F459014

General Info

Members Datasets Scaffolds Average Seq Length
523 329 523 182

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0719996|Ga0395905_0719996_331_864
Length 177
Sequence MSRLYKKFKEEIVGELKGRHPSRNVMELPVLKKIVISMGLGDGLKDKNALSEHSAELALISGQQPVVTRSKKAISNFKLREDQPVGLMVTLRGKRMYDFLDRFCNIVAPRIRDFRGFEKKCDGRGNYNFGIAEQQIFVELNPDKIKRAQGMNITLVTTAKKDEDCVELLTLLGFPFK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300002868 Avena fatua rhizosphere microbial communities - H2_Bulk_Litter_10 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300002870 Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_6 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300002872 Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_5 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003158 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_3 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
92 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
93 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
144 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
145 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
146 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
147 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
148 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
149 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
150 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
151 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
152 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
153 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
154 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
155 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
156 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
157 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
158 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
159 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
160 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
161 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
162 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
163 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
164 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
165 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
166 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
167 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
168 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
169 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
170 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
171 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
172 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
173 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
174 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
175 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
176 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
177 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
178 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
179 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
180 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
182 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
184 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
185 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
186 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
187 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
188 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
189 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
190 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
191 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
192 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
193 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
194 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
195 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
196 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
197 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
198 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
199 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
200 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
201 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
202 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
203 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
204 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
205 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
206 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
207 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
208 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
209 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
210 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
211 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
212 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
213 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
214 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
215 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
216 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
217 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
218 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
219 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
220 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
221 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
222 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
223 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
224 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
225 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
226 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
227 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
228 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
229 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
230 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
231 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
232 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
233 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
234 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
235 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
236 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
237 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
238 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
239 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
240 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
241 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
242 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
243 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
244 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
245 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
246 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
247 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
248 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
249 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
250 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
251 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
252 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
253 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
254 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
255 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
256 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
257 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
258 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
259 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
260 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
261 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
262 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
263 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
264 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
265 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
266 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
267 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
268 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
269 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
270 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
284 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
285 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
286 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
287 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
288 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
289 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
290 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
291 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
292 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
293 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
294 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
295 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
296 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
297 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
299 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
300 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
301 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
302 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
303 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
304 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
305 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
306 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
307 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
308 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
309 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
310 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
311 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
312 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
313 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
314 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
315 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
316 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
317 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
318 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
319 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
320 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
321 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
322 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
323 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
324 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
325 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
326 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
327 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
328 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
329 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.37
Metatranscriptomes 3.63
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.74
Nodule 0.19
Rhizoplane 4.4
Rhizosphere 83.17
Stem 0
Stem Tuber 0
Unclassified 6.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2458830 2162886007 Bacteria 2754
2 SwRhRL2b_contig_305464 2162886007 Bacteria 3378
3 Ga0006767J43181_103125 3300002868 Bacteria 8971
4 Ga0006763J43179_104103 3300002870 Bacteria 8906
5 Ga0006762J43184_103419 3300002872 Bacteria 7285
6 Ga0006760J45825_103550 3300003158 Bacteria 2322
7 Ga0006759J45824_1006649 3300003163 Bacteria 16605
8 rootH2_10070226 3300003320 Bacteria 1731
9 rootH1_10162592 3300003323 Bacteria 1576
10 Ga0032354_1009872 3300003693 Bacteria 14763
11 Ga0065704_10070877 3300005289 Bacteria 15122
12 Ga0065712_10355908 3300005290 Bacteria 781
13 Ga0065715_10177021 3300005293 Bacteria 1504
14 Ga0065707_10001618 3300005295 Bacteria 6793
15 Ga0070683_100723099 3300005329 Bacteria 954
16 Ga0070670_100472611 3300005331 Bacteria 1113
17 Ga0070680_100289777 3300005336 Bacteria 1387
18 Ga0070680_101216574 3300005336 Bacteria 652
19 Ga0070691_10236249 3300005341 Bacteria 975
20 Ga0070669_100006485 3300005353 Bacteria 8426
21 Ga0070675_100058025 3300005354 Bacteria 3192
22 Ga0070671_100005400 3300005355 Bacteria 10190
23 Ga0070671_100043910 3300005355 Bacteria 3714
24 Ga0070671_100263170 3300005355 Bacteria 1466
25 Ga0070674_100034590 3300005356 Bacteria 3376
26 Ga0070673_100819890 3300005364 Bacteria 860
27 Ga0070667_100055472 3300005367 Bacteria 3346
28 Ga0070667_100412400 3300005367 Bacteria 1231
29 Ga0070714_101040980 3300005435 Bacteria 797
30 Ga0070711_101221085 3300005439 Bacteria 651
31 Ga0070663_100098843 3300005455 Bacteria 2174
32 Ga0070678_100732694 3300005456 Bacteria 893
33 Ga0070681_10008976 3300005458 Bacteria 9830
34 Ga0070681_10035786 3300005458 Bacteria 4988
35 Ga0070681_10048581 3300005458 Bacteria 4239
36 Ga0070681_10124955 3300005458 Bacteria 2505
37 Ga0070681_10167503 3300005458 Bacteria 2119
38 Ga0070681_10400701 3300005458 Bacteria 1283
39 Ga0068867_100125039 3300005459 Bacteria 1992
40 Ga0070706_100382449 3300005467 Bacteria 1311
41 Ga0070679_100063584 3300005530 Bacteria 3678
42 Ga0070679_100281248 3300005530 Bacteria 1616
43 Ga0070679_100419599 3300005530 Bacteria 1283
44 Ga0070684_100189942 3300005535 Bacteria 1869
45 Ga0068853_100379103 3300005539 Bacteria 1320
46 Ga0070672_100074527 3300005543 Bacteria 2707
47 Ga0070672_100652043 3300005543 Bacteria 919
48 Ga0070686_100067091 3300005544 Bacteria 2336
49 Ga0070686_100754409 3300005544 Bacteria 781
50 Ga0070696_100424274 3300005546 Bacteria 1045
51 Ga0070693_100221817 3300005547 Bacteria 1239
52 Ga0070665_100014481 3300005548 Bacteria 7909
53 Ga0070665_100045273 3300005548 Bacteria 4419
54 Ga0068855_100114994 3300005563 Bacteria 3084
55 Ga0068855_100528271 3300005563 Bacteria 1279
56 Ga0070664_100353212 3300005564 Bacteria 1338
57 Ga0068854_100243308 3300005578 Bacteria 1434
58 Ga0068854_100372473 3300005578 Bacteria 1175
59 Ga0068856_100042931 3300005614 Bacteria 4449
60 Ga0068856_100047430 3300005614 Bacteria 4231
61 Ga0068856_100641382 3300005614 Bacteria 1083
62 Ga0068852_100172880 3300005616 Bacteria 2026
63 Ga0068852_101148936 3300005616 Bacteria 797
64 Ga0068859_100000641 3300005617 Bacteria 34946
65 Ga0068859_100092729 3300005617 Bacteria 3072
66 Ga0068864_100090413 3300005618 Bacteria 2699
67 Ga0068861_100099302 3300005719 Bacteria 2312
68 Ga0068861_100116426 3300005719 Bacteria 2149
69 Ga0068861_100330192 3300005719 Bacteria 1331
70 Ga0068863_100008761 3300005841 Bacteria 9878
71 Ga0068863_100083231 3300005841 Bacteria 3032
72 Ga0068863_100154561 3300005841 Bacteria 2196
73 Ga0068858_100000125 3300005842 Bacteria 79795
74 Ga0068858_100004270 3300005842 Bacteria 14053
75 Ga0068860_100006244 3300005843 Bacteria 11972
76 Ga0068860_100009263 3300005843 Bacteria 9789
77 Ga0068862_100065242 3300005844 Bacteria 3136
78 Ga0068862_100246197 3300005844 Bacteria 1627
79 Ga0068862_100657274 3300005844 Bacteria 1011
80 Ga0081455_10210306 3300005937 Bacteria 1450
81 Ga0081540_1048835 3300005983 Bacteria 2116
82 Ga0070716_100442782 3300006173 Bacteria 945
83 Ga0070712_100037323 3300006175 Bacteria 3311
84 Ga0075367_10237684 3300006178 Bacteria 1141
85 Ga0075366_10184479 3300006195 Bacteria 1268
86 Ga0097621_100122525 3300006237 Bacteria 2207
87 Ga0097621_100265847 3300006237 Bacteria 1506
88 Ga0097621_101180105 3300006237 Bacteria 721
89 Ga0075370_10203587 3300006353 Bacteria 1168
90 Ga0068871_100188243 3300006358 Bacteria 1777
91 Ga0075428_100033220 3300006844 Bacteria 5698
92 Ga0075430_100404355 3300006846 Bacteria 1127
93 Ga0075434_100413399 3300006871 Bacteria 1370
94 Ga0068865_100074556 3300006881 Bacteria 2417
95 Ga0068865_100564036 3300006881 Bacteria 958
96 Ga0097620_100000641 3300006931 Bacteria 34946
97 Ga0097620_100092731 3300006931 Bacteria 3072
98 Ga0097620_100822177 3300006931 Bacteria 1016
99 Ga0099826_10154582 3300006948 Bacteria 1308
100 Ga0075435_100074393 3300007076 Bacteria 2779
101 Ga0105250_10000032 3300009092 Bacteria 159642
102 Ga0105250_10180845 3300009092 Bacteria 885
103 Ga0105240_10065094 3300009093 Bacteria 4526
104 Ga0105240_10075753 3300009093 Bacteria 4149
105 Ga0105240_10112936 3300009093 Bacteria 3283
106 Ga0105240_10280822 3300009093 Bacteria 1913
107 Ga0105240_10281671 3300009093 Bacteria 1909
108 Ga0105240_10541348 3300009093 Bacteria 1289
109 Ga0105240_10541799 3300009093 Bacteria 1289
110 Ga0105247_10002466 3300009101 Bacteria 12578
111 Ga0105247_10025648 3300009101 Bacteria 3557
112 Ga0114129_10219902 3300009147 Bacteria 2563
113 Ga0105242_10313692 3300009176 Bacteria 1436
114 Ga0105248_10005842 3300009177 Bacteria 13527
115 Ga0105237_10096005 3300009545 Bacteria 2955
116 Ga0105237_10114912 3300009545 Bacteria 2685
117 Ga0105237_11490058 3300009545 Bacteria 683
118 Ga0105238_10022279 3300009551 Bacteria 6457
119 Ga0105238_10406256 3300009551 Bacteria 1355
120 Ga0105249_10014582 3300009553 Bacteria 6947
121 Ga0105249_10280371 3300009553 Bacteria 1664
122 Ga0105239_10353874 3300010375 Bacteria 1658
123 Ga0105246_10036204 3300011119 Bacteria 3305
124 Ga0157370_10522491 3300013104 Bacteria 1089
125 Ga0157369_10015323 3300013105 Bacteria 8645
126 Ga0157369_10213528 3300013105 Bacteria 2022
127 Ga0157369_10293856 3300013105 Bacteria 1691
128 Ga0157374_10414545 3300013296 Bacteria 1345
129 Ga0157374_10773641 3300013296 Bacteria 975
130 Ga0157378_10435474 3300013297 Bacteria 1298
131 Ga0163162_10026596 3300013306 Bacteria 5720
132 Ga0157372_10049576 3300013307 Bacteria 4669
133 Ga0157372_10325384 3300013307 Bacteria 1790
134 Ga0157375_10393940 3300013308 Bacteria 1552
135 Ga0163163_10007457 3300014325 Bacteria 9652
136 Ga0163163_10912221 3300014325 Bacteria 942
137 Ga0163163_11838651 3300014325 Bacteria 666
138 Ga0157380_10597862 3300014326 Bacteria 1091
139 Ga0157379_10000004 3300014968 Bacteria 173351
140 Ga0157379_10082681 3300014968 Bacteria 2877
141 Ga0157379_10104840 3300014968 Bacteria 2537
142 Ga0157379_10246902 3300014968 Bacteria 1619
143 Ga0157379_10267841 3300014968 Bacteria 1553
144 Ga0157376_10213111 3300014969 Bacteria 1784
145 Ga0163161_10075910 3300017792 Bacteria 2467
146 Ga0206356_11640133 3300020070 Bacteria 2223
147 Ga0213876_10032683 3300021384 Bacteria 2744
148 Ga0224572_1011889 3300024225 Bacteria 1649
149 Ga0207696_1000198 3300025711 Bacteria 92750
150 Ga0207710_10009562 3300025900 Bacteria 4077
151 Ga0207688_10066029 3300025901 Bacteria 2045
152 Ga0207688_10144333 3300025901 Bacteria 1402
153 Ga0207688_10222558 3300025901 Bacteria 1137
154 Ga0207688_10560761 3300025901 Bacteria 718
155 Ga0207680_10282085 3300025903 Bacteria 1154
156 Ga0207685_10041008 3300025905 Bacteria 1729
157 Ga0207699_10292789 3300025906 Bacteria 1135
158 Ga0207643_10098940 3300025908 Bacteria 1708
159 Ga0207705_10383730 3300025909 Bacteria 1085
160 Ga0207705_10564609 3300025909 Bacteria 885
161 Ga0207654_10062727 3300025911 Bacteria 2179
162 Ga0207707_10000276 3300025912 Bacteria 55321
163 Ga0207707_10000410 3300025912 Bacteria 44977
164 Ga0207707_10025066 3300025912 Bacteria 5218
165 Ga0207707_10219412 3300025912 Bacteria 1655
166 Ga0207707_10635967 3300025912 Bacteria 900
167 Ga0207695_10049612 3300025913 Bacteria 4423
168 Ga0207695_10072121 3300025913 Bacteria 3525
169 Ga0207695_10083172 3300025913 Bacteria 3234
170 Ga0207695_10097549 3300025913 Bacteria 2940
171 Ga0207671_10073947 3300025914 Bacteria 2546
172 Ga0207671_10157809 3300025914 Bacteria 1756
173 Ga0207671_10940877 3300025914 Bacteria 682
174 Ga0207693_10082217 3300025915 Bacteria 2522
175 Ga0207663_10292911 3300025916 Bacteria 1213
176 Ga0207660_10002217 3300025917 Bacteria 12862
177 Ga0207660_10941989 3300025917 Bacteria 705
178 Ga0207657_10063277 3300025919 Bacteria 3164
179 Ga0207649_10791599 3300025920 Bacteria 740
180 Ga0207649_11070076 3300025920 Bacteria 636
181 Ga0207652_10003383 3300025921 Bacteria 13178
182 Ga0207694_10003326 3300025924 Bacteria 12785
183 Ga0207694_10082964 3300025924 Bacteria 2520
184 Ga0207694_10573244 3300025924 Bacteria 948
185 Ga0207650_10016929 3300025925 Bacteria 5099
186 Ga0207650_10018767 3300025925 Bacteria 4857
187 Ga0207659_10122127 3300025926 Bacteria 1997
188 Ga0207700_10860938 3300025928 Bacteria 811
189 Ga0207700_11417027 3300025928 Bacteria 618
190 Ga0207664_11136536 3300025929 Bacteria 698
191 Ga0207644_10000428 3300025931 Bacteria 27319
192 Ga0207644_10179249 3300025931 Bacteria 1659
193 Ga0207690_10535741 3300025932 Bacteria 950
194 Ga0207706_10064282 3300025933 Bacteria 3230
195 Ga0207669_10108086 3300025937 Bacteria 1857
196 Ga0207665_10317843 3300025939 Bacteria 1167
197 Ga0207691_10104939 3300025940 Bacteria 2518
198 Ga0207691_10247801 3300025940 Bacteria 1539
199 Ga0207691_10816811 3300025940 Bacteria 783
200 Ga0207711_10159847 3300025941 Bacteria 2038
201 Ga0207711_10814954 3300025941 Bacteria 869
202 Ga0207689_10460341 3300025942 Bacteria 1063
203 Ga0207661_10649510 3300025944 Bacteria 969
204 Ga0207661_11060161 3300025944 Bacteria 746
205 Ga0207667_10008242 3300025949 Bacteria 12403
206 Ga0207651_10461638 3300025960 Bacteria 1091
207 Ga0207712_10030603 3300025961 Bacteria 3620
208 Ga0207712_10274654 3300025961 Bacteria 1373
209 Ga0207712_10281888 3300025961 Bacteria 1357
210 Ga0207640_10325567 3300025981 Bacteria 1225
211 Ga0207640_10419821 3300025981 Bacteria 1094
212 Ga0207658_10041770 3300025986 Bacteria 3322
213 Ga0207658_10175447 3300025986 Bacteria 1769
214 Ga0207658_10575909 3300025986 Bacteria 1009
215 Ga0207703_10001524 3300026035 Bacteria 21042
216 Ga0207703_10019203 3300026035 Bacteria 5338
217 Ga0207639_10851078 3300026041 Bacteria 851
218 Ga0207678_10005556 3300026067 Bacteria 11267
219 Ga0207678_10627444 3300026067 Bacteria 943
220 Ga0207702_10128657 3300026078 Bacteria 2276
221 Ga0207702_10285678 3300026078 Bacteria 1561
222 Ga0207702_10660068 3300026078 Bacteria 1029
223 Ga0207641_10002325 3300026088 Bacteria 17632
224 Ga0207641_10010988 3300026088 Bacteria 7422
225 Ga0207641_10188113 3300026088 Bacteria 1896
226 Ga0207648_10078777 3300026089 Bacteria 2875
227 Ga0207676_10363333 3300026095 Bacteria 1342
228 Ga0207674_10653560 3300026116 Bacteria 1015
229 Ga0207675_100132610 3300026118 Bacteria 2362
230 Ga0207675_101040909 3300026118 Bacteria 837
231 Ga0207698_10091691 3300026142 Bacteria 2488
232 Ga0207698_10339878 3300026142 Bacteria 1414
233 Ga0207698_10432739 3300026142 Bacteria 1266
234 Ga0268266_10010307 3300028379 Bacteria 8174
235 Ga0268265_10056316 3300028380 Bacteria 2990
236 Ga0268265_10693038 3300028380 Bacteria 983
237 Ga0268264_10000102 3300028381 Bacteria 222526
238 Ga0268264_10011424 3300028381 Bacteria 7332
239 Ga0265319_1002761 3300028563 Bacteria 9412
240 Ga0265319_1074569 3300028563 Bacteria 1084
241 Ga0265334_10001026 3300028573 Bacteria 13760
242 Ga0265318_10000228 3300028577 Bacteria 48687
243 Ga0265323_10039832 3300028653 Unclassified 1712
244 Ga0265338_10016309 3300028800 Bacteria 8091
245 Ga0265338_10145015 3300028800 Bacteria 1853
246 Ga0307511_10000235 3300030521 Bacteria 56564
247 Ga0307511_10056308 3300030521 Bacteria 3076
248 Ga0265330_10004229 3300031235 Bacteria 7321
249 Ga0265330_10027214 3300031235 Bacteria 2584
250 Ga0265332_10001037 3300031238 Bacteria 16333
251 Ga0265328_10002988 3300031239 Bacteria 7548
252 Ga0265320_10004080 3300031240 Bacteria 9592
253 Ga0265325_10005189 3300031241 Bacteria 8094
254 Ga0265329_10001451 3300031242 Bacteria 11427
255 Ga0265340_10013162 3300031247 Bacteria 4354
256 Ga0265340_10020617 3300031247 Bacteria 3384
257 Ga0265339_10002072 3300031249 Bacteria 14690
258 Ga0265339_10006835 3300031249 Bacteria 7436
259 Ga0265339_10014355 3300031249 Bacteria 4775
260 Ga0265339_10055447 3300031249 Bacteria 2150
261 Ga0265331_10004429 3300031250 Bacteria 8774
262 Ga0265331_10149262 3300031250 Bacteria 1062
263 Ga0265316_10013033 3300031344 Bacteria 7415
264 Ga0307509_10000987 3300031507 Bacteria 48811
265 Ga0307509_10002579 3300031507 Bacteria 29091
266 Ga0307509_10717737 3300031507 Bacteria 666
267 Ga0265313_10001786 3300031595 Bacteria 19657
268 Ga0265313_10015631 3300031595 Bacteria 4407
269 Ga0265313_10047129 3300031595 Bacteria 2088
270 Ga0307508_10111635 3300031616 Bacteria 2334
271 Ga0316575_10009147 3300031665 Bacteria 3624
272 Ga0316575_10016662 3300031665 Bacteria 2784
273 Ga0316575_10046954 3300031665 Bacteria 1716
274 Ga0265314_10005233 3300031711 Bacteria 11760
275 Ga0265342_10002379 3300031712 Bacteria 16291
276 Ga0265342_10042409 3300031712 Bacteria 2749
277 Ga0316576_10062578 3300031727 Bacteria 2729
278 Ga0316578_10090796 3300031728 Bacteria 1824
279 Ga0307516_10001316 3300031730 Bacteria 34466
280 Ga0307405_10286534 3300031731 Bacteria 1243
281 Ga0316577_10074627 3300031733 Bacteria 1894
282 Ga0307413_10180497 3300031824 Bacteria 1504
283 Ga0307413_10328642 3300031824 Bacteria 1171
284 Ga0307413_10394482 3300031824 Bacteria 1082
285 Ga0307410_10406316 3300031852 Bacteria 1101
286 Ga0307406_10254266 3300031901 Bacteria 1325
287 Ga0307406_10992102 3300031901 Bacteria 720
288 Ga0307407_10179766 3300031903 Bacteria 1401
289 Ga0307407_10197998 3300031903 Bacteria 1344
290 Ga0307407_10305319 3300031903 Bacteria 1111
291 Ga0307412_10221900 3300031911 Bacteria 1449
292 Ga0307412_10513034 3300031911 Bacteria 1000
293 Ga0307409_100059614 3300031995 Bacteria 2971
294 Ga0307409_100692432 3300031995 Bacteria 1017
295 Ga0307416_100218253 3300032002 Bacteria 1826
296 Ga0307416_100785368 3300032002 Bacteria 1047
297 Ga0307414_10030752 3300032004 Bacteria 3512
298 Ga0307411_10197680 3300032005 Bacteria 1541
299 Ga0307415_100068825 3300032126 Bacteria 2479
300 Ga0316593_10000942 3300032168 Bacteria 5984
301 Ga0316593_10006570 3300032168 Bacteria 3147
302 Ga0316593_10092284 3300032168 Bacteria 1067
303 Ga0316593_10122884 3300032168 Bacteria 933
304 Ga0307510_10000006 3300033180 Bacteria 566474
305 Ga0307510_10029950 3300033180 Bacteria 6180
306 Ga0316588_1008872 3300033528 Bacteria 2083
307 Ga0316588_1077603 3300033528 Bacteria 820
308 Ga0316212_1005837 3300033547 Bacteria 1786
309 Ga0373950_0000002 3300034818 Bacteria 933559
310 Ga0373936_0035525 3300035113 Bacteria 1984
311 Ga0373945_0139007 3300035116 Bacteria 978
312 Ga0316574_0028762 3300035398 Bacteria 3353
313 Ga0316574_0296695 3300035398 Bacteria 1028
314 Ga0373927_0272861 3300035695 Bacteria 1112
315 Ga0373933_0001189 3300035724 Bacteria 15436
316 Ga0373947_0096165 3300035725 Bacteria 1854
317 Ga0316582_0100593 3300036647 Bacteria 1914
318 Ga0316582_0138952 3300036647 Bacteria 1637
319 Ga0316584_0074846 3300036712 Bacteria 2538
320 Ga0395898_0014841 3300037466 Bacteria 7998
321 Ga0395898_0039994 3300037466 Bacteria 4639
322 Ga0395898_0883534 3300037466 Bacteria 832
323 Ga0395905_0719996 3300037471 Unclassified 900
324 Ga0436364_0864071 3300037853 Bacteria 814
325 Ga0395901_1080422 3300038443 Bacteria 774
326 Ga0400489_61698 3300039093 Bacteria 1408
327 Ga0436365_0032067 3300039437 Bacteria 3787
328 Ga0436360_0748450 3300039438 Bacteria 934
329 Ga0436360_0749057 3300039438 Bacteria 2001
330 Ga0436361_0195894 3300039447 Bacteria 847
331 Ga0436361_0555916 3300039447 Bacteria 2851
332 Ga0436363_0193457 3300039450 Bacteria 1244
333 Ga0436363_0411941 3300039450 Bacteria 728
334 Ga0436363_0978720 3300039450 Bacteria 2326
335 Ga0436362_0693496 3300039453 Bacteria 3146
336 Ga0436362_0820035 3300039453 Bacteria 1513
337 Ga0439439_0038579 3300041406 Bacteria 1234
338 Ga0439447_060661 3300041407 Bacteria 890
339 Ga0451798_0505011 3300041458 Bacteria 3411
340 Ga0451849_1052663 3300041505 Bacteria 2153
341 Ga0451853_2380426 3300041512 Bacteria 5326
342 Ga0439445_0150212 3300042004 Bacteria 678
343 Ga0439449_0100693 3300042007 Bacteria 1068
344 Ga0451577_0008152 3300042876 Bacteria 10217
345 Ga0453683_0005334 3300044673 Bacteria 8982
346 Ga0466966_0015541 3300044684 Bacteria 5032
347 Ga0466961_0517526 3300044693 Bacteria 720
348 Ga0453684_0240033 3300044712 Bacteria 2086
349 Ga0466959_0103445 3300045049 Bacteria 2037
350 Ga0451576_0053177 3300045051 Bacteria 4243
351 Ga0451576_0131416 3300045051 Bacteria 2610
352 Ga0495603_0365063 3300046455 Bacteria 828
353 Ga0495629_0111215 3300046459 Bacteria 1910
354 Ga0495638_0074489 3300046460 Bacteria 2071
355 Ga0495641_0074632 3300046461 Bacteria 1521
356 Ga0495650_0049935 3300046471 Bacteria 1733
357 Ga0495639_0082011 3300046475 Bacteria 1503
358 Ga0495596_0097449 3300046500 Bacteria 1142
359 Ga0495606_0219135 3300046507 Bacteria 1073
360 Ga0495616_0129981 3300046513 Bacteria 1155
361 Ga0495628_0093477 3300046516 Bacteria 2326
362 Ga0495628_0625607 3300046516 Bacteria 767
363 Ga0495630_0055150 3300046517 Bacteria 2978
364 Ga0495630_0286426 3300046517 Bacteria 1259
365 Ga0495632_0032155 3300046519 Bacteria 2706
366 Ga0495632_0109379 3300046519 Bacteria 1299
367 Ga0495632_0172236 3300046519 Bacteria 994
368 Ga0495643_0036660 3300046522 Bacteria 2693
369 Ga0495648_0038970 3300046524 Bacteria 3031
370 Ga0495640_0113969 3300046533 Bacteria 1763
371 Ga0495586_0010612 3300046535 Bacteria 4902
372 Ga0495621_0084394 3300046539 Bacteria 1189
373 Ga0495622_0117795 3300046557 Bacteria 1214
374 Ga0495622_0125634 3300046557 Bacteria 1170
375 Ga0495622_0127664 3300046557 Bacteria 1159
376 Ga0495668_0105281 3300046616 Bacteria 1543
377 Ga0495634_0164500 3300046642 Bacteria 1397
378 Ga0495611_0019227 3300046648 Bacteria 2934
379 Ga0495611_0344025 3300046648 Bacteria 685
380 Ga0495635_0323485 3300046663 Bacteria 1032
381 Ga0495658_0166619 3300046683 Bacteria 1362
382 Ga0495669_0058634 3300046684 Bacteria 1738
383 Ga0495624_0151369 3300046690 Bacteria 1419
384 Ga0495604_0744895 3300047317 Bacteria 620
385 Ga0495672_0024792 3300047320 Bacteria 3856
386 Ga0495680_0152274 3300047322 Bacteria 1685
387 Ga0495687_032507 3300047443 Bacteria 2380
388 Ga0496100_0110723 3300048903 Bacteria 1907
389 Ga0496100_0384481 3300048903 Bacteria 1066
390 Ga0496101_0002147 3300048904 Bacteria 12041
391 Ga0496101_0821202 3300048904 Bacteria 733
392 Ga0496102_0003295 3300048905 Bacteria 13691
393 Ga0496102_0045924 3300048905 Bacteria 3966
394 Ga0496102_0199613 3300048905 Bacteria 1885
395 Ga0496103_0040660 3300048906 Bacteria 2857
396 Ga0496103_0323730 3300048906 Bacteria 991
397 Ga0496104_0076607 3300048907 Bacteria 3185
398 Ga0496105_0032509 3300048908 Bacteria 4281
399 Ga0496106_0066543 3300048909 Bacteria 2745
400 Ga0496108_0028937 3300048911 Bacteria 4584
401 Ga0496108_0168503 3300048911 Bacteria 1894
402 Ga0496109_0707816 3300048912 Bacteria 945
403 Ga0496111_0022689 3300048914 Bacteria 4396
404 Ga0496112_0773816 3300048915 Bacteria 885
405 Ga0496113_0189425 3300048916 Bacteria 1633
406 Ga0496113_0361566 3300048916 Bacteria 1164
407 Ga0496114_0037374 3300048917 Bacteria 4015
408 Ga0496115_0114834 3300048918 Bacteria 2213
409 Ga0496115_0126283 3300048918 Bacteria 2107
410 Ga0496117_0000787 3300048920 Bacteria 49745
411 Ga0496117_0073497 3300048920 Bacteria 2281
412 Ga0496118_0000032 3300048921 Bacteria 330072
413 Ga0496118_0013267 3300048921 Bacteria 7811
414 Ga0496118_0112821 3300048921 Bacteria 1798
415 Ga0496119_0116851 3300048922 Bacteria 1471
416 Ga0496120_0151997 3300048923 Bacteria 1162
417 Ga0496121_0000704 3300048924 Bacteria 62218
418 Ga0496121_0028362 3300048924 Bacteria 5213
419 Ga0496121_0266210 3300048924 Bacteria 1180
420 Ga0496124_0006228 3300048927 Bacteria 13069
421 Ga0496125_0001378 3300048928 Bacteria 35674
422 Ga0496126_0011396 3300048929 Bacteria 9209
423 Ga0501312_051378 3300049528 Bacteria 696
424 Ga0501317_011660 3300049533 Bacteria 1072
425 Ga0501031_0131173 3300049568 Bacteria 1637
426 Ga0501031_0470580 3300049568 Bacteria 811
427 Ga0501033_0049659 3300049570 Bacteria 3114
428 Ga0501034_0231167 3300049571 Bacteria 1798
429 Ga0501036_0023621 3300049572 Bacteria 5181
430 Ga0501038_0015092 3300049574 Bacteria 7031
431 Ga0501039_0046960 3300049575 Bacteria 3337
432 Ga0501039_0115981 3300049575 Bacteria 2096
433 Ga0501040_0008066 3300049576 Bacteria 6839
434 Ga0501040_0044091 3300049576 Bacteria 3040
435 Ga0501040_0843536 3300049576 Bacteria 663
436 Ga0501041_0001598 3300049577 Bacteria 12636
437 Ga0501041_0120949 3300049577 Bacteria 1627
438 Ga0501042_0001373 3300049578 Bacteria 14288
439 Ga0501043_0299109 3300049579 Bacteria 1230
440 Ga0501043_0513223 3300049579 Unclassified 894
441 Ga0501046_0015243 3300049580 Bacteria 6464
442 Ga0501046_0105554 3300049580 Bacteria 2157
443 Ga0501046_0616236 3300049580 Unclassified 769
444 Ga0501046_0673623 3300049580 Bacteria 730
445 Ga0501047_0142861 3300049581 Bacteria 2271
446 Ga0501047_0148132 3300049581 Bacteria 2224
447 Ga0501048_0009558 3300049582 Bacteria 7281
448 Ga0501048_0067468 3300049582 Bacteria 2528
449 Ga0501067_0000339 3300049583 Bacteria 25485
450 Ga0501067_0003984 3300049583 Bacteria 8152
451 Ga0501067_0138286 3300049583 Bacteria 1356
452 Ga0501069_0570941 3300049585 Bacteria 678
453 Ga0501070_0044235 3300049586 Bacteria 3706
454 Ga0501070_0913786 3300049586 Bacteria 684
455 Ga0501071_0003527 3300049587 Bacteria 9786
456 Ga0501071_0024289 3300049587 Bacteria 4238
457 Ga0501071_0225613 3300049587 Bacteria 1411
458 Ga0501072_0056705 3300049588 Bacteria 3087
459 Ga0501072_0180820 3300049588 Bacteria 1682
460 Ga0501073_0005323 3300049589 Bacteria 9649
461 Ga0501073_0122379 3300049589 Bacteria 1803
462 Ga0501074_0089815 3300049590 Bacteria 2200
463 Ga0501075_0015597 3300049591 Bacteria 5453
464 Ga0501075_0055471 3300049591 Bacteria 2981
465 Ga0501075_0121563 3300049591 Bacteria 1987
466 Ga0501075_0123618 3300049591 Bacteria 1970
467 Ga0501075_0231797 3300049591 Bacteria 1408
468 Ga0501075_0677634 3300049591 Bacteria 786
469 Ga0501076_0004639 3300049592 Bacteria 9791
470 Ga0501076_0105365 3300049592 Bacteria 2276
471 Ga0501076_0767662 3300049592 Unclassified 795
472 Ga0501077_0007629 3300049593 Bacteria 6677
473 Ga0501079_0006996 3300049741 Bacteria 8503
474 Ga0501079_0092127 3300049741 Bacteria 2348
475 Ga0501080_0011395 3300049742 Bacteria 8144
476 Ga0501080_0267582 3300049742 Bacteria 1556
477 Ga0501081_0006719 3300049743 Bacteria 7480
478 Ga0501081_0008928 3300049743 Bacteria 6514
479 Ga0501083_0032077 3300049744 Bacteria 3604
480 Ga0501044_0413807 3300049823 Bacteria 1259
481 Ga0501045_0008747 3300049824 Bacteria 7062
482 Ga0501045_0084307 3300049824 Bacteria 2344
483 Ga0501045_0379223 3300049824 Bacteria 1053
484 nmdc:mga0k408_368872_c1 3300050493 Bacteria 855
485 nmdc:mga06z11_238965_c1 3300050494 Bacteria 1066
486 nmdc:mga0qj67_363598_c1 3300050509 Bacteria 1169
487 nmdc:mga0rr50_62474_c1 3300050513 Bacteria 2810
488 Ga0500635_0222521 3300053080 Bacteria 737
489 Ga0500651_0148876 3300053093 Bacteria 1406
490 Ga0500566_0238314 3300053094 Bacteria 893
491 Ga0500650_0293500 3300053098 Bacteria 721
492 Ga0500572_016818 3300053111 Bacteria 1870
493 Ga0500614_025617 3300053123 Bacteria 1404
494 Ga0500617_018488 3300053124 Bacteria 3036
495 Ga0500642_0084229 3300053130 Bacteria 1464
496 Ga0500652_019170 3300053131 Bacteria 2537
497 Ga0500652_095300 3300053131 Bacteria 1243
498 Ga0500658_0128002 3300053134 Bacteria 1130
499 Ga0500658_0193123 3300053134 Bacteria 930
500 Ga0500559_0055356 3300053136 Bacteria 1759
501 Ga0500559_0057739 3300053136 Bacteria 1725
502 Ga0500568_0112591 3300053139 Bacteria 1016
503 Ga0500573_0114831 3300053140 Bacteria 1504
504 Ga0500588_0005313 3300053146 Bacteria 2854
505 Ga0500588_0037688 3300053146 Bacteria 1437
506 Ga0500590_096636 3300053148 Bacteria 1425
507 Ga0500616_0007626 3300053153 Bacteria 6839
508 Ga0500622_0003284 3300053156 Bacteria 10962
509 Ga0500622_0011657 3300053156 Bacteria 4781
510 Ga0500622_0042597 3300053156 Bacteria 2357
511 Ga0500636_0193827 3300053177 Bacteria 1080
512 Ga0500637_0007794 3300053178 Bacteria 5375
513 Ga0501084_0008704 3300054114 Bacteria 8394
514 Ga0590074_015695 3300059423 Bacteria 1287
515 Ga0587092_066261 3300059512 Bacteria 686
516 Ga0587109_008544 3300059624 Bacteria 1584
517 Ga0587071_031143 3300060344 Bacteria 1028
518 Ga0587111_0105172 3300060346 Bacteria 708
519 Ga0501082_0004231 3300060353 Bacteria 12537
520 Ga0501082_0087089 3300060353 Bacteria 2694
521 Ga0530510_0007174 3300061734 Bacteria 7756
522 Ga0530510_0027258 3300061734 Bacteria 4094
523 Ga0530510_0127298 3300061734 Bacteria 1873

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047317 Ga0495604_0744895 Ga0495604_0744895_58_609 176
2 3300037471 Ga0395905_0719996 Ga0395905_0719996_331_864 177
3 3300005329 Ga0070683_100723099 Ga0070683_1007230991 178
4 3300005336 Ga0070680_101216574 Ga0070680_1012165741 178
5 3300005435 Ga0070714_101040980 Ga0070714_1010409801 178
6 3300005458 Ga0070681_10008976 Ga0070681_1000897611 178
7 3300005535 Ga0070684_100189942 Ga0070684_1001899423 178
8 3300005544 Ga0070686_100754409 Ga0070686_1007544091 178
9 3300005614 Ga0068856_100641382 Ga0068856_1006413822 178
10 3300005719 Ga0068861_100099302 Ga0068861_1000993024 178
11 3300005719 Ga0068861_100330192 Ga0068861_1003301922 178
12 3300006173 Ga0070716_100442782 Ga0070716_1004427822 178
13 3300006175 Ga0070712_100037323 Ga0070712_1000373234 178
14 3300009551 Ga0105238_10406256 Ga0105238_104062562 178
15 3300010375 Ga0105239_10353874 Ga0105239_103538742 178
16 3300014325 Ga0163163_11838651 Ga0163163_118386512 178
17 3300025901 Ga0207688_10222558 Ga0207688_102225582 178
18 3300025905 Ga0207685_10041008 Ga0207685_100410082 178
19 3300025906 Ga0207699_10292789 Ga0207699_102927893 178
20 3300025915 Ga0207693_10082217 Ga0207693_100822174 178
21 3300025917 Ga0207660_10941989 Ga0207660_109419891 178
22 3300025920 Ga0207649_11070076 Ga0207649_110700761 178
23 3300025924 Ga0207694_10082964 Ga0207694_100829646 178
24 3300025928 Ga0207700_11417027 Ga0207700_114170271 178
25 3300025929 Ga0207664_11136536 Ga0207664_111365362 178
26 3300025939 Ga0207665_10317843 Ga0207665_103178432 178
27 3300025944 Ga0207661_10649510 Ga0207661_106495101 178
28 3300025961 Ga0207712_10030603 Ga0207712_100306038 178
29 3300025961 Ga0207712_10281888 Ga0207712_102818883 178
30 3300026078 Ga0207702_10660068 Ga0207702_106600682 178
31 3300048903 Ga0496100_0384481 Ga0496100_0384481_254_817 178
32 3300048904 Ga0496101_0002147 Ga0496101_0002147_5570_6133 178
33 3300048905 Ga0496102_0045924 Ga0496102_0045924_1716_2279 178
34 3300048906 Ga0496103_0323730 Ga0496103_0323730_387_950 178
35 3300048907 Ga0496104_0076607 Ga0496104_0076607_1610_2173 178
36 3300048908 Ga0496105_0032509 Ga0496105_0032509_2871_3434 178
37 3300048911 Ga0496108_0028937 Ga0496108_0028937_2934_3497 178
38 3300048914 Ga0496111_0022689 Ga0496111_0022689_3281_3844 178
39 3300048916 Ga0496113_0361566 Ga0496113_0361566_230_793 178
40 3300048917 Ga0496114_0037374 Ga0496114_0037374_2066_2629 178
41 3300048918 Ga0496115_0114834 Ga0496115_0114834_1003_1566 178
42 2162886007 SwRhRL2b_contig_2458830 SwRhRL2b_0662.00000670 179
43 2162886007 SwRhRL2b_contig_305464 SwRhRL2b_0013.00005780 179
44 3300002868 Ga0006767J43181_103125 Ga0006767J43181_10312512 179
45 3300002870 Ga0006763J43179_104103 Ga0006763J43179_10410312 179
46 3300002872 Ga0006762J43184_103419 Ga0006762J43184_10341911 179
47 3300003158 Ga0006760J45825_103550 Ga0006760J45825_1035503 179
48 3300003163 Ga0006759J45824_1006649 Ga0006759J45824_100664914 179
49 3300003320 rootH2_10070226 rootH2_100702264 179
50 3300003323 rootH1_10162592 rootH1_101625922 179
51 3300003693 Ga0032354_1009872 Ga0032354_100987213 179
52 3300005289 Ga0065704_10070877 Ga0065704_1007087714 179
53 3300005290 Ga0065712_10355908 Ga0065712_103559082 179
54 3300005293 Ga0065715_10177021 Ga0065715_101770213 179
55 3300005295 Ga0065707_10001618 Ga0065707_1000161810 179
56 3300005331 Ga0070670_100472611 Ga0070670_1004726112 179
57 3300005336 Ga0070680_100289777 Ga0070680_1002897773 179
58 3300005341 Ga0070691_10236249 Ga0070691_102362492 179
59 3300005353 Ga0070669_100006485 Ga0070669_1000064853 179
60 3300005354 Ga0070675_100058025 Ga0070675_1000580254 179
61 3300005355 Ga0070671_100005400 Ga0070671_10000540014 179
62 3300005355 Ga0070671_100043910 Ga0070671_1000439107 179
63 3300005355 Ga0070671_100263170 Ga0070671_1002631702 179
64 3300005356 Ga0070674_100034590 Ga0070674_1000345903 179
65 3300005364 Ga0070673_100819890 Ga0070673_1008198901 179
66 3300005367 Ga0070667_100055472 Ga0070667_1000554721 179
67 3300005367 Ga0070667_100412400 Ga0070667_1004124003 179
68 3300005439 Ga0070711_101221085 Ga0070711_1012210851 179
69 3300005455 Ga0070663_100098843 Ga0070663_1000988436 179
70 3300005456 Ga0070678_100732694 Ga0070678_1007326942 179
71 3300005458 Ga0070681_10035786 Ga0070681_100357866 179
72 3300005458 Ga0070681_10048581 Ga0070681_100485819 179
73 3300005458 Ga0070681_10124955 Ga0070681_101249555 179
74 3300005458 Ga0070681_10167503 Ga0070681_101675033 179
75 3300005458 Ga0070681_10400701 Ga0070681_104007011 179
76 3300005459 Ga0068867_100125039 Ga0068867_1001250393 179
77 3300005467 Ga0070706_100382449 Ga0070706_1003824493 179
78 3300005530 Ga0070679_100063584 Ga0070679_1000635849 179
79 3300005530 Ga0070679_100281248 Ga0070679_1002812484 179
80 3300005530 Ga0070679_100419599 Ga0070679_1004195991 179
81 3300005539 Ga0068853_100379103 Ga0068853_1003791032 179
82 3300005543 Ga0070672_100074527 Ga0070672_1000745271 179
83 3300005543 Ga0070672_100652043 Ga0070672_1006520432 179
84 3300005544 Ga0070686_100067091 Ga0070686_1000670911 179
85 3300005546 Ga0070696_100424274 Ga0070696_1004242742 179
86 3300005547 Ga0070693_100221817 Ga0070693_1002218171 179
87 3300005548 Ga0070665_100014481 Ga0070665_10001448112 179
88 3300005548 Ga0070665_100045273 Ga0070665_1000452739 179
89 3300005563 Ga0068855_100114994 Ga0068855_1001149944 179
90 3300005563 Ga0068855_100528271 Ga0068855_1005282713 179
91 3300005564 Ga0070664_100353212 Ga0070664_1003532122 179
92 3300005578 Ga0068854_100243308 Ga0068854_1002433083 179
93 3300005578 Ga0068854_100372473 Ga0068854_1003724731 179
94 3300005614 Ga0068856_100042931 Ga0068856_1000429313 179
95 3300005614 Ga0068856_100047430 Ga0068856_1000474304 179
96 3300005616 Ga0068852_100172880 Ga0068852_1001728804 179
97 3300005616 Ga0068852_101148936 Ga0068852_1011489361 179
98 3300005617 Ga0068859_100000641 Ga0068859_10000064115 179
99 3300005617 Ga0068859_100092729 Ga0068859_1000927292 179
100 3300005618 Ga0068864_100090413 Ga0068864_1000904132 179
101 3300005719 Ga0068861_100116426 Ga0068861_1001164263 179
102 3300005841 Ga0068863_100008761 Ga0068863_10000876110 179
103 3300005841 Ga0068863_100083231 Ga0068863_1000832316 179
104 3300005841 Ga0068863_100154561 Ga0068863_1001545613 179
105 3300005842 Ga0068858_100000125 Ga0068858_10000012547 179
106 3300005842 Ga0068858_100004270 Ga0068858_10000427013 179
107 3300005843 Ga0068860_100006244 Ga0068860_1000062447 179
108 3300005843 Ga0068860_100009263 Ga0068860_10000926316 179
109 3300005844 Ga0068862_100065242 Ga0068862_1000652423 179
110 3300005844 Ga0068862_100246197 Ga0068862_1002461972 179
111 3300005844 Ga0068862_100657274 Ga0068862_1006572742 179
112 3300005937 Ga0081455_10210306 Ga0081455_102103063 179
113 3300005983 Ga0081540_1048835 Ga0081540_10488353 179
114 3300006178 Ga0075367_10237684 Ga0075367_102376842 179
115 3300006195 Ga0075366_10184479 Ga0075366_101844792 179
116 3300006237 Ga0097621_100122525 Ga0097621_1001225254 179
117 3300006237 Ga0097621_100265847 Ga0097621_1002658473 179
118 3300006237 Ga0097621_101180105 Ga0097621_1011801052 179
119 3300006353 Ga0075370_10203587 Ga0075370_102035872 179
120 3300006358 Ga0068871_100188243 Ga0068871_1001882434 179
121 3300006844 Ga0075428_100033220 Ga0075428_1000332209 179
122 3300006846 Ga0075430_100404355 Ga0075430_1004043551 179
123 3300006871 Ga0075434_100413399 Ga0075434_1004133993 179
124 3300006881 Ga0068865_100074556 Ga0068865_1000745566 179
125 3300006881 Ga0068865_100564036 Ga0068865_1005640362 179
126 3300006931 Ga0097620_100000641 Ga0097620_10000064115 179
127 3300006931 Ga0097620_100092731 Ga0097620_1000927312 179
128 3300006931 Ga0097620_100822177 Ga0097620_1008221773 179
129 3300006948 Ga0099826_10154582 Ga0099826_101545823 179
130 3300007076 Ga0075435_100074393 Ga0075435_1000743933 179
131 3300009092 Ga0105250_10000032 Ga0105250_1000003217 179
132 3300009092 Ga0105250_10180845 Ga0105250_101808452 179
133 3300009093 Ga0105240_10065094 Ga0105240_100650949 179
134 3300009093 Ga0105240_10075753 Ga0105240_100757533 179
135 3300009093 Ga0105240_10112936 Ga0105240_101129367 179
136 3300009093 Ga0105240_10280822 Ga0105240_102808223 179
137 3300009093 Ga0105240_10281671 Ga0105240_102816712 179
138 3300009093 Ga0105240_10541348 Ga0105240_105413481 179
139 3300009093 Ga0105240_10541799 Ga0105240_105417991 179
140 3300009101 Ga0105247_10002466 Ga0105247_1000246615 179
141 3300009101 Ga0105247_10025648 Ga0105247_100256484 179
142 3300009147 Ga0114129_10219902 Ga0114129_102199021 179
143 3300009176 Ga0105242_10313692 Ga0105242_103136922 179
144 3300009177 Ga0105248_10005842 Ga0105248_1000584213 179
145 3300009545 Ga0105237_10096005 Ga0105237_100960054 179
146 3300009545 Ga0105237_10114912 Ga0105237_101149124 179
147 3300009545 Ga0105237_11490058 Ga0105237_114900581 179
148 3300009551 Ga0105238_10022279 Ga0105238_100222792 179
149 3300009553 Ga0105249_10014582 Ga0105249_1001458212 179
150 3300009553 Ga0105249_10280371 Ga0105249_102803711 179
151 3300011119 Ga0105246_10036204 Ga0105246_100362042 179
152 3300013104 Ga0157370_10522491 Ga0157370_105224912 179
153 3300013105 Ga0157369_10015323 Ga0157369_100153236 179
154 3300013105 Ga0157369_10213528 Ga0157369_102135283 179
155 3300013105 Ga0157369_10293856 Ga0157369_102938563 179
156 3300013296 Ga0157374_10414545 Ga0157374_104145453 179
157 3300013296 Ga0157374_10773641 Ga0157374_107736412 179
158 3300013297 Ga0157378_10435474 Ga0157378_104354743 179
159 3300013306 Ga0163162_10026596 Ga0163162_100265969 179
160 3300013307 Ga0157372_10049576 Ga0157372_100495765 179
161 3300013307 Ga0157372_10325384 Ga0157372_103253844 179
162 3300013308 Ga0157375_10393940 Ga0157375_103939402 179
163 3300014325 Ga0163163_10007457 Ga0163163_1000745710 179
164 3300014325 Ga0163163_10912221 Ga0163163_109122212 179
165 3300014326 Ga0157380_10597862 Ga0157380_105978623 179
166 3300014968 Ga0157379_10000004 Ga0157379_10000004153 179
167 3300014968 Ga0157379_10082681 Ga0157379_100826813 179
168 3300014968 Ga0157379_10104840 Ga0157379_101048401 179
169 3300014968 Ga0157379_10246902 Ga0157379_102469024 179
170 3300014968 Ga0157379_10267841 Ga0157379_102678413 179
171 3300014969 Ga0157376_10213111 Ga0157376_102131112 179
172 3300017792 Ga0163161_10075910 Ga0163161_100759101 179
173 3300020070 Ga0206356_11640133 Ga0206356_116401334 179
174 3300021384 Ga0213876_10032683 Ga0213876_100326836 179
175 3300024225 Ga0224572_1011889 Ga0224572_10118893 179
176 3300025711 Ga0207696_1000198 Ga0207696_100019879 179
177 3300025900 Ga0207710_10009562 Ga0207710_100095629 179
178 3300025901 Ga0207688_10066029 Ga0207688_100660293 179
179 3300025901 Ga0207688_10144333 Ga0207688_101443333 179
180 3300025901 Ga0207688_10560761 Ga0207688_105607611 179
181 3300025903 Ga0207680_10282085 Ga0207680_102820852 179
182 3300025908 Ga0207643_10098940 Ga0207643_100989402 179
183 3300025909 Ga0207705_10383730 Ga0207705_103837302 179
184 3300025909 Ga0207705_10564609 Ga0207705_105646091 179
185 3300025911 Ga0207654_10062727 Ga0207654_100627274 179
186 3300025912 Ga0207707_10000276 Ga0207707_1000027627 179
187 3300025912 Ga0207707_10000410 Ga0207707_1000041036 179
188 3300025912 Ga0207707_10025066 Ga0207707_100250666 179
189 3300025912 Ga0207707_10219412 Ga0207707_102194123 179
190 3300025912 Ga0207707_10635967 Ga0207707_106359672 179
191 3300025913 Ga0207695_10049612 Ga0207695_100496124 179
192 3300025913 Ga0207695_10072121 Ga0207695_100721215 179
193 3300025913 Ga0207695_10083172 Ga0207695_100831727 179
194 3300025913 Ga0207695_10097549 Ga0207695_100975495 179
195 3300025914 Ga0207671_10073947 Ga0207671_100739472 179
196 3300025914 Ga0207671_10157809 Ga0207671_101578094 179
197 3300025914 Ga0207671_10940877 Ga0207671_109408771 179
198 3300025916 Ga0207663_10292911 Ga0207663_102929113 179
199 3300025917 Ga0207660_10002217 Ga0207660_100022171 179
200 3300025919 Ga0207657_10063277 Ga0207657_100632771 179
201 3300025920 Ga0207649_10791599 Ga0207649_107915992 179
202 3300025921 Ga0207652_10003383 Ga0207652_1000338315 179
203 3300025924 Ga0207694_10003326 Ga0207694_1000332613 179
204 3300025924 Ga0207694_10573244 Ga0207694_105732442 179
205 3300025925 Ga0207650_10016929 Ga0207650_100169296 179
206 3300025925 Ga0207650_10018767 Ga0207650_100187673 179
207 3300025926 Ga0207659_10122127 Ga0207659_101221274 179
208 3300025928 Ga0207700_10860938 Ga0207700_108609382 179
209 3300025931 Ga0207644_10000428 Ga0207644_1000042819 179
210 3300025931 Ga0207644_10179249 Ga0207644_101792493 179
211 3300025932 Ga0207690_10535741 Ga0207690_105357411 179
212 3300025933 Ga0207706_10064282 Ga0207706_100642823 179
213 3300025937 Ga0207669_10108086 Ga0207669_101080864 179
214 3300025940 Ga0207691_10104939 Ga0207691_101049394 179
215 3300025940 Ga0207691_10247801 Ga0207691_102478013 179
216 3300025940 Ga0207691_10816811 Ga0207691_108168112 179
217 3300025941 Ga0207711_10159847 Ga0207711_101598473 179
218 3300025941 Ga0207711_10814954 Ga0207711_108149542 179
219 3300025942 Ga0207689_10460341 Ga0207689_104603411 179
220 3300025944 Ga0207661_11060161 Ga0207661_110601612 179
221 3300025949 Ga0207667_10008242 Ga0207667_1000824215 179
222 3300025960 Ga0207651_10461638 Ga0207651_104616383 179
223 3300025961 Ga0207712_10274654 Ga0207712_102746543 179
224 3300025981 Ga0207640_10325567 Ga0207640_103255672 179
225 3300025981 Ga0207640_10419821 Ga0207640_104198213 179
226 3300025986 Ga0207658_10041770 Ga0207658_100417708 179
227 3300025986 Ga0207658_10175447 Ga0207658_101754474 179
228 3300025986 Ga0207658_10575909 Ga0207658_105759093 179
229 3300026035 Ga0207703_10001524 Ga0207703_1000152420 179
230 3300026035 Ga0207703_10019203 Ga0207703_100192037 179
231 3300026041 Ga0207639_10851078 Ga0207639_108510782 179
232 3300026067 Ga0207678_10005556 Ga0207678_100055566 179
233 3300026067 Ga0207678_10627444 Ga0207678_106274442 179
234 3300026078 Ga0207702_10128657 Ga0207702_101286576 179
235 3300026078 Ga0207702_10285678 Ga0207702_102856783 179
236 3300026088 Ga0207641_10002325 Ga0207641_1000232515 179
237 3300026088 Ga0207641_10010988 Ga0207641_100109888 179
238 3300026088 Ga0207641_10188113 Ga0207641_101881134 179
239 3300026089 Ga0207648_10078777 Ga0207648_100787776 179
240 3300026095 Ga0207676_10363333 Ga0207676_103633332 179
241 3300026116 Ga0207674_10653560 Ga0207674_106535601 179
242 3300026118 Ga0207675_100132610 Ga0207675_1001326104 179
243 3300026118 Ga0207675_101040909 Ga0207675_1010409092 179
244 3300026142 Ga0207698_10091691 Ga0207698_100916913 179
245 3300026142 Ga0207698_10339878 Ga0207698_103398783 179
246 3300026142 Ga0207698_10432739 Ga0207698_104327392 179
247 3300028379 Ga0268266_10010307 Ga0268266_100103073 179
248 3300028380 Ga0268265_10056316 Ga0268265_100563167 179
249 3300028380 Ga0268265_10693038 Ga0268265_106930382 179
250 3300028381 Ga0268264_10000102 Ga0268264_1000010215 179
251 3300028381 Ga0268264_10011424 Ga0268264_100114243 179
252 3300028563 Ga0265319_1002761 Ga0265319_10027619 179
253 3300028563 Ga0265319_1074569 Ga0265319_10745691 179
254 3300028573 Ga0265334_10001026 Ga0265334_1000102615 179
255 3300028577 Ga0265318_10000228 Ga0265318_1000022829 179
256 3300028653 Ga0265323_10039832 Ga0265323_100398322 179
257 3300028800 Ga0265338_10016309 Ga0265338_1001630913 179
258 3300028800 Ga0265338_10145015 Ga0265338_101450154 179
259 3300030521 Ga0307511_10000235 Ga0307511_1000023550 179
260 3300030521 Ga0307511_10056308 Ga0307511_100563086 179
261 3300031235 Ga0265330_10004229 Ga0265330_100042299 179
262 3300031235 Ga0265330_10027214 Ga0265330_100272144 179
263 3300031238 Ga0265332_10001037 Ga0265332_1000103717 179
264 3300031239 Ga0265328_10002988 Ga0265328_1000298810 179
265 3300031240 Ga0265320_10004080 Ga0265320_1000408013 179
266 3300031241 Ga0265325_10005189 Ga0265325_1000518912 179
267 3300031242 Ga0265329_10001451 Ga0265329_100014517 179
268 3300031247 Ga0265340_10013162 Ga0265340_100131622 179
269 3300031247 Ga0265340_10020617 Ga0265340_100206175 179
270 3300031249 Ga0265339_10002072 Ga0265339_1000207223 179
271 3300031249 Ga0265339_10006835 Ga0265339_100068354 179
272 3300031249 Ga0265339_10014355 Ga0265339_100143551 179
273 3300031249 Ga0265339_10055447 Ga0265339_100554476 179
274 3300031250 Ga0265331_10004429 Ga0265331_1000442910 179
275 3300031250 Ga0265331_10149262 Ga0265331_101492621 179
276 3300031344 Ga0265316_10013033 Ga0265316_1001303313 179
277 3300031507 Ga0307509_10000987 Ga0307509_1000098744 179
278 3300031507 Ga0307509_10002579 Ga0307509_1000257915 179
279 3300031507 Ga0307509_10717737 Ga0307509_107177371 179
280 3300031595 Ga0265313_10001786 Ga0265313_1000178613 179
281 3300031595 Ga0265313_10015631 Ga0265313_100156316 179
282 3300031595 Ga0265313_10047129 Ga0265313_100471294 179
283 3300031616 Ga0307508_10111635 Ga0307508_101116353 179
284 3300031665 Ga0316575_10009147 Ga0316575_100091476 179
285 3300031665 Ga0316575_10016662 Ga0316575_100166623 179
286 3300031665 Ga0316575_10046954 Ga0316575_100469542 179
287 3300031711 Ga0265314_10005233 Ga0265314_1000523311 179
288 3300031712 Ga0265342_10002379 Ga0265342_1000237916 179
289 3300031712 Ga0265342_10042409 Ga0265342_100424095 179
290 3300031727 Ga0316576_10062578 Ga0316576_100625785 179
291 3300031728 Ga0316578_10090796 Ga0316578_100907962 179
292 3300031730 Ga0307516_10001316 Ga0307516_1000131632 179
293 3300031731 Ga0307405_10286534 Ga0307405_102865342 179
294 3300031733 Ga0316577_10074627 Ga0316577_100746271 179
295 3300031824 Ga0307413_10180497 Ga0307413_101804973 179
296 3300031824 Ga0307413_10328642 Ga0307413_103286421 179
297 3300031824 Ga0307413_10394482 Ga0307413_103944821 179
298 3300031852 Ga0307410_10406316 Ga0307410_104063162 179
299 3300031901 Ga0307406_10254266 Ga0307406_102542663 179
300 3300031901 Ga0307406_10992102 Ga0307406_109921022 179
301 3300031903 Ga0307407_10179766 Ga0307407_101797663 179
302 3300031903 Ga0307407_10197998 Ga0307407_101979982 179
303 3300031903 Ga0307407_10305319 Ga0307407_103053192 179
304 3300031911 Ga0307412_10221900 Ga0307412_102219002 179
305 3300031911 Ga0307412_10513034 Ga0307412_105130342 179
306 3300031995 Ga0307409_100059614 Ga0307409_1000596145 179
307 3300031995 Ga0307409_100692432 Ga0307409_1006924322 179
308 3300032002 Ga0307416_100218253 Ga0307416_1002182533 179
309 3300032002 Ga0307416_100785368 Ga0307416_1007853682 179
310 3300032004 Ga0307414_10030752 Ga0307414_100307521 179
311 3300032005 Ga0307411_10197680 Ga0307411_101976803 179
312 3300032126 Ga0307415_100068825 Ga0307415_1000688256 179
313 3300032168 Ga0316593_10000942 Ga0316593_100009428 179
314 3300032168 Ga0316593_10006570 Ga0316593_100065704 179
315 3300032168 Ga0316593_10092284 Ga0316593_100922841 179
316 3300032168 Ga0316593_10122884 Ga0316593_101228842 179
317 3300033180 Ga0307510_10000006 Ga0307510_10000006346 179
318 3300033180 Ga0307510_10029950 Ga0307510_100299507 179
319 3300033528 Ga0316588_1008872 Ga0316588_10088722 179
320 3300033528 Ga0316588_1077603 Ga0316588_10776031 179
321 3300033547 Ga0316212_1005837 Ga0316212_10058372 179
322 3300034818 Ga0373950_0000002 Ga0373950_0000002_5371_6090 179
323 3300035113 Ga0373936_0035525 Ga0373936_0035525_317_862 179
324 3300035116 Ga0373945_0139007 Ga0373945_0139007_14_562 179
325 3300035398 Ga0316574_0028762 Ga0316574_0028762_2085_2633 179
326 3300035398 Ga0316574_0296695 Ga0316574_0296695_239_787 179
327 3300035695 Ga0373927_0272861 Ga0373927_0272861_419_958 179
328 3300035724 Ga0373933_0001189 Ga0373933_0001189_5478_6197 179
329 3300035725 Ga0373947_0096165 Ga0373947_0096165_940_1686 179
330 3300036647 Ga0316582_0100593 Ga0316582_0100593_426_965 179
331 3300036647 Ga0316582_0138952 Ga0316582_0138952_777_1316 179
332 3300036712 Ga0316584_0074846 Ga0316584_0074846_1687_2235 179
333 3300037466 Ga0395898_0014841 Ga0395898_0014841_2376_2915 179
334 3300037466 Ga0395898_0039994 Ga0395898_0039994_3484_4023 179
335 3300037466 Ga0395898_0883534 Ga0395898_0883534_238_777 179
336 3300037853 Ga0436364_0864071 Ga0436364_0864071_188_727 179
337 3300038443 Ga0395901_1080422 Ga0395901_1080422_67_606 179
338 3300039093 Ga0400489_61698 Ga0400489_61698_688_1227 179
339 3300039437 Ga0436365_0032067 Ga0436365_0032067_2309_2848 179
340 3300039438 Ga0436360_0748450 Ga0436360_0748450_121_660 179
341 3300039438 Ga0436360_0749057 Ga0436360_0749057_787_1326 179
342 3300039447 Ga0436361_0195894 Ga0436361_0195894_81_620 179
343 3300039447 Ga0436361_0555916 Ga0436361_0555916_189_941 179
344 3300039450 Ga0436363_0193457 Ga0436363_0193457_171_710 179
345 3300039450 Ga0436363_0411941 Ga0436363_0411941_120_659 179
346 3300039450 Ga0436363_0978720 Ga0436363_0978720_1757_2296 179
347 3300039453 Ga0436362_0693496 Ga0436362_0693496_369_908 179
348 3300039453 Ga0436362_0820035 Ga0436362_0820035_58_819 179
349 3300041406 Ga0439439_0038579 Ga0439439_0038579_212_757 179
350 3300041407 Ga0439447_060661 Ga0439447_060661_134_673 179
351 3300041458 Ga0451798_0505011 Ga0451798_0505011_1732_2277 179
352 3300041505 Ga0451849_1052663 Ga0451849_1052663_1157_1696 179
353 3300041512 Ga0451853_2380426 Ga0451853_2380426_1855_2394 179
354 3300042004 Ga0439445_0150212 Ga0439445_0150212_106_651 179
355 3300042007 Ga0439449_0100693 Ga0439449_0100693_423_968 179
356 3300042876 Ga0451577_0008152 Ga0451577_0008152_6239_6778 179
357 3300044673 Ga0453683_0005334 Ga0453683_0005334_1168_1707 179
358 3300044684 Ga0466966_0015541 Ga0466966_0015541_512_1051 179
359 3300044693 Ga0466961_0517526 Ga0466961_0517526_95_634 179
360 3300044712 Ga0453684_0240033 Ga0453684_0240033_1173_1712 179
361 3300045049 Ga0466959_0103445 Ga0466959_0103445_122_661 179
362 3300045051 Ga0451576_0053177 Ga0451576_0053177_2972_3511 179
363 3300045051 Ga0451576_0131416 Ga0451576_0131416_1242_1784 179
364 3300046455 Ga0495603_0365063 Ga0495603_0365063_142_681 179
365 3300046459 Ga0495629_0111215 Ga0495629_0111215_648_1187 179
366 3300046460 Ga0495638_0074489 Ga0495638_0074489_1079_1621 179
367 3300046461 Ga0495641_0074632 Ga0495641_0074632_442_981 179
368 3300046471 Ga0495650_0049935 Ga0495650_0049935_612_1151 179
369 3300046475 Ga0495639_0082011 Ga0495639_0082011_541_1080 179
370 3300046500 Ga0495596_0097449 Ga0495596_0097449_462_1001 179
371 3300046507 Ga0495606_0219135 Ga0495606_0219135_53_592 179
372 3300046513 Ga0495616_0129981 Ga0495616_0129981_56_601 179
373 3300046516 Ga0495628_0093477 Ga0495628_0093477_829_1575 179
374 3300046516 Ga0495628_0625607 Ga0495628_0625607_79_624 179
375 3300046517 Ga0495630_0055150 Ga0495630_0055150_403_942 179
376 3300046517 Ga0495630_0286426 Ga0495630_0286426_709_1248 179
377 3300046519 Ga0495632_0032155 Ga0495632_0032155_907_1446 179
378 3300046519 Ga0495632_0109379 Ga0495632_0109379_121_663 179
379 3300046519 Ga0495632_0172236 Ga0495632_0172236_221_766 179
380 3300046522 Ga0495643_0036660 Ga0495643_0036660_1666_2205 179
381 3300046524 Ga0495648_0038970 Ga0495648_0038970_373_915 179
382 3300046533 Ga0495640_0113969 Ga0495640_0113969_1025_1564 179
383 3300046535 Ga0495586_0010612 Ga0495586_0010612_2794_3333 179
384 3300046539 Ga0495621_0084394 Ga0495621_0084394_494_1033 179
385 3300046557 Ga0495622_0117795 Ga0495622_0117795_532_1071 179
386 3300046557 Ga0495622_0125634 Ga0495622_0125634_323_862 179
387 3300046557 Ga0495622_0127664 Ga0495622_0127664_223_762 179
388 3300046616 Ga0495668_0105281 Ga0495668_0105281_363_902 179
389 3300046642 Ga0495634_0164500 Ga0495634_0164500_381_920 179
390 3300046648 Ga0495611_0019227 Ga0495611_0019227_1426_1968 179
391 3300046648 Ga0495611_0344025 Ga0495611_0344025_70_615 179
392 3300046663 Ga0495635_0323485 Ga0495635_0323485_33_575 179
393 3300046683 Ga0495658_0166619 Ga0495658_0166619_612_1160 179
394 3300046684 Ga0495669_0058634 Ga0495669_0058634_186_725 179
395 3300046690 Ga0495624_0151369 Ga0495624_0151369_569_1108 179
396 3300047320 Ga0495672_0024792 Ga0495672_0024792_2479_3024 179
397 3300047322 Ga0495680_0152274 Ga0495680_0152274_101_643 179
398 3300047443 Ga0495687_032507 Ga0495687_032507_1183_1722 179
399 3300048903 Ga0496100_0110723 Ga0496100_0110723_978_1517 179
400 3300048904 Ga0496101_0821202 Ga0496101_0821202_70_609 179
401 3300048905 Ga0496102_0003295 Ga0496102_0003295_12614_13156 179
402 3300048905 Ga0496102_0199613 Ga0496102_0199613_633_1172 179
403 3300048906 Ga0496103_0040660 Ga0496103_0040660_1248_1790 179
404 3300048909 Ga0496106_0066543 Ga0496106_0066543_2011_2550 179
405 3300048911 Ga0496108_0168503 Ga0496108_0168503_643_1182 179
406 3300048912 Ga0496109_0707816 Ga0496109_0707816_274_813 179
407 3300048915 Ga0496112_0773816 Ga0496112_0773816_18_581 179
408 3300048916 Ga0496113_0189425 Ga0496113_0189425_68_607 179
409 3300048918 Ga0496115_0126283 Ga0496115_0126283_115_657 179
410 3300048920 Ga0496117_0000787 Ga0496117_0000787_19747_20289 179
411 3300048920 Ga0496117_0073497 Ga0496117_0073497_1537_2076 179
412 3300048921 Ga0496118_0000032 Ga0496118_0000032_239265_239807 179
413 3300048921 Ga0496118_0013267 Ga0496118_0013267_387_926 179
414 3300048921 Ga0496118_0112821 Ga0496118_0112821_1023_1562 179
415 3300048922 Ga0496119_0116851 Ga0496119_0116851_829_1371 179
416 3300048923 Ga0496120_0151997 Ga0496120_0151997_101_643 179
417 3300048924 Ga0496121_0000704 Ga0496121_0000704_60475_61014 179
418 3300048924 Ga0496121_0028362 Ga0496121_0028362_4533_5072 179
419 3300048924 Ga0496121_0266210 Ga0496121_0266210_49_591 179
420 3300048927 Ga0496124_0006228 Ga0496124_0006228_3306_3848 179
421 3300048928 Ga0496125_0001378 Ga0496125_0001378_6542_7081 179
422 3300048929 Ga0496126_0011396 Ga0496126_0011396_6450_6992 179
423 3300049528 Ga0501312_051378 Ga0501312_051378_138_683 179
424 3300049533 Ga0501317_011660 Ga0501317_011660_147_692 179
425 3300049568 Ga0501031_0131173 Ga0501031_0131173_350_889 179
426 3300049568 Ga0501031_0470580 Ga0501031_0470580_251_799 179
427 3300049570 Ga0501033_0049659 Ga0501033_0049659_561_1100 179
428 3300049571 Ga0501034_0231167 Ga0501034_0231167_986_1678 179
429 3300049572 Ga0501036_0023621 Ga0501036_0023621_563_1102 179
430 3300049574 Ga0501038_0015092 Ga0501038_0015092_2149_2688 179
431 3300049575 Ga0501039_0046960 Ga0501039_0046960_2070_2618 179
432 3300049575 Ga0501039_0115981 Ga0501039_0115981_330_869 179
433 3300049576 Ga0501040_0008066 Ga0501040_0008066_5897_6436 179
434 3300049576 Ga0501040_0044091 Ga0501040_0044091_521_1060 179
435 3300049576 Ga0501040_0843536 Ga0501040_0843536_76_624 179
436 3300049577 Ga0501041_0001598 Ga0501041_0001598_1788_2327 179
437 3300049577 Ga0501041_0120949 Ga0501041_0120949_830_1378 179
438 3300049578 Ga0501042_0001373 Ga0501042_0001373_7081_7620 179
439 3300049579 Ga0501043_0299109 Ga0501043_0299109_492_1031 179
440 3300049579 Ga0501043_0513223 Ga0501043_0513223_169_717 179
441 3300049580 Ga0501046_0015243 Ga0501046_0015243_2468_3007 179
442 3300049580 Ga0501046_0105554 Ga0501046_0105554_272_811 179
443 3300049580 Ga0501046_0616236 Ga0501046_0616236_13_561 179
444 3300049580 Ga0501046_0673623 Ga0501046_0673623_99_638 179
445 3300049581 Ga0501047_0142861 Ga0501047_0142861_1173_1718 179
446 3300049581 Ga0501047_0148132 Ga0501047_0148132_562_1101 179
447 3300049582 Ga0501048_0009558 Ga0501048_0009558_673_1212 179
448 3300049582 Ga0501048_0067468 Ga0501048_0067468_240_779 179
449 3300049583 Ga0501067_0000339 Ga0501067_0000339_168_887 179
450 3300049583 Ga0501067_0003984 Ga0501067_0003984_7185_7895 179
451 3300049583 Ga0501067_0138286 Ga0501067_0138286_68_607 179
452 3300049585 Ga0501069_0570941 Ga0501069_0570941_83_628 179
453 3300049586 Ga0501070_0044235 Ga0501070_0044235_1150_1689 179
454 3300049586 Ga0501070_0913786 Ga0501070_0913786_113_652 179
455 3300049587 Ga0501071_0003527 Ga0501071_0003527_9142_9681 179
456 3300049587 Ga0501071_0024289 Ga0501071_0024289_1536_2075 179
457 3300049587 Ga0501071_0225613 Ga0501071_0225613_199_747 179
458 3300049588 Ga0501072_0056705 Ga0501072_0056705_1773_2321 179
459 3300049588 Ga0501072_0180820 Ga0501072_0180820_402_941 179
460 3300049589 Ga0501073_0005323 Ga0501073_0005323_5317_6036 179
461 3300049589 Ga0501073_0122379 Ga0501073_0122379_773_1312 179
462 3300049590 Ga0501074_0089815 Ga0501074_0089815_1050_1589 179
463 3300049591 Ga0501075_0015597 Ga0501075_0015597_2406_2945 179
464 3300049591 Ga0501075_0055471 Ga0501075_0055471_1825_2364 179
465 3300049591 Ga0501075_0121563 Ga0501075_0121563_1032_1580 179
466 3300049591 Ga0501075_0123618 Ga0501075_0123618_367_906 179
467 3300049591 Ga0501075_0231797 Ga0501075_0231797_822_1361 179
468 3300049591 Ga0501075_0677634 Ga0501075_0677634_149_688 179
469 3300049592 Ga0501076_0004639 Ga0501076_0004639_6177_6716 179
470 3300049592 Ga0501076_0105365 Ga0501076_0105365_66_605 179
471 3300049592 Ga0501076_0767662 Ga0501076_0767662_66_614 179
472 3300049593 Ga0501077_0007629 Ga0501077_0007629_2189_2728 179
473 3300049741 Ga0501079_0006996 Ga0501079_0006996_212_751 179
474 3300049741 Ga0501079_0092127 Ga0501079_0092127_1584_2153 179
475 3300049742 Ga0501080_0011395 Ga0501080_0011395_1243_1782 179
476 3300049742 Ga0501080_0267582 Ga0501080_0267582_345_1067 179
477 3300049743 Ga0501081_0006719 Ga0501081_0006719_5065_5604 179
478 3300049743 Ga0501081_0008928 Ga0501081_0008928_5090_5638 179
479 3300049744 Ga0501083_0032077 Ga0501083_0032077_671_1210 179
480 3300049823 Ga0501044_0413807 Ga0501044_0413807_474_1013 179
481 3300049824 Ga0501045_0008747 Ga0501045_0008747_4412_4951 179
482 3300049824 Ga0501045_0084307 Ga0501045_0084307_23_562 179
483 3300049824 Ga0501045_0379223 Ga0501045_0379223_48_587 179
484 3300050493 nmdc:mga0k408_368872_c1 nmdc:mga0k408_368872_c1_28_573 179
485 3300050494 nmdc:mga06z11_238965_c1 nmdc:mga06z11_238965_c1_230_769 179
486 3300050509 nmdc:mga0qj67_363598_c1 nmdc:mga0qj67_363598_c1_31_723 179
487 3300050513 nmdc:mga0rr50_62474_c1 nmdc:mga0rr50_62474_c1_1622_2323 179
488 3300053080 Ga0500635_0222521 Ga0500635_0222521_92_631 179
489 3300053093 Ga0500651_0148876 Ga0500651_0148876_698_1258 179
490 3300053094 Ga0500566_0238314 Ga0500566_0238314_241_780 179
491 3300053098 Ga0500650_0293500 Ga0500650_0293500_152_694 179
492 3300053111 Ga0500572_016818 Ga0500572_016818_246_791 179
493 3300053123 Ga0500614_025617 Ga0500614_025617_677_1216 179
494 3300053124 Ga0500617_018488 Ga0500617_018488_536_1081 179
495 3300053130 Ga0500642_0084229 Ga0500642_0084229_374_916 179
496 3300053131 Ga0500652_019170 Ga0500652_019170_1732_2274 179
497 3300053131 Ga0500652_095300 Ga0500652_095300_500_1060 179
498 3300053134 Ga0500658_0128002 Ga0500658_0128002_465_1010 179
499 3300053134 Ga0500658_0193123 Ga0500658_0193123_205_747 179
500 3300053136 Ga0500559_0055356 Ga0500559_0055356_1072_1617 179
501 3300053136 Ga0500559_0057739 Ga0500559_0057739_721_1260 179
502 3300053139 Ga0500568_0112591 Ga0500568_0112591_217_756 179
503 3300053140 Ga0500573_0114831 Ga0500573_0114831_283_822 179
504 3300053146 Ga0500588_0005313 Ga0500588_0005313_806_1351 179
505 3300053146 Ga0500588_0037688 Ga0500588_0037688_314_856 179
506 3300053148 Ga0500590_096636 Ga0500590_096636_38_577 179
507 3300053153 Ga0500616_0007626 Ga0500616_0007626_3261_3803 179
508 3300053156 Ga0500622_0003284 Ga0500622_0003284_7642_8202 179
509 3300053156 Ga0500622_0011657 Ga0500622_0011657_2383_2928 179
510 3300053156 Ga0500622_0042597 Ga0500622_0042597_267_812 179
511 3300053177 Ga0500636_0193827 Ga0500636_0193827_13_552 179
512 3300053178 Ga0500637_0007794 Ga0500637_0007794_3837_4376 179
513 3300054114 Ga0501084_0008704 Ga0501084_0008704_1643_2182 179
514 3300059423 Ga0590074_015695 Ga0590074_015695_102_647 179
515 3300059512 Ga0587092_066261 Ga0587092_066261_128_670 179
516 3300059624 Ga0587109_008544 Ga0587109_008544_538_1080 179
517 3300060344 Ga0587071_031143 Ga0587071_031143_333_875 179
518 3300060346 Ga0587111_0105172 Ga0587111_0105172_97_663 179
519 3300060353 Ga0501082_0004231 Ga0501082_0004231_10500_11039 179
520 3300060353 Ga0501082_0087089 Ga0501082_0087089_248_787 179
521 3300061734 Ga0530510_0007174 Ga0530510_0007174_4709_5248 179
522 3300061734 Ga0530510_0027258 Ga0530510_0027258_3444_3992 179
523 3300061734 Ga0530510_0127298 Ga0530510_0127298_346_885 179

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00281

Ribosomal_L5

Ribosomal protein L5

24

80

0.99

PF00673

Ribosomal_L5_C

ribosomal L5P family C-terminus

84

176

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ns3-assembly1.cif.gz_A crystal structures of cy5 cyanine fluorophores stacked onto the end of double-stranded rna 0.9697 4 178
5ns4-assembly1.cif.gz_A crystal structures of cy3 cyanine fluorophores stacked onto the end of double-stranded rna 0.9573 1 178
5ns3-assembly1.cif.gz_B crystal structures of cy5 cyanine fluorophores stacked onto the end of double-stranded rna 0.9571 4 178
5ns4-assembly2.cif.gz_B crystal structures of cy3 cyanine fluorophores stacked onto the end of double-stranded rna 0.953 4 178
5ns4-assembly1.cif.gz_A crystal structures of cy3 cyanine fluorophores stacked onto the end of double-stranded rna 0.9506 1 178
ID Description Score Start End Superfamily
4warF00 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.8932 2 178 3.30.1440.10
4warF00 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.8884 2 178 3.30.1440.10
af_O14337_108_278_3.30.1440.10 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.8366 22 173 3.30.1440.10
af_P36519_120_288_3.30.1440.10 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.8357 22 177 3.30.1440.10
1vs9E00 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.8266 4 179 3.30.1440.10
ID Description Score Start End GO Terms
AF-A0A538J4T4-F1-model_v4 50S ribosomal protein L5 0.9389 1 177 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A554FZ23-F1-model_v4 Large ribosomal subunit protein uL5 0.9125 2 179 GO:0000049
GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A522EXR9-F1-model_v4 Large ribosomal subunit protein uL5 0.9122 1 179 GO:0000049
GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A2M6Y4L6-F1-model_v4 Large ribosomal subunit protein uL5 0.9122 1 179 GO:0000049
GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A2T2UIG2-F1-model_v4 Large ribosomal subunit protein uL5 0.9119 2 179 GO:0000049
GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Feature Viewer

pLDDT pTM Quality
73.99 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map