F459014
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 523 | 329 | 523 | 182 |
Family's Representative Sequence
| Representative Sequence | 3300037471|Ga0395905_0719996|Ga0395905_0719996_331_864 |
| Length | 177 |
| Sequence | MSRLYKKFKEEIVGELKGRHPSRNVMELPVLKKIVISMGLGDGLKDKNALSEHSAELALISGQQPVVTRSKKAISNFKLREDQPVGLMVTLRGKRMYDFLDRFCNIVAPRIRDFRGFEKKCDGRGNYNFGIAEQQIFVELNPDKIKRAQGMNITLVTTAKKDEDCVELLTLLGFPFK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 3300002868 | Avena fatua rhizosphere microbial communities - H2_Bulk_Litter_10 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 3 | 3300002870 | Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_6 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 4 | 3300002872 | Avena fatua rhizosphere microbial communities - H1_Bulk_Litter_5 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 5 | 3300003158 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_3 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 6 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 7 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 8 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 9 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 10 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 12 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 34 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 40 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 42 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 43 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 44 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 45 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 46 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 47 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 48 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 49 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 50 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 51 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 52 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 53 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 56 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 57 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 59 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 60 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 61 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 62 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 63 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 64 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 66 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 67 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 91 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 92 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 93 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 144 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 145 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 146 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 147 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 148 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 149 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 150 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 151 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 152 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 153 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 154 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 155 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 156 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 157 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 158 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 159 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 160 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 161 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 162 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 163 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 164 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 165 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 166 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 167 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 168 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 169 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 170 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 171 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 172 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 173 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 174 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 175 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 176 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 177 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 178 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 179 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 180 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 181 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 182 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 183 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 184 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 185 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 186 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 187 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 188 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 189 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 190 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 191 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 192 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 193 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 194 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 195 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 196 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 197 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 198 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 199 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 200 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 201 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 202 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 203 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 204 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 205 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 206 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 207 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 208 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 209 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 210 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 211 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 212 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 213 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 214 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 215 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 216 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 217 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 247 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 248 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 249 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 250 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 251 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 252 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 253 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 254 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 255 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 256 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 257 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 258 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 259 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 260 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 261 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 262 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 263 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 264 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 265 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 266 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 267 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 268 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 269 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 270 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 286 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 288 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 289 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 292 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 300 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 301 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 304 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 305 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 306 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 307 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 308 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 309 | 3300053124 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere | Metagenome | Endosphere |
| 310 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 311 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 312 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 313 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 314 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 315 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 316 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 317 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 318 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 319 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 320 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 321 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 322 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 324 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 325 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 326 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 327 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 328 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.37 |
| Metatranscriptomes | 3.63 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.74 |
| Nodule | 0.19 |
| Rhizoplane | 4.4 |
| Rhizosphere | 83.17 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.5 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_2458830 | 2162886007 | Bacteria | 2754 |
| 2 | SwRhRL2b_contig_305464 | 2162886007 | Bacteria | 3378 |
| 3 | Ga0006767J43181_103125 | 3300002868 | Bacteria | 8971 |
| 4 | Ga0006763J43179_104103 | 3300002870 | Bacteria | 8906 |
| 5 | Ga0006762J43184_103419 | 3300002872 | Bacteria | 7285 |
| 6 | Ga0006760J45825_103550 | 3300003158 | Bacteria | 2322 |
| 7 | Ga0006759J45824_1006649 | 3300003163 | Bacteria | 16605 |
| 8 | rootH2_10070226 | 3300003320 | Bacteria | 1731 |
| 9 | rootH1_10162592 | 3300003323 | Bacteria | 1576 |
| 10 | Ga0032354_1009872 | 3300003693 | Bacteria | 14763 |
| 11 | Ga0065704_10070877 | 3300005289 | Bacteria | 15122 |
| 12 | Ga0065712_10355908 | 3300005290 | Bacteria | 781 |
| 13 | Ga0065715_10177021 | 3300005293 | Bacteria | 1504 |
| 14 | Ga0065707_10001618 | 3300005295 | Bacteria | 6793 |
| 15 | Ga0070683_100723099 | 3300005329 | Bacteria | 954 |
| 16 | Ga0070670_100472611 | 3300005331 | Bacteria | 1113 |
| 17 | Ga0070680_100289777 | 3300005336 | Bacteria | 1387 |
| 18 | Ga0070680_101216574 | 3300005336 | Bacteria | 652 |
| 19 | Ga0070691_10236249 | 3300005341 | Bacteria | 975 |
| 20 | Ga0070669_100006485 | 3300005353 | Bacteria | 8426 |
| 21 | Ga0070675_100058025 | 3300005354 | Bacteria | 3192 |
| 22 | Ga0070671_100005400 | 3300005355 | Bacteria | 10190 |
| 23 | Ga0070671_100043910 | 3300005355 | Bacteria | 3714 |
| 24 | Ga0070671_100263170 | 3300005355 | Bacteria | 1466 |
| 25 | Ga0070674_100034590 | 3300005356 | Bacteria | 3376 |
| 26 | Ga0070673_100819890 | 3300005364 | Bacteria | 860 |
| 27 | Ga0070667_100055472 | 3300005367 | Bacteria | 3346 |
| 28 | Ga0070667_100412400 | 3300005367 | Bacteria | 1231 |
| 29 | Ga0070714_101040980 | 3300005435 | Bacteria | 797 |
| 30 | Ga0070711_101221085 | 3300005439 | Bacteria | 651 |
| 31 | Ga0070663_100098843 | 3300005455 | Bacteria | 2174 |
| 32 | Ga0070678_100732694 | 3300005456 | Bacteria | 893 |
| 33 | Ga0070681_10008976 | 3300005458 | Bacteria | 9830 |
| 34 | Ga0070681_10035786 | 3300005458 | Bacteria | 4988 |
| 35 | Ga0070681_10048581 | 3300005458 | Bacteria | 4239 |
| 36 | Ga0070681_10124955 | 3300005458 | Bacteria | 2505 |
| 37 | Ga0070681_10167503 | 3300005458 | Bacteria | 2119 |
| 38 | Ga0070681_10400701 | 3300005458 | Bacteria | 1283 |
| 39 | Ga0068867_100125039 | 3300005459 | Bacteria | 1992 |
| 40 | Ga0070706_100382449 | 3300005467 | Bacteria | 1311 |
| 41 | Ga0070679_100063584 | 3300005530 | Bacteria | 3678 |
| 42 | Ga0070679_100281248 | 3300005530 | Bacteria | 1616 |
| 43 | Ga0070679_100419599 | 3300005530 | Bacteria | 1283 |
| 44 | Ga0070684_100189942 | 3300005535 | Bacteria | 1869 |
| 45 | Ga0068853_100379103 | 3300005539 | Bacteria | 1320 |
| 46 | Ga0070672_100074527 | 3300005543 | Bacteria | 2707 |
| 47 | Ga0070672_100652043 | 3300005543 | Bacteria | 919 |
| 48 | Ga0070686_100067091 | 3300005544 | Bacteria | 2336 |
| 49 | Ga0070686_100754409 | 3300005544 | Bacteria | 781 |
| 50 | Ga0070696_100424274 | 3300005546 | Bacteria | 1045 |
| 51 | Ga0070693_100221817 | 3300005547 | Bacteria | 1239 |
| 52 | Ga0070665_100014481 | 3300005548 | Bacteria | 7909 |
| 53 | Ga0070665_100045273 | 3300005548 | Bacteria | 4419 |
| 54 | Ga0068855_100114994 | 3300005563 | Bacteria | 3084 |
| 55 | Ga0068855_100528271 | 3300005563 | Bacteria | 1279 |
| 56 | Ga0070664_100353212 | 3300005564 | Bacteria | 1338 |
| 57 | Ga0068854_100243308 | 3300005578 | Bacteria | 1434 |
| 58 | Ga0068854_100372473 | 3300005578 | Bacteria | 1175 |
| 59 | Ga0068856_100042931 | 3300005614 | Bacteria | 4449 |
| 60 | Ga0068856_100047430 | 3300005614 | Bacteria | 4231 |
| 61 | Ga0068856_100641382 | 3300005614 | Bacteria | 1083 |
| 62 | Ga0068852_100172880 | 3300005616 | Bacteria | 2026 |
| 63 | Ga0068852_101148936 | 3300005616 | Bacteria | 797 |
| 64 | Ga0068859_100000641 | 3300005617 | Bacteria | 34946 |
| 65 | Ga0068859_100092729 | 3300005617 | Bacteria | 3072 |
| 66 | Ga0068864_100090413 | 3300005618 | Bacteria | 2699 |
| 67 | Ga0068861_100099302 | 3300005719 | Bacteria | 2312 |
| 68 | Ga0068861_100116426 | 3300005719 | Bacteria | 2149 |
| 69 | Ga0068861_100330192 | 3300005719 | Bacteria | 1331 |
| 70 | Ga0068863_100008761 | 3300005841 | Bacteria | 9878 |
| 71 | Ga0068863_100083231 | 3300005841 | Bacteria | 3032 |
| 72 | Ga0068863_100154561 | 3300005841 | Bacteria | 2196 |
| 73 | Ga0068858_100000125 | 3300005842 | Bacteria | 79795 |
| 74 | Ga0068858_100004270 | 3300005842 | Bacteria | 14053 |
| 75 | Ga0068860_100006244 | 3300005843 | Bacteria | 11972 |
| 76 | Ga0068860_100009263 | 3300005843 | Bacteria | 9789 |
| 77 | Ga0068862_100065242 | 3300005844 | Bacteria | 3136 |
| 78 | Ga0068862_100246197 | 3300005844 | Bacteria | 1627 |
| 79 | Ga0068862_100657274 | 3300005844 | Bacteria | 1011 |
| 80 | Ga0081455_10210306 | 3300005937 | Bacteria | 1450 |
| 81 | Ga0081540_1048835 | 3300005983 | Bacteria | 2116 |
| 82 | Ga0070716_100442782 | 3300006173 | Bacteria | 945 |
| 83 | Ga0070712_100037323 | 3300006175 | Bacteria | 3311 |
| 84 | Ga0075367_10237684 | 3300006178 | Bacteria | 1141 |
| 85 | Ga0075366_10184479 | 3300006195 | Bacteria | 1268 |
| 86 | Ga0097621_100122525 | 3300006237 | Bacteria | 2207 |
| 87 | Ga0097621_100265847 | 3300006237 | Bacteria | 1506 |
| 88 | Ga0097621_101180105 | 3300006237 | Bacteria | 721 |
| 89 | Ga0075370_10203587 | 3300006353 | Bacteria | 1168 |
| 90 | Ga0068871_100188243 | 3300006358 | Bacteria | 1777 |
| 91 | Ga0075428_100033220 | 3300006844 | Bacteria | 5698 |
| 92 | Ga0075430_100404355 | 3300006846 | Bacteria | 1127 |
| 93 | Ga0075434_100413399 | 3300006871 | Bacteria | 1370 |
| 94 | Ga0068865_100074556 | 3300006881 | Bacteria | 2417 |
| 95 | Ga0068865_100564036 | 3300006881 | Bacteria | 958 |
| 96 | Ga0097620_100000641 | 3300006931 | Bacteria | 34946 |
| 97 | Ga0097620_100092731 | 3300006931 | Bacteria | 3072 |
| 98 | Ga0097620_100822177 | 3300006931 | Bacteria | 1016 |
| 99 | Ga0099826_10154582 | 3300006948 | Bacteria | 1308 |
| 100 | Ga0075435_100074393 | 3300007076 | Bacteria | 2779 |
| 101 | Ga0105250_10000032 | 3300009092 | Bacteria | 159642 |
| 102 | Ga0105250_10180845 | 3300009092 | Bacteria | 885 |
| 103 | Ga0105240_10065094 | 3300009093 | Bacteria | 4526 |
| 104 | Ga0105240_10075753 | 3300009093 | Bacteria | 4149 |
| 105 | Ga0105240_10112936 | 3300009093 | Bacteria | 3283 |
| 106 | Ga0105240_10280822 | 3300009093 | Bacteria | 1913 |
| 107 | Ga0105240_10281671 | 3300009093 | Bacteria | 1909 |
| 108 | Ga0105240_10541348 | 3300009093 | Bacteria | 1289 |
| 109 | Ga0105240_10541799 | 3300009093 | Bacteria | 1289 |
| 110 | Ga0105247_10002466 | 3300009101 | Bacteria | 12578 |
| 111 | Ga0105247_10025648 | 3300009101 | Bacteria | 3557 |
| 112 | Ga0114129_10219902 | 3300009147 | Bacteria | 2563 |
| 113 | Ga0105242_10313692 | 3300009176 | Bacteria | 1436 |
| 114 | Ga0105248_10005842 | 3300009177 | Bacteria | 13527 |
| 115 | Ga0105237_10096005 | 3300009545 | Bacteria | 2955 |
| 116 | Ga0105237_10114912 | 3300009545 | Bacteria | 2685 |
| 117 | Ga0105237_11490058 | 3300009545 | Bacteria | 683 |
| 118 | Ga0105238_10022279 | 3300009551 | Bacteria | 6457 |
| 119 | Ga0105238_10406256 | 3300009551 | Bacteria | 1355 |
| 120 | Ga0105249_10014582 | 3300009553 | Bacteria | 6947 |
| 121 | Ga0105249_10280371 | 3300009553 | Bacteria | 1664 |
| 122 | Ga0105239_10353874 | 3300010375 | Bacteria | 1658 |
| 123 | Ga0105246_10036204 | 3300011119 | Bacteria | 3305 |
| 124 | Ga0157370_10522491 | 3300013104 | Bacteria | 1089 |
| 125 | Ga0157369_10015323 | 3300013105 | Bacteria | 8645 |
| 126 | Ga0157369_10213528 | 3300013105 | Bacteria | 2022 |
| 127 | Ga0157369_10293856 | 3300013105 | Bacteria | 1691 |
| 128 | Ga0157374_10414545 | 3300013296 | Bacteria | 1345 |
| 129 | Ga0157374_10773641 | 3300013296 | Bacteria | 975 |
| 130 | Ga0157378_10435474 | 3300013297 | Bacteria | 1298 |
| 131 | Ga0163162_10026596 | 3300013306 | Bacteria | 5720 |
| 132 | Ga0157372_10049576 | 3300013307 | Bacteria | 4669 |
| 133 | Ga0157372_10325384 | 3300013307 | Bacteria | 1790 |
| 134 | Ga0157375_10393940 | 3300013308 | Bacteria | 1552 |
| 135 | Ga0163163_10007457 | 3300014325 | Bacteria | 9652 |
| 136 | Ga0163163_10912221 | 3300014325 | Bacteria | 942 |
| 137 | Ga0163163_11838651 | 3300014325 | Bacteria | 666 |
| 138 | Ga0157380_10597862 | 3300014326 | Bacteria | 1091 |
| 139 | Ga0157379_10000004 | 3300014968 | Bacteria | 173351 |
| 140 | Ga0157379_10082681 | 3300014968 | Bacteria | 2877 |
| 141 | Ga0157379_10104840 | 3300014968 | Bacteria | 2537 |
| 142 | Ga0157379_10246902 | 3300014968 | Bacteria | 1619 |
| 143 | Ga0157379_10267841 | 3300014968 | Bacteria | 1553 |
| 144 | Ga0157376_10213111 | 3300014969 | Bacteria | 1784 |
| 145 | Ga0163161_10075910 | 3300017792 | Bacteria | 2467 |
| 146 | Ga0206356_11640133 | 3300020070 | Bacteria | 2223 |
| 147 | Ga0213876_10032683 | 3300021384 | Bacteria | 2744 |
| 148 | Ga0224572_1011889 | 3300024225 | Bacteria | 1649 |
| 149 | Ga0207696_1000198 | 3300025711 | Bacteria | 92750 |
| 150 | Ga0207710_10009562 | 3300025900 | Bacteria | 4077 |
| 151 | Ga0207688_10066029 | 3300025901 | Bacteria | 2045 |
| 152 | Ga0207688_10144333 | 3300025901 | Bacteria | 1402 |
| 153 | Ga0207688_10222558 | 3300025901 | Bacteria | 1137 |
| 154 | Ga0207688_10560761 | 3300025901 | Bacteria | 718 |
| 155 | Ga0207680_10282085 | 3300025903 | Bacteria | 1154 |
| 156 | Ga0207685_10041008 | 3300025905 | Bacteria | 1729 |
| 157 | Ga0207699_10292789 | 3300025906 | Bacteria | 1135 |
| 158 | Ga0207643_10098940 | 3300025908 | Bacteria | 1708 |
| 159 | Ga0207705_10383730 | 3300025909 | Bacteria | 1085 |
| 160 | Ga0207705_10564609 | 3300025909 | Bacteria | 885 |
| 161 | Ga0207654_10062727 | 3300025911 | Bacteria | 2179 |
| 162 | Ga0207707_10000276 | 3300025912 | Bacteria | 55321 |
| 163 | Ga0207707_10000410 | 3300025912 | Bacteria | 44977 |
| 164 | Ga0207707_10025066 | 3300025912 | Bacteria | 5218 |
| 165 | Ga0207707_10219412 | 3300025912 | Bacteria | 1655 |
| 166 | Ga0207707_10635967 | 3300025912 | Bacteria | 900 |
| 167 | Ga0207695_10049612 | 3300025913 | Bacteria | 4423 |
| 168 | Ga0207695_10072121 | 3300025913 | Bacteria | 3525 |
| 169 | Ga0207695_10083172 | 3300025913 | Bacteria | 3234 |
| 170 | Ga0207695_10097549 | 3300025913 | Bacteria | 2940 |
| 171 | Ga0207671_10073947 | 3300025914 | Bacteria | 2546 |
| 172 | Ga0207671_10157809 | 3300025914 | Bacteria | 1756 |
| 173 | Ga0207671_10940877 | 3300025914 | Bacteria | 682 |
| 174 | Ga0207693_10082217 | 3300025915 | Bacteria | 2522 |
| 175 | Ga0207663_10292911 | 3300025916 | Bacteria | 1213 |
| 176 | Ga0207660_10002217 | 3300025917 | Bacteria | 12862 |
| 177 | Ga0207660_10941989 | 3300025917 | Bacteria | 705 |
| 178 | Ga0207657_10063277 | 3300025919 | Bacteria | 3164 |
| 179 | Ga0207649_10791599 | 3300025920 | Bacteria | 740 |
| 180 | Ga0207649_11070076 | 3300025920 | Bacteria | 636 |
| 181 | Ga0207652_10003383 | 3300025921 | Bacteria | 13178 |
| 182 | Ga0207694_10003326 | 3300025924 | Bacteria | 12785 |
| 183 | Ga0207694_10082964 | 3300025924 | Bacteria | 2520 |
| 184 | Ga0207694_10573244 | 3300025924 | Bacteria | 948 |
| 185 | Ga0207650_10016929 | 3300025925 | Bacteria | 5099 |
| 186 | Ga0207650_10018767 | 3300025925 | Bacteria | 4857 |
| 187 | Ga0207659_10122127 | 3300025926 | Bacteria | 1997 |
| 188 | Ga0207700_10860938 | 3300025928 | Bacteria | 811 |
| 189 | Ga0207700_11417027 | 3300025928 | Bacteria | 618 |
| 190 | Ga0207664_11136536 | 3300025929 | Bacteria | 698 |
| 191 | Ga0207644_10000428 | 3300025931 | Bacteria | 27319 |
| 192 | Ga0207644_10179249 | 3300025931 | Bacteria | 1659 |
| 193 | Ga0207690_10535741 | 3300025932 | Bacteria | 950 |
| 194 | Ga0207706_10064282 | 3300025933 | Bacteria | 3230 |
| 195 | Ga0207669_10108086 | 3300025937 | Bacteria | 1857 |
| 196 | Ga0207665_10317843 | 3300025939 | Bacteria | 1167 |
| 197 | Ga0207691_10104939 | 3300025940 | Bacteria | 2518 |
| 198 | Ga0207691_10247801 | 3300025940 | Bacteria | 1539 |
| 199 | Ga0207691_10816811 | 3300025940 | Bacteria | 783 |
| 200 | Ga0207711_10159847 | 3300025941 | Bacteria | 2038 |
| 201 | Ga0207711_10814954 | 3300025941 | Bacteria | 869 |
| 202 | Ga0207689_10460341 | 3300025942 | Bacteria | 1063 |
| 203 | Ga0207661_10649510 | 3300025944 | Bacteria | 969 |
| 204 | Ga0207661_11060161 | 3300025944 | Bacteria | 746 |
| 205 | Ga0207667_10008242 | 3300025949 | Bacteria | 12403 |
| 206 | Ga0207651_10461638 | 3300025960 | Bacteria | 1091 |
| 207 | Ga0207712_10030603 | 3300025961 | Bacteria | 3620 |
| 208 | Ga0207712_10274654 | 3300025961 | Bacteria | 1373 |
| 209 | Ga0207712_10281888 | 3300025961 | Bacteria | 1357 |
| 210 | Ga0207640_10325567 | 3300025981 | Bacteria | 1225 |
| 211 | Ga0207640_10419821 | 3300025981 | Bacteria | 1094 |
| 212 | Ga0207658_10041770 | 3300025986 | Bacteria | 3322 |
| 213 | Ga0207658_10175447 | 3300025986 | Bacteria | 1769 |
| 214 | Ga0207658_10575909 | 3300025986 | Bacteria | 1009 |
| 215 | Ga0207703_10001524 | 3300026035 | Bacteria | 21042 |
| 216 | Ga0207703_10019203 | 3300026035 | Bacteria | 5338 |
| 217 | Ga0207639_10851078 | 3300026041 | Bacteria | 851 |
| 218 | Ga0207678_10005556 | 3300026067 | Bacteria | 11267 |
| 219 | Ga0207678_10627444 | 3300026067 | Bacteria | 943 |
| 220 | Ga0207702_10128657 | 3300026078 | Bacteria | 2276 |
| 221 | Ga0207702_10285678 | 3300026078 | Bacteria | 1561 |
| 222 | Ga0207702_10660068 | 3300026078 | Bacteria | 1029 |
| 223 | Ga0207641_10002325 | 3300026088 | Bacteria | 17632 |
| 224 | Ga0207641_10010988 | 3300026088 | Bacteria | 7422 |
| 225 | Ga0207641_10188113 | 3300026088 | Bacteria | 1896 |
| 226 | Ga0207648_10078777 | 3300026089 | Bacteria | 2875 |
| 227 | Ga0207676_10363333 | 3300026095 | Bacteria | 1342 |
| 228 | Ga0207674_10653560 | 3300026116 | Bacteria | 1015 |
| 229 | Ga0207675_100132610 | 3300026118 | Bacteria | 2362 |
| 230 | Ga0207675_101040909 | 3300026118 | Bacteria | 837 |
| 231 | Ga0207698_10091691 | 3300026142 | Bacteria | 2488 |
| 232 | Ga0207698_10339878 | 3300026142 | Bacteria | 1414 |
| 233 | Ga0207698_10432739 | 3300026142 | Bacteria | 1266 |
| 234 | Ga0268266_10010307 | 3300028379 | Bacteria | 8174 |
| 235 | Ga0268265_10056316 | 3300028380 | Bacteria | 2990 |
| 236 | Ga0268265_10693038 | 3300028380 | Bacteria | 983 |
| 237 | Ga0268264_10000102 | 3300028381 | Bacteria | 222526 |
| 238 | Ga0268264_10011424 | 3300028381 | Bacteria | 7332 |
| 239 | Ga0265319_1002761 | 3300028563 | Bacteria | 9412 |
| 240 | Ga0265319_1074569 | 3300028563 | Bacteria | 1084 |
| 241 | Ga0265334_10001026 | 3300028573 | Bacteria | 13760 |
| 242 | Ga0265318_10000228 | 3300028577 | Bacteria | 48687 |
| 243 | Ga0265323_10039832 | 3300028653 | Unclassified | 1712 |
| 244 | Ga0265338_10016309 | 3300028800 | Bacteria | 8091 |
| 245 | Ga0265338_10145015 | 3300028800 | Bacteria | 1853 |
| 246 | Ga0307511_10000235 | 3300030521 | Bacteria | 56564 |
| 247 | Ga0307511_10056308 | 3300030521 | Bacteria | 3076 |
| 248 | Ga0265330_10004229 | 3300031235 | Bacteria | 7321 |
| 249 | Ga0265330_10027214 | 3300031235 | Bacteria | 2584 |
| 250 | Ga0265332_10001037 | 3300031238 | Bacteria | 16333 |
| 251 | Ga0265328_10002988 | 3300031239 | Bacteria | 7548 |
| 252 | Ga0265320_10004080 | 3300031240 | Bacteria | 9592 |
| 253 | Ga0265325_10005189 | 3300031241 | Bacteria | 8094 |
| 254 | Ga0265329_10001451 | 3300031242 | Bacteria | 11427 |
| 255 | Ga0265340_10013162 | 3300031247 | Bacteria | 4354 |
| 256 | Ga0265340_10020617 | 3300031247 | Bacteria | 3384 |
| 257 | Ga0265339_10002072 | 3300031249 | Bacteria | 14690 |
| 258 | Ga0265339_10006835 | 3300031249 | Bacteria | 7436 |
| 259 | Ga0265339_10014355 | 3300031249 | Bacteria | 4775 |
| 260 | Ga0265339_10055447 | 3300031249 | Bacteria | 2150 |
| 261 | Ga0265331_10004429 | 3300031250 | Bacteria | 8774 |
| 262 | Ga0265331_10149262 | 3300031250 | Bacteria | 1062 |
| 263 | Ga0265316_10013033 | 3300031344 | Bacteria | 7415 |
| 264 | Ga0307509_10000987 | 3300031507 | Bacteria | 48811 |
| 265 | Ga0307509_10002579 | 3300031507 | Bacteria | 29091 |
| 266 | Ga0307509_10717737 | 3300031507 | Bacteria | 666 |
| 267 | Ga0265313_10001786 | 3300031595 | Bacteria | 19657 |
| 268 | Ga0265313_10015631 | 3300031595 | Bacteria | 4407 |
| 269 | Ga0265313_10047129 | 3300031595 | Bacteria | 2088 |
| 270 | Ga0307508_10111635 | 3300031616 | Bacteria | 2334 |
| 271 | Ga0316575_10009147 | 3300031665 | Bacteria | 3624 |
| 272 | Ga0316575_10016662 | 3300031665 | Bacteria | 2784 |
| 273 | Ga0316575_10046954 | 3300031665 | Bacteria | 1716 |
| 274 | Ga0265314_10005233 | 3300031711 | Bacteria | 11760 |
| 275 | Ga0265342_10002379 | 3300031712 | Bacteria | 16291 |
| 276 | Ga0265342_10042409 | 3300031712 | Bacteria | 2749 |
| 277 | Ga0316576_10062578 | 3300031727 | Bacteria | 2729 |
| 278 | Ga0316578_10090796 | 3300031728 | Bacteria | 1824 |
| 279 | Ga0307516_10001316 | 3300031730 | Bacteria | 34466 |
| 280 | Ga0307405_10286534 | 3300031731 | Bacteria | 1243 |
| 281 | Ga0316577_10074627 | 3300031733 | Bacteria | 1894 |
| 282 | Ga0307413_10180497 | 3300031824 | Bacteria | 1504 |
| 283 | Ga0307413_10328642 | 3300031824 | Bacteria | 1171 |
| 284 | Ga0307413_10394482 | 3300031824 | Bacteria | 1082 |
| 285 | Ga0307410_10406316 | 3300031852 | Bacteria | 1101 |
| 286 | Ga0307406_10254266 | 3300031901 | Bacteria | 1325 |
| 287 | Ga0307406_10992102 | 3300031901 | Bacteria | 720 |
| 288 | Ga0307407_10179766 | 3300031903 | Bacteria | 1401 |
| 289 | Ga0307407_10197998 | 3300031903 | Bacteria | 1344 |
| 290 | Ga0307407_10305319 | 3300031903 | Bacteria | 1111 |
| 291 | Ga0307412_10221900 | 3300031911 | Bacteria | 1449 |
| 292 | Ga0307412_10513034 | 3300031911 | Bacteria | 1000 |
| 293 | Ga0307409_100059614 | 3300031995 | Bacteria | 2971 |
| 294 | Ga0307409_100692432 | 3300031995 | Bacteria | 1017 |
| 295 | Ga0307416_100218253 | 3300032002 | Bacteria | 1826 |
| 296 | Ga0307416_100785368 | 3300032002 | Bacteria | 1047 |
| 297 | Ga0307414_10030752 | 3300032004 | Bacteria | 3512 |
| 298 | Ga0307411_10197680 | 3300032005 | Bacteria | 1541 |
| 299 | Ga0307415_100068825 | 3300032126 | Bacteria | 2479 |
| 300 | Ga0316593_10000942 | 3300032168 | Bacteria | 5984 |
| 301 | Ga0316593_10006570 | 3300032168 | Bacteria | 3147 |
| 302 | Ga0316593_10092284 | 3300032168 | Bacteria | 1067 |
| 303 | Ga0316593_10122884 | 3300032168 | Bacteria | 933 |
| 304 | Ga0307510_10000006 | 3300033180 | Bacteria | 566474 |
| 305 | Ga0307510_10029950 | 3300033180 | Bacteria | 6180 |
| 306 | Ga0316588_1008872 | 3300033528 | Bacteria | 2083 |
| 307 | Ga0316588_1077603 | 3300033528 | Bacteria | 820 |
| 308 | Ga0316212_1005837 | 3300033547 | Bacteria | 1786 |
| 309 | Ga0373950_0000002 | 3300034818 | Bacteria | 933559 |
| 310 | Ga0373936_0035525 | 3300035113 | Bacteria | 1984 |
| 311 | Ga0373945_0139007 | 3300035116 | Bacteria | 978 |
| 312 | Ga0316574_0028762 | 3300035398 | Bacteria | 3353 |
| 313 | Ga0316574_0296695 | 3300035398 | Bacteria | 1028 |
| 314 | Ga0373927_0272861 | 3300035695 | Bacteria | 1112 |
| 315 | Ga0373933_0001189 | 3300035724 | Bacteria | 15436 |
| 316 | Ga0373947_0096165 | 3300035725 | Bacteria | 1854 |
| 317 | Ga0316582_0100593 | 3300036647 | Bacteria | 1914 |
| 318 | Ga0316582_0138952 | 3300036647 | Bacteria | 1637 |
| 319 | Ga0316584_0074846 | 3300036712 | Bacteria | 2538 |
| 320 | Ga0395898_0014841 | 3300037466 | Bacteria | 7998 |
| 321 | Ga0395898_0039994 | 3300037466 | Bacteria | 4639 |
| 322 | Ga0395898_0883534 | 3300037466 | Bacteria | 832 |
| 323 | Ga0395905_0719996 | 3300037471 | Unclassified | 900 |
| 324 | Ga0436364_0864071 | 3300037853 | Bacteria | 814 |
| 325 | Ga0395901_1080422 | 3300038443 | Bacteria | 774 |
| 326 | Ga0400489_61698 | 3300039093 | Bacteria | 1408 |
| 327 | Ga0436365_0032067 | 3300039437 | Bacteria | 3787 |
| 328 | Ga0436360_0748450 | 3300039438 | Bacteria | 934 |
| 329 | Ga0436360_0749057 | 3300039438 | Bacteria | 2001 |
| 330 | Ga0436361_0195894 | 3300039447 | Bacteria | 847 |
| 331 | Ga0436361_0555916 | 3300039447 | Bacteria | 2851 |
| 332 | Ga0436363_0193457 | 3300039450 | Bacteria | 1244 |
| 333 | Ga0436363_0411941 | 3300039450 | Bacteria | 728 |
| 334 | Ga0436363_0978720 | 3300039450 | Bacteria | 2326 |
| 335 | Ga0436362_0693496 | 3300039453 | Bacteria | 3146 |
| 336 | Ga0436362_0820035 | 3300039453 | Bacteria | 1513 |
| 337 | Ga0439439_0038579 | 3300041406 | Bacteria | 1234 |
| 338 | Ga0439447_060661 | 3300041407 | Bacteria | 890 |
| 339 | Ga0451798_0505011 | 3300041458 | Bacteria | 3411 |
| 340 | Ga0451849_1052663 | 3300041505 | Bacteria | 2153 |
| 341 | Ga0451853_2380426 | 3300041512 | Bacteria | 5326 |
| 342 | Ga0439445_0150212 | 3300042004 | Bacteria | 678 |
| 343 | Ga0439449_0100693 | 3300042007 | Bacteria | 1068 |
| 344 | Ga0451577_0008152 | 3300042876 | Bacteria | 10217 |
| 345 | Ga0453683_0005334 | 3300044673 | Bacteria | 8982 |
| 346 | Ga0466966_0015541 | 3300044684 | Bacteria | 5032 |
| 347 | Ga0466961_0517526 | 3300044693 | Bacteria | 720 |
| 348 | Ga0453684_0240033 | 3300044712 | Bacteria | 2086 |
| 349 | Ga0466959_0103445 | 3300045049 | Bacteria | 2037 |
| 350 | Ga0451576_0053177 | 3300045051 | Bacteria | 4243 |
| 351 | Ga0451576_0131416 | 3300045051 | Bacteria | 2610 |
| 352 | Ga0495603_0365063 | 3300046455 | Bacteria | 828 |
| 353 | Ga0495629_0111215 | 3300046459 | Bacteria | 1910 |
| 354 | Ga0495638_0074489 | 3300046460 | Bacteria | 2071 |
| 355 | Ga0495641_0074632 | 3300046461 | Bacteria | 1521 |
| 356 | Ga0495650_0049935 | 3300046471 | Bacteria | 1733 |
| 357 | Ga0495639_0082011 | 3300046475 | Bacteria | 1503 |
| 358 | Ga0495596_0097449 | 3300046500 | Bacteria | 1142 |
| 359 | Ga0495606_0219135 | 3300046507 | Bacteria | 1073 |
| 360 | Ga0495616_0129981 | 3300046513 | Bacteria | 1155 |
| 361 | Ga0495628_0093477 | 3300046516 | Bacteria | 2326 |
| 362 | Ga0495628_0625607 | 3300046516 | Bacteria | 767 |
| 363 | Ga0495630_0055150 | 3300046517 | Bacteria | 2978 |
| 364 | Ga0495630_0286426 | 3300046517 | Bacteria | 1259 |
| 365 | Ga0495632_0032155 | 3300046519 | Bacteria | 2706 |
| 366 | Ga0495632_0109379 | 3300046519 | Bacteria | 1299 |
| 367 | Ga0495632_0172236 | 3300046519 | Bacteria | 994 |
| 368 | Ga0495643_0036660 | 3300046522 | Bacteria | 2693 |
| 369 | Ga0495648_0038970 | 3300046524 | Bacteria | 3031 |
| 370 | Ga0495640_0113969 | 3300046533 | Bacteria | 1763 |
| 371 | Ga0495586_0010612 | 3300046535 | Bacteria | 4902 |
| 372 | Ga0495621_0084394 | 3300046539 | Bacteria | 1189 |
| 373 | Ga0495622_0117795 | 3300046557 | Bacteria | 1214 |
| 374 | Ga0495622_0125634 | 3300046557 | Bacteria | 1170 |
| 375 | Ga0495622_0127664 | 3300046557 | Bacteria | 1159 |
| 376 | Ga0495668_0105281 | 3300046616 | Bacteria | 1543 |
| 377 | Ga0495634_0164500 | 3300046642 | Bacteria | 1397 |
| 378 | Ga0495611_0019227 | 3300046648 | Bacteria | 2934 |
| 379 | Ga0495611_0344025 | 3300046648 | Bacteria | 685 |
| 380 | Ga0495635_0323485 | 3300046663 | Bacteria | 1032 |
| 381 | Ga0495658_0166619 | 3300046683 | Bacteria | 1362 |
| 382 | Ga0495669_0058634 | 3300046684 | Bacteria | 1738 |
| 383 | Ga0495624_0151369 | 3300046690 | Bacteria | 1419 |
| 384 | Ga0495604_0744895 | 3300047317 | Bacteria | 620 |
| 385 | Ga0495672_0024792 | 3300047320 | Bacteria | 3856 |
| 386 | Ga0495680_0152274 | 3300047322 | Bacteria | 1685 |
| 387 | Ga0495687_032507 | 3300047443 | Bacteria | 2380 |
| 388 | Ga0496100_0110723 | 3300048903 | Bacteria | 1907 |
| 389 | Ga0496100_0384481 | 3300048903 | Bacteria | 1066 |
| 390 | Ga0496101_0002147 | 3300048904 | Bacteria | 12041 |
| 391 | Ga0496101_0821202 | 3300048904 | Bacteria | 733 |
| 392 | Ga0496102_0003295 | 3300048905 | Bacteria | 13691 |
| 393 | Ga0496102_0045924 | 3300048905 | Bacteria | 3966 |
| 394 | Ga0496102_0199613 | 3300048905 | Bacteria | 1885 |
| 395 | Ga0496103_0040660 | 3300048906 | Bacteria | 2857 |
| 396 | Ga0496103_0323730 | 3300048906 | Bacteria | 991 |
| 397 | Ga0496104_0076607 | 3300048907 | Bacteria | 3185 |
| 398 | Ga0496105_0032509 | 3300048908 | Bacteria | 4281 |
| 399 | Ga0496106_0066543 | 3300048909 | Bacteria | 2745 |
| 400 | Ga0496108_0028937 | 3300048911 | Bacteria | 4584 |
| 401 | Ga0496108_0168503 | 3300048911 | Bacteria | 1894 |
| 402 | Ga0496109_0707816 | 3300048912 | Bacteria | 945 |
| 403 | Ga0496111_0022689 | 3300048914 | Bacteria | 4396 |
| 404 | Ga0496112_0773816 | 3300048915 | Bacteria | 885 |
| 405 | Ga0496113_0189425 | 3300048916 | Bacteria | 1633 |
| 406 | Ga0496113_0361566 | 3300048916 | Bacteria | 1164 |
| 407 | Ga0496114_0037374 | 3300048917 | Bacteria | 4015 |
| 408 | Ga0496115_0114834 | 3300048918 | Bacteria | 2213 |
| 409 | Ga0496115_0126283 | 3300048918 | Bacteria | 2107 |
| 410 | Ga0496117_0000787 | 3300048920 | Bacteria | 49745 |
| 411 | Ga0496117_0073497 | 3300048920 | Bacteria | 2281 |
| 412 | Ga0496118_0000032 | 3300048921 | Bacteria | 330072 |
| 413 | Ga0496118_0013267 | 3300048921 | Bacteria | 7811 |
| 414 | Ga0496118_0112821 | 3300048921 | Bacteria | 1798 |
| 415 | Ga0496119_0116851 | 3300048922 | Bacteria | 1471 |
| 416 | Ga0496120_0151997 | 3300048923 | Bacteria | 1162 |
| 417 | Ga0496121_0000704 | 3300048924 | Bacteria | 62218 |
| 418 | Ga0496121_0028362 | 3300048924 | Bacteria | 5213 |
| 419 | Ga0496121_0266210 | 3300048924 | Bacteria | 1180 |
| 420 | Ga0496124_0006228 | 3300048927 | Bacteria | 13069 |
| 421 | Ga0496125_0001378 | 3300048928 | Bacteria | 35674 |
| 422 | Ga0496126_0011396 | 3300048929 | Bacteria | 9209 |
| 423 | Ga0501312_051378 | 3300049528 | Bacteria | 696 |
| 424 | Ga0501317_011660 | 3300049533 | Bacteria | 1072 |
| 425 | Ga0501031_0131173 | 3300049568 | Bacteria | 1637 |
| 426 | Ga0501031_0470580 | 3300049568 | Bacteria | 811 |
| 427 | Ga0501033_0049659 | 3300049570 | Bacteria | 3114 |
| 428 | Ga0501034_0231167 | 3300049571 | Bacteria | 1798 |
| 429 | Ga0501036_0023621 | 3300049572 | Bacteria | 5181 |
| 430 | Ga0501038_0015092 | 3300049574 | Bacteria | 7031 |
| 431 | Ga0501039_0046960 | 3300049575 | Bacteria | 3337 |
| 432 | Ga0501039_0115981 | 3300049575 | Bacteria | 2096 |
| 433 | Ga0501040_0008066 | 3300049576 | Bacteria | 6839 |
| 434 | Ga0501040_0044091 | 3300049576 | Bacteria | 3040 |
| 435 | Ga0501040_0843536 | 3300049576 | Bacteria | 663 |
| 436 | Ga0501041_0001598 | 3300049577 | Bacteria | 12636 |
| 437 | Ga0501041_0120949 | 3300049577 | Bacteria | 1627 |
| 438 | Ga0501042_0001373 | 3300049578 | Bacteria | 14288 |
| 439 | Ga0501043_0299109 | 3300049579 | Bacteria | 1230 |
| 440 | Ga0501043_0513223 | 3300049579 | Unclassified | 894 |
| 441 | Ga0501046_0015243 | 3300049580 | Bacteria | 6464 |
| 442 | Ga0501046_0105554 | 3300049580 | Bacteria | 2157 |
| 443 | Ga0501046_0616236 | 3300049580 | Unclassified | 769 |
| 444 | Ga0501046_0673623 | 3300049580 | Bacteria | 730 |
| 445 | Ga0501047_0142861 | 3300049581 | Bacteria | 2271 |
| 446 | Ga0501047_0148132 | 3300049581 | Bacteria | 2224 |
| 447 | Ga0501048_0009558 | 3300049582 | Bacteria | 7281 |
| 448 | Ga0501048_0067468 | 3300049582 | Bacteria | 2528 |
| 449 | Ga0501067_0000339 | 3300049583 | Bacteria | 25485 |
| 450 | Ga0501067_0003984 | 3300049583 | Bacteria | 8152 |
| 451 | Ga0501067_0138286 | 3300049583 | Bacteria | 1356 |
| 452 | Ga0501069_0570941 | 3300049585 | Bacteria | 678 |
| 453 | Ga0501070_0044235 | 3300049586 | Bacteria | 3706 |
| 454 | Ga0501070_0913786 | 3300049586 | Bacteria | 684 |
| 455 | Ga0501071_0003527 | 3300049587 | Bacteria | 9786 |
| 456 | Ga0501071_0024289 | 3300049587 | Bacteria | 4238 |
| 457 | Ga0501071_0225613 | 3300049587 | Bacteria | 1411 |
| 458 | Ga0501072_0056705 | 3300049588 | Bacteria | 3087 |
| 459 | Ga0501072_0180820 | 3300049588 | Bacteria | 1682 |
| 460 | Ga0501073_0005323 | 3300049589 | Bacteria | 9649 |
| 461 | Ga0501073_0122379 | 3300049589 | Bacteria | 1803 |
| 462 | Ga0501074_0089815 | 3300049590 | Bacteria | 2200 |
| 463 | Ga0501075_0015597 | 3300049591 | Bacteria | 5453 |
| 464 | Ga0501075_0055471 | 3300049591 | Bacteria | 2981 |
| 465 | Ga0501075_0121563 | 3300049591 | Bacteria | 1987 |
| 466 | Ga0501075_0123618 | 3300049591 | Bacteria | 1970 |
| 467 | Ga0501075_0231797 | 3300049591 | Bacteria | 1408 |
| 468 | Ga0501075_0677634 | 3300049591 | Bacteria | 786 |
| 469 | Ga0501076_0004639 | 3300049592 | Bacteria | 9791 |
| 470 | Ga0501076_0105365 | 3300049592 | Bacteria | 2276 |
| 471 | Ga0501076_0767662 | 3300049592 | Unclassified | 795 |
| 472 | Ga0501077_0007629 | 3300049593 | Bacteria | 6677 |
| 473 | Ga0501079_0006996 | 3300049741 | Bacteria | 8503 |
| 474 | Ga0501079_0092127 | 3300049741 | Bacteria | 2348 |
| 475 | Ga0501080_0011395 | 3300049742 | Bacteria | 8144 |
| 476 | Ga0501080_0267582 | 3300049742 | Bacteria | 1556 |
| 477 | Ga0501081_0006719 | 3300049743 | Bacteria | 7480 |
| 478 | Ga0501081_0008928 | 3300049743 | Bacteria | 6514 |
| 479 | Ga0501083_0032077 | 3300049744 | Bacteria | 3604 |
| 480 | Ga0501044_0413807 | 3300049823 | Bacteria | 1259 |
| 481 | Ga0501045_0008747 | 3300049824 | Bacteria | 7062 |
| 482 | Ga0501045_0084307 | 3300049824 | Bacteria | 2344 |
| 483 | Ga0501045_0379223 | 3300049824 | Bacteria | 1053 |
| 484 | nmdc:mga0k408_368872_c1 | 3300050493 | Bacteria | 855 |
| 485 | nmdc:mga06z11_238965_c1 | 3300050494 | Bacteria | 1066 |
| 486 | nmdc:mga0qj67_363598_c1 | 3300050509 | Bacteria | 1169 |
| 487 | nmdc:mga0rr50_62474_c1 | 3300050513 | Bacteria | 2810 |
| 488 | Ga0500635_0222521 | 3300053080 | Bacteria | 737 |
| 489 | Ga0500651_0148876 | 3300053093 | Bacteria | 1406 |
| 490 | Ga0500566_0238314 | 3300053094 | Bacteria | 893 |
| 491 | Ga0500650_0293500 | 3300053098 | Bacteria | 721 |
| 492 | Ga0500572_016818 | 3300053111 | Bacteria | 1870 |
| 493 | Ga0500614_025617 | 3300053123 | Bacteria | 1404 |
| 494 | Ga0500617_018488 | 3300053124 | Bacteria | 3036 |
| 495 | Ga0500642_0084229 | 3300053130 | Bacteria | 1464 |
| 496 | Ga0500652_019170 | 3300053131 | Bacteria | 2537 |
| 497 | Ga0500652_095300 | 3300053131 | Bacteria | 1243 |
| 498 | Ga0500658_0128002 | 3300053134 | Bacteria | 1130 |
| 499 | Ga0500658_0193123 | 3300053134 | Bacteria | 930 |
| 500 | Ga0500559_0055356 | 3300053136 | Bacteria | 1759 |
| 501 | Ga0500559_0057739 | 3300053136 | Bacteria | 1725 |
| 502 | Ga0500568_0112591 | 3300053139 | Bacteria | 1016 |
| 503 | Ga0500573_0114831 | 3300053140 | Bacteria | 1504 |
| 504 | Ga0500588_0005313 | 3300053146 | Bacteria | 2854 |
| 505 | Ga0500588_0037688 | 3300053146 | Bacteria | 1437 |
| 506 | Ga0500590_096636 | 3300053148 | Bacteria | 1425 |
| 507 | Ga0500616_0007626 | 3300053153 | Bacteria | 6839 |
| 508 | Ga0500622_0003284 | 3300053156 | Bacteria | 10962 |
| 509 | Ga0500622_0011657 | 3300053156 | Bacteria | 4781 |
| 510 | Ga0500622_0042597 | 3300053156 | Bacteria | 2357 |
| 511 | Ga0500636_0193827 | 3300053177 | Bacteria | 1080 |
| 512 | Ga0500637_0007794 | 3300053178 | Bacteria | 5375 |
| 513 | Ga0501084_0008704 | 3300054114 | Bacteria | 8394 |
| 514 | Ga0590074_015695 | 3300059423 | Bacteria | 1287 |
| 515 | Ga0587092_066261 | 3300059512 | Bacteria | 686 |
| 516 | Ga0587109_008544 | 3300059624 | Bacteria | 1584 |
| 517 | Ga0587071_031143 | 3300060344 | Bacteria | 1028 |
| 518 | Ga0587111_0105172 | 3300060346 | Bacteria | 708 |
| 519 | Ga0501082_0004231 | 3300060353 | Bacteria | 12537 |
| 520 | Ga0501082_0087089 | 3300060353 | Bacteria | 2694 |
| 521 | Ga0530510_0007174 | 3300061734 | Bacteria | 7756 |
| 522 | Ga0530510_0027258 | 3300061734 | Bacteria | 4094 |
| 523 | Ga0530510_0127298 | 3300061734 | Bacteria | 1873 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300047317 | Ga0495604_0744895 | Ga0495604_0744895_58_609 | 176 |
| 2 | 3300037471 | Ga0395905_0719996 | Ga0395905_0719996_331_864 | 177 |
| 3 | 3300005329 | Ga0070683_100723099 | Ga0070683_1007230991 | 178 |
| 4 | 3300005336 | Ga0070680_101216574 | Ga0070680_1012165741 | 178 |
| 5 | 3300005435 | Ga0070714_101040980 | Ga0070714_1010409801 | 178 |
| 6 | 3300005458 | Ga0070681_10008976 | Ga0070681_1000897611 | 178 |
| 7 | 3300005535 | Ga0070684_100189942 | Ga0070684_1001899423 | 178 |
| 8 | 3300005544 | Ga0070686_100754409 | Ga0070686_1007544091 | 178 |
| 9 | 3300005614 | Ga0068856_100641382 | Ga0068856_1006413822 | 178 |
| 10 | 3300005719 | Ga0068861_100099302 | Ga0068861_1000993024 | 178 |
| 11 | 3300005719 | Ga0068861_100330192 | Ga0068861_1003301922 | 178 |
| 12 | 3300006173 | Ga0070716_100442782 | Ga0070716_1004427822 | 178 |
| 13 | 3300006175 | Ga0070712_100037323 | Ga0070712_1000373234 | 178 |
| 14 | 3300009551 | Ga0105238_10406256 | Ga0105238_104062562 | 178 |
| 15 | 3300010375 | Ga0105239_10353874 | Ga0105239_103538742 | 178 |
| 16 | 3300014325 | Ga0163163_11838651 | Ga0163163_118386512 | 178 |
| 17 | 3300025901 | Ga0207688_10222558 | Ga0207688_102225582 | 178 |
| 18 | 3300025905 | Ga0207685_10041008 | Ga0207685_100410082 | 178 |
| 19 | 3300025906 | Ga0207699_10292789 | Ga0207699_102927893 | 178 |
| 20 | 3300025915 | Ga0207693_10082217 | Ga0207693_100822174 | 178 |
| 21 | 3300025917 | Ga0207660_10941989 | Ga0207660_109419891 | 178 |
| 22 | 3300025920 | Ga0207649_11070076 | Ga0207649_110700761 | 178 |
| 23 | 3300025924 | Ga0207694_10082964 | Ga0207694_100829646 | 178 |
| 24 | 3300025928 | Ga0207700_11417027 | Ga0207700_114170271 | 178 |
| 25 | 3300025929 | Ga0207664_11136536 | Ga0207664_111365362 | 178 |
| 26 | 3300025939 | Ga0207665_10317843 | Ga0207665_103178432 | 178 |
| 27 | 3300025944 | Ga0207661_10649510 | Ga0207661_106495101 | 178 |
| 28 | 3300025961 | Ga0207712_10030603 | Ga0207712_100306038 | 178 |
| 29 | 3300025961 | Ga0207712_10281888 | Ga0207712_102818883 | 178 |
| 30 | 3300026078 | Ga0207702_10660068 | Ga0207702_106600682 | 178 |
| 31 | 3300048903 | Ga0496100_0384481 | Ga0496100_0384481_254_817 | 178 |
| 32 | 3300048904 | Ga0496101_0002147 | Ga0496101_0002147_5570_6133 | 178 |
| 33 | 3300048905 | Ga0496102_0045924 | Ga0496102_0045924_1716_2279 | 178 |
| 34 | 3300048906 | Ga0496103_0323730 | Ga0496103_0323730_387_950 | 178 |
| 35 | 3300048907 | Ga0496104_0076607 | Ga0496104_0076607_1610_2173 | 178 |
| 36 | 3300048908 | Ga0496105_0032509 | Ga0496105_0032509_2871_3434 | 178 |
| 37 | 3300048911 | Ga0496108_0028937 | Ga0496108_0028937_2934_3497 | 178 |
| 38 | 3300048914 | Ga0496111_0022689 | Ga0496111_0022689_3281_3844 | 178 |
| 39 | 3300048916 | Ga0496113_0361566 | Ga0496113_0361566_230_793 | 178 |
| 40 | 3300048917 | Ga0496114_0037374 | Ga0496114_0037374_2066_2629 | 178 |
| 41 | 3300048918 | Ga0496115_0114834 | Ga0496115_0114834_1003_1566 | 178 |
| 42 | 2162886007 | SwRhRL2b_contig_2458830 | SwRhRL2b_0662.00000670 | 179 |
| 43 | 2162886007 | SwRhRL2b_contig_305464 | SwRhRL2b_0013.00005780 | 179 |
| 44 | 3300002868 | Ga0006767J43181_103125 | Ga0006767J43181_10312512 | 179 |
| 45 | 3300002870 | Ga0006763J43179_104103 | Ga0006763J43179_10410312 | 179 |
| 46 | 3300002872 | Ga0006762J43184_103419 | Ga0006762J43184_10341911 | 179 |
| 47 | 3300003158 | Ga0006760J45825_103550 | Ga0006760J45825_1035503 | 179 |
| 48 | 3300003163 | Ga0006759J45824_1006649 | Ga0006759J45824_100664914 | 179 |
| 49 | 3300003320 | rootH2_10070226 | rootH2_100702264 | 179 |
| 50 | 3300003323 | rootH1_10162592 | rootH1_101625922 | 179 |
| 51 | 3300003693 | Ga0032354_1009872 | Ga0032354_100987213 | 179 |
| 52 | 3300005289 | Ga0065704_10070877 | Ga0065704_1007087714 | 179 |
| 53 | 3300005290 | Ga0065712_10355908 | Ga0065712_103559082 | 179 |
| 54 | 3300005293 | Ga0065715_10177021 | Ga0065715_101770213 | 179 |
| 55 | 3300005295 | Ga0065707_10001618 | Ga0065707_1000161810 | 179 |
| 56 | 3300005331 | Ga0070670_100472611 | Ga0070670_1004726112 | 179 |
| 57 | 3300005336 | Ga0070680_100289777 | Ga0070680_1002897773 | 179 |
| 58 | 3300005341 | Ga0070691_10236249 | Ga0070691_102362492 | 179 |
| 59 | 3300005353 | Ga0070669_100006485 | Ga0070669_1000064853 | 179 |
| 60 | 3300005354 | Ga0070675_100058025 | Ga0070675_1000580254 | 179 |
| 61 | 3300005355 | Ga0070671_100005400 | Ga0070671_10000540014 | 179 |
| 62 | 3300005355 | Ga0070671_100043910 | Ga0070671_1000439107 | 179 |
| 63 | 3300005355 | Ga0070671_100263170 | Ga0070671_1002631702 | 179 |
| 64 | 3300005356 | Ga0070674_100034590 | Ga0070674_1000345903 | 179 |
| 65 | 3300005364 | Ga0070673_100819890 | Ga0070673_1008198901 | 179 |
| 66 | 3300005367 | Ga0070667_100055472 | Ga0070667_1000554721 | 179 |
| 67 | 3300005367 | Ga0070667_100412400 | Ga0070667_1004124003 | 179 |
| 68 | 3300005439 | Ga0070711_101221085 | Ga0070711_1012210851 | 179 |
| 69 | 3300005455 | Ga0070663_100098843 | Ga0070663_1000988436 | 179 |
| 70 | 3300005456 | Ga0070678_100732694 | Ga0070678_1007326942 | 179 |
| 71 | 3300005458 | Ga0070681_10035786 | Ga0070681_100357866 | 179 |
| 72 | 3300005458 | Ga0070681_10048581 | Ga0070681_100485819 | 179 |
| 73 | 3300005458 | Ga0070681_10124955 | Ga0070681_101249555 | 179 |
| 74 | 3300005458 | Ga0070681_10167503 | Ga0070681_101675033 | 179 |
| 75 | 3300005458 | Ga0070681_10400701 | Ga0070681_104007011 | 179 |
| 76 | 3300005459 | Ga0068867_100125039 | Ga0068867_1001250393 | 179 |
| 77 | 3300005467 | Ga0070706_100382449 | Ga0070706_1003824493 | 179 |
| 78 | 3300005530 | Ga0070679_100063584 | Ga0070679_1000635849 | 179 |
| 79 | 3300005530 | Ga0070679_100281248 | Ga0070679_1002812484 | 179 |
| 80 | 3300005530 | Ga0070679_100419599 | Ga0070679_1004195991 | 179 |
| 81 | 3300005539 | Ga0068853_100379103 | Ga0068853_1003791032 | 179 |
| 82 | 3300005543 | Ga0070672_100074527 | Ga0070672_1000745271 | 179 |
| 83 | 3300005543 | Ga0070672_100652043 | Ga0070672_1006520432 | 179 |
| 84 | 3300005544 | Ga0070686_100067091 | Ga0070686_1000670911 | 179 |
| 85 | 3300005546 | Ga0070696_100424274 | Ga0070696_1004242742 | 179 |
| 86 | 3300005547 | Ga0070693_100221817 | Ga0070693_1002218171 | 179 |
| 87 | 3300005548 | Ga0070665_100014481 | Ga0070665_10001448112 | 179 |
| 88 | 3300005548 | Ga0070665_100045273 | Ga0070665_1000452739 | 179 |
| 89 | 3300005563 | Ga0068855_100114994 | Ga0068855_1001149944 | 179 |
| 90 | 3300005563 | Ga0068855_100528271 | Ga0068855_1005282713 | 179 |
| 91 | 3300005564 | Ga0070664_100353212 | Ga0070664_1003532122 | 179 |
| 92 | 3300005578 | Ga0068854_100243308 | Ga0068854_1002433083 | 179 |
| 93 | 3300005578 | Ga0068854_100372473 | Ga0068854_1003724731 | 179 |
| 94 | 3300005614 | Ga0068856_100042931 | Ga0068856_1000429313 | 179 |
| 95 | 3300005614 | Ga0068856_100047430 | Ga0068856_1000474304 | 179 |
| 96 | 3300005616 | Ga0068852_100172880 | Ga0068852_1001728804 | 179 |
| 97 | 3300005616 | Ga0068852_101148936 | Ga0068852_1011489361 | 179 |
| 98 | 3300005617 | Ga0068859_100000641 | Ga0068859_10000064115 | 179 |
| 99 | 3300005617 | Ga0068859_100092729 | Ga0068859_1000927292 | 179 |
| 100 | 3300005618 | Ga0068864_100090413 | Ga0068864_1000904132 | 179 |
| 101 | 3300005719 | Ga0068861_100116426 | Ga0068861_1001164263 | 179 |
| 102 | 3300005841 | Ga0068863_100008761 | Ga0068863_10000876110 | 179 |
| 103 | 3300005841 | Ga0068863_100083231 | Ga0068863_1000832316 | 179 |
| 104 | 3300005841 | Ga0068863_100154561 | Ga0068863_1001545613 | 179 |
| 105 | 3300005842 | Ga0068858_100000125 | Ga0068858_10000012547 | 179 |
| 106 | 3300005842 | Ga0068858_100004270 | Ga0068858_10000427013 | 179 |
| 107 | 3300005843 | Ga0068860_100006244 | Ga0068860_1000062447 | 179 |
| 108 | 3300005843 | Ga0068860_100009263 | Ga0068860_10000926316 | 179 |
| 109 | 3300005844 | Ga0068862_100065242 | Ga0068862_1000652423 | 179 |
| 110 | 3300005844 | Ga0068862_100246197 | Ga0068862_1002461972 | 179 |
| 111 | 3300005844 | Ga0068862_100657274 | Ga0068862_1006572742 | 179 |
| 112 | 3300005937 | Ga0081455_10210306 | Ga0081455_102103063 | 179 |
| 113 | 3300005983 | Ga0081540_1048835 | Ga0081540_10488353 | 179 |
| 114 | 3300006178 | Ga0075367_10237684 | Ga0075367_102376842 | 179 |
| 115 | 3300006195 | Ga0075366_10184479 | Ga0075366_101844792 | 179 |
| 116 | 3300006237 | Ga0097621_100122525 | Ga0097621_1001225254 | 179 |
| 117 | 3300006237 | Ga0097621_100265847 | Ga0097621_1002658473 | 179 |
| 118 | 3300006237 | Ga0097621_101180105 | Ga0097621_1011801052 | 179 |
| 119 | 3300006353 | Ga0075370_10203587 | Ga0075370_102035872 | 179 |
| 120 | 3300006358 | Ga0068871_100188243 | Ga0068871_1001882434 | 179 |
| 121 | 3300006844 | Ga0075428_100033220 | Ga0075428_1000332209 | 179 |
| 122 | 3300006846 | Ga0075430_100404355 | Ga0075430_1004043551 | 179 |
| 123 | 3300006871 | Ga0075434_100413399 | Ga0075434_1004133993 | 179 |
| 124 | 3300006881 | Ga0068865_100074556 | Ga0068865_1000745566 | 179 |
| 125 | 3300006881 | Ga0068865_100564036 | Ga0068865_1005640362 | 179 |
| 126 | 3300006931 | Ga0097620_100000641 | Ga0097620_10000064115 | 179 |
| 127 | 3300006931 | Ga0097620_100092731 | Ga0097620_1000927312 | 179 |
| 128 | 3300006931 | Ga0097620_100822177 | Ga0097620_1008221773 | 179 |
| 129 | 3300006948 | Ga0099826_10154582 | Ga0099826_101545823 | 179 |
| 130 | 3300007076 | Ga0075435_100074393 | Ga0075435_1000743933 | 179 |
| 131 | 3300009092 | Ga0105250_10000032 | Ga0105250_1000003217 | 179 |
| 132 | 3300009092 | Ga0105250_10180845 | Ga0105250_101808452 | 179 |
| 133 | 3300009093 | Ga0105240_10065094 | Ga0105240_100650949 | 179 |
| 134 | 3300009093 | Ga0105240_10075753 | Ga0105240_100757533 | 179 |
| 135 | 3300009093 | Ga0105240_10112936 | Ga0105240_101129367 | 179 |
| 136 | 3300009093 | Ga0105240_10280822 | Ga0105240_102808223 | 179 |
| 137 | 3300009093 | Ga0105240_10281671 | Ga0105240_102816712 | 179 |
| 138 | 3300009093 | Ga0105240_10541348 | Ga0105240_105413481 | 179 |
| 139 | 3300009093 | Ga0105240_10541799 | Ga0105240_105417991 | 179 |
| 140 | 3300009101 | Ga0105247_10002466 | Ga0105247_1000246615 | 179 |
| 141 | 3300009101 | Ga0105247_10025648 | Ga0105247_100256484 | 179 |
| 142 | 3300009147 | Ga0114129_10219902 | Ga0114129_102199021 | 179 |
| 143 | 3300009176 | Ga0105242_10313692 | Ga0105242_103136922 | 179 |
| 144 | 3300009177 | Ga0105248_10005842 | Ga0105248_1000584213 | 179 |
| 145 | 3300009545 | Ga0105237_10096005 | Ga0105237_100960054 | 179 |
| 146 | 3300009545 | Ga0105237_10114912 | Ga0105237_101149124 | 179 |
| 147 | 3300009545 | Ga0105237_11490058 | Ga0105237_114900581 | 179 |
| 148 | 3300009551 | Ga0105238_10022279 | Ga0105238_100222792 | 179 |
| 149 | 3300009553 | Ga0105249_10014582 | Ga0105249_1001458212 | 179 |
| 150 | 3300009553 | Ga0105249_10280371 | Ga0105249_102803711 | 179 |
| 151 | 3300011119 | Ga0105246_10036204 | Ga0105246_100362042 | 179 |
| 152 | 3300013104 | Ga0157370_10522491 | Ga0157370_105224912 | 179 |
| 153 | 3300013105 | Ga0157369_10015323 | Ga0157369_100153236 | 179 |
| 154 | 3300013105 | Ga0157369_10213528 | Ga0157369_102135283 | 179 |
| 155 | 3300013105 | Ga0157369_10293856 | Ga0157369_102938563 | 179 |
| 156 | 3300013296 | Ga0157374_10414545 | Ga0157374_104145453 | 179 |
| 157 | 3300013296 | Ga0157374_10773641 | Ga0157374_107736412 | 179 |
| 158 | 3300013297 | Ga0157378_10435474 | Ga0157378_104354743 | 179 |
| 159 | 3300013306 | Ga0163162_10026596 | Ga0163162_100265969 | 179 |
| 160 | 3300013307 | Ga0157372_10049576 | Ga0157372_100495765 | 179 |
| 161 | 3300013307 | Ga0157372_10325384 | Ga0157372_103253844 | 179 |
| 162 | 3300013308 | Ga0157375_10393940 | Ga0157375_103939402 | 179 |
| 163 | 3300014325 | Ga0163163_10007457 | Ga0163163_1000745710 | 179 |
| 164 | 3300014325 | Ga0163163_10912221 | Ga0163163_109122212 | 179 |
| 165 | 3300014326 | Ga0157380_10597862 | Ga0157380_105978623 | 179 |
| 166 | 3300014968 | Ga0157379_10000004 | Ga0157379_10000004153 | 179 |
| 167 | 3300014968 | Ga0157379_10082681 | Ga0157379_100826813 | 179 |
| 168 | 3300014968 | Ga0157379_10104840 | Ga0157379_101048401 | 179 |
| 169 | 3300014968 | Ga0157379_10246902 | Ga0157379_102469024 | 179 |
| 170 | 3300014968 | Ga0157379_10267841 | Ga0157379_102678413 | 179 |
| 171 | 3300014969 | Ga0157376_10213111 | Ga0157376_102131112 | 179 |
| 172 | 3300017792 | Ga0163161_10075910 | Ga0163161_100759101 | 179 |
| 173 | 3300020070 | Ga0206356_11640133 | Ga0206356_116401334 | 179 |
| 174 | 3300021384 | Ga0213876_10032683 | Ga0213876_100326836 | 179 |
| 175 | 3300024225 | Ga0224572_1011889 | Ga0224572_10118893 | 179 |
| 176 | 3300025711 | Ga0207696_1000198 | Ga0207696_100019879 | 179 |
| 177 | 3300025900 | Ga0207710_10009562 | Ga0207710_100095629 | 179 |
| 178 | 3300025901 | Ga0207688_10066029 | Ga0207688_100660293 | 179 |
| 179 | 3300025901 | Ga0207688_10144333 | Ga0207688_101443333 | 179 |
| 180 | 3300025901 | Ga0207688_10560761 | Ga0207688_105607611 | 179 |
| 181 | 3300025903 | Ga0207680_10282085 | Ga0207680_102820852 | 179 |
| 182 | 3300025908 | Ga0207643_10098940 | Ga0207643_100989402 | 179 |
| 183 | 3300025909 | Ga0207705_10383730 | Ga0207705_103837302 | 179 |
| 184 | 3300025909 | Ga0207705_10564609 | Ga0207705_105646091 | 179 |
| 185 | 3300025911 | Ga0207654_10062727 | Ga0207654_100627274 | 179 |
| 186 | 3300025912 | Ga0207707_10000276 | Ga0207707_1000027627 | 179 |
| 187 | 3300025912 | Ga0207707_10000410 | Ga0207707_1000041036 | 179 |
| 188 | 3300025912 | Ga0207707_10025066 | Ga0207707_100250666 | 179 |
| 189 | 3300025912 | Ga0207707_10219412 | Ga0207707_102194123 | 179 |
| 190 | 3300025912 | Ga0207707_10635967 | Ga0207707_106359672 | 179 |
| 191 | 3300025913 | Ga0207695_10049612 | Ga0207695_100496124 | 179 |
| 192 | 3300025913 | Ga0207695_10072121 | Ga0207695_100721215 | 179 |
| 193 | 3300025913 | Ga0207695_10083172 | Ga0207695_100831727 | 179 |
| 194 | 3300025913 | Ga0207695_10097549 | Ga0207695_100975495 | 179 |
| 195 | 3300025914 | Ga0207671_10073947 | Ga0207671_100739472 | 179 |
| 196 | 3300025914 | Ga0207671_10157809 | Ga0207671_101578094 | 179 |
| 197 | 3300025914 | Ga0207671_10940877 | Ga0207671_109408771 | 179 |
| 198 | 3300025916 | Ga0207663_10292911 | Ga0207663_102929113 | 179 |
| 199 | 3300025917 | Ga0207660_10002217 | Ga0207660_100022171 | 179 |
| 200 | 3300025919 | Ga0207657_10063277 | Ga0207657_100632771 | 179 |
| 201 | 3300025920 | Ga0207649_10791599 | Ga0207649_107915992 | 179 |
| 202 | 3300025921 | Ga0207652_10003383 | Ga0207652_1000338315 | 179 |
| 203 | 3300025924 | Ga0207694_10003326 | Ga0207694_1000332613 | 179 |
| 204 | 3300025924 | Ga0207694_10573244 | Ga0207694_105732442 | 179 |
| 205 | 3300025925 | Ga0207650_10016929 | Ga0207650_100169296 | 179 |
| 206 | 3300025925 | Ga0207650_10018767 | Ga0207650_100187673 | 179 |
| 207 | 3300025926 | Ga0207659_10122127 | Ga0207659_101221274 | 179 |
| 208 | 3300025928 | Ga0207700_10860938 | Ga0207700_108609382 | 179 |
| 209 | 3300025931 | Ga0207644_10000428 | Ga0207644_1000042819 | 179 |
| 210 | 3300025931 | Ga0207644_10179249 | Ga0207644_101792493 | 179 |
| 211 | 3300025932 | Ga0207690_10535741 | Ga0207690_105357411 | 179 |
| 212 | 3300025933 | Ga0207706_10064282 | Ga0207706_100642823 | 179 |
| 213 | 3300025937 | Ga0207669_10108086 | Ga0207669_101080864 | 179 |
| 214 | 3300025940 | Ga0207691_10104939 | Ga0207691_101049394 | 179 |
| 215 | 3300025940 | Ga0207691_10247801 | Ga0207691_102478013 | 179 |
| 216 | 3300025940 | Ga0207691_10816811 | Ga0207691_108168112 | 179 |
| 217 | 3300025941 | Ga0207711_10159847 | Ga0207711_101598473 | 179 |
| 218 | 3300025941 | Ga0207711_10814954 | Ga0207711_108149542 | 179 |
| 219 | 3300025942 | Ga0207689_10460341 | Ga0207689_104603411 | 179 |
| 220 | 3300025944 | Ga0207661_11060161 | Ga0207661_110601612 | 179 |
| 221 | 3300025949 | Ga0207667_10008242 | Ga0207667_1000824215 | 179 |
| 222 | 3300025960 | Ga0207651_10461638 | Ga0207651_104616383 | 179 |
| 223 | 3300025961 | Ga0207712_10274654 | Ga0207712_102746543 | 179 |
| 224 | 3300025981 | Ga0207640_10325567 | Ga0207640_103255672 | 179 |
| 225 | 3300025981 | Ga0207640_10419821 | Ga0207640_104198213 | 179 |
| 226 | 3300025986 | Ga0207658_10041770 | Ga0207658_100417708 | 179 |
| 227 | 3300025986 | Ga0207658_10175447 | Ga0207658_101754474 | 179 |
| 228 | 3300025986 | Ga0207658_10575909 | Ga0207658_105759093 | 179 |
| 229 | 3300026035 | Ga0207703_10001524 | Ga0207703_1000152420 | 179 |
| 230 | 3300026035 | Ga0207703_10019203 | Ga0207703_100192037 | 179 |
| 231 | 3300026041 | Ga0207639_10851078 | Ga0207639_108510782 | 179 |
| 232 | 3300026067 | Ga0207678_10005556 | Ga0207678_100055566 | 179 |
| 233 | 3300026067 | Ga0207678_10627444 | Ga0207678_106274442 | 179 |
| 234 | 3300026078 | Ga0207702_10128657 | Ga0207702_101286576 | 179 |
| 235 | 3300026078 | Ga0207702_10285678 | Ga0207702_102856783 | 179 |
| 236 | 3300026088 | Ga0207641_10002325 | Ga0207641_1000232515 | 179 |
| 237 | 3300026088 | Ga0207641_10010988 | Ga0207641_100109888 | 179 |
| 238 | 3300026088 | Ga0207641_10188113 | Ga0207641_101881134 | 179 |
| 239 | 3300026089 | Ga0207648_10078777 | Ga0207648_100787776 | 179 |
| 240 | 3300026095 | Ga0207676_10363333 | Ga0207676_103633332 | 179 |
| 241 | 3300026116 | Ga0207674_10653560 | Ga0207674_106535601 | 179 |
| 242 | 3300026118 | Ga0207675_100132610 | Ga0207675_1001326104 | 179 |
| 243 | 3300026118 | Ga0207675_101040909 | Ga0207675_1010409092 | 179 |
| 244 | 3300026142 | Ga0207698_10091691 | Ga0207698_100916913 | 179 |
| 245 | 3300026142 | Ga0207698_10339878 | Ga0207698_103398783 | 179 |
| 246 | 3300026142 | Ga0207698_10432739 | Ga0207698_104327392 | 179 |
| 247 | 3300028379 | Ga0268266_10010307 | Ga0268266_100103073 | 179 |
| 248 | 3300028380 | Ga0268265_10056316 | Ga0268265_100563167 | 179 |
| 249 | 3300028380 | Ga0268265_10693038 | Ga0268265_106930382 | 179 |
| 250 | 3300028381 | Ga0268264_10000102 | Ga0268264_1000010215 | 179 |
| 251 | 3300028381 | Ga0268264_10011424 | Ga0268264_100114243 | 179 |
| 252 | 3300028563 | Ga0265319_1002761 | Ga0265319_10027619 | 179 |
| 253 | 3300028563 | Ga0265319_1074569 | Ga0265319_10745691 | 179 |
| 254 | 3300028573 | Ga0265334_10001026 | Ga0265334_1000102615 | 179 |
| 255 | 3300028577 | Ga0265318_10000228 | Ga0265318_1000022829 | 179 |
| 256 | 3300028653 | Ga0265323_10039832 | Ga0265323_100398322 | 179 |
| 257 | 3300028800 | Ga0265338_10016309 | Ga0265338_1001630913 | 179 |
| 258 | 3300028800 | Ga0265338_10145015 | Ga0265338_101450154 | 179 |
| 259 | 3300030521 | Ga0307511_10000235 | Ga0307511_1000023550 | 179 |
| 260 | 3300030521 | Ga0307511_10056308 | Ga0307511_100563086 | 179 |
| 261 | 3300031235 | Ga0265330_10004229 | Ga0265330_100042299 | 179 |
| 262 | 3300031235 | Ga0265330_10027214 | Ga0265330_100272144 | 179 |
| 263 | 3300031238 | Ga0265332_10001037 | Ga0265332_1000103717 | 179 |
| 264 | 3300031239 | Ga0265328_10002988 | Ga0265328_1000298810 | 179 |
| 265 | 3300031240 | Ga0265320_10004080 | Ga0265320_1000408013 | 179 |
| 266 | 3300031241 | Ga0265325_10005189 | Ga0265325_1000518912 | 179 |
| 267 | 3300031242 | Ga0265329_10001451 | Ga0265329_100014517 | 179 |
| 268 | 3300031247 | Ga0265340_10013162 | Ga0265340_100131622 | 179 |
| 269 | 3300031247 | Ga0265340_10020617 | Ga0265340_100206175 | 179 |
| 270 | 3300031249 | Ga0265339_10002072 | Ga0265339_1000207223 | 179 |
| 271 | 3300031249 | Ga0265339_10006835 | Ga0265339_100068354 | 179 |
| 272 | 3300031249 | Ga0265339_10014355 | Ga0265339_100143551 | 179 |
| 273 | 3300031249 | Ga0265339_10055447 | Ga0265339_100554476 | 179 |
| 274 | 3300031250 | Ga0265331_10004429 | Ga0265331_1000442910 | 179 |
| 275 | 3300031250 | Ga0265331_10149262 | Ga0265331_101492621 | 179 |
| 276 | 3300031344 | Ga0265316_10013033 | Ga0265316_1001303313 | 179 |
| 277 | 3300031507 | Ga0307509_10000987 | Ga0307509_1000098744 | 179 |
| 278 | 3300031507 | Ga0307509_10002579 | Ga0307509_1000257915 | 179 |
| 279 | 3300031507 | Ga0307509_10717737 | Ga0307509_107177371 | 179 |
| 280 | 3300031595 | Ga0265313_10001786 | Ga0265313_1000178613 | 179 |
| 281 | 3300031595 | Ga0265313_10015631 | Ga0265313_100156316 | 179 |
| 282 | 3300031595 | Ga0265313_10047129 | Ga0265313_100471294 | 179 |
| 283 | 3300031616 | Ga0307508_10111635 | Ga0307508_101116353 | 179 |
| 284 | 3300031665 | Ga0316575_10009147 | Ga0316575_100091476 | 179 |
| 285 | 3300031665 | Ga0316575_10016662 | Ga0316575_100166623 | 179 |
| 286 | 3300031665 | Ga0316575_10046954 | Ga0316575_100469542 | 179 |
| 287 | 3300031711 | Ga0265314_10005233 | Ga0265314_1000523311 | 179 |
| 288 | 3300031712 | Ga0265342_10002379 | Ga0265342_1000237916 | 179 |
| 289 | 3300031712 | Ga0265342_10042409 | Ga0265342_100424095 | 179 |
| 290 | 3300031727 | Ga0316576_10062578 | Ga0316576_100625785 | 179 |
| 291 | 3300031728 | Ga0316578_10090796 | Ga0316578_100907962 | 179 |
| 292 | 3300031730 | Ga0307516_10001316 | Ga0307516_1000131632 | 179 |
| 293 | 3300031731 | Ga0307405_10286534 | Ga0307405_102865342 | 179 |
| 294 | 3300031733 | Ga0316577_10074627 | Ga0316577_100746271 | 179 |
| 295 | 3300031824 | Ga0307413_10180497 | Ga0307413_101804973 | 179 |
| 296 | 3300031824 | Ga0307413_10328642 | Ga0307413_103286421 | 179 |
| 297 | 3300031824 | Ga0307413_10394482 | Ga0307413_103944821 | 179 |
| 298 | 3300031852 | Ga0307410_10406316 | Ga0307410_104063162 | 179 |
| 299 | 3300031901 | Ga0307406_10254266 | Ga0307406_102542663 | 179 |
| 300 | 3300031901 | Ga0307406_10992102 | Ga0307406_109921022 | 179 |
| 301 | 3300031903 | Ga0307407_10179766 | Ga0307407_101797663 | 179 |
| 302 | 3300031903 | Ga0307407_10197998 | Ga0307407_101979982 | 179 |
| 303 | 3300031903 | Ga0307407_10305319 | Ga0307407_103053192 | 179 |
| 304 | 3300031911 | Ga0307412_10221900 | Ga0307412_102219002 | 179 |
| 305 | 3300031911 | Ga0307412_10513034 | Ga0307412_105130342 | 179 |
| 306 | 3300031995 | Ga0307409_100059614 | Ga0307409_1000596145 | 179 |
| 307 | 3300031995 | Ga0307409_100692432 | Ga0307409_1006924322 | 179 |
| 308 | 3300032002 | Ga0307416_100218253 | Ga0307416_1002182533 | 179 |
| 309 | 3300032002 | Ga0307416_100785368 | Ga0307416_1007853682 | 179 |
| 310 | 3300032004 | Ga0307414_10030752 | Ga0307414_100307521 | 179 |
| 311 | 3300032005 | Ga0307411_10197680 | Ga0307411_101976803 | 179 |
| 312 | 3300032126 | Ga0307415_100068825 | Ga0307415_1000688256 | 179 |
| 313 | 3300032168 | Ga0316593_10000942 | Ga0316593_100009428 | 179 |
| 314 | 3300032168 | Ga0316593_10006570 | Ga0316593_100065704 | 179 |
| 315 | 3300032168 | Ga0316593_10092284 | Ga0316593_100922841 | 179 |
| 316 | 3300032168 | Ga0316593_10122884 | Ga0316593_101228842 | 179 |
| 317 | 3300033180 | Ga0307510_10000006 | Ga0307510_10000006346 | 179 |
| 318 | 3300033180 | Ga0307510_10029950 | Ga0307510_100299507 | 179 |
| 319 | 3300033528 | Ga0316588_1008872 | Ga0316588_10088722 | 179 |
| 320 | 3300033528 | Ga0316588_1077603 | Ga0316588_10776031 | 179 |
| 321 | 3300033547 | Ga0316212_1005837 | Ga0316212_10058372 | 179 |
| 322 | 3300034818 | Ga0373950_0000002 | Ga0373950_0000002_5371_6090 | 179 |
| 323 | 3300035113 | Ga0373936_0035525 | Ga0373936_0035525_317_862 | 179 |
| 324 | 3300035116 | Ga0373945_0139007 | Ga0373945_0139007_14_562 | 179 |
| 325 | 3300035398 | Ga0316574_0028762 | Ga0316574_0028762_2085_2633 | 179 |
| 326 | 3300035398 | Ga0316574_0296695 | Ga0316574_0296695_239_787 | 179 |
| 327 | 3300035695 | Ga0373927_0272861 | Ga0373927_0272861_419_958 | 179 |
| 328 | 3300035724 | Ga0373933_0001189 | Ga0373933_0001189_5478_6197 | 179 |
| 329 | 3300035725 | Ga0373947_0096165 | Ga0373947_0096165_940_1686 | 179 |
| 330 | 3300036647 | Ga0316582_0100593 | Ga0316582_0100593_426_965 | 179 |
| 331 | 3300036647 | Ga0316582_0138952 | Ga0316582_0138952_777_1316 | 179 |
| 332 | 3300036712 | Ga0316584_0074846 | Ga0316584_0074846_1687_2235 | 179 |
| 333 | 3300037466 | Ga0395898_0014841 | Ga0395898_0014841_2376_2915 | 179 |
| 334 | 3300037466 | Ga0395898_0039994 | Ga0395898_0039994_3484_4023 | 179 |
| 335 | 3300037466 | Ga0395898_0883534 | Ga0395898_0883534_238_777 | 179 |
| 336 | 3300037853 | Ga0436364_0864071 | Ga0436364_0864071_188_727 | 179 |
| 337 | 3300038443 | Ga0395901_1080422 | Ga0395901_1080422_67_606 | 179 |
| 338 | 3300039093 | Ga0400489_61698 | Ga0400489_61698_688_1227 | 179 |
| 339 | 3300039437 | Ga0436365_0032067 | Ga0436365_0032067_2309_2848 | 179 |
| 340 | 3300039438 | Ga0436360_0748450 | Ga0436360_0748450_121_660 | 179 |
| 341 | 3300039438 | Ga0436360_0749057 | Ga0436360_0749057_787_1326 | 179 |
| 342 | 3300039447 | Ga0436361_0195894 | Ga0436361_0195894_81_620 | 179 |
| 343 | 3300039447 | Ga0436361_0555916 | Ga0436361_0555916_189_941 | 179 |
| 344 | 3300039450 | Ga0436363_0193457 | Ga0436363_0193457_171_710 | 179 |
| 345 | 3300039450 | Ga0436363_0411941 | Ga0436363_0411941_120_659 | 179 |
| 346 | 3300039450 | Ga0436363_0978720 | Ga0436363_0978720_1757_2296 | 179 |
| 347 | 3300039453 | Ga0436362_0693496 | Ga0436362_0693496_369_908 | 179 |
| 348 | 3300039453 | Ga0436362_0820035 | Ga0436362_0820035_58_819 | 179 |
| 349 | 3300041406 | Ga0439439_0038579 | Ga0439439_0038579_212_757 | 179 |
| 350 | 3300041407 | Ga0439447_060661 | Ga0439447_060661_134_673 | 179 |
| 351 | 3300041458 | Ga0451798_0505011 | Ga0451798_0505011_1732_2277 | 179 |
| 352 | 3300041505 | Ga0451849_1052663 | Ga0451849_1052663_1157_1696 | 179 |
| 353 | 3300041512 | Ga0451853_2380426 | Ga0451853_2380426_1855_2394 | 179 |
| 354 | 3300042004 | Ga0439445_0150212 | Ga0439445_0150212_106_651 | 179 |
| 355 | 3300042007 | Ga0439449_0100693 | Ga0439449_0100693_423_968 | 179 |
| 356 | 3300042876 | Ga0451577_0008152 | Ga0451577_0008152_6239_6778 | 179 |
| 357 | 3300044673 | Ga0453683_0005334 | Ga0453683_0005334_1168_1707 | 179 |
| 358 | 3300044684 | Ga0466966_0015541 | Ga0466966_0015541_512_1051 | 179 |
| 359 | 3300044693 | Ga0466961_0517526 | Ga0466961_0517526_95_634 | 179 |
| 360 | 3300044712 | Ga0453684_0240033 | Ga0453684_0240033_1173_1712 | 179 |
| 361 | 3300045049 | Ga0466959_0103445 | Ga0466959_0103445_122_661 | 179 |
| 362 | 3300045051 | Ga0451576_0053177 | Ga0451576_0053177_2972_3511 | 179 |
| 363 | 3300045051 | Ga0451576_0131416 | Ga0451576_0131416_1242_1784 | 179 |
| 364 | 3300046455 | Ga0495603_0365063 | Ga0495603_0365063_142_681 | 179 |
| 365 | 3300046459 | Ga0495629_0111215 | Ga0495629_0111215_648_1187 | 179 |
| 366 | 3300046460 | Ga0495638_0074489 | Ga0495638_0074489_1079_1621 | 179 |
| 367 | 3300046461 | Ga0495641_0074632 | Ga0495641_0074632_442_981 | 179 |
| 368 | 3300046471 | Ga0495650_0049935 | Ga0495650_0049935_612_1151 | 179 |
| 369 | 3300046475 | Ga0495639_0082011 | Ga0495639_0082011_541_1080 | 179 |
| 370 | 3300046500 | Ga0495596_0097449 | Ga0495596_0097449_462_1001 | 179 |
| 371 | 3300046507 | Ga0495606_0219135 | Ga0495606_0219135_53_592 | 179 |
| 372 | 3300046513 | Ga0495616_0129981 | Ga0495616_0129981_56_601 | 179 |
| 373 | 3300046516 | Ga0495628_0093477 | Ga0495628_0093477_829_1575 | 179 |
| 374 | 3300046516 | Ga0495628_0625607 | Ga0495628_0625607_79_624 | 179 |
| 375 | 3300046517 | Ga0495630_0055150 | Ga0495630_0055150_403_942 | 179 |
| 376 | 3300046517 | Ga0495630_0286426 | Ga0495630_0286426_709_1248 | 179 |
| 377 | 3300046519 | Ga0495632_0032155 | Ga0495632_0032155_907_1446 | 179 |
| 378 | 3300046519 | Ga0495632_0109379 | Ga0495632_0109379_121_663 | 179 |
| 379 | 3300046519 | Ga0495632_0172236 | Ga0495632_0172236_221_766 | 179 |
| 380 | 3300046522 | Ga0495643_0036660 | Ga0495643_0036660_1666_2205 | 179 |
| 381 | 3300046524 | Ga0495648_0038970 | Ga0495648_0038970_373_915 | 179 |
| 382 | 3300046533 | Ga0495640_0113969 | Ga0495640_0113969_1025_1564 | 179 |
| 383 | 3300046535 | Ga0495586_0010612 | Ga0495586_0010612_2794_3333 | 179 |
| 384 | 3300046539 | Ga0495621_0084394 | Ga0495621_0084394_494_1033 | 179 |
| 385 | 3300046557 | Ga0495622_0117795 | Ga0495622_0117795_532_1071 | 179 |
| 386 | 3300046557 | Ga0495622_0125634 | Ga0495622_0125634_323_862 | 179 |
| 387 | 3300046557 | Ga0495622_0127664 | Ga0495622_0127664_223_762 | 179 |
| 388 | 3300046616 | Ga0495668_0105281 | Ga0495668_0105281_363_902 | 179 |
| 389 | 3300046642 | Ga0495634_0164500 | Ga0495634_0164500_381_920 | 179 |
| 390 | 3300046648 | Ga0495611_0019227 | Ga0495611_0019227_1426_1968 | 179 |
| 391 | 3300046648 | Ga0495611_0344025 | Ga0495611_0344025_70_615 | 179 |
| 392 | 3300046663 | Ga0495635_0323485 | Ga0495635_0323485_33_575 | 179 |
| 393 | 3300046683 | Ga0495658_0166619 | Ga0495658_0166619_612_1160 | 179 |
| 394 | 3300046684 | Ga0495669_0058634 | Ga0495669_0058634_186_725 | 179 |
| 395 | 3300046690 | Ga0495624_0151369 | Ga0495624_0151369_569_1108 | 179 |
| 396 | 3300047320 | Ga0495672_0024792 | Ga0495672_0024792_2479_3024 | 179 |
| 397 | 3300047322 | Ga0495680_0152274 | Ga0495680_0152274_101_643 | 179 |
| 398 | 3300047443 | Ga0495687_032507 | Ga0495687_032507_1183_1722 | 179 |
| 399 | 3300048903 | Ga0496100_0110723 | Ga0496100_0110723_978_1517 | 179 |
| 400 | 3300048904 | Ga0496101_0821202 | Ga0496101_0821202_70_609 | 179 |
| 401 | 3300048905 | Ga0496102_0003295 | Ga0496102_0003295_12614_13156 | 179 |
| 402 | 3300048905 | Ga0496102_0199613 | Ga0496102_0199613_633_1172 | 179 |
| 403 | 3300048906 | Ga0496103_0040660 | Ga0496103_0040660_1248_1790 | 179 |
| 404 | 3300048909 | Ga0496106_0066543 | Ga0496106_0066543_2011_2550 | 179 |
| 405 | 3300048911 | Ga0496108_0168503 | Ga0496108_0168503_643_1182 | 179 |
| 406 | 3300048912 | Ga0496109_0707816 | Ga0496109_0707816_274_813 | 179 |
| 407 | 3300048915 | Ga0496112_0773816 | Ga0496112_0773816_18_581 | 179 |
| 408 | 3300048916 | Ga0496113_0189425 | Ga0496113_0189425_68_607 | 179 |
| 409 | 3300048918 | Ga0496115_0126283 | Ga0496115_0126283_115_657 | 179 |
| 410 | 3300048920 | Ga0496117_0000787 | Ga0496117_0000787_19747_20289 | 179 |
| 411 | 3300048920 | Ga0496117_0073497 | Ga0496117_0073497_1537_2076 | 179 |
| 412 | 3300048921 | Ga0496118_0000032 | Ga0496118_0000032_239265_239807 | 179 |
| 413 | 3300048921 | Ga0496118_0013267 | Ga0496118_0013267_387_926 | 179 |
| 414 | 3300048921 | Ga0496118_0112821 | Ga0496118_0112821_1023_1562 | 179 |
| 415 | 3300048922 | Ga0496119_0116851 | Ga0496119_0116851_829_1371 | 179 |
| 416 | 3300048923 | Ga0496120_0151997 | Ga0496120_0151997_101_643 | 179 |
| 417 | 3300048924 | Ga0496121_0000704 | Ga0496121_0000704_60475_61014 | 179 |
| 418 | 3300048924 | Ga0496121_0028362 | Ga0496121_0028362_4533_5072 | 179 |
| 419 | 3300048924 | Ga0496121_0266210 | Ga0496121_0266210_49_591 | 179 |
| 420 | 3300048927 | Ga0496124_0006228 | Ga0496124_0006228_3306_3848 | 179 |
| 421 | 3300048928 | Ga0496125_0001378 | Ga0496125_0001378_6542_7081 | 179 |
| 422 | 3300048929 | Ga0496126_0011396 | Ga0496126_0011396_6450_6992 | 179 |
| 423 | 3300049528 | Ga0501312_051378 | Ga0501312_051378_138_683 | 179 |
| 424 | 3300049533 | Ga0501317_011660 | Ga0501317_011660_147_692 | 179 |
| 425 | 3300049568 | Ga0501031_0131173 | Ga0501031_0131173_350_889 | 179 |
| 426 | 3300049568 | Ga0501031_0470580 | Ga0501031_0470580_251_799 | 179 |
| 427 | 3300049570 | Ga0501033_0049659 | Ga0501033_0049659_561_1100 | 179 |
| 428 | 3300049571 | Ga0501034_0231167 | Ga0501034_0231167_986_1678 | 179 |
| 429 | 3300049572 | Ga0501036_0023621 | Ga0501036_0023621_563_1102 | 179 |
| 430 | 3300049574 | Ga0501038_0015092 | Ga0501038_0015092_2149_2688 | 179 |
| 431 | 3300049575 | Ga0501039_0046960 | Ga0501039_0046960_2070_2618 | 179 |
| 432 | 3300049575 | Ga0501039_0115981 | Ga0501039_0115981_330_869 | 179 |
| 433 | 3300049576 | Ga0501040_0008066 | Ga0501040_0008066_5897_6436 | 179 |
| 434 | 3300049576 | Ga0501040_0044091 | Ga0501040_0044091_521_1060 | 179 |
| 435 | 3300049576 | Ga0501040_0843536 | Ga0501040_0843536_76_624 | 179 |
| 436 | 3300049577 | Ga0501041_0001598 | Ga0501041_0001598_1788_2327 | 179 |
| 437 | 3300049577 | Ga0501041_0120949 | Ga0501041_0120949_830_1378 | 179 |
| 438 | 3300049578 | Ga0501042_0001373 | Ga0501042_0001373_7081_7620 | 179 |
| 439 | 3300049579 | Ga0501043_0299109 | Ga0501043_0299109_492_1031 | 179 |
| 440 | 3300049579 | Ga0501043_0513223 | Ga0501043_0513223_169_717 | 179 |
| 441 | 3300049580 | Ga0501046_0015243 | Ga0501046_0015243_2468_3007 | 179 |
| 442 | 3300049580 | Ga0501046_0105554 | Ga0501046_0105554_272_811 | 179 |
| 443 | 3300049580 | Ga0501046_0616236 | Ga0501046_0616236_13_561 | 179 |
| 444 | 3300049580 | Ga0501046_0673623 | Ga0501046_0673623_99_638 | 179 |
| 445 | 3300049581 | Ga0501047_0142861 | Ga0501047_0142861_1173_1718 | 179 |
| 446 | 3300049581 | Ga0501047_0148132 | Ga0501047_0148132_562_1101 | 179 |
| 447 | 3300049582 | Ga0501048_0009558 | Ga0501048_0009558_673_1212 | 179 |
| 448 | 3300049582 | Ga0501048_0067468 | Ga0501048_0067468_240_779 | 179 |
| 449 | 3300049583 | Ga0501067_0000339 | Ga0501067_0000339_168_887 | 179 |
| 450 | 3300049583 | Ga0501067_0003984 | Ga0501067_0003984_7185_7895 | 179 |
| 451 | 3300049583 | Ga0501067_0138286 | Ga0501067_0138286_68_607 | 179 |
| 452 | 3300049585 | Ga0501069_0570941 | Ga0501069_0570941_83_628 | 179 |
| 453 | 3300049586 | Ga0501070_0044235 | Ga0501070_0044235_1150_1689 | 179 |
| 454 | 3300049586 | Ga0501070_0913786 | Ga0501070_0913786_113_652 | 179 |
| 455 | 3300049587 | Ga0501071_0003527 | Ga0501071_0003527_9142_9681 | 179 |
| 456 | 3300049587 | Ga0501071_0024289 | Ga0501071_0024289_1536_2075 | 179 |
| 457 | 3300049587 | Ga0501071_0225613 | Ga0501071_0225613_199_747 | 179 |
| 458 | 3300049588 | Ga0501072_0056705 | Ga0501072_0056705_1773_2321 | 179 |
| 459 | 3300049588 | Ga0501072_0180820 | Ga0501072_0180820_402_941 | 179 |
| 460 | 3300049589 | Ga0501073_0005323 | Ga0501073_0005323_5317_6036 | 179 |
| 461 | 3300049589 | Ga0501073_0122379 | Ga0501073_0122379_773_1312 | 179 |
| 462 | 3300049590 | Ga0501074_0089815 | Ga0501074_0089815_1050_1589 | 179 |
| 463 | 3300049591 | Ga0501075_0015597 | Ga0501075_0015597_2406_2945 | 179 |
| 464 | 3300049591 | Ga0501075_0055471 | Ga0501075_0055471_1825_2364 | 179 |
| 465 | 3300049591 | Ga0501075_0121563 | Ga0501075_0121563_1032_1580 | 179 |
| 466 | 3300049591 | Ga0501075_0123618 | Ga0501075_0123618_367_906 | 179 |
| 467 | 3300049591 | Ga0501075_0231797 | Ga0501075_0231797_822_1361 | 179 |
| 468 | 3300049591 | Ga0501075_0677634 | Ga0501075_0677634_149_688 | 179 |
| 469 | 3300049592 | Ga0501076_0004639 | Ga0501076_0004639_6177_6716 | 179 |
| 470 | 3300049592 | Ga0501076_0105365 | Ga0501076_0105365_66_605 | 179 |
| 471 | 3300049592 | Ga0501076_0767662 | Ga0501076_0767662_66_614 | 179 |
| 472 | 3300049593 | Ga0501077_0007629 | Ga0501077_0007629_2189_2728 | 179 |
| 473 | 3300049741 | Ga0501079_0006996 | Ga0501079_0006996_212_751 | 179 |
| 474 | 3300049741 | Ga0501079_0092127 | Ga0501079_0092127_1584_2153 | 179 |
| 475 | 3300049742 | Ga0501080_0011395 | Ga0501080_0011395_1243_1782 | 179 |
| 476 | 3300049742 | Ga0501080_0267582 | Ga0501080_0267582_345_1067 | 179 |
| 477 | 3300049743 | Ga0501081_0006719 | Ga0501081_0006719_5065_5604 | 179 |
| 478 | 3300049743 | Ga0501081_0008928 | Ga0501081_0008928_5090_5638 | 179 |
| 479 | 3300049744 | Ga0501083_0032077 | Ga0501083_0032077_671_1210 | 179 |
| 480 | 3300049823 | Ga0501044_0413807 | Ga0501044_0413807_474_1013 | 179 |
| 481 | 3300049824 | Ga0501045_0008747 | Ga0501045_0008747_4412_4951 | 179 |
| 482 | 3300049824 | Ga0501045_0084307 | Ga0501045_0084307_23_562 | 179 |
| 483 | 3300049824 | Ga0501045_0379223 | Ga0501045_0379223_48_587 | 179 |
| 484 | 3300050493 | nmdc:mga0k408_368872_c1 | nmdc:mga0k408_368872_c1_28_573 | 179 |
| 485 | 3300050494 | nmdc:mga06z11_238965_c1 | nmdc:mga06z11_238965_c1_230_769 | 179 |
| 486 | 3300050509 | nmdc:mga0qj67_363598_c1 | nmdc:mga0qj67_363598_c1_31_723 | 179 |
| 487 | 3300050513 | nmdc:mga0rr50_62474_c1 | nmdc:mga0rr50_62474_c1_1622_2323 | 179 |
| 488 | 3300053080 | Ga0500635_0222521 | Ga0500635_0222521_92_631 | 179 |
| 489 | 3300053093 | Ga0500651_0148876 | Ga0500651_0148876_698_1258 | 179 |
| 490 | 3300053094 | Ga0500566_0238314 | Ga0500566_0238314_241_780 | 179 |
| 491 | 3300053098 | Ga0500650_0293500 | Ga0500650_0293500_152_694 | 179 |
| 492 | 3300053111 | Ga0500572_016818 | Ga0500572_016818_246_791 | 179 |
| 493 | 3300053123 | Ga0500614_025617 | Ga0500614_025617_677_1216 | 179 |
| 494 | 3300053124 | Ga0500617_018488 | Ga0500617_018488_536_1081 | 179 |
| 495 | 3300053130 | Ga0500642_0084229 | Ga0500642_0084229_374_916 | 179 |
| 496 | 3300053131 | Ga0500652_019170 | Ga0500652_019170_1732_2274 | 179 |
| 497 | 3300053131 | Ga0500652_095300 | Ga0500652_095300_500_1060 | 179 |
| 498 | 3300053134 | Ga0500658_0128002 | Ga0500658_0128002_465_1010 | 179 |
| 499 | 3300053134 | Ga0500658_0193123 | Ga0500658_0193123_205_747 | 179 |
| 500 | 3300053136 | Ga0500559_0055356 | Ga0500559_0055356_1072_1617 | 179 |
| 501 | 3300053136 | Ga0500559_0057739 | Ga0500559_0057739_721_1260 | 179 |
| 502 | 3300053139 | Ga0500568_0112591 | Ga0500568_0112591_217_756 | 179 |
| 503 | 3300053140 | Ga0500573_0114831 | Ga0500573_0114831_283_822 | 179 |
| 504 | 3300053146 | Ga0500588_0005313 | Ga0500588_0005313_806_1351 | 179 |
| 505 | 3300053146 | Ga0500588_0037688 | Ga0500588_0037688_314_856 | 179 |
| 506 | 3300053148 | Ga0500590_096636 | Ga0500590_096636_38_577 | 179 |
| 507 | 3300053153 | Ga0500616_0007626 | Ga0500616_0007626_3261_3803 | 179 |
| 508 | 3300053156 | Ga0500622_0003284 | Ga0500622_0003284_7642_8202 | 179 |
| 509 | 3300053156 | Ga0500622_0011657 | Ga0500622_0011657_2383_2928 | 179 |
| 510 | 3300053156 | Ga0500622_0042597 | Ga0500622_0042597_267_812 | 179 |
| 511 | 3300053177 | Ga0500636_0193827 | Ga0500636_0193827_13_552 | 179 |
| 512 | 3300053178 | Ga0500637_0007794 | Ga0500637_0007794_3837_4376 | 179 |
| 513 | 3300054114 | Ga0501084_0008704 | Ga0501084_0008704_1643_2182 | 179 |
| 514 | 3300059423 | Ga0590074_015695 | Ga0590074_015695_102_647 | 179 |
| 515 | 3300059512 | Ga0587092_066261 | Ga0587092_066261_128_670 | 179 |
| 516 | 3300059624 | Ga0587109_008544 | Ga0587109_008544_538_1080 | 179 |
| 517 | 3300060344 | Ga0587071_031143 | Ga0587071_031143_333_875 | 179 |
| 518 | 3300060346 | Ga0587111_0105172 | Ga0587111_0105172_97_663 | 179 |
| 519 | 3300060353 | Ga0501082_0004231 | Ga0501082_0004231_10500_11039 | 179 |
| 520 | 3300060353 | Ga0501082_0087089 | Ga0501082_0087089_248_787 | 179 |
| 521 | 3300061734 | Ga0530510_0007174 | Ga0530510_0007174_4709_5248 | 179 |
| 522 | 3300061734 | Ga0530510_0027258 | Ga0530510_0027258_3444_3992 | 179 |
| 523 | 3300061734 | Ga0530510_0127298 | Ga0530510_0127298_346_885 | 179 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5ns3-assembly1.cif.gz_A | crystal structures of cy5 cyanine fluorophores stacked onto the end of double-stranded rna | 0.9697 | 4 | 178 |
| 5ns4-assembly1.cif.gz_A | crystal structures of cy3 cyanine fluorophores stacked onto the end of double-stranded rna | 0.9573 | 1 | 178 |
| 5ns3-assembly1.cif.gz_B | crystal structures of cy5 cyanine fluorophores stacked onto the end of double-stranded rna | 0.9571 | 4 | 178 |
| 5ns4-assembly2.cif.gz_B | crystal structures of cy3 cyanine fluorophores stacked onto the end of double-stranded rna | 0.953 | 4 | 178 |
| 5ns4-assembly1.cif.gz_A | crystal structures of cy3 cyanine fluorophores stacked onto the end of double-stranded rna | 0.9506 | 1 | 178 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4warF00 | Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 | 0.8932 | 2 | 178 | 3.30.1440.10 |
| 4warF00 | Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 | 0.8884 | 2 | 178 | 3.30.1440.10 |
| af_O14337_108_278_3.30.1440.10 | Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 | 0.8366 | 22 | 173 | 3.30.1440.10 |
| af_P36519_120_288_3.30.1440.10 | Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 | 0.8357 | 22 | 177 | 3.30.1440.10 |
| 1vs9E00 | Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 | 0.8266 | 4 | 179 | 3.30.1440.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538J4T4-F1-model_v4 | 50S ribosomal protein L5 | 0.9389 | 1 | 177 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A554FZ23-F1-model_v4 | Large ribosomal subunit protein uL5 | 0.9125 | 2 | 179 |
GO:0000049
GO:0003735 GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A522EXR9-F1-model_v4 | Large ribosomal subunit protein uL5 | 0.9122 | 1 | 179 |
GO:0000049
GO:0003735 GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A2M6Y4L6-F1-model_v4 | Large ribosomal subunit protein uL5 | 0.9122 | 1 | 179 |
GO:0000049
GO:0003735 GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
| AF-A0A2T2UIG2-F1-model_v4 | Large ribosomal subunit protein uL5 | 0.9119 | 2 | 179 |
GO:0000049
GO:0003735 GO:0005840 GO:0006412 GO:0019843 GO:1990904 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar