_10041220 3300009147 Bacteria 6507
173 Ga0114129_10251123 3300009147 Bacteria 2374
174 Ga0114129_10523388 3300009147 Bacteria 1546
175 Ga0114129_10527980 3300009147 Bacteria 1538
176 Ga0114129_10946841 3300009147 Bacteria 1088
177 Ga0105243_10000382 3300009148 Bacteria 47538
178 Ga0105243_10530354 3300009148 Bacteria 1121
179 Ga0105243_10872809 3300009148 Bacteria 893
180 Ga0105241_10056401 3300009174 Unclassified 3012
181 Ga0105241_10137353 3300009174 Bacteria 1987
182 Ga0105241_10317434 3300009174 Bacteria 1342
183 Ga0105241_10405543 3300009174 Bacteria 1196
184 Ga0105242_10002927 3300009176 Bacteria 13340
185 Ga0105242_10297658 3300009176 Bacteria 1471
186 Ga0105242_10444828 3300009176 Bacteria 1220
187 Ga0105242_10583647 3300009176 Bacteria 1077
188 Ga0105242_11073597 3300009176 Bacteria 817
189 Ga0105242_11146272 3300009176 Unclassified 794
190 Ga0105248_10004314 3300009177 Bacteria 15727
191 Ga0105248_10061486 3300009177 Bacteria 4217
192 Ga0105248_10224591 3300009177 Bacteria 2114
193 Ga0105248_10557706 3300009177 Bacteria 1292
194 Ga0105248_10881382 3300009177 Bacteria 1010
195 Ga0105248_11199695 3300009177 Bacteria 858
196 Ga0105237_12268310 3300009545 Bacteria 553
197 Ga0105238_10835756 3300009551 Bacteria 937
198 Ga0105249_10266288 3300009553 Bacteria 1705
199 Ga0130084_1095944 3300009835 Bacteria 564
200 Ga0105239_10134745 3300010375 Bacteria 2750
201 Ga0105239_10716418 3300010375 Unclassified 1144
202 Ga0105246_10042788 3300011119 Bacteria 3069
203 Ga0105246_10205292 3300011119 Bacteria 1535
204 Ga0157371_10275792 3300013102 Bacteria 1214
205 Ga0157378_10000015 3300013297 Bacteria 143601
206 Ga0157378_10015736 3300013297 Bacteria 6623
207 Ga0157378_10204561 3300013297 Bacteria 1869
208 Ga0157378_10298599 3300013297 Bacteria 1558
209 Ga0157378_10427838 3300013297 Bacteria 1310
210 Ga0157378_10434184 3300013297 Bacteria 1300
211 Ga0157378_10772527 3300013297 Bacteria 985
212 Ga0163162_10012043 3300013306 Bacteria 8434
213 Ga0163162_10042131 3300013306 Bacteria 4568
214 Ga0163162_11414576 3300013306 Bacteria 791
215 Ga0157372_10235452 3300013307 Bacteria 2124
216 Ga0157372_10600704 3300013307 Bacteria 1283
217 Ga0157375_10018566 3300013308 Bacteria 6309
218 Ga0157375_10021033 3300013308 Bacteria 5975
219 Ga0157375_10261671 3300013308 Bacteria 1892
220 Ga0157375_11606585 3300013308 Bacteria 769
221 Ga0163163_10072679 3300014325 Bacteria 3429
222 Ga0163163_10541832 3300014325 Archaea 1226
223 Ga0163163_11833587 3300014325 Bacteria 667
224 Ga0157380_10018308 3300014326 Bacteria 5198
225 Ga0157380_10092260 3300014326 Bacteria 2502
226 Ga0157380_11864186 3300014326 Bacteria 661
227 Ga0182008_10114556 3300014497 Bacteria 1337
228 Ga0157379_10063665 3300014968 Bacteria 3296
229 Ga0157379_10159162 3300014968 Unclassified 2038
230 Ga0157376_10052151 3300014969 Bacteria 3400
231 Ga0157376_10082620 3300014969 Bacteria 2761
232 Ga0163161_10173625 3300017792 Bacteria 1649
233 Ga0197907_10716278 3300020069 Bacteria 869
234 Ga0206349_1575420 3300020075 Bacteria 672
235 Ga0206355_1371886 3300020076 Bacteria 759
236 Ga0213872_10032677 3300021361 Bacteria 2384
237 Ga0207672_1000256 3300025223 Bacteria 7312
238 Ga0207710_10000001 3300025900 Bacteria 1797433
239 Ga0207710_10372657 3300025900 Unclassified 730
240 Ga0207688_10333857 3300025901 Bacteria 932
241 Ga0207680_10085134 3300025903 Bacteria 1996
242 Ga0207647_10722178 3300025904 Bacteria 541
243 Ga0207685_10000009 3300025905 Bacteria 242842
244 Ga0207699_10109329 3300025906 Bacteria 1769
245 Ga0207645_10018205 3300025907 Bacteria 4627
246 Ga0207643_10218639 3300025908 Bacteria 1165
247 Ga0207684_10000168 3300025910 Bacteria 110284
248 Ga0207684_10514749 3300025910 Bacteria 1025
249 Ga0207654_10389855 3300025911 Unclassified 966
250 Ga0207654_10654375 3300025911 Bacteria 753
251 Ga0207707_10021016 3300025912 Bacteria 5701
252 Ga0207707_10324035 3300025912 Bacteria 1330
253 Ga0207695_10586284 3300025913 Bacteria 996
254 Ga0207695_11335589 3300025913 Bacteria 597
255 Ga0207695_11482975 3300025913 Bacteria 559
256 Ga0207671_10060562 3300025914 Unclassified 2808
257 Ga0207693_10900188 3300025915 Bacteria 679
258 Ga0207663_10081834 3300025916 Bacteria 2116
259 Ga0207660_10373904 3300025917 Unclassified 1145
260 Ga0207662_10114416 3300025918 Bacteria 1685
261 Ga0207662_10493213 3300025918 Bacteria 843
262 Ga0207657_10370432 3300025919 Bacteria 1128
263 Ga0207652_10616246 3300025921 Bacteria 972
264 Ga0207646_10316044 3300025922 Unclassified 1411
265 Ga0207646_11093700 3300025922 Bacteria 702
266 Ga0207681_10001595 3300025923 Bacteria 14595
267 Ga0207650_10002124 3300025925 Bacteria 13858
268 Ga0207650_10316089 3300025925 Archaea 1278
269 Ga0207650_10431650 3300025925 Bacteria 1094
270 Ga0207687_10031741 3300025927 Bacteria 3572
271 Ga0207664_10559476 3300025929 Bacteria 1026
272 Ga0207644_10000637 3300025931 Bacteria 22247
273 Ga0207644_10254312 3300025931 Bacteria 1403
274 Ga0207690_10000114 3300025932 Bacteria 66039
275 Ga0207706_10079976 3300025933 Bacteria 2874
276 Ga0207686_10004183 3300025934 Bacteria 7739
277 Ga0207686_10021626 3300025934 Unclassified 3695
278 Ga0207709_10000731 3300025935 Bacteria 26259
279 Ga0207709_10069973 3300025935 Bacteria 2223
280 Ga0207670_10002529 3300025936 Bacteria 9603
281 Ga0207670_10180602 3300025936 Bacteria 1589
282 Ga0207704_10058557 3300025938 Bacteria 2373
283 Ga0207665_10234816 3300025939 Unclassified 1349
284 Ga0207691_10979582 3300025940 Bacteria 706
285 Ga0207711_10030416 3300025941 Bacteria 4554
286 Ga0207711_10431546 3300025941 Bacteria 1226
287 Ga0207711_10673710 3300025941 Bacteria 965
288 Ga0207711_10895953 3300025941 Bacteria 825
289 Ga0207689_10001881 3300025942 Bacteria 19847
290 Ga0207689_10042529 3300025942 Bacteria 3758
291 Ga0207689_10051896 3300025942 Unclassified 3380
292 Ga0207689_10146166 3300025942 Bacteria 1948
293 Ga0207689_10355382 3300025942 Bacteria 1218
294 Ga0207689_10413973 3300025942 Bacteria 1124
295 Ga0207679_11121026 3300025945 Bacteria 722
296 Ga0207667_10154938 3300025949 Bacteria 2358
297 Ga0207651_10231359 3300025960 Unclassified 1501
298 Ga0207651_10487377 3300025960 Bacteria 1064
299 Ga0207651_10529424 3300025960 Bacteria 1022
300 Ga0207651_11266723 3300025960 Bacteria 663
301 Ga0207668_10159232 3300025972 Bacteria 1757
302 Ga0207640_10154575 3300025981 Bacteria 1689
303 Ga0207640_10187255 3300025981 Bacteria 1557
304 Ga0207677_10005089 3300026023 Bacteria 7108
305 Ga0207677_10031473 3300026023 Bacteria 3398
306 Ga0207677_10937702 3300026023 Bacteria 782
307 Ga0207703_10000080 3300026035 Bacteria 111786
308 Ga0207703_10019683 3300026035 Bacteria 5275
309 Ga0207639_10494317 3300026041 Bacteria 1117
310 Ga0207708_10000407 3300026075 Bacteria 33931
311 Ga0207708_10065030 3300026075 Bacteria 2787
312 Ga0207702_10175530 3300026078 Bacteria 1969
313 Ga0207641_10082151 3300026088 Bacteria 2799
314 Ga0207641_10113795 3300026088 Bacteria 2403
315 Ga0207641_10440699 3300026088 Bacteria 1257
316 Ga0207676_10024145 3300026095 Bacteria 4496
317 Ga0207676_10212119 3300026095 Bacteria 1718
318 Ga0207674_10057247 3300026116 Bacteria 3952
319 Ga0207674_10125975 3300026116 Unclassified 2527
320 Ga0207674_10365732 3300026116 Bacteria 1394
321 Ga0207675_100001169 3300026118 Bacteria 26145
322 Ga0207675_100023331 3300026118 Bacteria 5754
323 Ga0207675_100115252 3300026118 Bacteria 2539
324 Ga0207675_100224872 3300026118 Bacteria 1809
325 Ga0207675_100299721 3300026118 Bacteria 1565
326 Ga0207675_101436582 3300026118 Bacteria 710
327 Ga0209588_1000545 3300027671 Bacteria 9684
328 Ga0209588_1024656 3300027671 Bacteria 1900
329 Ga0209813_10001883 3300027866 Bacteria 4732
330 Ga0268266_11780714 3300028379 Bacteria 591
331 Ga0268265_10079623 3300028380 Bacteria 2581
332 Ga0268265_10460126 3300028380 Archaea 1190
333 Ga0268264_10019779 3300028381 Bacteria 5500
334 Ga0268264_10169154 3300028381 Bacteria 1975
335 Ga0268264_11616391 3300028381 Unclassified 659
336 Ga0307511_10006194 3300030521 Bacteria 12074
337 Ga0265316_10132817 3300031344 Bacteria 1874
338 Ga0307408_100026071 3300031548 Bacteria 4009
339 Ga0307408_100071326 3300031548 Bacteria 2568
340 Ga0307408_100092951 3300031548 Unclassified 2281
341 Ga0265313_10053793 3300031595 Bacteria 1915
342 Ga0307405_10023001 3300031731 Unclassified 3534
343 Ga0307405_10051408 3300031731 Bacteria 2557
344 Ga0307405_10566898 3300031731 Bacteria 921
345 Ga0307413_10318606 3300031824 Unclassified 1187
346 Ga0307410_10060421 3300031852 Bacteria 2590
347 Ga0307410_10101352 3300031852 Bacteria 2064
348 Ga0307406_10005217 3300031901 Bacteria 7098
349 Ga0307406_10188444 3300031901 Unclassified 1508
350 Ga0307406_10864771 3300031901 Bacteria 767
351 Ga0307407_10245337 3300031903 Bacteria 1224
352 Ga0307412_10031285 3300031911 Bacteria 3360
353 Ga0307412_10391443 3300031911 Unclassified 1128
354 Ga0307409_100046423 3300031995 Bacteria 3288
355 Ga0307409_100340855 3300031995 Bacteria 1410
356 Ga0307416_100067561 3300032002 Bacteria 2949
357 Ga0307416_100171014 3300032002 Unclassified 2022
358 Ga0307416_100895577 3300032002 Bacteria 987
359 Ga0307416_101212778 3300032002 Bacteria 860
360 Ga0307414_10046959 3300032004 Bacteria 2968
361 Ga0307414_10099397 3300032004 Unclassified 2186
362 Ga0307414_11073164 3300032004 Bacteria 743
363 Ga0307414_11963706 3300032004 Bacteria 546
364 Ga0307411_10052141 3300032005 Bacteria 2673
365 Ga0307411_10336242 3300032005 Unclassified 1225
366 Ga0307411_10827362 3300032005 Bacteria 817
367 Ga0307415_100002600 3300032126 Bacteria 9009
368 Ga0307415_100021926 3300032126 Bacteria 3934
369 Ga0307415_100026376 3300032126 Unclassified 3664
370 Ga0373952_0128493 3300035092 Unclassified 694
371 Ga0373941_0019969 3300035115 Bacteria 1873
372 Ga0373946_0555329 3300035171 Bacteria 593
373 Ga0373955_0083876 3300035172 Bacteria 1806
374 Ga0373931_0925658 3300035691 Unclassified 587
375 Ga0373927_0249321 3300035695 Bacteria 1167
376 Ga0373937_0303043 3300036401 Bacteria 1510
377 Ga0373937_0672955 3300036401 Bacteria 981
378 Ga0373925_0483275 3300037068 Bacteria 1016
379 Ga0395899_0006938 3300037312 Bacteria 8775
380 Ga0395899_0153319 3300037312 Bacteria 1632
381 Ga0395900_0036849 3300037418 Bacteria 5041
382 Ga0395900_0052257 3300037418 Bacteria 4207
383 Ga0395900_0282471 3300037418 Bacteria 1651
384 Ga0395898_0002202 3300037466 Bacteria 23805
385 Ga0395898_0020117 3300037466 Bacteria 6781
386 Ga0395898_0355058 3300037466 Bacteria 1398
387 Ga0395905_0003579 3300037471 Bacteria 16536
388 Ga0395905_0025350 3300037471 Bacteria 5592
389 Ga0395901_0003081 3300038443 Bacteria 16789
390 Ga0395901_0076156 3300038443 Bacteria 3500
391 Ga0395901_0463317 3300038443 Bacteria 1295
392 Ga0395901_0513447 3300038443 Bacteria 1218
393 Ga0395901_0776254 3300038443 Bacteria 949
394 Ga0242420_002362 3300038996 Bacteria 2683
395 Ga0436360_0064421 3300039438 Bacteria 4126
396 Ga0436360_0693870 3300039438 Bacteria 1209
397 Ga0436361_0736395 3300039447 Bacteria 999
398 Ga0436362_0249809 3300039453 Unclassified 620
399 Ga0436362_0500899 3300039453 Bacteria 2066
400 Ga0439448_0005793 3300042005 Unclassified 3530
401 Ga0450890_021016 3300042127 Bacteria 886
402 Ga0439458_0009977 3300042157 Bacteria 2116
403 Ga0451577_0112712 3300042876 Bacteria 2434
404 Ga0451577_0139435 3300042876 Bacteria 2178
405 Ga0451577_0343504 3300042876 Bacteria 1354
406 Ga0451577_1212591 3300042876 Unclassified 673
407 Ga0453683_0083272 3300044673 Bacteria 2004
408 Ga0453683_0121820 3300044673 Bacteria 1642
409 Ga0453683_0240694 3300044673 Bacteria 1152
410 Ga0453684_0000781 3300044712 Bacteria 109749
411 Ga0453684_0451673 3300044712 Bacteria 1430
412 Ga0466971_0185583 3300044719 Bacteria 979
413 Ga0451576_0090693 3300045051 Bacteria 3179
414 Ga0451576_1327776 3300045051 Bacteria 749
415 Ga0451576_1802814 3300045051 Bacteria 632
416 Ga0451576_1825639 3300045051 Unclassified 628
417 Ga0495607_0049064 3300046501 Bacteria 2464
418 Ga0495606_0111551 3300046507 Bacteria 1649
419 Ga0495663_0000784 3300046525 Bacteria 10857
420 Ga0495598_0000047 3300046537 Bacteria 18754
421 Ga0495621_0006637 3300046539 Bacteria 3388
422 Ga0495668_0178901 3300046616 Bacteria 1162
423 Ga0495668_0179193 3300046616 Unclassified 1161
424 Ga0495649_0058849 3300046694 Bacteria 2070
425 Ga0495636_0067332 3300047318 Bacteria 1524
426 Ga0495672_0009240 3300047320 Bacteria 7168
427 Ga0495676_0565307 3300047321 Bacteria 742
428 Ga0496100_0438299 3300048903 Unclassified 1000
429 Ga0496102_0705208 3300048905 Bacteria 932
430 Ga0496104_1026336 3300048907 Unclassified 728
431 Ga0496106_0016737 3300048909 Bacteria 5425
432 Ga0496112_0532317 3300048915 Bacteria 1109
433 Ga0496114_0001388 3300048917 Bacteria 18360
434 Ga0501291_001858 3300049514 Unclassified 2474
435 Ga0501291_083613 3300049514 Bacteria 639
436 Ga0501292_009993 3300049515 Unclassified 1414
437 Ga0501296_003686 3300049519 Unclassified 1642
438 Ga0501298_013312 3300049521 Unclassified 1455
439 Ga0501298_017215 3300049521 Bacteria 1317
440 Ga0501031_0251181 3300049568 Bacteria 1149
441 Ga0501036_0107386 3300049572 Bacteria 2360
442 Ga0501037_0241810 3300049573 Bacteria 1265
443 Ga0501037_0767317 3300049573 Unclassified 638
444 Ga0501039_0005891 3300049575 Bacteria 9287
445 Ga0501041_0023003 3300049577 Bacteria 3735
446 Ga0501043_0149926 3300049579 Bacteria 1825
447 Ga0501046_0113280 3300049580 Bacteria 2070
448 Ga0501198_003026 3300049649 Bacteria 2287
449 Ga0501202_030621 3300049652 Unclassified 1120
450 Ga0501202_044678 3300049652 Unclassified 967
451 Ga0501206_012481 3300049653 Unclassified 1154
452 Ga0501207_001104 3300049654 Bacteria 3300
453 Ga0501207_001597 3300049654 Unclassified 2848
454 Ga0501216_002208 3300049660 Unclassified 2734
455 Ga0501216_028965 3300049660 Bacteria 1013
456 Ga0501217_004536 3300049661 Bacteria 2860
457 Ga0501217_047206 3300049661 Unclassified 1114
458 Ga0501223_001729 3300049663 Bacteria 4975
459 Ga0501224_009997 3300049664 Unclassified 1389
460 Ga0501227_002880 3300049665 Bacteria 3774
461 Ga0501227_020783 3300049665 Unclassified 1509
462 Ga0501233_024948 3300049668 Unclassified 1311
463 Ga0501235_003510 3300049669 Unclassified 3394
464 Ga0501235_004939 3300049669 Bacteria 2891
465 Ga0501236_006914 3300049670 Unclassified 1406
466 Ga0501239_005119 3300049672 Unclassified 1314
467 Ga0501242_014186 3300049674 Unclassified 984
468 Ga0501243_014315 3300049675 Bacteria 1266
469 Ga0501256_014564 3300049685 Unclassified 783
470 Ga0501259_071635 3300049688 Bacteria 744
471 Ga0501260_012371 3300049689 Unclassified 871
472 Ga0501261_010323 3300049690 Unclassified 1228
473 Ga0501221_008636 3300049704 Unclassified 1775
474 Ga0501221_010815 3300049704 Bacteria 1629
475 Ga0501225_0003750 3300049705 Bacteria 4571
476 Ga0501225_0032360 3300049705 Unclassified 1438
477 Ga0501229_003409 3300049706 Bacteria 1907
478 Ga0501234_000651 3300049707 Bacteria 5367
479 Ga0501234_009385 3300049707 Unclassified 1526
480 Ga0501245_012724 3300049708 Bacteria 1237
481 Ga0501265_034030 3300049762 Unclassified 745
482 Ga0501266_014859 3300049763 Unclassified 1024
483 Ga0501274_010124 3300049771 Unclassified 865
484 Ga0501283_023477 3300049779 Unclassified 1000
485 Ga0501035_0159694 3300049822 Bacteria 1952
486 Ga0501035_0196803 3300049822 Bacteria 1731
487 Ga0501212_011288 3300049851 Bacteria 1285
488 nmdc:mga03n38_11525_c1 3300050490 Bacteria 3297
489 nmdc:mga00v17_158387_c1 3300050491 Bacteria 1457
490 nmdc:mga0yw44_71616_c1 3300050492 Bacteria 2153
491 nmdc:mga0k408_395021_c1 3300050493 Bacteria 823
492 nmdc:mga04h51_14032_c1 3300050495 Bacteria 2281
493 nmdc:mga05p37_105454_c1 3300050507 Bacteria 3468
494 nmdc:mga05p37_147136_c1 3300050507 Bacteria 2883
495 nmdc:mga05p37_261412_c1 3300050507 Bacteria 2071
496 nmdc:mga05p37_402982_c1 3300050507 Bacteria 1597
497 nmdc:mga09592_410612_c1 3300050508 Bacteria 1170
498 nmdc:mga09592_436693_c1 3300050508 Bacteria 1130
499 nmdc:mga09592_55339_c1 3300050508 Bacteria 3353
500 nmdc:mga0qj67_134397_c1 3300050509 Bacteria 2004
501 nmdc:mga0qj67_34878_c1 3300050509 Bacteria 3932
502 nmdc:mga06r32_1167251_c1 3300050510 Unclassified 717
503 nmdc:mga06r32_1181227_c1 3300050510 Bacteria 712
504 nmdc:mga06r32_65564_c1 3300050510 Bacteria 3503
505 nmdc:mga06r32_701083_c1 3300050510 Unclassified 978
506 nmdc:mga06r32_746885_c1 3300050510 Bacteria 942
507 nmdc:mga06r32_772477_c1 3300050510 Bacteria 923
508 nmdc:mga08y16_255388_c1 3300050511 Bacteria 1811
509 nmdc:mga0n895_1158729_c1 3300050512 Bacteria 748
510 nmdc:mga0n895_1269316_c1 3300050512 Bacteria 708
511 nmdc:mga0n895_2442_c1 3300050512 Bacteria 14515
512 nmdc:mga0n895_259862_c1 3300050512 Bacteria 1762
513 nmdc:mga0n895_281982_c1 3300050512 Bacteria 1685
514 nmdc:mga0n895_942140_c1 3300050512 Bacteria 847
515 nmdc:mga0rr50_173405_c1 3300050513 Bacteria 1759
516 nmdc:mga0rr50_586118_c1 3300050513 Bacteria 950
517 nmdc:mga0a205_102608_c1 3300050515 Bacteria 2759
518 nmdc:mga0a205_114855_c1 3300050515 Bacteria 2591
519 nmdc:mga0a205_247449_c1 3300050515 Bacteria 1663
520 nmdc:mga0a205_459548_c1 3300050515 Bacteria 1133
521 nmdc:mga0a205_5218_c1 3300050515 Bacteria 11689
522 Ga0500578_0349351 3300053086 Bacteria 865
523 Ga0500566_0218223 3300053094 Bacteria 950
524 Ga0500641_0010726 3300053096 Bacteria 3318
525 Ga0500595_019433 3300053119 Bacteria 2465
526 Ga0500642_0421897 3300053130 Bacteria 578
527 Ga0500652_000015 3300053131 Bacteria 131012
528 Ga0500636_0031063 3300053177 Bacteria 3161
529 Ga0530510_0062794 3300061734 Bacteria 2689
530 2867476376 2867475112 Bacteria 6909112
531 2928523837 2928521798 Bacteria 4960112
532 2954012778 2954011201 Bacteria 4762601
533 Ga0105247_10489691
534 MBSR1b_contig_5328574
535 JGI24748J21848_1000012
536 JGI24034J26672_10000003
537 rootH1_10113251
538 rootL2_10264034
539 Ga0065714_10048958
540 Ga0065704_10109913
541 Ga0065715_10117905
542 Ga0065715_10167280
543 Ga0065715_10598368
544 Ga0065707_10100365
545 Ga0065707_10303000
546 Ga0065707_10664180
547 Ga0070690_100036264
548 Ga0070670_100000364
549 Ga0070670_100770499
550 Ga0068869_100034586
551 Ga0068869_100067015
552 Ga0068869_100302007
553 Ga0068869_100345215
554 Ga0070666_10002313
555 Ga0070680_100133393
556 Ga0070682_100000599
557 Ga0068868_100045325
558 Ga0068868_100071905
559 Ga0068868_100176642
560 Ga0070660_100276972
561 Ga0070689_100001207
562 Ga0070691_10003282
563 Ga0070687_100047776
564 Ga0070687_100754785
565 Ga0070687_100983764
566 Ga0070692_10231829
567 Ga0070668_100516581
568 Ga0070671_100523374
569 Ga0070674_100963241
570 Ga0070673_100093365
571 Ga0070688_100448674
572 Ga0070688_100572675
573 Ga0070659_100000197
574 Ga0070659_100299768
575 Ga0070667_100005503
576 Ga0070709_10146542
577 Ga0070701_10375360
578 Ga0070705_100040434
579 Ga0070705_100221115
580 Ga0070700_100000142
581 Ga0070700_100063941
582 Ga0070694_100019730
583 Ga0070694_100395450
584 Ga0070694_100423901
585 Ga0070694_100631730
586 Ga0070708_100623743
587 Ga0070708_101239801
588 Ga0070678_101156142
589 Ga0070662_100048364
590 Ga0070662_100787629
591 Ga0070681_10036355
592 Ga0070681_11278988
593 Ga0068867_100277031
594 Ga0068867_100568921
595 Ga0070706_100000358
596 Ga0070706_100135725
597 Ga0070706_100348505
598 Ga0070707_100334021
599 Ga0070707_100427314
600 Ga0070707_101480994
601 Ga0070698_100131074
602 Ga0070698_100197820
603 Ga0070699_100002881
604 Ga0070699_100346910
605 Ga0070684_100438895
606 Ga0070697_100004457
607 Ga0070697_100879257
608 Ga0068853_101392095
609 Ga0070686_100014523
610 Ga0070695_100007419
611 Ga0070695_100029105
612 Ga0070695_100391841
613 Ga0070696_100150566
614 Ga0070696_100212164
615 Ga0070693_100137221
616 Ga0070693_100266498
617 Ga0070704_100044544
618 Ga0070704_100113963
619 Ga0070704_100149338
620 Ga0070704_100226998
621 Ga0070704_100332277
622 Ga0068855_100052729
623 Ga0070664_101745888
624 Ga0068854_100649080
625 Ga0068854_100717273
626 Ga0068856_100086773
627 Ga0070702_100133965
628 Ga0070702_100174868
629 Ga0068859_100024551
630 Ga0068859_100043670
631 Ga0068859_100123198
632 Ga0068859_100502437
633 Ga0068864_100032588
634 Ga0068866_10095825
635 Ga0068861_100001492
636 Ga0068861_100079297
637 Ga0068861_100359878
638 Ga0068861_100457520
639 Ga0068863_100013976
640 Ga0068863_100084458
641 Ga0068863_100174242
642 Ga0068863_101086731
643 Ga0068858_100000468
644 Ga0068858_100006519
645 Ga0068860_100252132
646 Ga0068860_100398143
647 Ga0068860_101935686
648 Ga0068862_100030818
649 Ga0068862_101182271
650 Ga0081455_10000124
651 Ga0081539_10052572
652 Ga0075365_10533077
653 Ga0075368_10006328
654 Ga0075363_100043677
655 Ga0075364_10198901
656 Ga0070715_10000030
657 Ga0070712_100833014
658 Ga0070712_101373277
659 Ga0075367_10047413
660 Ga0075369_10047323
661 Ga0075366_10401049
662 Ga0097621_100001360
663 Ga0097621_100194999
664 Ga0097621_100450704
665 Ga0097621_101101887
666 Ga0068871_100003480
667 Ga0075428_100501031
668 Ga0075428_100676515
669 Ga0075430_100009783
670 Ga0075430_100486970
671 Ga0075431_100006302
672 Ga0075431_100035201
673 Ga0075431_101754518
674 Ga0075433_10031699
675 Ga0075433_10104309
676 Ga0075433_10761998
677 Ga0075434_100000279
678 Ga0075434_100046196
679 Ga0075434_100212685
680 Ga0075434_100236706
681 Ga0075434_100269422
682 Ga0075434_100918415
683 Ga0075429_100008668
684 Ga0075429_100039775
685 Ga0075429_100485721
686 Ga0075436_100739938
687 Ga0097620_100024551
688 Ga0097620_100043670
689 Ga0097620_100123194
690 Ga0097620_100502395
691 Ga0075435_100035491
692 Ga0075435_100239671
693 Ga0105251_10032657
694 Ga0105240_10104283
695 Ga0105240_10145527
696 Ga0105240_10730140
697 Ga0111539_10524916
698 Ga0111539_10657888
699 Ga0111539_10756940
700 Ga0105245_10004743
701 Ga0105245_10469140
702 Ga0105247_10643752
703 Ga0105247_10944137
704 Ga0114129_10041220
705 Ga0114129_10251123
706 Ga0114129_10523388
707 Ga0114129_10527980
708 Ga0114129_10946841
709 Ga0105243_10000382
710 Ga0105243_10530354
711 Ga0105243_10872809
712 Ga0105241_10056401
713 Ga0105241_10137353
714 Ga0105241_10317434
715 Ga0105241_10405543
716 Ga0105242_10002927
717 Ga0105242_10297658
718 Ga0105242_10444828
719 Ga0105242_10583647
720 Ga0105242_11073597
721 Ga0105242_11146272
722 Ga0105248_10004314
723 Ga0105248_10061486
724 Ga0105248_10224591
725 Ga0105248_10557706
726 Ga0105248_10881382
727 Ga0105248_11199695
728 Ga0105237_12268310
729 Ga0105238_10835756
730 Ga0105249_10266288
731 Ga0130084_1095944
732 Ga0105239_10134745
733 Ga0105239_10716418
734 Ga0105246_10042788
735 Ga0105246_10205292
736 Ga0157371_10275792
737 Ga0157378_10000015
738 Ga0157378_10015736
739 Ga0157378_10204561
740 Ga0157378_10298599
741 Ga0157378_10427838
742 Ga0157378_10434184
743 Ga0157378_10772527
744 Ga0163162_10012043
745 Ga0163162_10042131
746 Ga0163162_11414576
747 Ga0157372_10235452
748 Ga0157372_10600704
749 Ga0157375_10018566
750 Ga0157375_10021033
751 Ga0157375_10261671
752 Ga0157375_11606585
753 Ga0163163_10072679
754 Ga0163163_10541832
755 Ga0163163_11833587
756 Ga0157380_10018308
757 Ga0157380_10092260
758 Ga0157380_11864186
759 Ga0182008_10114556
760 Ga0157379_10063665
761 Ga0157379_10159162
762 Ga0157376_10052151
763 Ga0157376_10082620
764 Ga0163161_10173625
765 Ga0197907_10716278
766 Ga0206349_1575420
767 Ga0206355_1371886
768 Ga0213872_10032677
769 Ga0207672_1000256
770 Ga0207710_10000001
771 Ga0207710_10372657
772 Ga0207688_10333857
773 Ga0207680_10085134
774 Ga0207647_10722178
775 Ga0207685_10000009
776 Ga0207699_10109329
777 Ga0207645_10018205
778 Ga0207643_10218639
779 Ga0207684_10000168
780 Ga0207684_10514749
781 Ga0207654_10389855
782 Ga0207654_10654375
783 Ga0207707_10021016
784 Ga0207707_10324035
785 Ga0207695_10586284
786 Ga0207695_11335589
787 Ga0207695_11482975
788 Ga0207671_10060562
789 Ga0207693_10900188
790 Ga0207663_10081834
791 Ga0207660_10373904
792 Ga0207662_10114416
793 Ga0207662_10493213
794 Ga0207657_10370432
795 Ga0207652_10616246
796 Ga0207646_10316044
797 Ga0207646_11093700
798 Ga0207681_10001595
799 Ga0207650_10002124
800 Ga0207650_10316089
801 Ga0207650_10431650
802 Ga0207687_10031741
803 Ga0207664_10559476
804 Ga0207644_10000637
805 Ga0207644_10254312
806 Ga0207690_10000114
807 Ga0207706_10079976
808 Ga0207686_10004183
809 Ga0207686_10021626
810 Ga0207709_10000731
811 Ga0207709_10069973
812 Ga0207670_10002529
813 Ga0207670_10180602
814 Ga0207704_10058557
815 Ga0207665_10234816
816 Ga0207691_10979582
817 Ga0207711_10030416
818 Ga0207711_10431546
819 Ga0207711_10673710
820 Ga0207711_10895953
821 Ga0207689_10001881
822 Ga0207689_10042529
823 Ga0207689_10051896
824 Ga0207689_10146166
825 Ga0207689_10355382
826 Ga0207689_10413973
827 Ga0207679_11121026
828 Ga0207667_10154938
829 Ga0207651_10231359
830 Ga0207651_10487377
831 Ga0207651_10529424
832 Ga0207651_11266723
833 Ga0207668_10159232
834 Ga0207640_10154575
835 Ga0207640_10187255
836 Ga0207677_10005089
837 Ga0207677_10031473
838 Ga0207677_10937702
839 Ga0207703_10000080
840 Ga0207703_10019683
841 Ga0207639_10494317
842 Ga0207708_10000407
843 Ga0207708_10065030
844 Ga0207702_10175530
845 Ga0207641_10082151
846 Ga0207641_10113795
847 Ga0207641_10440699
848 Ga0207676_10024145
849 Ga0207676_10212119
850 Ga0207674_10057247
851 Ga0207674_10125975
852 Ga0207674_10365732
853 Ga0207675_100001169
854 Ga0207675_100023331
855 Ga0207675_100115252
856 Ga0207675_100224872
857 Ga0207675_100299721
858 Ga0207675_101436582
859 Ga0209588_1000545
860 Ga0209588_1024656
861 Ga0209813_10001883
862 Ga0268266_11780714
863 Ga0268265_10079623
864 Ga0268265_10460126
865 Ga0268264_10019779
866 Ga0268264_10169154
867 Ga0268264_11616391
868 Ga0307511_10006194
869 Ga0265316_10132817
870 Ga0307408_100026071
871 Ga0307408_100071326
872 Ga0307408_100092951
873 Ga0265313_10053793
874 Ga0307405_10023001
875 Ga0307405_10051408
876 Ga0307405_10566898
877 Ga0307413_10318606
878 Ga0307410_10060421
879 Ga0307410_10101352
880 Ga0307406_10005217
881 Ga0307406_10188444
882 Ga0307406_10864771
883 Ga0307407_10245337
884 Ga0307412_10031285
885 Ga0307412_10391443
886 Ga0307409_100046423
887 Ga0307409_100340855
888 Ga0307416_100067561
889 Ga0307416_100171014
890 Ga0307416_100895577
891 Ga0307416_101212778
892 Ga0307414_10046959
893 Ga0307414_10099397
894 Ga0307414_11073164
895 Ga0307414_11963706
896 Ga0307411_10052141
897 Ga0307411_10336242
898 Ga0307411_10827362
899 Ga0307415_100002600
900 Ga0307415_100021926
901 Ga0307415_100026376
902 Ga0373952_0128493
903 Ga0373941_0019969
904 Ga0373946_0555329
905 Ga0373955_0083876
906 Ga0373931_0925658
907 Ga0373927_0249321
908 Ga0373937_0303043
909 Ga0373937_0672955
910 Ga0373925_0483275
911 Ga0395899_0006938
912 Ga0395899_0153319
913 Ga0395900_0036849
914 Ga0395900_0052257
915 Ga0395900_0282471
916 Ga0395898_0002202
917 Ga0395898_0020117
918 Ga0395898_0355058
919 Ga0395905_0003579
920 Ga0395905_0025350
921 Ga0395901_0003081
922 Ga0395901_0076156
923 Ga0395901_0463317
924 Ga0395901_0513447
925 Ga0395901_0776254
926 Ga0242420_002362
927 Ga0436360_0064421
928 Ga0436360_0693870
929 Ga0436361_0736395
930 Ga0436362_0249809
931 Ga0436362_0500899
932 Ga0439448_0005793
933 Ga0450890_021016
934 Ga0439458_0009977
935 Ga0451577_0112712
936 Ga0451577_0139435
937 Ga0451577_0343504
938 Ga0451577_1212591
939 Ga0453683_0083272
940 Ga0453683_0121820
941 Ga0453683_0240694
942 Ga0453684_0000781
943 Ga0453684_0451673
944 Ga0466971_0185583
945 Ga0451576_0090693
946 Ga0451576_1327776
947 Ga0451576_1802814
948 Ga0451576_1825639
949 Ga0495607_0049064
950 Ga0495606_0111551
951 Ga0495663_0000784
952 Ga0495598_0000047
953 Ga0495621_0006637
954 Ga0495668_0178901
955 Ga0495668_0179193
956 Ga0495649_0058849
957 Ga0495636_0067332
958 Ga0495672_0009240
959 Ga0495676_0565307
960 Ga0496100_0438299
961 Ga0496102_0705208
962 Ga0496104_1026336
963 Ga0496106_0016737
964 Ga0496112_0532317
965 Ga0496114_0001388
966 Ga0501291_001858
967 Ga0501291_083613
968 Ga0501292_009993
969 Ga0501296_003686
970 Ga0501298_013312
971 Ga0501298_017215
972 Ga0501031_0251181
973 Ga0501036_0107386
974 Ga0501037_0241810
975 Ga0501037_0767317
976 Ga0501039_0005891
977 Ga0501041_0023003
978 Ga0501043_0149926
979 Ga0501046_0113280
980 Ga0501198_003026
981 Ga0501202_030621
982 Ga0501202_044678
983 Ga0501206_012481
984 Ga0501207_001104
985 Ga0501207_001597
986 Ga0501216_002208
987 Ga0501216_028965
988 Ga0501217_004536
989 Ga0501217_047206
990 Ga0501223_001729
991 Ga0501224_009997
992 Ga0501227_002880
993 Ga0501227_020783
994 Ga0501233_024948
995 Ga0501235_003510
996 Ga0501235_004939
997 Ga0501236_006914
998 Ga0501239_005119
999 Ga0501242_014186
1000 Ga0501243_014315
1001 Ga0501256_014564
1002 Ga0501259_071635
1003 Ga0501260_012371
1004 Ga0501261_010323
1005 Ga0501221_008636
1006 Ga0501221_010815
1007 Ga0501225_0003750
1008 Ga0501225_0032360
1009 Ga0501229_003409
1010 Ga0501234_000651
1011 Ga0501234_009385
1012 Ga0501245_012724
1013 Ga0501265_034030
1014 Ga0501266_014859
1015 Ga0501274_010124
1016 Ga0501283_023477
1017 Ga0501035_0159694
1018 Ga0501035_0196803
1019 Ga0501212_011288
1020 nmdc:mga03n38_11525_c1
1021 nmdc:mga00v17_158387_c1
1022 nmdc:mga0yw44_71616_c1
1023 nmdc:mga0k408_395021_c1
1024 nmdc:mga04h51_14032_c1
1025 nmdc:mga05p37_105454_c1
1026 nmdc:mga05p37_147136_c1
1027 nmdc:mga05p37_261412_c1
1028 nmdc:mga05p37_402982_c1
1029 nmdc:mga09592_410612_c1
1030 nmdc:mga09592_436693_c1
1031 nmdc:mga09592_55339_c1
1032 nmdc:mga0qj67_134397_c1
1033 nmdc:mga0qj67_34878_c1
1034 nmdc:mga06r32_1167251_c1
1035 nmdc:mga06r32_1181227_c1
1036 nmdc:mga06r32_65564_c1
1037 nmdc:mga06r32_701083_c1
1038 nmdc:mga06r32_746885_c1
1039 nmdc:mga06r32_772477_c1
1040 nmdc:mga08y16_255388_c1
1041 nmdc:mga0n895_1158729_c1
1042 nmdc:mga0n895_1269316_c1
1043 nmdc:mga0n895_2442_c1
1044 nmdc:mga0n895_259862_c1
1045 nmdc:mga0n895_281982_c1
1046 nmdc:mga0n895_942140_c1
1047 nmdc:mga0rr50_173405_c1
1048 nmdc:mga0rr50_586118_c1
1049 nmdc:mga0a205_102608_c1
1050 nmdc:mga0a205_114855_c1
1051 nmdc:mga0a205_247449_c1
1052 nmdc:mga0a205_459548_c1
1053 nmdc:mga0a205_5218_c1
1054 Ga0500578_0349351
1055 Ga0500566_0218223
1056 Ga0500641_0010726
1057 Ga0500595_019433
1058 Ga0500642_0421897
1059 Ga0500652_000015
1060 Ga0500636_0031063
1061 Ga0530510_0062794
1062 2867476376
1063 2928523837
1064 2954012778

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06983

3-dmu-9_3-mt

3-demethylubiquinone-9 3-methyltransferase

32

146

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1u69-assembly1.cif.gz_A crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.9514 14 166
1u69-assembly2.cif.gz_D crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.948 14 166
1u69-assembly2.cif.gz_D crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.9356 14 166
1u69-assembly1.cif.gz_A crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.9279 14 166
1u69-assembly3.cif.gz_C crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.927 14 166
ID Description Score Start End Superfamily
1u69D00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9435 14 166 3.10.180.10
1u69D00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9308 14 166 3.10.180.10
3omsA01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.803 18 82 3.30.720.100
3omsA01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.7918 18 82 3.30.720.100
af_Q03508_60_252_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7375 87 109 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A2W0BKJ4-F1-model_v4 PhnB-like domain-containing protein 0.9859 14 95
AF-A0A2W2BFS1-F1-model_v4 VOC family protein 0.9793 14 166
AF-A0A520ZV93-F1-model_v4 VOC family protein 0.9751 14 166
AF-A0A1P8YBS8-F1-model_v4 3-demethylubiquinone-9 3-methyltransferase family protein 0.9742 14 130 GO:0008168
GO:0032259
AF-A0A2V8T2E1-F1-model_v4 PhnB-like domain-containing protein 0.9723 14 127

Map