metagRoot

F458600

General Info

Members	Datasets	Scaffolds	Average Seq Length
520	284	517	330

Family's Representative Sequence

Representative Sequence	3300048910\|Ga0496107_0085050\|Ga0496107_0085050_262_1428
Length	388
Sequence	VAEWQSRRFLCDNWNDKNYEEKQAQTLHVECSLSFGFWYLQVNNNTSQGEFGMQIGMIGLGRMGANMVRRLLRDGHECVVNDRSPDAVKALEAEGAIGAASLAGFIEKLKPPRAIWLMIPAALVDTILNQLAEIVAAGDINIDGGNSYYIDDIRRAHELKAKGIHYVDVGTSGGVWGLERGYCQMIGGESDVVAHLDPIFKTLAPGRSAVSPTPGRAADAGTAADGYLHCGPSGAGHFVKMVHNGIEYGLMAAYAEGLNVLHDANVGKSERTADAETTPLRSPEHYQYDFNIADIAEVWRRGSVIASWLLDLTAIAFAESPQLESFSGRVSDSGEGRWTINAAIEEGVPVPVLSAALFQRFSSRGEADFANKILSAMRLQFGGHVERK

Samples

	Sample ID	Description	Type	Environment
1	2162886006	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1	Metagenome	Rhizosphere
2	2617270889	Nostoc punctiforme PCC 73102	Isolate	Unclassified
3	2739367655	Pusillimonas sp. YR330	Isolate	Unclassified
4	3300000532	Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled	Metagenome	Rhizosphere
5	3300002459	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6	Metagenome	Rhizosphere
6	3300003214	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL	Metagenome	Endosphere
7	3300003751	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2	Metagenome	Endosphere
8	3300003752	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2	Metagenome	Endosphere
9	3300003756	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2	Metagenome	Endosphere
10	3300003759	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2	Metagenome	Endosphere
11	3300003841	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2	Metagenome	Endosphere
12	3300005288	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
13	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
14	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
15	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
16	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
17	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
18	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
19	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
20	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
21	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
22	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
23	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
24	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
25	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
26	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
27	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
28	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
29	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
30	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
31	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
32	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
33	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
34	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
35	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
36	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
37	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
38	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
39	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
40	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
41	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
42	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
43	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
44	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
45	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
46	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
47	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
48	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
49	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
50	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
51	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
52	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
53	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
54	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
55	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
56	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
57	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
58	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
59	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
60	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
61	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
62	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
63	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
64	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
65	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
66	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
67	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
68	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
69	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
70	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
71	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
72	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
73	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
74	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
75	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
76	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
77	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
78	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
79	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
80	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
81	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
82	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
83	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
84	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
85	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
86	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
87	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
88	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
89	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
90	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
91	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
92	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
93	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
94	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
95	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
96	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
97	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
98	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
99	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
100	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
101	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
102	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
103	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
104	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
105	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
106	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
107	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
108	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
109	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
110	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
111	3300020080	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
112	3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Metagenome	Unclassified
113	3300022467	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
114	3300025224	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
115	3300025225	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
116	3300025226	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
117	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
118	3300025231	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
119	3300025233	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
120	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
121	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
122	3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
155	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
156	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
157	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
158	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
159	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
160	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
161	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
162	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
163	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
164	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
165	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
166	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
167	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
168	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
169	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
170	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
171	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
172	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
173	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
174	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
175	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
176	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
177	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
178	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
179	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
180	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
181	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
182	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
183	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
184	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
185	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
186	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
187	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
188	3300035091	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4	Metagenome	Rhizosphere
189	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
190	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
191	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
192	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
193	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
194	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
195	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
196	3300038996	Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19	Metagenome	Rhizosphere
197	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
198	3300042012	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213	Metagenome	Rhizosphere
199	3300042157	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210	Metagenome	Rhizosphere
200	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
201	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
202	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
203	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
204	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
205	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
206	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
207	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
208	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
209	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
210	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
211	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
212	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
213	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
214	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
215	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
216	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
217	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
218	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
219	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
220	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
221	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
222	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
223	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
224	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
225	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
226	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
227	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
228	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
229	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
230	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
231	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
232	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
233	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
234	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
235	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
236	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
237	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
238	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
239	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
240	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
241	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
242	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
243	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
244	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
245	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
246	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
247	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
248	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
249	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
250	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
251	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
252	3300049652	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought	Metagenome	Rhizosphere
253	3300049654	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control	Metagenome	Rhizosphere
254	3300049656	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought	Metagenome	Rhizosphere
255	3300049661	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control	Metagenome	Rhizosphere
256	3300049663	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought	Metagenome	Rhizosphere
257	3300049664	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought	Metagenome	Rhizosphere
258	3300049665	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought	Metagenome	Rhizosphere
259	3300049668	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought	Metagenome	Rhizosphere
260	3300049705	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought	Metagenome	Rhizosphere
261	3300049707	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought	Metagenome	Rhizosphere
262	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
263	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
264	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
265	3300049770	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control	Metagenome	Rhizosphere
266	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
267	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
268	3300049853	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought	Metagenome	Rhizosphere
269	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
270	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
271	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
272	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
273	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
274	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
275	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
276	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
277	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
278	3300053154	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere	Metagenome	Endosphere
279	3300053178	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere	Metagenome	Endosphere
280	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
281	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
282	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
283	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere
284	642555144	Nostoc punctiforme PCC 73102	Isolate	Unclassified

Type Distribution

Type	Percentage (%)
Metagenomes	99.04
Metatranscriptomes	0.38
Isolates	0.58

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	3.27
Nodule	0
Rhizoplane	7.88
Rhizosphere	87.5
Stem	0
Stem Tuber	0
Unclassified	1.35

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	SwRhRL3b_contig_2455151	2162886006	Bacteria	1762
2	CNAas_1001132	3300000532	Bacteria	2425
3	JGI24751J29686_10000005	3300002459	Bacteria	134775
4	JGI24751J29686_10000065	3300002459	Bacteria	60593
5	JGI24751J29686_10000066	3300002459	Bacteria	60549
6	JGI25165J46597_1000001	3300003214	Bacteria	1111887
7	Ga0055538_1000001	3300003751	Bacteria	1111887
8	Ga0055539_1000001	3300003752	Bacteria	1111887
9	Ga0055533_1000003	3300003756	Bacteria	1111887
10	Ga0055525_1000003	3300003759	Bacteria	962094
11	Ga0055541_1000001	3300003841	Bacteria	1111887
12	Ga0065714_10064478	3300005288	Bacteria	56205
13	Ga0065704_10096790	3300005289	Bacteria	2424
14	Ga0065712_10000121	3300005290	Bacteria	103063
15	Ga0065712_10076532	3300005290	Bacteria	3624
16	Ga0065715_10001117	3300005293	Bacteria	8617
17	Ga0065715_10008140	3300005293	Bacteria	5009
18	Ga0065715_10089423	3300005293	Bacteria	10386
19	Ga0065715_10090187	3300005293	Bacteria	7487
20	Ga0065715_10139910	3300005293	Bacteria	1865
21	Ga0065707_10091834	3300005295	Bacteria	3873
22	Ga0070676_10157323	3300005328	Bacteria	1459
23	Ga0070670_100000244	3300005331	Bacteria	48842
24	Ga0070670_100000616	3300005331	Bacteria	27869
25	Ga0070670_100122331	3300005331	Bacteria	2245
26	Ga0070670_100231442	3300005331	Bacteria	1608
27	Ga0070670_100274355	3300005331	Bacteria	1472
28	Ga0068869_100118928	3300005334	Bacteria	2018
29	Ga0070680_100016677	3300005336	Bacteria	5783
30	Ga0070680_100020549	3300005336	Bacteria	5241
31	Ga0070682_100074653	3300005337	Bacteria	2178
32	Ga0070682_100102519	3300005337	Bacteria	1892
33	Ga0068868_100085071	3300005338	Bacteria	2540
34	Ga0068868_100306765	3300005338	Bacteria	1349
35	Ga0070660_100334814	3300005339	Bacteria	1245
36	Ga0070689_100107984	3300005340	Bacteria	2210
37	Ga0070687_100049197	3300005343	Bacteria	2171
38	Ga0070669_100092091	3300005353	Bacteria	2275
39	Ga0070671_100009224	3300005355	Bacteria	7925
40	Ga0070671_100221757	3300005355	Bacteria	1604
41	Ga0070674_100092175	3300005356	Bacteria	2190
42	Ga0070673_100119621	3300005364	Bacteria	2195
43	Ga0070673_100172339	3300005364	Bacteria	1847
44	Ga0070673_100285216	3300005364	Bacteria	1449
45	Ga0070688_100044106	3300005365	Bacteria	2751
46	Ga0070659_100010147	3300005366	Bacteria	6931
47	Ga0070659_100195006	3300005366	Bacteria	1666
48	Ga0070667_100044044	3300005367	Bacteria	3746
49	Ga0070667_100044992	3300005367	Bacteria	3710
50	Ga0070714_100043310	3300005435	Bacteria	3807
51	Ga0070714_100048809	3300005435	Bacteria	3601
52	Ga0070713_100397512	3300005436	Bacteria	1286
53	Ga0070710_10002632	3300005437	Bacteria	8526
54	Ga0070711_100134116	3300005439	Bacteria	1848
55	Ga0070711_100242424	3300005439	Bacteria	1410
56	Ga0070705_100008633	3300005440	Bacteria	5046
57	Ga0070705_100019525	3300005440	Bacteria	3568
58	Ga0070705_100094465	3300005440	Bacteria	1872
59	Ga0070700_100000068	3300005441	Bacteria	74024
60	Ga0070694_100041871	3300005444	Bacteria	3057
61	Ga0070694_100212357	3300005444	Bacteria	1448
62	Ga0070694_100385824	3300005444	Bacteria	1094
63	Ga0070678_100009379	3300005456	Bacteria	5926
64	Ga0070681_10001644	3300005458	Bacteria	19947
65	Ga0070681_10003890	3300005458	Bacteria	14065
66	Ga0070681_10010093	3300005458	Bacteria	9307
67	Ga0068867_100011574	3300005459	Bacteria	6229
68	Ga0068867_100109852	3300005459	Bacteria	2118
69	Ga0070685_10016120	3300005466	Bacteria	3977
70	Ga0070706_100000055	3300005467	Bacteria	137675
71	Ga0070706_100142196	3300005467	Bacteria	2240
72	Ga0070706_100224121	3300005467	Bacteria	1755
73	Ga0070707_100031053	3300005468	Bacteria	5087
74	Ga0070707_100033829	3300005468	Bacteria	4874
75	Ga0070698_100012665	3300005471	Bacteria	8929
76	Ga0070698_100019841	3300005471	Bacteria	7051
77	Ga0070699_100001348	3300005518	Bacteria	22638
78	Ga0070699_100011261	3300005518	Bacteria	7725
79	Ga0070679_100000519	3300005530	Bacteria	32737
80	Ga0070679_100046441	3300005530	Bacteria	4329
81	Ga0070684_100000327	3300005535	Bacteria	32866
82	Ga0070684_100275188	3300005535	Bacteria	1542
83	Ga0068853_100195039	3300005539	Bacteria	1841
84	Ga0070672_100082008	3300005543	Bacteria	2587
85	Ga0070686_100015131	3300005544	Bacteria	4461
86	Ga0070695_100068868	3300005545	Bacteria	2312
87	Ga0070696_100036592	3300005546	Bacteria	3384
88	Ga0070696_100063349	3300005546	Bacteria	2590
89	Ga0070696_100070796	3300005546	Bacteria	2454
90	Ga0070696_100118746	3300005546	Bacteria	1912
91	Ga0070696_100189825	3300005546	Bacteria	1529
92	Ga0070696_100217101	3300005546	Bacteria	1433
93	Ga0070693_100015762	3300005547	Bacteria	3898
94	Ga0070693_100016459	3300005547	Bacteria	3829
95	Ga0070693_100022429	3300005547	Bacteria	3357
96	Ga0070693_100027637	3300005547	Bacteria	3077
97	Ga0070693_100071541	3300005547	Bacteria	2044
98	Ga0070693_100078141	3300005547	Bacteria	1966
99	Ga0070665_100178117	3300005548	Bacteria	2127
100	Ga0070665_100296292	3300005548	Bacteria	1620
101	Ga0070704_100259946	3300005549	Bacteria	1430
102	Ga0070664_100265912	3300005564	Bacteria	1544
103	Ga0070664_100337668	3300005564	Bacteria	1368
104	Ga0068857_100022476	3300005577	Bacteria	5549
105	Ga0068854_100045555	3300005578	Bacteria	3120
106	Ga0068854_100135058	3300005578	Bacteria	1888
107	Ga0068856_100163399	3300005614	Bacteria	2238
108	Ga0068856_100183768	3300005614	Bacteria	2104
109	Ga0070702_100004996	3300005615	Bacteria	6123
110	Ga0070702_100020123	3300005615	Bacteria	3492
111	Ga0068852_100209365	3300005616	Bacteria	1849
112	Ga0068859_100001086	3300005617	Bacteria	27780
113	Ga0068859_100033960	3300005617	Bacteria	5121
114	Ga0068859_100079168	3300005617	Bacteria	3326
115	Ga0068859_100104230	3300005617	Bacteria	2895
116	Ga0068859_100194124	3300005617	Bacteria	2115
117	Ga0068859_100242280	3300005617	Bacteria	1893
118	Ga0068859_100561596	3300005617	Bacteria	1235
119	Ga0068864_100000201	3300005618	Bacteria	54044
120	Ga0068864_100002479	3300005618	Bacteria	15239
121	Ga0068864_100057872	3300005618	Bacteria	3349
122	Ga0068864_100190768	3300005618	Bacteria	1878
123	Ga0068864_100591835	3300005618	Bacteria	1076
124	Ga0068861_100003599	3300005719	Bacteria	10321
125	Ga0068870_10009617	3300005840	Bacteria	4405
126	Ga0068863_100022992	3300005841	Bacteria	5958
127	Ga0068858_100073701	3300005842	Bacteria	3169
128	Ga0068858_100092249	3300005842	Bacteria	2819
129	Ga0068858_100102165	3300005842	Bacteria	2674
130	Ga0068858_100177239	3300005842	Bacteria	2012
131	Ga0068858_100180971	3300005842	Bacteria	1990
132	Ga0068860_100071220	3300005843	Bacteria	3304
133	Ga0068860_100106391	3300005843	Bacteria	2679
134	Ga0068860_100246447	3300005843	Bacteria	1739
135	Ga0068862_100035096	3300005844	Bacteria	4245
136	Ga0068862_100037947	3300005844	Bacteria	4085
137	Ga0081455_10094800	3300005937	Bacteria	2410
138	Ga0081539_10009519	3300005985	Bacteria	8096
139	Ga0070717_10041155	3300006028	Bacteria	3767
140	Ga0070717_10107973	3300006028	Bacteria	2371
141	Ga0070715_10028041	3300006163	Bacteria	2254
142	Ga0070716_100000535	3300006173	Bacteria	15881
143	Ga0070716_100033552	3300006173	Bacteria	2809
144	Ga0097621_100008999	3300006237	Bacteria	7226
145	Ga0068871_100095747	3300006358	Bacteria	2479
146	Ga0068871_100119715	3300006358	Bacteria	2223
147	Ga0068871_100207259	3300006358	Bacteria	1695
148	Ga0075430_100038433	3300006846	Bacteria	4053
149	Ga0075431_100223756	3300006847	Bacteria	1919
150	Ga0075433_10003838	3300006852	Bacteria	11634
151	Ga0075433_10044887	3300006852	Bacteria	3841
152	Ga0075433_10108883	3300006852	Bacteria	2458
153	Ga0075433_10243120	3300006852	Bacteria	1598
154	Ga0075434_100000747	3300006871	Bacteria	25566
155	Ga0075434_100029936	3300006871	Bacteria	5359
156	Ga0075434_100110520	3300006871	Bacteria	2759
157	Ga0075434_100297511	3300006871	Bacteria	1634
158	Ga0075434_100297779	3300006871	Bacteria	1633
159	Ga0075429_100087428	3300006880	Bacteria	2716
160	Ga0075429_100128266	3300006880	Bacteria	2219
161	Ga0068865_100040069	3300006881	Bacteria	3181
162	Ga0075436_100122555	3300006914	Bacteria	1820
163	Ga0097620_100001086	3300006931	Bacteria	27780
164	Ga0097620_100033959	3300006931	Bacteria	5121
165	Ga0097620_100079168	3300006931	Bacteria	3326
166	Ga0097620_100104229	3300006931	Bacteria	2895
167	Ga0097620_100242276	3300006931	Bacteria	1893
168	Ga0097620_100561595	3300006931	Bacteria	1235
169	Ga0075435_100013018	3300007076	Bacteria	6175
170	Ga0075435_100057148	3300007076	Bacteria	3155
171	Ga0111539_10000773	3300009094	Bacteria	41594
172	Ga0111539_10060744	3300009094	Bacteria	4479
173	Ga0111539_10110477	3300009094	Bacteria	3226
174	Ga0105245_10111579	3300009098	Bacteria	2543
175	Ga0105245_10378739	3300009098	Unclassified	1409
176	Ga0105247_10001252	3300009101	Bacteria	18828
177	Ga0114129_10153733	3300009147	Bacteria	3148
178	Ga0114129_10411598	3300009147	Bacteria	1780
179	Ga0114129_10543372	3300009147	Bacteria	1512
180	Ga0105243_10005744	3300009148	Bacteria	9635
181	Ga0105243_10064230	3300009148	Bacteria	2945
182	Ga0105241_10124930	3300009174	Bacteria	2077
183	Ga0105241_10151095	3300009174	Bacteria	1900
184	Ga0105241_10157312	3300009174	Bacteria	1865
185	Ga0105241_10162647	3300009174	Bacteria	1836
186	Ga0105241_10303286	3300009174	Bacteria	1371
187	Ga0105248_10007173	3300009177	Bacteria	12226
188	Ga0105248_10011851	3300009177	Bacteria	9619
189	Ga0105248_10019758	3300009177	Bacteria	7460
190	Ga0105248_10158307	3300009177	Bacteria	2555
191	Ga0105248_10359025	3300009177	Bacteria	1640
192	Ga0105248_10430008	3300009177	Bacteria	1487
193	Ga0105237_10000218	3300009545	Bacteria	80923
194	Ga0105237_10044306	3300009545	Bacteria	4479
195	Ga0105238_10000560	3300009551	Bacteria	38926
196	Ga0105238_10005969	3300009551	Bacteria	12076
197	Ga0105249_10005573	3300009553	Bacteria	10887
198	Ga0105249_10046489	3300009553	Bacteria	3950
199	Ga0105239_10115739	3300010375	Bacteria	2974
200	Ga0105246_10159470	3300011119	Bacteria	1717
201	Ga0157373_10006086	3300013100	Bacteria	9021
202	Ga0157373_10013702	3300013100	Bacteria	5944
203	Ga0157373_10025690	3300013100	Bacteria	4258
204	Ga0157369_10063430	3300013105	Bacteria	3981
205	Ga0157374_10077250	3300013296	Bacteria	3151
206	Ga0157378_10021454	3300013297	Bacteria	5680
207	Ga0157378_10065870	3300013297	Bacteria	3243
208	Ga0157378_10118780	3300013297	Bacteria	2434
209	Ga0163162_10011007	3300013306	Bacteria	8809
210	Ga0163162_10074478	3300013306	Bacteria	3454
211	Ga0163162_10360906	3300013306	Bacteria	1586
212	Ga0163162_10414845	3300013306	Bacteria	1479
213	Ga0157372_10228048	3300013307	Bacteria	2159
214	Ga0157375_10454559	3300013308	Bacteria	1446
215	Ga0157375_10638580	3300013308	Bacteria	1221
216	Ga0163163_10000121	3300014325	Bacteria	82770
217	Ga0163163_10000767	3300014325	Bacteria	27221
218	Ga0163163_10001344	3300014325	Bacteria	20761
219	Ga0163163_10021546	3300014325	Bacteria	6084
220	Ga0163163_10102013	3300014325	Bacteria	2892
221	Ga0163163_10105771	3300014325	Bacteria	2840
222	Ga0157377_10017118	3300014745	Bacteria	3744
223	Ga0157377_10316255	3300014745	Bacteria	1036
224	Ga0157376_10003754	3300014969	Bacteria	10504
225	Ga0163161_10006803	3300017792	Bacteria	7904
226	Ga0206350_10875308	3300020080	Bacteria	2392
227	Ga0213875_10000378	3300021388	Bacteria	40689
228	Ga0224712_10001570	3300022467	Bacteria	5334
229	Ga0209784_100004	3300025224	Bacteria	1378156
230	Ga0209566_100004	3300025225	Bacteria	1531866
231	Ga0209674_100006	3300025226	Bacteria	1531866
232	Ga0209563_100009	3300025230	Bacteria	1378156
233	Ga0207427_100628	3300025231	Bacteria	17201
234	Ga0209437_100004	3300025233	Bacteria	1378156
235	Ga0209677_100005	3300025253	Bacteria	1378156
236	Ga0209233_1000005	3300025261	Bacteria	1531866
237	Ga0207653_10000846	3300025885	Bacteria	10198
238	Ga0207710_10004502	3300025900	Bacteria	6070
239	Ga0207647_10049861	3300025904	Bacteria	2595
240	Ga0207685_10018193	3300025905	Bacteria	2288
241	Ga0207699_10002047	3300025906	Bacteria	9525
242	Ga0207699_10226745	3300025906	Bacteria	1278
243	Ga0207645_10049372	3300025907	Bacteria	2687
244	Ga0207643_10005761	3300025908	Bacteria	6621
245	Ga0207643_10013256	3300025908	Bacteria	4461
246	Ga0207643_10017769	3300025908	Bacteria	3893
247	Ga0207684_10000704	3300025910	Bacteria	39445
248	Ga0207684_10076673	3300025910	Bacteria	2842
249	Ga0207684_10080286	3300025910	Bacteria	2775
250	Ga0207654_10076314	3300025911	Bacteria	2005
251	Ga0207654_10087546	3300025911	Bacteria	1890
252	Ga0207654_10281556	3300025911	Bacteria	1125
253	Ga0207707_10000030	3300025912	Bacteria	160015
254	Ga0207707_10006032	3300025912	Bacteria	10601
255	Ga0207707_10108207	3300025912	Bacteria	2430
256	Ga0207671_10003948	3300025914	Bacteria	14436
257	Ga0207671_10088356	3300025914	Bacteria	2331
258	Ga0207671_10212153	3300025914	Bacteria	1515
259	Ga0207693_10023542	3300025915	Bacteria	4889
260	Ga0207693_10168418	3300025915	Bacteria	1725
261	Ga0207660_10014229	3300025917	Bacteria	5227
262	Ga0207660_10020666	3300025917	Bacteria	4423
263	Ga0207662_10042363	3300025918	Bacteria	2683
264	Ga0207652_10031516	3300025921	Bacteria	4454
265	Ga0207652_10089862	3300025921	Bacteria	2698
266	Ga0207646_10000251	3300025922	Bacteria	72761
267	Ga0207646_10034058	3300025922	Bacteria	4603
268	Ga0207681_10136428	3300025923	Bacteria	1821
269	Ga0207694_10002814	3300025924	Bacteria	14036
270	Ga0207694_10046077	3300025924	Bacteria	3370
271	Ga0207650_10000001	3300025925	Bacteria	1545726
272	Ga0207650_10000011	3300025925	Bacteria	450115
273	Ga0207650_10165112	3300025925	Bacteria	1756
274	Ga0207650_10220853	3300025925	Bacteria	1525
275	Ga0207659_10166213	3300025926	Bacteria	1736
276	Ga0207687_10005851	3300025927	Bacteria	8133
277	Ga0207687_10054934	3300025927	Bacteria	2788
278	Ga0207687_10425985	3300025927	Bacteria	1096
279	Ga0207700_10015550	3300025928	Bacteria	5024
280	Ga0207700_10309917	3300025928	Bacteria	1365
281	Ga0207664_10000993	3300025929	Bacteria	19046
282	Ga0207664_10044057	3300025929	Bacteria	3492
283	Ga0207644_10035093	3300025931	Bacteria	3512
284	Ga0207644_10113038	3300025931	Bacteria	2056
285	Ga0207644_10202263	3300025931	Bacteria	1567
286	Ga0207690_10031355	3300025932	Bacteria	3400
287	Ga0207706_10116269	3300025933	Bacteria	2352
288	Ga0207706_10175469	3300025933	Bacteria	1883
289	Ga0207706_10187212	3300025933	Bacteria	1817
290	Ga0207706_10322917	3300025933	Bacteria	1343
291	Ga0207686_10039849	3300025934	Bacteria	2852
292	Ga0207709_10019433	3300025935	Bacteria	3820
293	Ga0207709_10237922	3300025935	Bacteria	1323
294	Ga0207670_10000154	3300025936	Bacteria	45331
295	Ga0207669_10321668	3300025937	Bacteria	1184
296	Ga0207704_10244375	3300025938	Bacteria	1343
297	Ga0207665_10000439	3300025939	Bacteria	28569
298	Ga0207665_10006587	3300025939	Bacteria	7700
299	Ga0207665_10154060	3300025939	Bacteria	1648
300	Ga0207691_10000633	3300025940	Bacteria	34794
301	Ga0207691_10036557	3300025940	Bacteria	4551
302	Ga0207711_10004510	3300025941	Bacteria	11860
303	Ga0207711_10068302	3300025941	Bacteria	3078
304	Ga0207711_10092823	3300025941	Bacteria	2657
305	Ga0207711_10149155	3300025941	Bacteria	2109
306	Ga0207711_10240239	3300025941	Bacteria	1660
307	Ga0207711_10262837	3300025941	Bacteria	1587
308	Ga0207689_10093430	3300025942	Bacteria	2471
309	Ga0207689_10419332	3300025942	Bacteria	1117
310	Ga0207661_10162505	3300025944	Bacteria	1938
311	Ga0207651_10031703	3300025960	Bacteria	3383
312	Ga0207712_10002602	3300025961	Bacteria	11577
313	Ga0207712_10009581	3300025961	Bacteria	6133
314	Ga0207712_10092692	3300025961	Bacteria	2228
315	Ga0207640_10150711	3300025981	Bacteria	1708
316	Ga0207703_10060741	3300026035	Bacteria	3091
317	Ga0207703_10096578	3300026035	Bacteria	2495
318	Ga0207708_10000130	3300026075	Bacteria	58987
319	Ga0207708_10112492	3300026075	Bacteria	2115
320	Ga0207702_10072216	3300026078	Bacteria	2974
321	Ga0207702_10097681	3300026078	Bacteria	2585
322	Ga0207641_10055530	3300026088	Bacteria	3363
323	Ga0207648_10008828	3300026089	Bacteria	9707
324	Ga0207648_10042852	3300026089	Bacteria	3974
325	Ga0207648_10158461	3300026089	Bacteria	1999
326	Ga0207676_10000026	3300026095	Bacteria	248593
327	Ga0207676_10026942	3300026095	Bacteria	4276
328	Ga0207676_10118599	3300026095	Bacteria	2227
329	Ga0207676_10334685	3300026095	Bacteria	1394
330	Ga0207676_10456537	3300026095	Bacteria	1205
331	Ga0207674_10542802	3300026116	Bacteria	1123
332	Ga0207675_100002441	3300026118	Bacteria	18409
333	Ga0207675_100036291	3300026118	Bacteria	4599
334	Ga0207675_100081904	3300026118	Bacteria	3026
335	Ga0207675_100553022	3300026118	Bacteria	1150
336	Ga0207683_10002733	3300026121	Bacteria	15408
337	Ga0207683_10021332	3300026121	Bacteria	5544
338	Ga0207683_10167429	3300026121	Bacteria	1989
339	Ga0207698_10410752	3300026142	Bacteria	1296
340	Ga0207428_10002260	3300027907	Bacteria	19336
341	Ga0268266_10203276	3300028379	Bacteria	1814
342	Ga0268265_10027715	3300028380	Bacteria	4047
343	Ga0268265_10086401	3300028380	Bacteria	2493
344	Ga0268264_10052100	3300028381	Bacteria	3412
345	Ga0268264_10254782	3300028381	Bacteria	1632
346	Ga0268264_10399704	3300028381	Bacteria	1320
347	Ga0265331_10038083	3300031250	Bacteria	2352
348	Ga0265327_10000886	3300031251	Bacteria	44160
349	Ga0307408_100009144	3300031548	Bacteria	6535
350	Ga0307408_100161880	3300031548	Bacteria	1778
351	Ga0307413_10058378	3300031824	Bacteria	2365
352	Ga0307410_10007535	3300031852	Bacteria	5966
353	Ga0307406_10003808	3300031901	Bacteria	8214
354	Ga0307407_10005894	3300031903	Bacteria	5378
355	Ga0307407_10122559	3300031903	Bacteria	1651
356	Ga0307412_10008311	3300031911	Bacteria	5916
357	Ga0307409_100039498	3300031995	Bacteria	3503
358	Ga0307416_100032118	3300032002	Bacteria	3962
359	Ga0307414_10006323	3300032004	Bacteria	6594
360	Ga0307414_10042214	3300032004	Bacteria	3097
361	Ga0307411_10002572	3300032005	Bacteria	8094
362	Ga0307415_100004828	3300032126	Bacteria	7066
363	Ga0373951_0001414	3300035091	Bacteria	6306
364	Ga0373947_0247973	3300035725	Bacteria	1177
365	Ga0373937_0068912	3300036401	Bacteria	3261
366	Ga0395900_0016448	3300037418	Bacteria	7543
367	Ga0395900_0049830	3300037418	Bacteria	4315
368	Ga0395900_0138103	3300037418	Bacteria	2497
369	Ga0395900_0166855	3300037418	Bacteria	2243
370	Ga0395898_0224664	3300037466	Bacteria	1791
371	Ga0395898_0362320	3300037466	Bacteria	1382
372	Ga0395905_0023264	3300037471	Bacteria	5858
373	Ga0395905_0112903	3300037471	Bacteria	2552
374	Ga0395905_0164020	3300037471	Bacteria	2088
375	Ga0436364_1077934	3300037853	Bacteria	38430
376	Ga0436364_1180183	3300037853	Bacteria	1287
377	Ga0395901_0014598	3300038443	Bacteria	7983
378	Ga0395901_0066864	3300038443	Bacteria	3743
379	Ga0395901_0347782	3300038443	Bacteria	1530
380	Ga0395901_0375923	3300038443	Bacteria	1463
381	Ga0242420_013424	3300038996	Bacteria	1396
382	Ga0436365_1137642	3300039437	Bacteria	1312
383	Ga0439455_0010086	3300042012	Bacteria	2067
384	Ga0439458_0007123	3300042157	Bacteria	2489
385	Ga0466961_0001813	3300044693	Bacteria	13245
386	Ga0466971_0024959	3300044719	Bacteria	2669
387	Ga0466957_0020118	3300044842	Bacteria	3928
388	Ga0466959_0011433	3300045049	Bacteria	6379
389	Ga0466958_0015627	3300045836	Bacteria	4353
390	Ga0495629_0021848	3300046459	Bacteria	4566
391	Ga0495641_0081843	3300046461	Bacteria	1446
392	Ga0495582_0091351	3300046473	Bacteria	1698
393	Ga0495608_0000810	3300046511	Bacteria	21947
394	Ga0495618_0023536	3300046514	Bacteria	3810
395	Ga0495628_0010752	3300046516	Bacteria	7752
396	Ga0495586_0054218	3300046535	Bacteria	2173
397	Ga0495586_0204271	3300046535	Bacteria	1121
398	Ga0495657_0077398	3300046675	Bacteria	2158
399	Ga0495623_0089758	3300046679	Bacteria	1888
400	Ga0495646_0002263	3300046680	Bacteria	11772
401	Ga0495613_0107731	3300046689	Bacteria	2010
402	Ga0495624_0001526	3300046690	Bacteria	17943
403	Ga0495604_0075816	3300047317	Bacteria	2531
404	Ga0495684_0070709	3300047471	Bacteria	2653
405	Ga0495602_0033011	3300048088	Bacteria	4863
406	Ga0496100_0125594	3300048903	Bacteria	1800
407	Ga0496101_0003723	3300048904	Bacteria	9511
408	Ga0496101_0070954	3300048904	Bacteria	2552
409	Ga0496102_0001896	3300048905	Bacteria	18032
410	Ga0496102_0149022	3300048905	Bacteria	2197
411	Ga0496103_0010391	3300048906	Bacteria	5508
412	Ga0496104_0003518	3300048907	Bacteria	13506
413	Ga0496104_0169867	3300048907	Bacteria	2091
414	Ga0496105_0000090	3300048908	Bacteria	63276
415	Ga0496105_0054249	3300048908	Bacteria	3310
416	Ga0496105_0108016	3300048908	Bacteria	2297
417	Ga0496106_0140007	3300048909	Bacteria	1903
418	Ga0496106_0160834	3300048909	Bacteria	1776
419	Ga0496106_0187142	3300048909	Bacteria	1645
420	Ga0496106_0310388	3300048909	Bacteria	1265
421	Ga0496107_0029856	3300048910	Bacteria	3882
422	Ga0496107_0076152	3300048910	Bacteria	2443
423	Ga0496107_0085050	3300048910	Unclassified	2308
424	Ga0496108_0001465	3300048911	Bacteria	18642
425	Ga0496108_0019932	3300048911	Bacteria	5508
426	Ga0496108_0050821	3300048911	Bacteria	3472
427	Ga0496108_0602485	3300048911	Bacteria	957
428	Ga0496109_0000787	3300048912	Bacteria	26394
429	Ga0496109_0001506	3300048912	Bacteria	19379
430	Ga0496109_0141532	3300048912	Bacteria	2249
431	Ga0496109_0447234	3300048912	Bacteria	1221
432	Ga0496110_0002074	3300048913	Bacteria	14941
433	Ga0496110_0027433	3300048913	Bacteria	4882
434	Ga0496110_0092068	3300048913	Bacteria	2713
435	Ga0496110_0276773	3300048913	Bacteria	1528
436	Ga0496111_0000578	3300048914	Bacteria	19157
437	Ga0496111_0005442	3300048914	Bacteria	8158
438	Ga0496112_0088657	3300048915	Bacteria	3062
439	Ga0496112_0165044	3300048915	Bacteria	2181
440	Ga0496112_0259036	3300048915	Bacteria	1689
441	Ga0496113_0094207	3300048916	Bacteria	2313
442	Ga0496113_0294386	3300048916	Bacteria	1299
443	Ga0496114_0000776	3300048917	Bacteria	23842
444	Ga0496114_0008396	3300048917	Bacteria	8182
445	Ga0496114_0027896	3300048917	Bacteria	4628
446	Ga0496115_0018111	3300048918	Bacteria	5399
447	Ga0501033_0050390	3300049570	Bacteria	3089
448	Ga0501034_0054873	3300049571	Bacteria	4011
449	Ga0501036_0003166	3300049572	Bacteria	13134
450	Ga0501038_0005858	3300049574	Bacteria	11368
451	Ga0501039_0034432	3300049575	Bacteria	3908
452	Ga0501040_0017963	3300049576	Bacteria	4694
453	Ga0501040_0134237	3300049576	Bacteria	1742
454	Ga0501041_0039677	3300049577	Bacteria	2857
455	Ga0501042_0091588	3300049578	Bacteria	2182
456	Ga0501046_0017759	3300049580	Bacteria	5934
457	Ga0501048_0041357	3300049582	Bacteria	3301
458	Ga0501048_0061511	3300049582	Bacteria	2659
459	Ga0501068_0035705	3300049584	Bacteria	2968
460	Ga0501069_0041889	3300049585	Bacteria	2532
461	Ga0501070_0103057	3300049586	Bacteria	2360
462	Ga0501074_0006587	3300049590	Bacteria	8399
463	Ga0501076_0062321	3300049592	Bacteria	2969
464	Ga0501077_0007980	3300049593	Bacteria	6543
465	Ga0501077_0038025	3300049593	Bacteria	3063
466	Ga0501077_0043078	3300049593	Bacteria	2869
467	Ga0501202_001397	3300049652	Bacteria	3869
468	Ga0501207_000223	3300049654	Bacteria	5760
469	Ga0501209_019806	3300049656	Bacteria	1577
470	Ga0501217_000694	3300049661	Bacteria	5772
471	Ga0501223_000861	3300049663	Bacteria	7198
472	Ga0501223_023929	3300049663	Bacteria	1190
473	Ga0501223_028632	3300049663	Bacteria	1084
474	Ga0501224_007519	3300049664	Bacteria	1587
475	Ga0501227_020707	3300049665	Bacteria	1511
476	Ga0501233_001215	3300049668	Bacteria	4386
477	Ga0501225_0003255	3300049705	Bacteria	4957
478	Ga0501225_0016329	3300049705	Bacteria	2064
479	Ga0501234_001519	3300049707	Bacteria	3641
480	Ga0501234_002097	3300049707	Bacteria	3153
481	Ga0501079_0020469	3300049741	Bacteria	5058
482	Ga0501081_0027248	3300049743	Bacteria	3854
483	Ga0501081_0282661	3300049743	Bacteria	1215
484	Ga0501083_0025686	3300049744	Bacteria	4077
485	Ga0501273_000581	3300049770	Bacteria	3018
486	Ga0501035_0004707	3300049822	Bacteria	12955
487	Ga0501045_0026985	3300049824	Bacteria	4134
488	Ga0501226_000360	3300049853	Bacteria	6637
489	nmdc:mga05p37_183031_c1	3300050507	Bacteria	2548
490	nmdc:mga09592_246582_c1	3300050508	Bacteria	1548
491	nmdc:mga08y16_396840_c1	3300050511	Bacteria	1412
492	nmdc:mga08y16_6872_c1	3300050511	Bacteria	11932
493	nmdc:mga0n895_228942_c1	3300050512	Bacteria	1887
494	nmdc:mga0n895_234784_c2	3300050512	Bacteria	1346
495	nmdc:mga0n895_310928_c1	3300050512	Bacteria	1597
496	nmdc:mga0rr50_149152_c1	3300050513	Bacteria	1888
497	nmdc:mga08x19_20373_c1	3300050514	Bacteria	4083
498	nmdc:mga08x19_4979_c1	3300050514	Bacteria	1919
499	nmdc:mga0a205_181964_c1	3300050515	Bacteria	1996
500	nmdc:mga0a205_198347_c1	3300050515	Bacteria	1898
501	nmdc:mga0a205_234591_c1	3300050515	Bacteria	1717
502	nmdc:mga0a205_319838_c1	3300050515	Bacteria	1423
503	nmdc:mga0a205_6644_c1	3300050515	Bacteria	10469
504	nmdc:mga0a205_81087_c1	3300050515	Bacteria	3134
505	nmdc:mga0a205_98656_c1	3300050515	Bacteria	2820
506	Ga0495601_0000337	3300053077	Bacteria	24639
507	Ga0500595_000975	3300053119	Bacteria	16073
508	Ga0500619_000036	3300053154	Bacteria	41573
509	Ga0500637_0006937	3300053178	Bacteria	5630
510	Ga0501084_0003436	3300054114	Bacteria	12855
511	Ga0501084_0299685	3300054114	Bacteria	1358
512	Ga0501082_0095244	3300060353	Bacteria	2572
513	Ga0501082_0408078	3300060353	Bacteria	1186
514	Ga0466962_0018336	3300061719	Bacteria	3366
515	Ga0530510_0017016	3300061734	Bacteria	5150
516	Ga0530510_0027398	3300061734	Bacteria	4082
517	Ga0530510_0070115	3300061734	Bacteria	2544

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300060353	Ga0501082_0408078	Ga0501082_0408078_86_877	256
2	3300026121	Ga0207683_10021332	Ga0207683_100213322	269
3	3300038443	Ga0395901_0347782	Ga0395901_0347782_29_853	269
4	3300050515	nmdc:mga0a205_319838_c1	nmdc:mga0a205_319838_c1_566_1378	269
5	3300035725	Ga0373947_0247973	Ga0373947_0247973_210_1076	281
6	3300046459	Ga0495629_0021848	Ga0495629_0021848_3428_4294	281
7	3300046461	Ga0495641_0081843	Ga0495641_0081843_205_1071	281
8	3300046473	Ga0495582_0091351	Ga0495582_0091351_362_1228	281
9	3300048904	Ga0496101_0070954	Ga0496101_0070954_336_1208	281
10	3300048905	Ga0496102_0001896	Ga0496102_0001896_1208_2080	281
11	3300048906	Ga0496103_0010391	Ga0496103_0010391_2310_3182	281
12	3300048908	Ga0496105_0054249	Ga0496105_0054249_897_1769	281
13	3300048917	Ga0496114_0000776	Ga0496114_0000776_1280_2152	281
14	3300048917	Ga0496114_0027896	Ga0496114_0027896_1989_2861	281
15	3300048918	Ga0496115_0018111	Ga0496115_0018111_4205_5077	281
16	3300005336	Ga0070680_100016677	Ga0070680_1000166773	285
17	3300005339	Ga0070660_100334814	Ga0070660_1003348142	285
18	3300005356	Ga0070674_100092175	Ga0070674_1000921752	285
19	3300005366	Ga0070659_100195006	Ga0070659_1001950061	285
20	3300005456	Ga0070678_100009379	Ga0070678_1000093794	285
21	3300005458	Ga0070681_10001644	Ga0070681_100016446	285
22	3300005535	Ga0070684_100000327	Ga0070684_10000032711	285
23	3300005535	Ga0070684_100275188	Ga0070684_1002751882	285
24	3300005546	Ga0070696_100189825	Ga0070696_1001898252	285
25	3300005547	Ga0070693_100078141	Ga0070693_1000781411	285
26	3300005614	Ga0068856_100163399	Ga0068856_1001633992	285
27	3300005937	Ga0081455_10094800	Ga0081455_100948002	285
28	3300006358	Ga0068871_100207259	Ga0068871_1002072592	285
29	3300009098	Ga0105245_10111579	Ga0105245_101115792	285
30	3300010375	Ga0105239_10115739	Ga0105239_101157392	285
31	3300013296	Ga0157374_10077250	Ga0157374_100772503	285
32	3300013297	Ga0157378_10118780	Ga0157378_101187802	285
33	3300013306	Ga0163162_10360906	Ga0163162_103609062	285
34	3300013308	Ga0157375_10638580	Ga0157375_106385802	285
35	3300025912	Ga0207707_10006032	Ga0207707_100060325	285
36	3300025917	Ga0207660_10020666	Ga0207660_100206663	285
37	3300025927	Ga0207687_10005851	Ga0207687_100058516	285
38	3300025927	Ga0207687_10054934	Ga0207687_100549342	285
39	3300025927	Ga0207687_10425985	Ga0207687_104259852	285
40	3300025933	Ga0207706_10187212	Ga0207706_101872122	285
41	3300025933	Ga0207706_10322917	Ga0207706_103229171	285
42	3300025937	Ga0207669_10321668	Ga0207669_103216682	285
43	3300025944	Ga0207661_10162505	Ga0207661_101625052	285
44	3300026078	Ga0207702_10072216	Ga0207702_100722162	285
45	3300026121	Ga0207683_10002733	Ga0207683_1000273314	285
46	3300026121	Ga0207683_10167429	Ga0207683_101674292	285
47	3300037418	Ga0395900_0138103	Ga0395900_0138103_708_1586	285
48	3300037466	Ga0395898_0224664	Ga0395898_0224664_68_946	285
49	3300038443	Ga0395901_0066864	Ga0395901_0066864_636_1514	285
50	3300046535	Ga0495586_0054218	Ga0495586_0054218_732_1610	285
51	3300046689	Ga0495613_0107731	Ga0495613_0107731_210_1088	285
52	3300048903	Ga0496100_0125594	Ga0496100_0125594_229_1113	285
53	3300048904	Ga0496101_0003723	Ga0496101_0003723_5014_5898	285
54	3300048907	Ga0496104_0003518	Ga0496104_0003518_10804_11688	285
55	3300048908	Ga0496105_0000090	Ga0496105_0000090_18012_18896	285
56	3300048908	Ga0496105_0108016	Ga0496105_0108016_324_1202	285
57	3300048909	Ga0496106_0187142	Ga0496106_0187142_69_947	285
58	3300048910	Ga0496107_0029856	Ga0496107_0029856_661_1545	285
59	3300048910	Ga0496107_0076152	Ga0496107_0076152_324_1202	285
60	3300048911	Ga0496108_0001465	Ga0496108_0001465_17360_18238	285
61	3300048911	Ga0496108_0019932	Ga0496108_0019932_3406_4290	285
62	3300048912	Ga0496109_0000787	Ga0496109_0000787_8902_9786	285
63	3300048912	Ga0496109_0001506	Ga0496109_0001506_15250_16128	285
64	3300048912	Ga0496109_0141532	Ga0496109_0141532_800_1684	285
65	3300048913	Ga0496110_0002074	Ga0496110_0002074_6989_7873	285
66	3300048913	Ga0496110_0027433	Ga0496110_0027433_1486_2364	285
67	3300048913	Ga0496110_0276773	Ga0496110_0276773_561_1439	285
68	3300048914	Ga0496111_0000578	Ga0496111_0000578_1252_2130	285
69	3300048914	Ga0496111_0005442	Ga0496111_0005442_5031_5915	285
70	3300048915	Ga0496112_0088657	Ga0496112_0088657_1462_2346	285
71	3300048916	Ga0496113_0094207	Ga0496113_0094207_1306_2190	285
72	3300048917	Ga0496114_0008396	Ga0496114_0008396_5031_5915	285
73	3300049663	Ga0501223_028632	Ga0501223_028632_166_1068	298
74	3300046535	Ga0495586_0204271	Ga0495586_0204271_188_1108	299
75	3300048911	Ga0496108_0602485	Ga0496108_0602485_38_940	299
76	3300025911	Ga0207654_10087546	Ga0207654_100875461	307
77	3300025915	Ga0207693_10168418	Ga0207693_101684182	307
78	3300026118	Ga0207675_100553022	Ga0207675_1005530222	307
79	3300047471	Ga0495684_0070709	Ga0495684_0070709_1620_2567	308
80	3300049576	Ga0501040_0134237	Ga0501040_0134237_614_1600	309
81	3300049593	Ga0501077_0043078	Ga0501077_0043078_1299_2285	314
82	3300009174	Ga0105241_10162647	Ga0105241_101626472	315
83	3300013100	Ga0157373_10006086	Ga0157373_100060864	315
84	3300049743	Ga0501081_0282661	Ga0501081_0282661_84_1109	315
85	3300009551	Ga0105238_10000560	Ga0105238_1000056011	317
86	3300025924	Ga0207694_10002814	Ga0207694_100028144	317
87	3300005436	Ga0070713_100397512	Ga0070713_1003975121	318
88	3300005439	Ga0070711_100134116	Ga0070711_1001341162	318
89	3300025928	Ga0207700_10309917	Ga0207700_103099172	318
90	3300036401	Ga0373937_0068912	Ga0373937_0068912_1230_2207	318
91	3300005437	Ga0070710_10002632	Ga0070710_100026325	319
92	3300025921	Ga0207652_10031516	Ga0207652_100315162	319
93	3300014745	Ga0157377_10316255	Ga0157377_103162551	321
94	3300026116	Ga0207674_10542802	Ga0207674_105428021	321
95	3300026118	Ga0207675_100036291	Ga0207675_1000362911	321
96	3300048909	Ga0496106_0140007	Ga0496106_0140007_846_1853	321
97	3300050511	nmdc:mga08y16_396840_c1	nmdc:mga08y16_396840_c1_312_1292	321
98	3300054114	Ga0501084_0299685	Ga0501084_0299685_98_1084	321
99	3300061734	Ga0530510_0070115	Ga0530510_0070115_206_1192	321
100	3300005467	Ga0070706_100224121	Ga0070706_1002241212	322
101	3300005546	Ga0070696_100063349	Ga0070696_1000633492	322
102	3300006871	Ga0075434_100110520	Ga0075434_1001105202	322
103	3300025910	Ga0207684_10076673	Ga0207684_100766733	322
104	3300013100	Ga0157373_10013702	Ga0157373_100137024	324
105	3300037418	Ga0395900_0049830	Ga0395900_0049830_2507_3586	324
106	3300037471	Ga0395905_0164020	Ga0395905_0164020_630_1709	324
107	3300038443	Ga0395901_0014598	Ga0395901_0014598_2145_3224	324
108	3300048909	Ga0496106_0160834	Ga0496106_0160834_402_1406	324
109	3300048913	Ga0496110_0092068	Ga0496110_0092068_1270_2259	324
110	3300050515	nmdc:mga0a205_198347_c1	nmdc:mga0a205_198347_c1_491_1480	324
111	3300005331	Ga0070670_100122331	Ga0070670_1001223312	325
112	3300005617	Ga0068859_100079168	Ga0068859_1000791682	325
113	3300005840	Ga0068870_10009617	Ga0068870_100096172	325
114	3300005844	Ga0068862_100035096	Ga0068862_1000350962	325
115	3300006931	Ga0097620_100079168	Ga0097620_1000791683	325
116	3300025908	Ga0207643_10013256	Ga0207643_100132564	325
117	3300025925	Ga0207650_10220853	Ga0207650_102208531	325
118	3300028380	Ga0268265_10027715	Ga0268265_100277153	325
119	3300035091	Ga0373951_0001414	Ga0373951_0001414_422_1432	327
120	iso_pu_bacteria	2739367655	2739612494	328
121	3300005364	Ga0070673_100172339	Ga0070673_1001723392	329
122	iso_pu_bacteria	2617270889	2617912499	329
123	iso_pu_bacteria	642555144	642602087	329
124	3300005293	Ga0065715_10001117	Ga0065715_100011173	330
125	3300005459	Ga0068867_100109852	Ga0068867_1001098522	330
126	3300037418	Ga0395900_0016448	Ga0395900_0016448_6336_7343	330
127	3300037418	Ga0395900_0166855	Ga0395900_0166855_508_1515	330
128	3300037471	Ga0395905_0023264	Ga0395905_0023264_728_1735	330
129	3300037471	Ga0395905_0112903	Ga0395905_0112903_810_1817	330
130	3300046511	Ga0495608_0000810	Ga0495608_0000810_20167_21189	330
131	3300046514	Ga0495618_0023536	Ga0495618_0023536_112_1134	330
132	3300046516	Ga0495628_0010752	Ga0495628_0010752_366_1388	330
133	3300046675	Ga0495657_0077398	Ga0495657_0077398_520_1542	330
134	3300046679	Ga0495623_0089758	Ga0495623_0089758_188_1210	330
135	3300046680	Ga0495646_0002263	Ga0495646_0002263_5935_6957	330
136	3300046690	Ga0495624_0001526	Ga0495624_0001526_11852_12874	330
137	3300047317	Ga0495604_0075816	Ga0495604_0075816_1172_2194	330
138	3300048088	Ga0495602_0033011	Ga0495602_0033011_2675_3697	330
139	3300049582	Ga0501048_0061511	Ga0501048_0061511_372_1376	330
140	3300050515	nmdc:mga0a205_234591_c1	nmdc:mga0a205_234591_c1_651_1658	330
141	3300053077	Ga0495601_0000337	Ga0495601_0000337_15845_16867	330
142	3300053119	Ga0500595_000975	Ga0500595_000975_13574_14596	330
143	3300053154	Ga0500619_000036	Ga0500619_000036_22513_23535	330
144	3300032004	Ga0307414_10042214	Ga0307414_100422143	332
145	3300049570	Ga0501033_0050390	Ga0501033_0050390_1122_2144	332
146	3300049572	Ga0501036_0003166	Ga0501036_0003166_9588_10610	332
147	3300049574	Ga0501038_0005858	Ga0501038_0005858_465_1487	332
148	3300049575	Ga0501039_0034432	Ga0501039_0034432_1012_2034	332
149	3300049576	Ga0501040_0017963	Ga0501040_0017963_2696_3718	332
150	3300049577	Ga0501041_0039677	Ga0501041_0039677_1043_2065	332
151	3300049578	Ga0501042_0091588	Ga0501042_0091588_277_1299	332
152	3300049580	Ga0501046_0017759	Ga0501046_0017759_4496_5518	332
153	3300049582	Ga0501048_0041357	Ga0501048_0041357_1237_2259	332
154	3300049584	Ga0501068_0035705	Ga0501068_0035705_628_1650	332
155	3300049585	Ga0501069_0041889	Ga0501069_0041889_534_1556	332
156	3300049586	Ga0501070_0103057	Ga0501070_0103057_586_1608	332
157	3300049590	Ga0501074_0006587	Ga0501074_0006587_5408_6430	332
158	3300049592	Ga0501076_0062321	Ga0501076_0062321_1129_2151	332
159	3300049593	Ga0501077_0007980	Ga0501077_0007980_1448_2473	332
160	3300049593	Ga0501077_0038025	Ga0501077_0038025_1374_2396	332
161	3300049741	Ga0501079_0020469	Ga0501079_0020469_480_1502	332
162	3300049743	Ga0501081_0027248	Ga0501081_0027248_1319_2341	332
163	3300049744	Ga0501083_0025686	Ga0501083_0025686_1001_2023	332
164	3300049822	Ga0501035_0004707	Ga0501035_0004707_4974_5996	332
165	3300049824	Ga0501045_0026985	Ga0501045_0026985_1883_2905	332
166	3300054114	Ga0501084_0003436	Ga0501084_0003436_9673_10695	332
167	3300060353	Ga0501082_0095244	Ga0501082_0095244_509_1531	332
168	3300061734	Ga0530510_0027398	Ga0530510_0027398_1509_2531	332
169	3300000532	CNAas_1001132	CNAas_10011322	333
170	3300002459	JGI24751J29686_10000065	JGI24751J29686_1000006515	333
171	3300002459	JGI24751J29686_10000066	JGI24751J29686_1000006631	333
172	3300005288	Ga0065714_10064478	Ga0065714_1006447819	333
173	3300005290	Ga0065712_10000121	Ga0065712_1000012154	333
174	3300005293	Ga0065715_10008140	Ga0065715_100081404	333
175	3300005293	Ga0065715_10089423	Ga0065715_100894237	333
176	3300005331	Ga0070670_100000244	Ga0070670_1000002447	333
177	3300005331	Ga0070670_100274355	Ga0070670_1002743552	333
178	3300005337	Ga0070682_100102519	Ga0070682_1001025191	333
179	3300005435	Ga0070714_100048809	Ga0070714_1000488092	333
180	3300005440	Ga0070705_100019525	Ga0070705_1000195254	333
181	3300005441	Ga0070700_100000068	Ga0070700_10000006835	333
182	3300005467	Ga0070706_100000055	Ga0070706_10000005583	333
183	3300005467	Ga0070706_100142196	Ga0070706_1001421962	333
184	3300005539	Ga0068853_100195039	Ga0068853_1001950392	333
185	3300005546	Ga0070696_100036592	Ga0070696_1000365923	333
186	3300005547	Ga0070693_100015762	Ga0070693_1000157623	333
187	3300005547	Ga0070693_100027637	Ga0070693_1000276374	333
188	3300005577	Ga0068857_100022476	Ga0068857_1000224762	333
189	3300005615	Ga0070702_100020123	Ga0070702_1000201232	333
190	3300005617	Ga0068859_100001086	Ga0068859_10000108613	333
191	3300005617	Ga0068859_100104230	Ga0068859_1001042302	333
192	3300005618	Ga0068864_100190768	Ga0068864_1001907681	333
193	3300005618	Ga0068864_100591835	Ga0068864_1005918351	333
194	3300005842	Ga0068858_100073701	Ga0068858_1000737012	333
195	3300005842	Ga0068858_100177239	Ga0068858_1001772392	333
196	3300006358	Ga0068871_100119715	Ga0068871_1001197152	333
197	3300006846	Ga0075430_100038433	Ga0075430_1000384333	333
198	3300006847	Ga0075431_100223756	Ga0075431_1002237561	333
199	3300006914	Ga0075436_100122555	Ga0075436_1001225552	333
200	3300006931	Ga0097620_100001086	Ga0097620_1000010865	333
201	3300006931	Ga0097620_100104229	Ga0097620_1001042292	333
202	3300007076	Ga0075435_100013018	Ga0075435_1000130183	333
203	3300009101	Ga0105247_10001252	Ga0105247_100012528	333
204	3300009147	Ga0114129_10411598	Ga0114129_104115982	333
205	3300009147	Ga0114129_10543372	Ga0114129_105433722	333
206	3300009177	Ga0105248_10011851	Ga0105248_100118514	333
207	3300009551	Ga0105238_10005969	Ga0105238_100059693	333
208	3300013105	Ga0157369_10063430	Ga0157369_100634303	333
209	3300014325	Ga0163163_10000121	Ga0163163_1000012125	333
210	3300014745	Ga0157377_10017118	Ga0157377_100171181	333
211	3300020080	Ga0206350_10875308	Ga0206350_108753082	333
212	3300021388	Ga0213875_10000378	Ga0213875_100003782	333
213	3300022467	Ga0224712_10001570	Ga0224712_100015704	333
214	3300025900	Ga0207710_10004502	Ga0207710_100045025	333
215	3300025906	Ga0207699_10226745	Ga0207699_102267452	333
216	3300025908	Ga0207643_10005761	Ga0207643_100057613	333
217	3300025910	Ga0207684_10000704	Ga0207684_100007043	333
218	3300025924	Ga0207694_10046077	Ga0207694_100460773	333
219	3300025925	Ga0207650_10000001	Ga0207650_100000011041	333
220	3300025929	Ga0207664_10000993	Ga0207664_100009932	333
221	3300025939	Ga0207665_10154060	Ga0207665_101540602	333
222	3300025941	Ga0207711_10068302	Ga0207711_100683022	333
223	3300025941	Ga0207711_10240239	Ga0207711_102402392	333
224	3300026035	Ga0207703_10096578	Ga0207703_100965783	333
225	3300026075	Ga0207708_10000130	Ga0207708_1000013022	333
226	3300026095	Ga0207676_10334685	Ga0207676_103346852	333
227	3300028381	Ga0268264_10399704	Ga0268264_103997042	333
228	3300031548	Ga0307408_100009144	Ga0307408_1000091443	333
229	3300031824	Ga0307413_10058378	Ga0307413_100583782	333
230	3300031852	Ga0307410_10007535	Ga0307410_100075352	333
231	3300031901	Ga0307406_10003808	Ga0307406_100038083	333
232	3300031903	Ga0307407_10005894	Ga0307407_100058944	333
233	3300031903	Ga0307407_10122559	Ga0307407_101225592	333
234	3300031911	Ga0307412_10008311	Ga0307412_100083113	333
235	3300031995	Ga0307409_100039498	Ga0307409_1000394983	333
236	3300032002	Ga0307416_100032118	Ga0307416_1000321183	333
237	3300032004	Ga0307414_10006323	Ga0307414_100063232	333
238	3300032005	Ga0307411_10002572	Ga0307411_100025724	333
239	3300032126	Ga0307415_100004828	Ga0307415_1000048285	333
240	3300037466	Ga0395898_0362320	Ga0395898_0362320_69_1088	333
241	3300037853	Ga0436364_1077934	Ga0436364_1077934_35421_36446	333
242	3300037853	Ga0436364_1180183	Ga0436364_1180183_120_1130	333
243	3300038443	Ga0395901_0375923	Ga0395901_0375923_68_1087	333
244	3300048915	Ga0496112_0259036	Ga0496112_0259036_96_1103	333
245	3300049571	Ga0501034_0054873	Ga0501034_0054873_118_1155	333
246	3300049652	Ga0501202_001397	Ga0501202_001397_2399_3406	333
247	3300049654	Ga0501207_000223	Ga0501207_000223_3315_4322	333
248	3300049656	Ga0501209_019806	Ga0501209_019806_124_1131	333
249	3300049661	Ga0501217_000694	Ga0501217_000694_3380_4387	333
250	3300049663	Ga0501223_000861	Ga0501223_000861_1562_2569	333
251	3300049664	Ga0501224_007519	Ga0501224_007519_394_1401	333
252	3300049665	Ga0501227_020707	Ga0501227_020707_491_1498	333
253	3300049668	Ga0501233_001215	Ga0501233_001215_1539_2546	333
254	3300049705	Ga0501225_0003255	Ga0501225_0003255_535_1542	333
255	3300049705	Ga0501225_0016329	Ga0501225_0016329_710_1717	333
256	3300049707	Ga0501234_001519	Ga0501234_001519_2403_3410	333
257	3300049770	Ga0501273_000581	Ga0501273_000581_1221_2228	333
258	3300049853	Ga0501226_000360	Ga0501226_000360_4218_5225	333
259	3300050512	nmdc:mga0n895_310928_c1	nmdc:mga0n895_310928_c1_202_1209	333
260	3300050513	nmdc:mga0rr50_149152_c1	nmdc:mga0rr50_149152_c1_325_1332	333
261	3300050514	nmdc:mga08x19_4979_c1	nmdc:mga08x19_4979_c1_713_1723	333
262	2162886006	SwRhRL3b_contig_2455151	SwRhRL3b_0428.00000520	334
263	3300002459	JGI24751J29686_10000005	JGI24751J29686_1000000568	334
264	3300003214	JGI25165J46597_1000001	JGI25165J46597_1000001761	334
265	3300003751	Ga0055538_1000001	Ga0055538_1000001272	334
266	3300003752	Ga0055539_1000001	Ga0055539_1000001272	334
267	3300003756	Ga0055533_1000003	Ga0055533_1000003761	334
268	3300003759	Ga0055525_1000003	Ga0055525_1000003761	334
269	3300003841	Ga0055541_1000001	Ga0055541_1000001761	334
270	3300005289	Ga0065704_10096790	Ga0065704_100967902	334
271	3300005290	Ga0065712_10076532	Ga0065712_100765323	334
272	3300005293	Ga0065715_10090187	Ga0065715_100901872	334
273	3300005293	Ga0065715_10139910	Ga0065715_101399101	334
274	3300005295	Ga0065707_10091834	Ga0065707_100918342	334
275	3300005328	Ga0070676_10157323	Ga0070676_101573231	334
276	3300005331	Ga0070670_100000616	Ga0070670_1000006162	334
277	3300005331	Ga0070670_100231442	Ga0070670_1002314422	334
278	3300005334	Ga0068869_100118928	Ga0068869_1001189281	334
279	3300005336	Ga0070680_100020549	Ga0070680_1000205493	334
280	3300005337	Ga0070682_100074653	Ga0070682_1000746533	334
281	3300005338	Ga0068868_100085071	Ga0068868_1000850712	334
282	3300005338	Ga0068868_100306765	Ga0068868_1003067651	334
283	3300005340	Ga0070689_100107984	Ga0070689_1001079842	334
284	3300005343	Ga0070687_100049197	Ga0070687_1000491972	334
285	3300005353	Ga0070669_100092091	Ga0070669_1000920912	334
286	3300005355	Ga0070671_100009224	Ga0070671_1000092244	334
287	3300005355	Ga0070671_100221757	Ga0070671_1002217572	334
288	3300005364	Ga0070673_100119621	Ga0070673_1001196212	334
289	3300005364	Ga0070673_100285216	Ga0070673_1002852162	334
290	3300005365	Ga0070688_100044106	Ga0070688_1000441062	334
291	3300005366	Ga0070659_100010147	Ga0070659_1000101474	334
292	3300005367	Ga0070667_100044044	Ga0070667_1000440441	334
293	3300005367	Ga0070667_100044992	Ga0070667_1000449923	334
294	3300005435	Ga0070714_100043310	Ga0070714_1000433103	334
295	3300005439	Ga0070711_100242424	Ga0070711_1002424242	334
296	3300005440	Ga0070705_100008633	Ga0070705_1000086333	334
297	3300005440	Ga0070705_100094465	Ga0070705_1000944652	334
298	3300005444	Ga0070694_100041871	Ga0070694_1000418712	334
299	3300005444	Ga0070694_100212357	Ga0070694_1002123571	334
300	3300005444	Ga0070694_100385824	Ga0070694_1003858241	334
301	3300005458	Ga0070681_10003890	Ga0070681_100038908	334
302	3300005458	Ga0070681_10010093	Ga0070681_100100934	334
303	3300005459	Ga0068867_100011574	Ga0068867_1000115742	334
304	3300005466	Ga0070685_10016120	Ga0070685_100161202	334
305	3300005468	Ga0070707_100031053	Ga0070707_1000310534	334
306	3300005468	Ga0070707_100033829	Ga0070707_1000338294	334
307	3300005471	Ga0070698_100012665	Ga0070698_1000126654	334
308	3300005471	Ga0070698_100019841	Ga0070698_1000198413	334
309	3300005518	Ga0070699_100001348	Ga0070699_10000134813	334
310	3300005518	Ga0070699_100011261	Ga0070699_1000112615	334
311	3300005530	Ga0070679_100000519	Ga0070679_10000051924	334
312	3300005530	Ga0070679_100046441	Ga0070679_1000464412	334
313	3300005543	Ga0070672_100082008	Ga0070672_1000820082	334
314	3300005544	Ga0070686_100015131	Ga0070686_1000151312	334
315	3300005545	Ga0070695_100068868	Ga0070695_1000688682	334
316	3300005546	Ga0070696_100070796	Ga0070696_1000707962	334
317	3300005546	Ga0070696_100118746	Ga0070696_1001187462	334
318	3300005546	Ga0070696_100217101	Ga0070696_1002171011	334
319	3300005547	Ga0070693_100016459	Ga0070693_1000164592	334
320	3300005547	Ga0070693_100022429	Ga0070693_1000224293	334
321	3300005547	Ga0070693_100071541	Ga0070693_1000715412	334
322	3300005548	Ga0070665_100178117	Ga0070665_1001781171	334
323	3300005548	Ga0070665_100296292	Ga0070665_1002962921	334
324	3300005549	Ga0070704_100259946	Ga0070704_1002599462	334
325	3300005564	Ga0070664_100265912	Ga0070664_1002659122	334
326	3300005564	Ga0070664_100337668	Ga0070664_1003376681	334
327	3300005578	Ga0068854_100045555	Ga0068854_1000455552	334
328	3300005578	Ga0068854_100135058	Ga0068854_1001350582	334
329	3300005614	Ga0068856_100183768	Ga0068856_1001837681	334
330	3300005615	Ga0070702_100004996	Ga0070702_1000049963	334
331	3300005616	Ga0068852_100209365	Ga0068852_1002093652	334
332	3300005617	Ga0068859_100033960	Ga0068859_1000339603	334
333	3300005617	Ga0068859_100194124	Ga0068859_1001941242	334
334	3300005617	Ga0068859_100242280	Ga0068859_1002422802	334
335	3300005617	Ga0068859_100561596	Ga0068859_1005615962	334
336	3300005618	Ga0068864_100000201	Ga0068864_10000020137	334
337	3300005618	Ga0068864_100002479	Ga0068864_1000024797	334
338	3300005618	Ga0068864_100057872	Ga0068864_1000578722	334
339	3300005719	Ga0068861_100003599	Ga0068861_1000035994	334
340	3300005841	Ga0068863_100022992	Ga0068863_1000229925	334
341	3300005842	Ga0068858_100092249	Ga0068858_1000922492	334
342	3300005842	Ga0068858_100102165	Ga0068858_1001021652	334
343	3300005842	Ga0068858_100180971	Ga0068858_1001809712	334
344	3300005843	Ga0068860_100071220	Ga0068860_1000712203	334
345	3300005843	Ga0068860_100106391	Ga0068860_1001063912	334
346	3300005843	Ga0068860_100246447	Ga0068860_1002464472	334
347	3300005844	Ga0068862_100037947	Ga0068862_1000379473	334
348	3300005985	Ga0081539_10009519	Ga0081539_100095194	334
349	3300006028	Ga0070717_10041155	Ga0070717_100411553	334
350	3300006028	Ga0070717_10107973	Ga0070717_101079732	334
351	3300006163	Ga0070715_10028041	Ga0070715_100280412	334
352	3300006173	Ga0070716_100000535	Ga0070716_1000005353	334
353	3300006173	Ga0070716_100033552	Ga0070716_1000335521	334
354	3300006237	Ga0097621_100008999	Ga0097621_1000089992	334
355	3300006358	Ga0068871_100095747	Ga0068871_1000957472	334
356	3300006852	Ga0075433_10003838	Ga0075433_100038389	334
357	3300006852	Ga0075433_10044887	Ga0075433_100448872	334
358	3300006852	Ga0075433_10108883	Ga0075433_101088832	334
359	3300006852	Ga0075433_10243120	Ga0075433_102431202	334
360	3300006871	Ga0075434_100000747	Ga0075434_1000007477	334
361	3300006871	Ga0075434_100029936	Ga0075434_1000299362	334
362	3300006871	Ga0075434_100297511	Ga0075434_1002975111	334
363	3300006871	Ga0075434_100297779	Ga0075434_1002977791	334
364	3300006880	Ga0075429_100087428	Ga0075429_1000874281	334
365	3300006880	Ga0075429_100128266	Ga0075429_1001282663	334
366	3300006881	Ga0068865_100040069	Ga0068865_1000400691	334
367	3300006931	Ga0097620_100033959	Ga0097620_1000339593	334
368	3300006931	Ga0097620_100242276	Ga0097620_1002422762	334
369	3300006931	Ga0097620_100561595	Ga0097620_1005615951	334
370	3300007076	Ga0075435_100057148	Ga0075435_1000571482	334
371	3300009094	Ga0111539_10000773	Ga0111539_1000077310	334
372	3300009094	Ga0111539_10060744	Ga0111539_100607444	334
373	3300009094	Ga0111539_10110477	Ga0111539_101104772	334
374	3300009098	Ga0105245_10378739	Ga0105245_103787391	334
375	3300009147	Ga0114129_10153733	Ga0114129_101537332	334
376	3300009148	Ga0105243_10005744	Ga0105243_100057444	334
377	3300009148	Ga0105243_10064230	Ga0105243_100642303	334
378	3300009174	Ga0105241_10124930	Ga0105241_101249302	334
379	3300009174	Ga0105241_10151095	Ga0105241_101510952	334
380	3300009174	Ga0105241_10157312	Ga0105241_101573121	334
381	3300009174	Ga0105241_10303286	Ga0105241_103032862	334
382	3300009177	Ga0105248_10007173	Ga0105248_100071733	334
383	3300009177	Ga0105248_10019758	Ga0105248_100197582	334
384	3300009177	Ga0105248_10158307	Ga0105248_101583071	334
385	3300009177	Ga0105248_10359025	Ga0105248_103590251	334
386	3300009177	Ga0105248_10430008	Ga0105248_104300081	334
387	3300009545	Ga0105237_10000218	Ga0105237_1000021833	334
388	3300009545	Ga0105237_10044306	Ga0105237_100443062	334
389	3300009553	Ga0105249_10005573	Ga0105249_100055732	334
390	3300009553	Ga0105249_10046489	Ga0105249_100464893	334
391	3300011119	Ga0105246_10159470	Ga0105246_101594702	334
392	3300013100	Ga0157373_10025690	Ga0157373_100256902	334
393	3300013297	Ga0157378_10021454	Ga0157378_100214543	334
394	3300013297	Ga0157378_10065870	Ga0157378_100658702	334
395	3300013306	Ga0163162_10011007	Ga0163162_100110072	334
396	3300013306	Ga0163162_10074478	Ga0163162_100744784	334
397	3300013306	Ga0163162_10414845	Ga0163162_104148452	334
398	3300013307	Ga0157372_10228048	Ga0157372_102280482	334
399	3300013308	Ga0157375_10454559	Ga0157375_104545592	334
400	3300014325	Ga0163163_10000767	Ga0163163_100007672	334
401	3300014325	Ga0163163_10001344	Ga0163163_1000134411	334
402	3300014325	Ga0163163_10021546	Ga0163163_100215462	334
403	3300014325	Ga0163163_10102013	Ga0163163_101020132	334
404	3300014325	Ga0163163_10105771	Ga0163163_101057712	334
405	3300014969	Ga0157376_10003754	Ga0157376_100037545	334
406	3300017792	Ga0163161_10006803	Ga0163161_100068032	334
407	3300025224	Ga0209784_100004	Ga0209784_100004755	334
408	3300025225	Ga0209566_100004	Ga0209566_100004912	334
409	3300025226	Ga0209674_100006	Ga0209674_100006912	334
410	3300025230	Ga0209563_100009	Ga0209563_100009755	334
411	3300025231	Ga0207427_100628	Ga0207427_10062811	334
412	3300025233	Ga0209437_100004	Ga0209437_100004755	334
413	3300025253	Ga0209677_100005	Ga0209677_100005755	334
414	3300025261	Ga0209233_1000005	Ga0209233_1000005912	334
415	3300025885	Ga0207653_10000846	Ga0207653_100008464	334
416	3300025904	Ga0207647_10049861	Ga0207647_100498612	334
417	3300025905	Ga0207685_10018193	Ga0207685_100181932	334
418	3300025906	Ga0207699_10002047	Ga0207699_100020478	334
419	3300025907	Ga0207645_10049372	Ga0207645_100493722	334
420	3300025908	Ga0207643_10017769	Ga0207643_100177694	334
421	3300025910	Ga0207684_10080286	Ga0207684_100802863	334
422	3300025911	Ga0207654_10076314	Ga0207654_100763142	334
423	3300025911	Ga0207654_10281556	Ga0207654_102815561	334
424	3300025912	Ga0207707_10000030	Ga0207707_1000003042	334
425	3300025912	Ga0207707_10108207	Ga0207707_101082071	334
426	3300025914	Ga0207671_10003948	Ga0207671_100039487	334
427	3300025914	Ga0207671_10088356	Ga0207671_100883561	334
428	3300025914	Ga0207671_10212153	Ga0207671_102121531	334
429	3300025915	Ga0207693_10023542	Ga0207693_100235422	334
430	3300025917	Ga0207660_10014229	Ga0207660_100142293	334
431	3300025918	Ga0207662_10042363	Ga0207662_100423632	334
432	3300025921	Ga0207652_10089862	Ga0207652_100898621	334
433	3300025922	Ga0207646_10000251	Ga0207646_100002512	334
434	3300025922	Ga0207646_10034058	Ga0207646_100340582	334
435	3300025923	Ga0207681_10136428	Ga0207681_101364282	334
436	3300025925	Ga0207650_10000011	Ga0207650_1000001167	334
437	3300025925	Ga0207650_10165112	Ga0207650_101651122	334
438	3300025926	Ga0207659_10166213	Ga0207659_101662132	334
439	3300025928	Ga0207700_10015550	Ga0207700_100155503	334
440	3300025929	Ga0207664_10044057	Ga0207664_100440572	334
441	3300025931	Ga0207644_10035093	Ga0207644_100350931	334
442	3300025931	Ga0207644_10113038	Ga0207644_101130382	334
443	3300025931	Ga0207644_10202263	Ga0207644_102022632	334
444	3300025932	Ga0207690_10031355	Ga0207690_100313552	334
445	3300025933	Ga0207706_10116269	Ga0207706_101162692	334
446	3300025933	Ga0207706_10175469	Ga0207706_101754692	334
447	3300025934	Ga0207686_10039849	Ga0207686_100398493	334
448	3300025935	Ga0207709_10019433	Ga0207709_100194334	334
449	3300025935	Ga0207709_10237922	Ga0207709_102379221	334
450	3300025936	Ga0207670_10000154	Ga0207670_100001543	334
451	3300025938	Ga0207704_10244375	Ga0207704_102443751	334
452	3300025939	Ga0207665_10000439	Ga0207665_1000043913	334
453	3300025939	Ga0207665_10006587	Ga0207665_100065873	334
454	3300025940	Ga0207691_10000633	Ga0207691_1000063313	334
455	3300025940	Ga0207691_10036557	Ga0207691_100365574	334
456	3300025941	Ga0207711_10004510	Ga0207711_100045105	334
457	3300025941	Ga0207711_10092823	Ga0207711_100928231	334
458	3300025941	Ga0207711_10149155	Ga0207711_101491552	334
459	3300025941	Ga0207711_10262837	Ga0207711_102628372	334
460	3300025942	Ga0207689_10093430	Ga0207689_100934302	334
461	3300025942	Ga0207689_10419332	Ga0207689_104193322	334
462	3300025960	Ga0207651_10031703	Ga0207651_100317033	334
463	3300025961	Ga0207712_10002602	Ga0207712_100026027	334
464	3300025961	Ga0207712_10009581	Ga0207712_100095815	334
465	3300025961	Ga0207712_10092692	Ga0207712_100926921	334
466	3300025981	Ga0207640_10150711	Ga0207640_101507112	334
467	3300026035	Ga0207703_10060741	Ga0207703_100607412	334
468	3300026075	Ga0207708_10112492	Ga0207708_101124922	334
469	3300026078	Ga0207702_10097681	Ga0207702_100976812	334
470	3300026088	Ga0207641_10055530	Ga0207641_100555303	334
471	3300026089	Ga0207648_10008828	Ga0207648_100088283	334
472	3300026089	Ga0207648_10042852	Ga0207648_100428524	334
473	3300026089	Ga0207648_10158461	Ga0207648_101584612	334
474	3300026095	Ga0207676_10000026	Ga0207676_10000026215	334
475	3300026095	Ga0207676_10026942	Ga0207676_100269423	334
476	3300026095	Ga0207676_10118599	Ga0207676_101185992	334
477	3300026095	Ga0207676_10456537	Ga0207676_104565371	334
478	3300026118	Ga0207675_100002441	Ga0207675_1000024416	334
479	3300026118	Ga0207675_100081904	Ga0207675_1000819042	334
480	3300026142	Ga0207698_10410752	Ga0207698_104107521	334
481	3300027907	Ga0207428_10002260	Ga0207428_1000226010	334
482	3300028379	Ga0268266_10203276	Ga0268266_102032761	334
483	3300028380	Ga0268265_10086401	Ga0268265_100864012	334
484	3300028381	Ga0268264_10052100	Ga0268264_100521002	334
485	3300028381	Ga0268264_10254782	Ga0268264_102547822	334
486	3300031250	Ga0265331_10038083	Ga0265331_100380832	334
487	3300031251	Ga0265327_10000886	Ga0265327_1000088610	334
488	3300031548	Ga0307408_100161880	Ga0307408_1001618802	334
489	3300038996	Ga0242420_013424	Ga0242420_013424_32_1039	334
490	3300039437	Ga0436365_1137642	Ga0436365_1137642_88_1107	334
491	3300042012	Ga0439455_0010086	Ga0439455_0010086_983_1993	334
492	3300042157	Ga0439458_0007123	Ga0439458_0007123_440_1450	334
493	3300044693	Ga0466961_0001813	Ga0466961_0001813_10535_11581	334
494	3300044719	Ga0466971_0024959	Ga0466971_0024959_362_1408	334
495	3300044842	Ga0466957_0020118	Ga0466957_0020118_1852_2898	334
496	3300045049	Ga0466959_0011433	Ga0466959_0011433_868_1914	334
497	3300045836	Ga0466958_0015627	Ga0466958_0015627_2224_3270	334
498	3300048905	Ga0496102_0149022	Ga0496102_0149022_1058_2065	334
499	3300048907	Ga0496104_0169867	Ga0496104_0169867_785_1792	334
500	3300048909	Ga0496106_0310388	Ga0496106_0310388_200_1207	334
501	3300048910	Ga0496107_0085050	Ga0496107_0085050_262_1428	334
502	3300048911	Ga0496108_0050821	Ga0496108_0050821_2371_3381	334
503	3300048912	Ga0496109_0447234	Ga0496109_0447234_119_1135	334
504	3300048915	Ga0496112_0165044	Ga0496112_0165044_820_1827	334
505	3300048916	Ga0496113_0294386	Ga0496113_0294386_156_1163	334
506	3300049663	Ga0501223_023929	Ga0501223_023929_139_1155	334
507	3300049707	Ga0501234_002097	Ga0501234_002097_98_1114	334
508	3300050507	nmdc:mga05p37_183031_c1	nmdc:mga05p37_183031_c1_212_1219	334
509	3300050508	nmdc:mga09592_246582_c1	nmdc:mga09592_246582_c1_65_1072	334
510	3300050511	nmdc:mga08y16_6872_c1	nmdc:mga08y16_6872_c1_10104_11108	334
511	3300050512	nmdc:mga0n895_228942_c1	nmdc:mga0n895_228942_c1_803_1810	334
512	3300050512	nmdc:mga0n895_234784_c2	nmdc:mga0n895_234784_c2_244_1248	334
513	3300050514	nmdc:mga08x19_20373_c1	nmdc:mga08x19_20373_c1_2794_3810	334
514	3300050515	nmdc:mga0a205_181964_c1	nmdc:mga0a205_181964_c1_529_1539	334
515	3300050515	nmdc:mga0a205_6644_c1	nmdc:mga0a205_6644_c1_5592_6608	334
516	3300050515	nmdc:mga0a205_81087_c1	nmdc:mga0a205_81087_c1_316_1323	334
517	3300050515	nmdc:mga0a205_98656_c1	nmdc:mga0a205_98656_c1_427_1431	334
518	3300053178	Ga0500637_0006937	Ga0500637_0006937_1235_2260	334
519	3300061719	Ga0466962_0018336	Ga0466962_0018336_796_1842	334
520	3300061734	Ga0530510_0017016	Ga0530510_0017016_3747_4763	334

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

54

211

0.98 PF00393

6PGD

6-phosphogluconate dehydrogenase, C-terminal domain

280

385

0.88 PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

54

144

0.88 PF00393

6PGD

6-phosphogluconate dehydrogenase, C-terminal domain

236

275

0.86 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
6fp1-assembly1.cif.gz_A	the crystal structure of p.fluorescens kynurenine 3-monooxygenase (kmo) in complex with competitive inhibitor no. 1	0.9627	1	31
5x6q-assembly1.cif.gz_A	crystal structure of pseudomonas fluorescens kmo in complex with ro 61-8048	0.96	1	31
4e21-assembly1.cif.gz_B-2	the crystal structure of 6-phosphogluconate dehydrogenase from geobacter metallireducens	0.9591	2	326
6fox-assembly2.cif.gz_B	the crystal structure of p.fluorescens kynurenine 3-monooxygenase (kmo) in complex with kynurenine	0.959	1	31
6j39-assembly1.cif.gz_A	crystal structure of cmis2 with inhibitor	0.9585	1	32

ID	Description	Score	Start	End	Superfamily
4e21A02	Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2	0.9791	178	322	1.10.1040.10
4e21A02	Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2	0.964	178	322	1.10.1040.10
4e21B01	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.9564	1	177	3.40.50.720
4e21B01	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.951	1	177	3.40.50.720
af_O65404_36_399_3.50.50.60	Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain	0.9433	2	32	3.50.50.60

ID	Description	Score	Start	End	GO Terms
AF-A0A2M7WZ84-F1-model_v4	6-phosphogluconate dehydrogenase (Decarboxylating)	0.9973	1	152	GO:0004616 GO:0050661
AF-A0A534C3M2-F1-model_v4	6-phosphogluconate dehydrogenase (Decarboxylating)	0.9935	1	144	GO:0004616 GO:0050661
AF-A0A2M7WZ84-F1-model_v4	6-phosphogluconate dehydrogenase (Decarboxylating)	0.9908	1	152	GO:0004616 GO:0050661
AF-A0A0L0LZ89-F1-model_v4	deleted	0.9907	1	114
AF-A0A7C2WQY9-F1-model_v4	6-phosphogluconate dehydrogenase	0.9899	1	114	GO:0004616 GO:0050661

Feature Viewer

pLDDT	pTM	Quality
94.49	0.89	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F458600

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF03446

NAD_binding_2

NAD binding domain of 6-phosphogluconate dehydrogenase

54

211

0.98

PF00393

6PGD

6-phosphogluconate dehydrogenase, C-terminal domain

280

385

0.88

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

54

144

0.88

PF00393

6PGD

6-phosphogluconate dehydrogenase, C-terminal domain

236

275

0.86

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map