F455590

General Info

Members Datasets Scaffolds Average Seq Length
500 309 468 159

Family's Representative Sequence

Representative Sequence 3300046501|Ga0495607_0039208|Ga0495607_0039208_895_1443
Length 182
Sequence MITDYTVKAADGSDASLEAYRGKVLLIVNTASKCGFTPQYEGLEALHRDYGARGFEVLAFPCNQFGAQEPGDAAEIANFCSLTYDVTFPVFAKVDVNGTDAEPLFETLKAEAPGLLGSKGIKWNFTKFLVDRDGKVVDRYAPTTKPEDLRQDIEKLLYRWGLTQRIRTPVRPSCARGPGRSR

Samples

Sample ID Description Type Environment
1 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
2 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
3 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
4 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
5 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
6 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
7 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
8 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
9 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
10 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
11 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
12 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
13 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
14 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
15 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
16 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
17 2889306138 Methylobacterium sp. PvR107 Isolate Rhizosphere
18 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
19 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
20 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
21 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
22 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
23 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
24 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
25 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
26 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
27 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
28 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
29 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
30 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
31 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
32 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
33 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
34 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
35 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
36 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
37 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
38 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
39 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
40 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
41 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
42 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
43 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
44 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
45 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
46 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
47 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
48 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
49 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
50 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
51 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
52 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
53 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
54 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
55 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
56 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
57 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
74 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
75 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
76 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
102 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
103 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
106 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
107 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
108 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
109 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
110 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
111 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
112 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
114 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
117 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
119 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
160 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
161 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
162 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
163 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
164 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
165 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
168 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
169 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
170 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
171 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
172 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
173 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
174 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
175 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
176 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
177 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
178 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
179 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
180 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
181 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
182 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
183 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
184 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
185 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
186 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
187 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
188 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
189 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
190 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
191 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
192 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
193 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
194 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
195 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
196 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
197 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
198 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
199 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
200 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
201 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
202 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
203 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
204 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
205 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
206 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
207 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
208 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
209 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
210 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
211 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
212 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
213 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
214 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
215 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
216 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
217 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
218 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
219 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
220 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
221 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
222 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
223 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
224 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
225 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
226 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
227 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
228 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
229 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
230 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
231 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
232 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
233 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
234 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
235 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
236 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
237 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
238 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
239 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
240 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
241 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
242 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
243 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
244 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
245 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
246 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
247 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
248 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
249 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
250 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
251 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
252 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
253 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
254 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
255 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
256 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
257 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
258 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
259 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
260 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
261 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
262 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
263 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
264 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
265 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
266 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
267 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
268 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
269 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
270 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
271 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
272 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
273 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
276 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
278 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
279 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
280 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
281 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
282 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
283 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
284 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
285 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
286 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
287 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
288 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
289 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
290 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
291 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
292 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
293 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
294 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
295 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
296 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
297 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
298 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
299 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
300 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
301 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
302 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
303 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
304 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
305 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
306 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
307 639633007 Azoarcus olearius BH72 Isolate Unclassified
308 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
309 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.2
Metatranscriptomes 0.4
Isolates 6.4

Biome Distribution

Category Percentage (%)
Aerial Root 1
Bulb 0
Endosphere 17.6
Nodule 0.4
Rhizoplane 2.4
Rhizosphere 64.2
Stem 0
Stem Tuber 0
Unclassified 14.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARcpr5oldR_c002370 3300000041 Bacteria 1747
2 ARcpr5yngRDRAFT_c006787 3300000043 Bacteria 1024
3 JGI24739J22299_10033017 3300001989 Bacteria 1776
4 JGI25162J39368_1000166 3300002737 Bacteria 72515
5 JGI25163J39215_1000126 3300002771 Bacteria 31582
6 JGI25164J39214_1000129 3300002772 Bacteria 72515
7 JGI25165J46597_1000032 3300003214 Bacteria 294371
8 JGI25165J46597_1000251 3300003214 Bacteria 72515
9 JGI25153J46596_10000006 3300003215 Bacteria 447760
10 JGI25153J46596_10010235 3300003215 Bacteria 4260
11 rootH2_10031033 3300003320 Bacteria 4643
12 rootH1_10081486 3300003323 Bacteria 2275
13 Ga0055537_1002006 3300003773 Bacteria 7246
14 Ga0055537_1004762 3300003773 Bacteria 3798
15 Ga0055524_1000255 3300003775 Bacteria 54719
16 Ga0055536_1028000 3300003781 Bacteria 1544
17 Ga0055530_10000591 3300003791 Bacteria 31446
18 Ga0055530_10002291 3300003791 Bacteria 12553
19 Ga0055531_10001569 3300003794 Bacteria 16727
20 Ga0055531_10021641 3300003794 Bacteria 2484
21 Ga0065165_1003364 3300005262 Bacteria 11354
22 Ga0065165_1010896 3300005262 Bacteria 3867
23 Ga0065165_1028617 3300005262 Bacteria 1796
24 Ga0070658_10236412 3300005327 Bacteria 1548
25 Ga0070658_10298449 3300005327 Bacteria 1373
26 Ga0070658_10980912 3300005327 Bacteria 735
27 Ga0070658_11226618 3300005327 Bacteria 652
28 Ga0070670_100017079 3300005331 Bacteria 6227
29 Ga0070670_100160963 3300005331 Bacteria 1945
30 Ga0070666_10260120 3300005335 Bacteria 1230
31 Ga0070682_100462780 3300005337 Bacteria 974
32 Ga0070668_100007991 3300005347 Bacteria 7858
33 Ga0070669_100070430 3300005353 Bacteria 2585
34 Ga0070659_100774887 3300005366 Bacteria 833
35 Ga0070667_100004021 3300005367 Bacteria 12447
36 Ga0070667_100041319 3300005367 Bacteria 3869
37 Ga0070667_100313841 3300005367 Bacteria 1414
38 Ga0070667_102141408 3300005367 Bacteria 527
39 Ga0070713_100214620 3300005436 Bacteria 1744
40 Ga0070663_100721537 3300005455 Bacteria 849
41 Ga0070681_10183648 3300005458 Bacteria 2012
42 Ga0070679_100067204 3300005530 Bacteria 3574
43 Ga0068853_100101806 3300005539 Bacteria 2541
44 Ga0068853_101406421 3300005539 Bacteria 675
45 Ga0070665_100010049 3300005548 Bacteria 9575
46 Ga0070665_100145464 3300005548 Bacteria 2373
47 Ga0070665_100319385 3300005548 Bacteria 1557
48 Ga0068855_100014506 3300005563 Bacteria 9489
49 Ga0068855_100186962 3300005563 Bacteria 2339
50 Ga0070664_100632352 3300005564 Bacteria 994
51 Ga0068856_100233695 3300005614 Bacteria 1854
52 Ga0068859_100004040 3300005617 Bacteria 14959
53 Ga0068864_100005216 3300005618 Bacteria 10650
54 Ga0068864_100060237 3300005618 Bacteria 3287
55 Ga0068864_100088692 3300005618 Bacteria 2725
56 Ga0068864_100475877 3300005618 Bacteria 1198
57 Ga0068861_100045272 3300005719 Bacteria 3313
58 Ga0068863_100000023 3300005841 Bacteria 186490
59 Ga0068863_100000072 3300005841 Bacteria 113996
60 Ga0068863_100039007 3300005841 Bacteria 4519
61 Ga0068858_100000555 3300005842 Bacteria 38954
62 Ga0068858_100003263 3300005842 Bacteria 16173
63 Ga0068858_100005876 3300005842 Bacteria 11982
64 Ga0068858_100020350 3300005842 Bacteria 6206
65 Ga0068858_100154469 3300005842 Bacteria 2159
66 Ga0068858_100341459 3300005842 Bacteria 1433
67 Ga0068858_100873447 3300005842 Bacteria 879
68 Ga0068860_100000247 3300005843 Bacteria 81527
69 Ga0068860_100010113 3300005843 Bacteria 9348
70 Ga0068862_100015977 3300005844 Bacteria 6240
71 Ga0068862_100093567 3300005844 Bacteria 2621
72 Ga0075364_10949583 3300006051 Bacteria 585
73 Ga0097621_102117958 3300006237 Bacteria 538
74 Ga0097620_100004040 3300006931 Bacteria 14959
75 Ga0079104_1040537 3300006946 Bacteria 1090
76 Ga0099794_10406999 3300007265 Bacteria 711
77 Ga0099795_10086318 3300007788 Bacteria 1209
78 Ga0105250_10001554 3300009092 Bacteria 12329
79 Ga0105250_10013514 3300009092 Bacteria 3364
80 Ga0105240_10001656 3300009093 Bacteria 37802
81 Ga0105240_10017081 3300009093 Bacteria 9797
82 Ga0105240_10274270 3300009093 Bacteria 1941
83 Ga0105240_11552529 3300009093 Bacteria 693
84 Ga0105245_10139565 3300009098 Bacteria 2281
85 Ga0105247_10665600 3300009101 Bacteria 779
86 Ga0105243_10704839 3300009148 Bacteria 984
87 Ga0105241_11021453 3300009174 Bacteria 775
88 Ga0105241_11628988 3300009174 Bacteria 625
89 Ga0105242_10139393 3300009176 Bacteria 2103
90 Ga0105242_10143674 3300009176 Bacteria 2073
91 Ga0105248_10000154 3300009177 Bacteria 80081
92 Ga0105248_10007221 3300009177 Bacteria 12185
93 Ga0105248_10043959 3300009177 Bacteria 5010
94 Ga0105248_10193107 3300009177 Bacteria 2294
95 Ga0105248_10320145 3300009177 Bacteria 1747
96 Ga0105237_10142097 3300009545 Bacteria 2395
97 Ga0105238_10058083 3300009551 Bacteria 3879
98 Ga0105238_10149189 3300009551 Bacteria 2314
99 Ga0105238_10305521 3300009551 Bacteria 1575
100 Ga0105238_10329085 3300009551 Bacteria 1514
101 Ga0105238_10710572 3300009551 Bacteria 1017
102 Ga0105238_10879427 3300009551 Bacteria 914
103 Ga0105238_11405605 3300009551 Bacteria 725
104 Ga0099796_10164462 3300010159 Bacteria 882
105 Ga0105239_10758113 3300010375 Bacteria 1111
106 Ga0157373_10032049 3300013100 Bacteria 3784
107 Ga0157373_10232748 3300013100 Bacteria 1301
108 Ga0157371_10271914 3300013102 Bacteria 1223
109 Ga0157370_10125575 3300013104 Bacteria 2394
110 Ga0157370_10197545 3300013104 Bacteria 1867
111 Ga0157370_10826632 3300013104 Bacteria 842
112 Ga0157369_10302984 3300013105 Bacteria 1662
113 Ga0157369_10889776 3300013105 Bacteria 913
114 Ga0157374_11204077 3300013296 Bacteria 779
115 Ga0157378_10009089 3300013297 Bacteria 8650
116 Ga0157378_10226081 3300013297 Bacteria 1781
117 Ga0163162_10020053 3300013306 Bacteria 6566
118 Ga0163162_10348581 3300013306 Bacteria 1613
119 Ga0163162_10492406 3300013306 Bacteria 1357
120 Ga0157372_10598151 3300013307 Bacteria 1286
121 Ga0163163_10236271 3300014325 Bacteria 1877
122 Ga0163163_11374906 3300014325 Bacteria 768
123 Ga0157380_12037273 3300014326 Bacteria 636
124 Ga0182008_10003490 3300014497 Bacteria 9481
125 Ga0157379_10445458 3300014968 Bacteria 1195
126 Ga0157376_10780479 3300014969 Bacteria 967
127 Ga0182006_1011122 3300015261 Bacteria 3975
128 Ga0182006_1039448 3300015261 Bacteria 1863
129 Ga0182007_10009565 3300015262 Bacteria 3899
130 Ga0183363_1001 3300015690 Bacteria 611534
131 Ga0163161_10757346 3300017792 Bacteria 813
132 Ga0213872_10001645 3300021361 Bacteria 14100
133 Ga0213872_10064648 3300021361 Bacteria 1653
134 Ga0209760_100043 3300025207 Bacteria 113964
135 Ga0207427_100047 3300025231 Bacteria 240409
136 Ga0209437_100009 3300025233 Bacteria 915954
137 Ga0209437_106416 3300025233 Bacteria 1958
138 Ga0207425_1057379 3300025245 Bacteria 694
139 Ga0209026_1000888 3300025250 Bacteria 15481
140 Ga0209026_1008820 3300025250 Bacteria 2056
141 Ga0209233_1000032 3300025261 Bacteria 623596
142 Ga0209233_1000066 3300025261 Bacteria 381218
143 Ga0209233_1041480 3300025261 Bacteria 994
144 Ga0209565_1000010 3300025263 Bacteria 687724
145 Ga0209565_1000457 3300025263 Bacteria 31431
146 Ga0209673_1003099 3300025273 Bacteria 10179
147 Ga0209673_1020222 3300025273 Bacteria 2363
148 Ga0209675_1021646 3300025291 Bacteria 1710
149 Ga0209676_1000453 3300025292 Bacteria 69137
150 Ga0209758_1000001 3300025297 Bacteria 1981790
151 Ga0209758_1003161 3300025297 Bacteria 15473
152 Ga0209758_1038253 3300025297 Bacteria 1842
153 Ga0209050_1000026 3300025298 Bacteria 499134
154 Ga0209050_1000824 3300025298 Bacteria 43070
155 Ga0209050_1001953 3300025298 Bacteria 19508
156 Ga0209050_1003410 3300025298 Bacteria 11774
157 Ga0209050_1011632 3300025298 Bacteria 4144
158 Ga0209256_1000010 3300025299 Bacteria 912110
159 Ga0209257_1000009 3300025304 Bacteria 1205047
160 Ga0209257_1023648 3300025304 Bacteria 2154
161 Ga0207697_10062375 3300025315 Bacteria 1552
162 Ga0207696_1000191 3300025711 Bacteria 94782
163 Ga0207696_1023686 3300025711 Bacteria 1933
164 Ga0207713_1000166 3300025735 Bacteria 96359
165 Ga0207688_10489899 3300025901 Bacteria 769
166 Ga0207680_10293009 3300025903 Bacteria 1133
167 Ga0207680_10515874 3300025903 Bacteria 852
168 Ga0207705_10232389 3300025909 Bacteria 1403
169 Ga0207705_10445039 3300025909 Bacteria 1004
170 Ga0207654_10523591 3300025911 Bacteria 840
171 Ga0207707_10014966 3300025912 Bacteria 6755
172 Ga0207695_10001727 3300025913 Bacteria 34901
173 Ga0207695_10007051 3300025913 Bacteria 14414
174 Ga0207695_10008190 3300025913 Bacteria 13131
175 Ga0207695_10046119 3300025913 Bacteria 4621
176 Ga0207695_10088785 3300025913 Bacteria 3110
177 Ga0207671_10037081 3300025914 Bacteria 3615
178 Ga0207660_10457568 3300025917 Bacteria 1032
179 Ga0207649_10243067 3300025920 Bacteria 1293
180 Ga0207652_10013586 3300025921 Bacteria 6584
181 Ga0207694_10096534 3300025924 Bacteria 2338
182 Ga0207694_10098592 3300025924 Bacteria 2314
183 Ga0207694_10327313 3300025924 Bacteria 1265
184 Ga0207694_10432480 3300025924 Bacteria 1097
185 Ga0207694_10870400 3300025924 Bacteria 762
186 Ga0207694_11060837 3300025924 Bacteria 686
187 Ga0207650_10000174 3300025925 Bacteria 75634
188 Ga0207650_10123160 3300025925 Bacteria 2021
189 Ga0207687_10001006 3300025927 Bacteria 19126
190 Ga0207700_10186905 3300025928 Bacteria 1739
191 Ga0207644_10304589 3300025931 Bacteria 1285
192 Ga0207690_10351267 3300025932 Bacteria 1166
193 Ga0207709_10000676 3300025935 Bacteria 27558
194 Ga0207709_10704728 3300025935 Bacteria 808
195 Ga0207709_10990192 3300025935 Bacteria 687
196 Ga0207711_10004398 3300025941 Bacteria 12012
197 Ga0207711_10016659 3300025941 Bacteria 6103
198 Ga0207711_10178486 3300025941 Bacteria 1930
199 Ga0207689_10517772 3300025942 Bacteria 1000
200 Ga0207661_11172274 3300025944 Bacteria 707
201 Ga0207667_10013151 3300025949 Bacteria 9490
202 Ga0207667_10136726 3300025949 Bacteria 2523
203 Ga0207668_10003471 3300025972 Bacteria 9248
204 Ga0207668_10383908 3300025972 Bacteria 1183
205 Ga0207658_10002889 3300025986 Bacteria 12318
206 Ga0207658_10278480 3300025986 Bacteria 1433
207 Ga0207677_10774277 3300026023 Bacteria 857
208 Ga0207703_10000564 3300026035 Bacteria 38136
209 Ga0207703_10000571 3300026035 Bacteria 37816
210 Ga0207703_10003247 3300026035 Bacteria 13660
211 Ga0207703_10068701 3300026035 Bacteria 2920
212 Ga0207703_10726063 3300026035 Bacteria 946
213 Ga0207639_10053909 3300026041 Bacteria 3071
214 Ga0207639_10149141 3300026041 Bacteria 1957
215 Ga0207708_11589277 3300026075 Bacteria 575
216 Ga0207702_10184005 3300026078 Bacteria 1926
217 Ga0207641_10000084 3300026088 Bacteria 133555
218 Ga0207641_10000286 3300026088 Bacteria 63418
219 Ga0207676_10000188 3300026095 Bacteria 54316
220 Ga0207676_10000193 3300026095 Bacteria 53147
221 Ga0207676_10026749 3300026095 Bacteria 4291
222 Ga0207676_10132218 3300026095 Bacteria 2123
223 Ga0207675_100042506 3300026118 Bacteria 4244
224 Ga0207698_10432393 3300026142 Bacteria 1266
225 Ga0207698_10850182 3300026142 Bacteria 917
226 Ga0209999_1014544 3300027543 Bacteria 1430
227 Ga0268266_10056737 3300028379 Bacteria 3369
228 Ga0268266_10220582 3300028379 Bacteria 1743
229 Ga0268266_10251411 3300028379 Bacteria 1635
230 Ga0268265_10072471 3300028380 Bacteria 2687
231 Ga0268264_10000253 3300028381 Bacteria 98587
232 Ga0268264_10042659 3300028381 Bacteria 3755
233 Ga0265323_10037078 3300028653 Bacteria 1788
234 Ga0307517_10000497 3300028786 Bacteria 67390
235 Ga0307517_10119221 3300028786 Bacteria 1960
236 Ga0307517_10158317 3300028786 Bacteria 1529
237 Ga0307517_10159782 3300028786 Bacteria 1516
238 Ga0307517_10219035 3300028786 Bacteria 1159
239 Ga0307511_10337948 3300030521 Bacteria 655
240 Ga0316176_1010560 3300030732 Bacteria 1169
241 Ga0314311_1027475 3300030733 Bacteria 1550
242 Ga0316182_1016491 3300030745 Bacteria 1200
243 Ga0265770_1051825 3300030878 Bacteria 744
244 Ga0265760_10324461 3300031090 Bacteria 548
245 Ga0265327_10002244 3300031251 Bacteria 20931
246 Ga0265327_10419538 3300031251 Bacteria 580
247 Ga0265316_10300032 3300031344 Bacteria 1170
248 Ga0307513_10000045 3300031456 Bacteria 158626
249 Ga0307513_10084494 3300031456 Bacteria 3260
250 Ga0307513_10617011 3300031456 Bacteria 793
251 Ga0307508_10003045 3300031616 Bacteria 17248
252 Ga0307405_10825050 3300031731 Bacteria 779
253 Ga0307410_11296518 3300031852 Bacteria 637
254 Ga0307412_10040596 3300031911 Bacteria 3011
255 Ga0307414_10217712 3300032004 Bacteria 1565
256 Ga0307415_100718856 3300032126 Bacteria 903
257 Ga0307510_10009544 3300033180 Bacteria 11562
258 Ga0307510_10066450 3300033180 Bacteria 3641
259 Ga0373936_0043190 3300035113 Bacteria 1811
260 Ga0373953_0185009 3300035117 Bacteria 899
261 Ga0373954_0204412 3300035118 Bacteria 970
262 Ga0373956_0000006 3300035119 Bacteria 65782
263 Ga0373957_0000372 3300035120 Bacteria 11352
264 Ga0373955_0036443 3300035172 Bacteria 2610
265 Ga0373933_0000564 3300035724 Bacteria 23136
266 Ga0373937_0000205 3300036401 Bacteria 57080
267 Ga0395899_0015309 3300037312 Bacteria 5844
268 Ga0395900_0000009 3300037418 Bacteria 476249
269 Ga0395898_0020293 3300037466 Bacteria 6749
270 Ga0395905_0082557 3300037471 Bacteria 3011
271 Ga0395905_1039741 3300037471 Bacteria 722
272 Ga0436364_0611150 3300037853 Bacteria 1023
273 Ga0436364_1172101 3300037853 Bacteria 1934
274 Ga0395901_0000014 3300038443 Bacteria 375100
275 Ga0436361_0410911 3300039447 Bacteria 609
276 Ga0436361_0586221 3300039447 Bacteria 1515
277 Ga0436361_0602681 3300039447 Bacteria 3068
278 Ga0436363_1000084 3300039450 Bacteria 1229
279 Ga0439436_0024641 3300041404 Bacteria 1774
280 Ga0439461_0000593 3300041410 Bacteria 5240
281 Ga0439461_0003135 3300041410 Bacteria 2698
282 Ga0439465_0000607 3300041413 Bacteria 10860
283 Ga0439465_0001762 3300041413 Bacteria 7081
284 Ga0451795_0903877 3300041456 Bacteria 660
285 Ga0451841_1288079 3300041498 Bacteria 1708
286 Ga0451843_0373864 3300041509 Bacteria 610
287 Ga0439431_0000029 3300041997 Bacteria 22226
288 Ga0439431_0016372 3300041997 Bacteria 1734
289 Ga0439433_0012117 3300041999 Bacteria 1890
290 Ga0439445_0001209 3300042004 Bacteria 5562
291 Ga0439445_0038714 3300042004 Bacteria 1262
292 Ga0439432_000209 3300042006 Bacteria 20859
293 Ga0439432_007911 3300042006 Bacteria 3748
294 Ga0439432_022197 3300042006 Bacteria 2097
295 Ga0439452_003787 3300042010 Bacteria 5201
296 Ga0439452_013810 3300042010 Bacteria 2259
297 Ga0439462_0000929 3300042015 Bacteria 6204
298 Ga0450899_040043 3300042135 Bacteria 585
299 Ga0450910_012771 3300042147 Bacteria 1217
300 Ga0439446_0011085 3300042156 Bacteria 2441
301 Ga0439434_0000160 3300042435 Bacteria 18106
302 Ga0450901_009090 3300042533 Bacteria 1026
303 Ga0466969_0002067 3300044656 Bacteria 10720
304 Ga0466972_0173638 3300044658 Bacteria 1011
305 Ga0466973_0044883 3300044659 Bacteria 4136
306 Ga0466966_0160749 3300044684 Bacteria 1367
307 Ga0466961_0012382 3300044693 Bacteria 5453
308 Ga0466963_0000428 3300044694 Bacteria 19380
309 Ga0466971_0024627 3300044719 Bacteria 2685
310 Ga0466968_0108895 3300044735 Bacteria 1244
311 Ga0466968_0220316 3300044735 Bacteria 893
312 Ga0466970_0736313 3300044765 Bacteria 576
313 Ga0466957_0005418 3300044842 Bacteria 7164
314 Ga0466959_0018314 3300045049 Bacteria 5141
315 Ga0451576_0868860 3300045051 Bacteria 947
316 Ga0466958_0029284 3300045836 Bacteria 3267
317 Ga0495627_036115 3300046453 Bacteria 1537
318 Ga0495638_0000249 3300046460 Bacteria 73312
319 Ga0495638_0000344 3300046460 Bacteria 58565
320 Ga0495651_0063430 3300046462 Bacteria 2824
321 Ga0495650_0003599 3300046471 Bacteria 11173
322 Ga0495607_0039208 3300046501 Bacteria 2831
323 Ga0495583_0000262 3300046506 Bacteria 86241
324 Ga0495583_0015069 3300046506 Bacteria 4225
325 Ga0495583_0026686 3300046506 Bacteria 2859
326 Ga0495583_0041724 3300046506 Bacteria 2147
327 Ga0495583_0200806 3300046506 Bacteria 810
328 Ga0495610_0030405 3300046512 Bacteria 2831
329 Ga0495616_0005044 3300046513 Bacteria 8215
330 Ga0495616_0369111 3300046513 Bacteria 595
331 Ga0495631_0021528 3300046518 Bacteria 3002
332 Ga0495632_0004828 3300046519 Bacteria 9055
333 Ga0495643_0007572 3300046522 Bacteria 6987
334 Ga0495643_0153763 3300046522 Bacteria 1137
335 Ga0495648_0000015 3300046524 Bacteria 285838
336 Ga0495648_0009764 3300046524 Bacteria 7393
337 Ga0495648_0089289 3300046524 Bacteria 1730
338 Ga0495663_0018391 3300046525 Bacteria 1990
339 Ga0495663_0230470 3300046525 Bacteria 653
340 Ga0495666_0107928 3300046526 Bacteria 1309
341 Ga0495654_0285241 3300046530 Bacteria 678
342 Ga0495597_0140952 3300046542 Bacteria 994
343 Ga0495633_0040193 3300046558 Bacteria 2229
344 Ga0495633_0318168 3300046558 Bacteria 706
345 Ga0495668_0000261 3300046616 Bacteria 74577
346 Ga0495668_0008230 3300046616 Bacteria 6540
347 Ga0495668_0015552 3300046616 Bacteria 4440
348 Ga0495611_0397037 3300046648 Bacteria 630
349 Ga0495625_0001272 3300046660 Bacteria 31687
350 Ga0495625_0027096 3300046660 Bacteria 4320
351 Ga0495625_0268649 3300046660 Bacteria 1101
352 Ga0495625_0300478 3300046660 Bacteria 1027
353 Ga0495661_0022981 3300046665 Bacteria 4052
354 Ga0495661_0060057 3300046665 Bacteria 2260
355 Ga0495669_0000144 3300046684 Bacteria 45112
356 Ga0495670_0000004 3300046691 Bacteria 310086
357 Ga0495670_0015429 3300046691 Bacteria 3754
358 Ga0495671_0000084 3300046692 Bacteria 89406
359 Ga0495660_0034066 3300046810 Bacteria 2852
360 Ga0495680_0085434 3300047322 Bacteria 2376
361 Ga0495687_006553 3300047443 Bacteria 7103
362 Ga0495687_007272 3300047443 Bacteria 6566
363 Ga0495675_0096690 3300047444 Bacteria 1851
364 Ga0495679_000621 3300047446 Bacteria 23962
365 Ga0495679_001278 3300047446 Bacteria 14771
366 Ga0495673_0000206 3300047469 Bacteria 89432
367 Ga0495681_0050287 3300047470 Bacteria 1965
368 Ga0495681_0311525 3300047470 Bacteria 607
369 Ga0495686_0000164 3300047472 Bacteria 126101
370 Ga0495686_0020430 3300047472 Bacteria 4416
371 Ga0496100_1362638 3300048903 Bacteria 560
372 Ga0496102_1071710 3300048905 Bacteria 726
373 Ga0496104_0015252 3300048907 Bacteria 6958
374 Ga0496105_0014368 3300048908 Bacteria 6300
375 Ga0496105_0798120 3300048908 Bacteria 718
376 Ga0496112_0036264 3300048915 Bacteria 4810
377 Ga0496112_0070048 3300048915 Bacteria 3465
378 Ga0496113_0598156 3300048916 Bacteria 883
379 Ga0496115_0000354 3300048918 Bacteria 38566
380 Ga0496115_0002975 3300048918 Bacteria 12172
381 Ga0496116_0392525 3300048919 Bacteria 617
382 Ga0496117_0002014 3300048920 Bacteria 26924
383 Ga0496117_0015197 3300048920 Bacteria 6584
384 Ga0496117_0249103 3300048920 Bacteria 970
385 Ga0496118_0008522 3300048921 Bacteria 10584
386 Ga0496118_0132302 3300048921 Bacteria 1599
387 Ga0496118_0377394 3300048921 Bacteria 745
388 Ga0496119_0066471 3300048922 Bacteria 2130
389 Ga0496119_0108978 3300048922 Bacteria 1540
390 Ga0496119_0323405 3300048922 Bacteria 754
391 Ga0496120_0369228 3300048923 Bacteria 640
392 Ga0496121_0000347 3300048924 Bacteria 96608
393 Ga0496121_0033933 3300048924 Bacteria 4605
394 Ga0496121_0055602 3300048924 Bacteria 3295
395 Ga0496121_0387085 3300048924 Bacteria 920
396 Ga0496121_0400009 3300048924 Bacteria 900
397 Ga0496122_0031067 3300048925 Bacteria 4455
398 Ga0496122_0039498 3300048925 Bacteria 3762
399 Ga0496122_0285794 3300048925 Bacteria 898
400 Ga0496122_0377026 3300048925 Bacteria 729
401 Ga0496123_0031172 3300048926 Bacteria 3884
402 Ga0496123_0105617 3300048926 Bacteria 1625
403 Ga0496123_0187787 3300048926 Bacteria 1072
404 Ga0496123_0212974 3300048926 Bacteria 980
405 Ga0496123_0241589 3300048926 Bacteria 896
406 Ga0496125_0024595 3300048928 Bacteria 5533
407 Ga0496125_0058885 3300048928 Bacteria 3099
408 Ga0496125_0128811 3300048928 Bacteria 1786
409 Ga0496125_0428338 3300048928 Bacteria 764
410 Ga0496126_0064085 3300048929 Bacteria 3293
411 Ga0496126_0103105 3300048929 Bacteria 2493
412 Ga0496126_0141318 3300048929 Bacteria 2072
413 Ga0496126_0266210 3300048929 Bacteria 1424
414 Ga0496126_1082153 3300048929 Bacteria 596
415 Ga0495682_0000120 3300049460 Bacteria 68718
416 Ga0495682_0146768 3300049460 Bacteria 842
417 Ga0501031_0315534 3300049568 Bacteria 1013
418 Ga0501038_0234940 3300049574 Bacteria 1457
419 Ga0501241_008763 3300049758 Bacteria 1845
420 Ga0501035_0116583 3300049822 Bacteria 2337
421 Ga0501035_0307231 3300049822 Bacteria 1335
422 Ga0501044_0219707 3300049823 Bacteria 1851
423 Ga0495601_0216071 3300053077 Bacteria 1252
424 Ga0500610_0000163 3300053079 Bacteria 19889
425 Ga0500635_0097283 3300053080 Bacteria 1078
426 Ga0500643_002654 3300053087 Bacteria 9025
427 Ga0500647_0219439 3300053091 Bacteria 852
428 Ga0500566_0003363 3300053094 Bacteria 9550
429 Ga0500641_0033732 3300053096 Bacteria 2034
430 Ga0500641_0045199 3300053096 Bacteria 1793
431 Ga0500650_0195251 3300053098 Bacteria 923
432 Ga0500556_0007120 3300053104 Bacteria 3196
433 Ga0500556_0163221 3300053104 Bacteria 879
434 Ga0500562_000464 3300053108 Bacteria 9836
435 Ga0500562_004683 3300053108 Bacteria 3448
436 Ga0500572_000611 3300053111 Bacteria 12013
437 Ga0500594_0026412 3300053118 Bacteria 1496
438 Ga0500595_000516 3300053119 Bacteria 23303
439 Ga0500595_019890 3300053119 Bacteria 2427
440 Ga0500595_132228 3300053119 Bacteria 702
441 Ga0500597_040092 3300053120 Bacteria 1966
442 Ga0500608_237060 3300053122 Bacteria 723
443 Ga0500658_0001066 3300053134 Bacteria 11224
444 Ga0500658_0003575 3300053134 Bacteria 5868
445 Ga0500658_0023997 3300053134 Bacteria 2334
446 Ga0500559_0022135 3300053136 Bacteria 2696
447 Ga0500559_0043951 3300053136 Bacteria 1953
448 Ga0500568_0018274 3300053139 Bacteria 3073
449 Ga0500568_0069989 3300053139 Bacteria 1344
450 Ga0500573_0000061 3300053140 Bacteria 67535
451 Ga0500573_0000189 3300053140 Bacteria 25044
452 Ga0500573_0240382 3300053140 Bacteria 939
453 Ga0500590_040158 3300053148 Bacteria 2411
454 Ga0500590_130044 3300053148 Bacteria 1166
455 Ga0500604_0005801 3300053151 Bacteria 3263
456 Ga0500604_0055154 3300053151 Bacteria 1235
457 Ga0500616_0012043 3300053153 Bacteria 5076
458 Ga0500624_000043 3300053157 Bacteria 90095
459 Ga0500627_0000994 3300053158 Bacteria 7709
460 Ga0500627_0379680 3300053158 Bacteria 605
461 Ga0500634_0015519 3300053161 Bacteria 4046
462 Ga0500636_0001875 3300053177 Bacteria 11512
463 Ga0500636_0271111 3300053177 Bacteria 853
464 Ga0500637_0000089 3300053178 Bacteria 32896
465 Ga0500645_000692 3300053730 Bacteria 20960
466 Ga0500645_002262 3300053730 Bacteria 8752
467 Ga0500645_035363 3300053730 Bacteria 1488
468 Ga0466962_0017128 3300061719 Bacteria 3491

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005335 Ga0070666_10260120 Ga0070666_102601201 147
2 3300025903 Ga0207680_10293009 Ga0207680_102930092 147
3 3300025924 Ga0207694_10327313 Ga0207694_103273132 147
4 3300009174 Ga0105241_11628988 Ga0105241_116289881 148
5 3300013296 Ga0157374_11204077 Ga0157374_112040771 148
6 3300031344 Ga0265316_10300032 Ga0265316_103000321 149
7 3300048929 Ga0496126_0103105 Ga0496126_0103105_425_910 149
8 3300021361 Ga0213872_10001645 Ga0213872_1000164512 150
9 3300021361 Ga0213872_10064648 Ga0213872_100646482 150
10 3300039447 Ga0436361_0586221 Ga0436361_0586221_850_1305 150
11 3300039447 Ga0436361_0602681 Ga0436361_0602681_850_1305 150
12 3300009101 Ga0105247_10665600 Ga0105247_106656002 151
13 iso_pu_bacteria 2990265787 2990267770 154
14 iso_pu_bacteria 2993693658 2993694989 154
15 3300032004 Ga0307414_10217712 Ga0307414_102177121 155
16 iso_pu_bacteria 2524023250 2524611850 155
17 iso_pu_bacteria 2599185354 2600200489 155
18 iso_pu_bacteria 2643221622 2644126343 155
19 iso_pu_bacteria 2751185897 2753763730 155
20 iso_pu_bacteria 2816332141 2816517770 155
21 iso_pu_bacteria 2842391507 2842391951 155
22 iso_pu_bacteria 2842698319 2842701109 155
23 iso_pu_bacteria 2842757796 2842760105 155
24 iso_pu_bacteria 2883577096 2883581253 155
25 iso_pu_bacteria 2885429604 2885431488 155
26 iso_pu_bacteria 2889306138 2889311469 155
27 iso_pu_bacteria 2902405164 2902411680 155
28 iso_pu_bacteria 2919134579 2919138527 155
29 iso_pu_bacteria 2928027323 2928027747 155
30 iso_pu_bacteria 2946787523 2946791083 155
31 iso_pu_bacteria 2961064222 2961066154 155
32 iso_pu_bacteria 2984555340 2984557960 155
33 iso_pu_bacteria 2984564862 2984567674 155
34 iso_pu_bacteria 2993356040 2993358726 155
35 iso_pu_bacteria 3003665799 3003669891 155
36 iso_pu_bacteria 8057101203 8057103424 155
37 3300013104 Ga0157370_10197545 Ga0157370_101975452 156
38 3300017792 Ga0163161_10757346 Ga0163161_107573462 156
39 iso_pu_bacteria 2619619299 2621300911 156
40 iso_pu_bacteria 2738541265 2738670464 156
41 iso_pu_bacteria 2738541282 2738748857 156
42 iso_pu_bacteria 2738541303 2738857899 156
43 iso_pu_bacteria 2816332298 2817489788 156
44 iso_pu_bacteria 2834028612 2834029665 156
45 iso_pu_bacteria 3007866637 3007870239 156
46 iso_pu_bacteria 639633007 639786410 156
47 iso_pu_bacteria 8056131705 8056133562 156
48 3300003781 Ga0055536_1028000 Ga0055536_10280001 157
49 3300025292 Ga0209676_1000453 Ga0209676_100045360 157
50 3300025298 Ga0209050_1001953 Ga0209050_10019536 157
51 3300030745 Ga0316182_1016491 Ga0316182_10164912 157
52 3300039450 Ga0436363_1000084 Ga0436363_1000084_421_894 157
53 3300042533 Ga0450901_009090 Ga0450901_009090_78_551 157
54 3300046501 Ga0495607_0039208 Ga0495607_0039208_895_1443 157
55 3300046660 Ga0495625_0001272 Ga0495625_0001272_17296_17772 157
56 3300048929 Ga0496126_0141318 Ga0496126_0141318_1342_1818 157
57 3300048929 Ga0496126_0266210 Ga0496126_0266210_831_1307 157
58 3300053120 Ga0500597_040092 Ga0500597_040092_324_800 157
59 3300053140 Ga0500573_0000189 Ga0500573_0000189_13927_14406 157
60 3300053157 Ga0500624_000043 Ga0500624_000043_63717_64193 157
61 3300053178 Ga0500637_0000089 Ga0500637_0000089_12076_12552 157
62 3300005327 Ga0070658_10236412 Ga0070658_102364122 158
63 3300005327 Ga0070658_11226618 Ga0070658_112266181 158
64 3300005337 Ga0070682_100462780 Ga0070682_1004627801 158
65 3300005367 Ga0070667_102141408 Ga0070667_1021414081 158
66 3300005436 Ga0070713_100214620 Ga0070713_1002146202 158
67 3300005458 Ga0070681_10183648 Ga0070681_101836482 158
68 3300005530 Ga0070679_100067204 Ga0070679_1000672042 158
69 3300005563 Ga0068855_100186962 Ga0068855_1001869622 158
70 3300005618 Ga0068864_100475877 Ga0068864_1004758772 158
71 3300005842 Ga0068858_100154469 Ga0068858_1001544692 158
72 3300005842 Ga0068858_100873447 Ga0068858_1008734472 158
73 3300006051 Ga0075364_10949583 Ga0075364_109495831 158
74 3300007265 Ga0099794_10406999 Ga0099794_104069992 158
75 3300007788 Ga0099795_10086318 Ga0099795_100863183 158
76 3300009093 Ga0105240_10001656 Ga0105240_1000165627 158
77 3300009093 Ga0105240_10274270 Ga0105240_102742702 158
78 3300009093 Ga0105240_11552529 Ga0105240_115525292 158
79 3300009176 Ga0105242_10139393 Ga0105242_101393932 158
80 3300009177 Ga0105248_10000154 Ga0105248_1000015461 158
81 3300009177 Ga0105248_10320145 Ga0105248_103201452 158
82 3300009545 Ga0105237_10142097 Ga0105237_101420974 158
83 3300009551 Ga0105238_10058083 Ga0105238_100580832 158
84 3300009551 Ga0105238_10305521 Ga0105238_103055211 158
85 3300009551 Ga0105238_10329085 Ga0105238_103290853 158
86 3300009551 Ga0105238_10710572 Ga0105238_107105722 158
87 3300009551 Ga0105238_10879427 Ga0105238_108794271 158
88 3300010159 Ga0099796_10164462 Ga0099796_101644621 158
89 3300013102 Ga0157371_10271914 Ga0157371_102719141 158
90 3300013104 Ga0157370_10125575 Ga0157370_101255753 158
91 3300013105 Ga0157369_10302984 Ga0157369_103029843 158
92 3300014325 Ga0163163_10236271 Ga0163163_102362712 158
93 3300014325 Ga0163163_11374906 Ga0163163_113749062 158
94 3300014326 Ga0157380_12037273 Ga0157380_120372731 158
95 3300014968 Ga0157379_10445458 Ga0157379_104454582 158
96 3300025250 Ga0209026_1000888 Ga0209026_10008886 158
97 3300025261 Ga0209233_1041480 Ga0209233_10414802 158
98 3300025901 Ga0207688_10489899 Ga0207688_104898992 158
99 3300025903 Ga0207680_10515874 Ga0207680_105158742 158
100 3300025909 Ga0207705_10232389 Ga0207705_102323892 158
101 3300025911 Ga0207654_10523591 Ga0207654_105235912 158
102 3300025912 Ga0207707_10014966 Ga0207707_100149662 158
103 3300025913 Ga0207695_10001727 Ga0207695_1000172724 158
104 3300025913 Ga0207695_10007051 Ga0207695_100070517 158
105 3300025913 Ga0207695_10046119 Ga0207695_100461194 158
106 3300025913 Ga0207695_10088785 Ga0207695_100887854 158
107 3300025914 Ga0207671_10037081 Ga0207671_100370813 158
108 3300025917 Ga0207660_10457568 Ga0207660_104575682 158
109 3300025920 Ga0207649_10243067 Ga0207649_102430672 158
110 3300025921 Ga0207652_10013586 Ga0207652_100135867 158
111 3300025924 Ga0207694_10096534 Ga0207694_100965343 158
112 3300025924 Ga0207694_10432480 Ga0207694_104324801 158
113 3300025924 Ga0207694_10870400 Ga0207694_108704001 158
114 3300025928 Ga0207700_10186905 Ga0207700_101869052 158
115 3300025942 Ga0207689_10517772 Ga0207689_105177721 158
116 3300025944 Ga0207661_11172274 Ga0207661_111722742 158
117 3300025949 Ga0207667_10136726 Ga0207667_101367262 158
118 3300026035 Ga0207703_10726063 Ga0207703_107260632 158
119 3300026075 Ga0207708_11589277 Ga0207708_115892771 158
120 3300026095 Ga0207676_10026749 Ga0207676_100267492 158
121 3300026142 Ga0207698_10850182 Ga0207698_108501822 158
122 3300027543 Ga0209999_1014544 Ga0209999_10145442 158
123 3300028786 Ga0307517_10000497 Ga0307517_1000049712 158
124 3300030878 Ga0265770_1051825 Ga0265770_10518252 158
125 3300031090 Ga0265760_10324461 Ga0265760_103244611 158
126 3300031251 Ga0265327_10002244 Ga0265327_1000224417 158
127 3300031456 Ga0307513_10617011 Ga0307513_106170111 158
128 3300031852 Ga0307410_11296518 Ga0307410_112965182 158
129 3300035113 Ga0373936_0043190 Ga0373936_0043190_718_1194 158
130 3300037312 Ga0395899_0015309 Ga0395899_0015309_1846_2322 158
131 3300037418 Ga0395900_0000009 Ga0395900_0000009_283356_283832 158
132 3300037466 Ga0395898_0020293 Ga0395898_0020293_4863_5339 158
133 3300037471 Ga0395905_0082557 Ga0395905_0082557_1199_1675 158
134 3300037471 Ga0395905_1039741 Ga0395905_1039741_47_526 158
135 3300038443 Ga0395901_0000014 Ga0395901_0000014_234555_235031 158
136 3300039447 Ga0436361_0410911 Ga0436361_0410911_118_597 158
137 3300044735 Ga0466968_0108895 Ga0466968_0108895_626_1102 158
138 3300044765 Ga0466970_0736313 Ga0466970_0736313_51_527 158
139 3300046513 Ga0495616_0005044 Ga0495616_0005044_2831_3307 158
140 3300046616 Ga0495668_0008230 Ga0495668_0008230_2562_3038 158
141 3300047470 Ga0495681_0311525 Ga0495681_0311525_48_524 158
142 3300048915 Ga0496112_0036264 Ga0496112_0036264_2181_2657 158
143 3300048916 Ga0496113_0598156 Ga0496113_0598156_245_721 158
144 3300048918 Ga0496115_0002975 Ga0496115_0002975_7731_8207 158
145 3300049568 Ga0501031_0315534 Ga0501031_0315534_192_668 158
146 3300049574 Ga0501038_0234940 Ga0501038_0234940_634_1110 158
147 3300049822 Ga0501035_0116583 Ga0501035_0116583_977_1453 158
148 3300049823 Ga0501044_0219707 Ga0501044_0219707_512_988 158
149 3300053098 Ga0500650_0195251 Ga0500650_0195251_252_728 158
150 3300053104 Ga0500556_0007120 Ga0500556_0007120_126_602 158
151 3300053108 Ga0500562_000464 Ga0500562_000464_565_1041 158
152 3300053119 Ga0500595_019890 Ga0500595_019890_442_918 158
153 3300053151 Ga0500604_0055154 Ga0500604_0055154_49_525 158
154 3300053158 Ga0500627_0000994 Ga0500627_0000994_4777_5253 158
155 3300000041 ARcpr5oldR_c002370 ARcpr5oldR_0023702 159
156 3300000043 ARcpr5yngRDRAFT_c006787 ARcpr5yngRDRAFT_0067872 159
157 3300001989 JGI24739J22299_10033017 JGI24739J22299_100330172 159
158 3300002737 JGI25162J39368_1000166 JGI25162J39368_100016658 159
159 3300002771 JGI25163J39215_1000126 JGI25163J39215_10001263 159
160 3300002772 JGI25164J39214_1000129 JGI25164J39214_100012920 159
161 3300003214 JGI25165J46597_1000032 JGI25165J46597_100003221 159
162 3300003214 JGI25165J46597_1000251 JGI25165J46597_100025120 159
163 3300003215 JGI25153J46596_10000006 JGI25153J46596_10000006174 159
164 3300003215 JGI25153J46596_10010235 JGI25153J46596_100102353 159
165 3300003320 rootH2_10031033 rootH2_100310332 159
166 3300003323 rootH1_10081486 rootH1_100814862 159
167 3300003773 Ga0055537_1002006 Ga0055537_10020063 159
168 3300003773 Ga0055537_1004762 Ga0055537_10047625 159
169 3300003775 Ga0055524_1000255 Ga0055524_100025541 159
170 3300003791 Ga0055530_10000591 Ga0055530_100005919 159
171 3300003791 Ga0055530_10002291 Ga0055530_100022914 159
172 3300003794 Ga0055531_10001569 Ga0055531_100015695 159
173 3300003794 Ga0055531_10021641 Ga0055531_100216413 159
174 3300005262 Ga0065165_1003364 Ga0065165_10033645 159
175 3300005262 Ga0065165_1010896 Ga0065165_10108963 159
176 3300005262 Ga0065165_1028617 Ga0065165_10286172 159
177 3300005327 Ga0070658_10298449 Ga0070658_102984492 159
178 3300005327 Ga0070658_10980912 Ga0070658_109809121 159
179 3300005331 Ga0070670_100017079 Ga0070670_1000170794 159
180 3300005331 Ga0070670_100160963 Ga0070670_1001609632 159
181 3300005347 Ga0070668_100007991 Ga0070668_1000079914 159
182 3300005353 Ga0070669_100070430 Ga0070669_1000704302 159
183 3300005366 Ga0070659_100774887 Ga0070659_1007748871 159
184 3300005367 Ga0070667_100004021 Ga0070667_1000040217 159
185 3300005367 Ga0070667_100041319 Ga0070667_1000413195 159
186 3300005367 Ga0070667_100313841 Ga0070667_1003138413 159
187 3300005455 Ga0070663_100721537 Ga0070663_1007215372 159
188 3300005539 Ga0068853_100101806 Ga0068853_1001018062 159
189 3300005539 Ga0068853_101406421 Ga0068853_1014064212 159
190 3300005548 Ga0070665_100010049 Ga0070665_1000100497 159
191 3300005548 Ga0070665_100145464 Ga0070665_1001454643 159
192 3300005548 Ga0070665_100319385 Ga0070665_1003193852 159
193 3300005563 Ga0068855_100014506 Ga0068855_1000145063 159
194 3300005564 Ga0070664_100632352 Ga0070664_1006323521 159
195 3300005614 Ga0068856_100233695 Ga0068856_1002336952 159
196 3300005617 Ga0068859_100004040 Ga0068859_10000404012 159
197 3300005618 Ga0068864_100005216 Ga0068864_1000052163 159
198 3300005618 Ga0068864_100060237 Ga0068864_1000602372 159
199 3300005618 Ga0068864_100088692 Ga0068864_1000886922 159
200 3300005719 Ga0068861_100045272 Ga0068861_1000452722 159
201 3300005841 Ga0068863_100000023 Ga0068863_100000023133 159
202 3300005841 Ga0068863_100000072 Ga0068863_10000007259 159
203 3300005841 Ga0068863_100039007 Ga0068863_1000390074 159
204 3300005842 Ga0068858_100000555 Ga0068858_10000055514 159
205 3300005842 Ga0068858_100003263 Ga0068858_10000326313 159
206 3300005842 Ga0068858_100005876 Ga0068858_1000058766 159
207 3300005842 Ga0068858_100020350 Ga0068858_1000203507 159
208 3300005842 Ga0068858_100341459 Ga0068858_1003414593 159
209 3300005843 Ga0068860_100000247 Ga0068860_10000024739 159
210 3300005843 Ga0068860_100010113 Ga0068860_1000101134 159
211 3300005844 Ga0068862_100015977 Ga0068862_1000159774 159
212 3300005844 Ga0068862_100093567 Ga0068862_1000935672 159
213 3300006237 Ga0097621_102117958 Ga0097621_1021179581 159
214 3300006931 Ga0097620_100004040 Ga0097620_10000404012 159
215 3300006946 Ga0079104_1040537 Ga0079104_10405372 159
216 3300009092 Ga0105250_10001554 Ga0105250_100015546 159
217 3300009092 Ga0105250_10013514 Ga0105250_100135142 159
218 3300009093 Ga0105240_10017081 Ga0105240_100170813 159
219 3300009098 Ga0105245_10139565 Ga0105245_101395652 159
220 3300009148 Ga0105243_10704839 Ga0105243_107048392 159
221 3300009174 Ga0105241_11021453 Ga0105241_110214531 159
222 3300009176 Ga0105242_10143674 Ga0105242_101436742 159
223 3300009177 Ga0105248_10007221 Ga0105248_100072213 159
224 3300009177 Ga0105248_10043959 Ga0105248_100439597 159
225 3300009177 Ga0105248_10193107 Ga0105248_101931072 159
226 3300009551 Ga0105238_10149189 Ga0105238_101491894 159
227 3300009551 Ga0105238_11405605 Ga0105238_114056052 159
228 3300010375 Ga0105239_10758113 Ga0105239_107581131 159
229 3300013100 Ga0157373_10032049 Ga0157373_100320492 159
230 3300013100 Ga0157373_10232748 Ga0157373_102327482 159
231 3300013104 Ga0157370_10826632 Ga0157370_108266322 159
232 3300013105 Ga0157369_10889776 Ga0157369_108897762 159
233 3300013297 Ga0157378_10009089 Ga0157378_100090894 159
234 3300013297 Ga0157378_10226081 Ga0157378_102260812 159
235 3300013306 Ga0163162_10020053 Ga0163162_100200533 159
236 3300013306 Ga0163162_10348581 Ga0163162_103485812 159
237 3300013306 Ga0163162_10492406 Ga0163162_104924063 159
238 3300013307 Ga0157372_10598151 Ga0157372_105981512 159
239 3300014497 Ga0182008_10003490 Ga0182008_100034908 159
240 3300014969 Ga0157376_10780479 Ga0157376_107804792 159
241 3300015261 Ga0182006_1011122 Ga0182006_10111223 159
242 3300015261 Ga0182006_1039448 Ga0182006_10394483 159
243 3300015262 Ga0182007_10009565 Ga0182007_100095652 159
244 3300015690 Ga0183363_1001 Ga0183363_100196 159
245 3300025207 Ga0209760_100043 Ga0209760_10004372 159
246 3300025231 Ga0207427_100047 Ga0207427_10004757 159
247 3300025233 Ga0209437_100009 Ga0209437_10000957 159
248 3300025233 Ga0209437_106416 Ga0209437_1064162 159
249 3300025245 Ga0207425_1057379 Ga0207425_10573792 159
250 3300025250 Ga0209026_1008820 Ga0209026_10088203 159
251 3300025261 Ga0209233_1000032 Ga0209233_100003257 159
252 3300025261 Ga0209233_1000066 Ga0209233_100006622 159
253 3300025263 Ga0209565_1000010 Ga0209565_1000010551 159
254 3300025263 Ga0209565_1000457 Ga0209565_100045727 159
255 3300025273 Ga0209673_1003099 Ga0209673_10030993 159
256 3300025273 Ga0209673_1020222 Ga0209673_10202222 159
257 3300025291 Ga0209675_1021646 Ga0209675_10216463 159
258 3300025297 Ga0209758_1000001 Ga0209758_10000011651 159
259 3300025297 Ga0209758_1003161 Ga0209758_10031614 159
260 3300025297 Ga0209758_1038253 Ga0209758_10382532 159
261 3300025298 Ga0209050_1000026 Ga0209050_1000026210 159
262 3300025298 Ga0209050_1000824 Ga0209050_100082419 159
263 3300025298 Ga0209050_1003410 Ga0209050_100341010 159
264 3300025298 Ga0209050_1011632 Ga0209050_10116322 159
265 3300025299 Ga0209256_1000010 Ga0209256_1000010839 159
266 3300025304 Ga0209257_1000009 Ga0209257_1000009210 159
267 3300025304 Ga0209257_1023648 Ga0209257_10236483 159
268 3300025315 Ga0207697_10062375 Ga0207697_100623752 159
269 3300025711 Ga0207696_1000191 Ga0207696_100019110 159
270 3300025711 Ga0207696_1023686 Ga0207696_10236862 159
271 3300025735 Ga0207713_1000166 Ga0207713_10001668 159
272 3300025909 Ga0207705_10445039 Ga0207705_104450392 159
273 3300025913 Ga0207695_10008190 Ga0207695_100081903 159
274 3300025924 Ga0207694_10098592 Ga0207694_100985924 159
275 3300025924 Ga0207694_11060837 Ga0207694_110608372 159
276 3300025925 Ga0207650_10000174 Ga0207650_1000017457 159
277 3300025925 Ga0207650_10123160 Ga0207650_101231602 159
278 3300025927 Ga0207687_10001006 Ga0207687_1000100614 159
279 3300025931 Ga0207644_10304589 Ga0207644_103045892 159
280 3300025932 Ga0207690_10351267 Ga0207690_103512672 159
281 3300025935 Ga0207709_10000676 Ga0207709_1000067610 159
282 3300025935 Ga0207709_10704728 Ga0207709_107047281 159
283 3300025935 Ga0207709_10990192 Ga0207709_109901921 159
284 3300025941 Ga0207711_10004398 Ga0207711_1000439811 159
285 3300025941 Ga0207711_10016659 Ga0207711_100166596 159
286 3300025941 Ga0207711_10178486 Ga0207711_101784862 159
287 3300025949 Ga0207667_10013151 Ga0207667_100131513 159
288 3300025972 Ga0207668_10003471 Ga0207668_100034715 159
289 3300025972 Ga0207668_10383908 Ga0207668_103839081 159
290 3300025986 Ga0207658_10002889 Ga0207658_100028894 159
291 3300025986 Ga0207658_10278480 Ga0207658_102784802 159
292 3300026023 Ga0207677_10774277 Ga0207677_107742771 159
293 3300026035 Ga0207703_10000564 Ga0207703_1000056430 159
294 3300026035 Ga0207703_10000571 Ga0207703_1000057123 159
295 3300026035 Ga0207703_10003247 Ga0207703_100032477 159
296 3300026035 Ga0207703_10068701 Ga0207703_100687012 159
297 3300026041 Ga0207639_10053909 Ga0207639_100539093 159
298 3300026041 Ga0207639_10149141 Ga0207639_101491413 159
299 3300026078 Ga0207702_10184005 Ga0207702_101840052 159
300 3300026088 Ga0207641_10000084 Ga0207641_1000008460 159
301 3300026088 Ga0207641_10000286 Ga0207641_100002866 159
302 3300026095 Ga0207676_10000188 Ga0207676_100001887 159
303 3300026095 Ga0207676_10000193 Ga0207676_1000019314 159
304 3300026095 Ga0207676_10132218 Ga0207676_101322183 159
305 3300026118 Ga0207675_100042506 Ga0207675_1000425062 159
306 3300026142 Ga0207698_10432393 Ga0207698_104323932 159
307 3300028379 Ga0268266_10056737 Ga0268266_100567374 159
308 3300028379 Ga0268266_10220582 Ga0268266_102205823 159
309 3300028379 Ga0268266_10251411 Ga0268266_102514113 159
310 3300028380 Ga0268265_10072471 Ga0268265_100724712 159
311 3300028381 Ga0268264_10000253 Ga0268264_1000025353 159
312 3300028381 Ga0268264_10042659 Ga0268264_100426594 159
313 3300028653 Ga0265323_10037078 Ga0265323_100370784 159
314 3300028786 Ga0307517_10119221 Ga0307517_101192212 159
315 3300028786 Ga0307517_10158317 Ga0307517_101583173 159
316 3300028786 Ga0307517_10159782 Ga0307517_101597823 159
317 3300028786 Ga0307517_10219035 Ga0307517_102190352 159
318 3300030521 Ga0307511_10337948 Ga0307511_103379481 159
319 3300030732 Ga0316176_1010560 Ga0316176_10105601 159
320 3300030733 Ga0314311_1027475 Ga0314311_10274752 159
321 3300031251 Ga0265327_10419538 Ga0265327_104195381 159
322 3300031456 Ga0307513_10000045 Ga0307513_1000004558 159
323 3300031456 Ga0307513_10084494 Ga0307513_100844944 159
324 3300031616 Ga0307508_10003045 Ga0307508_100030454 159
325 3300031731 Ga0307405_10825050 Ga0307405_108250501 159
326 3300031911 Ga0307412_10040596 Ga0307412_100405962 159
327 3300032126 Ga0307415_100718856 Ga0307415_1007188562 159
328 3300033180 Ga0307510_10009544 Ga0307510_100095445 159
329 3300033180 Ga0307510_10066450 Ga0307510_100664504 159
330 3300035117 Ga0373953_0185009 Ga0373953_0185009_302_787 159
331 3300035118 Ga0373954_0204412 Ga0373954_0204412_206_685 159
332 3300035119 Ga0373956_0000006 Ga0373956_0000006_18022_18507 159
333 3300035120 Ga0373957_0000372 Ga0373957_0000372_987_1472 159
334 3300035172 Ga0373955_0036443 Ga0373955_0036443_1413_1898 159
335 3300035724 Ga0373933_0000564 Ga0373933_0000564_382_867 159
336 3300036401 Ga0373937_0000205 Ga0373937_0000205_49812_50297 159
337 3300037853 Ga0436364_0611150 Ga0436364_0611150_16_501 159
338 3300037853 Ga0436364_1172101 Ga0436364_1172101_430_909 159
339 3300041404 Ga0439436_0024641 Ga0439436_0024641_735_1214 159
340 3300041410 Ga0439461_0000593 Ga0439461_0000593_4678_5157 159
341 3300041410 Ga0439461_0003135 Ga0439461_0003135_2154_2633 159
342 3300041413 Ga0439465_0000607 Ga0439465_0000607_1341_1820 159
343 3300041413 Ga0439465_0001762 Ga0439465_0001762_493_972 159
344 3300041456 Ga0451795_0903877 Ga0451795_0903877_91_579 159
345 3300041498 Ga0451841_1288079 Ga0451841_1288079_1177_1665 159
346 3300041509 Ga0451843_0373864 Ga0451843_0373864_19_507 159
347 3300041997 Ga0439431_0000029 Ga0439431_0000029_17419_17898 159
348 3300041997 Ga0439431_0016372 Ga0439431_0016372_418_897 159
349 3300041999 Ga0439433_0012117 Ga0439433_0012117_321_800 159
350 3300042004 Ga0439445_0001209 Ga0439445_0001209_134_613 159
351 3300042004 Ga0439445_0038714 Ga0439445_0038714_546_1025 159
352 3300042006 Ga0439432_000209 Ga0439432_000209_15556_16035 159
353 3300042006 Ga0439432_007911 Ga0439432_007911_572_1057 159
354 3300042006 Ga0439432_022197 Ga0439432_022197_383_862 159
355 3300042010 Ga0439452_003787 Ga0439452_003787_2787_3266 159
356 3300042010 Ga0439452_013810 Ga0439452_013810_1102_1581 159
357 3300042015 Ga0439462_0000929 Ga0439462_0000929_1101_1580 159
358 3300042135 Ga0450899_040043 Ga0450899_040043_76_555 159
359 3300042147 Ga0450910_012771 Ga0450910_012771_176_655 159
360 3300042156 Ga0439446_0011085 Ga0439446_0011085_664_1143 159
361 3300042435 Ga0439434_0000160 Ga0439434_0000160_11387_11866 159
362 3300044656 Ga0466969_0002067 Ga0466969_0002067_2048_2527 159
363 3300044658 Ga0466972_0173638 Ga0466972_0173638_498_977 159
364 3300044659 Ga0466973_0044883 Ga0466973_0044883_3446_3925 159
365 3300044684 Ga0466966_0160749 Ga0466966_0160749_714_1193 159
366 3300044693 Ga0466961_0012382 Ga0466961_0012382_1948_2427 159
367 3300044694 Ga0466963_0000428 Ga0466963_0000428_18876_19355 159
368 3300044719 Ga0466971_0024627 Ga0466971_0024627_1693_2172 159
369 3300044735 Ga0466968_0220316 Ga0466968_0220316_345_824 159
370 3300044842 Ga0466957_0005418 Ga0466957_0005418_4233_4712 159
371 3300045049 Ga0466959_0018314 Ga0466959_0018314_1610_2089 159
372 3300045051 Ga0451576_0868860 Ga0451576_0868860_310_789 159
373 3300045836 Ga0466958_0029284 Ga0466958_0029284_2251_2730 159
374 3300046453 Ga0495627_036115 Ga0495627_036115_15_494 159
375 3300046460 Ga0495638_0000249 Ga0495638_0000249_43657_44154 159
376 3300046460 Ga0495638_0000344 Ga0495638_0000344_26659_27138 159
377 3300046462 Ga0495651_0063430 Ga0495651_0063430_1239_1724 159
378 3300046471 Ga0495650_0003599 Ga0495650_0003599_2713_3201 159
379 3300046506 Ga0495583_0000262 Ga0495583_0000262_36153_36650 159
380 3300046506 Ga0495583_0015069 Ga0495583_0015069_997_1476 159
381 3300046506 Ga0495583_0026686 Ga0495583_0026686_1588_2067 159
382 3300046506 Ga0495583_0041724 Ga0495583_0041724_1456_1935 159
383 3300046506 Ga0495583_0200806 Ga0495583_0200806_154_633 159
384 3300046512 Ga0495610_0030405 Ga0495610_0030405_1368_1850 159
385 3300046513 Ga0495616_0369111 Ga0495616_0369111_65_544 159
386 3300046518 Ga0495631_0021528 Ga0495631_0021528_1213_1695 159
387 3300046519 Ga0495632_0004828 Ga0495632_0004828_2315_2812 159
388 3300046522 Ga0495643_0007572 Ga0495643_0007572_135_614 159
389 3300046522 Ga0495643_0153763 Ga0495643_0153763_540_1019 159
390 3300046524 Ga0495648_0000015 Ga0495648_0000015_245731_246228 159
391 3300046524 Ga0495648_0009764 Ga0495648_0009764_293_772 159
392 3300046524 Ga0495648_0089289 Ga0495648_0089289_110_589 159
393 3300046525 Ga0495663_0018391 Ga0495663_0018391_995_1495 159
394 3300046525 Ga0495663_0230470 Ga0495663_0230470_119_598 159
395 3300046526 Ga0495666_0107928 Ga0495666_0107928_570_1052 159
396 3300046530 Ga0495654_0285241 Ga0495654_0285241_17_496 159
397 3300046542 Ga0495597_0140952 Ga0495597_0140952_270_749 159
398 3300046558 Ga0495633_0040193 Ga0495633_0040193_982_1482 159
399 3300046558 Ga0495633_0318168 Ga0495633_0318168_140_637 159
400 3300046616 Ga0495668_0000261 Ga0495668_0000261_2932_3411 159
401 3300046616 Ga0495668_0015552 Ga0495668_0015552_2536_3015 159
402 3300046648 Ga0495611_0397037 Ga0495611_0397037_38_517 159
403 3300046660 Ga0495625_0027096 Ga0495625_0027096_2226_2705 159
404 3300046660 Ga0495625_0268649 Ga0495625_0268649_490_969 159
405 3300046660 Ga0495625_0300478 Ga0495625_0300478_101_580 159
406 3300046665 Ga0495661_0022981 Ga0495661_0022981_879_1364 159
407 3300046665 Ga0495661_0060057 Ga0495661_0060057_124_603 159
408 3300046684 Ga0495669_0000144 Ga0495669_0000144_41742_42221 159
409 3300046691 Ga0495670_0000004 Ga0495670_0000004_205783_206262 159
410 3300046691 Ga0495670_0015429 Ga0495670_0015429_3106_3585 159
411 3300046692 Ga0495671_0000084 Ga0495671_0000084_36353_36850 159
412 3300046810 Ga0495660_0034066 Ga0495660_0034066_1320_1799 159
413 3300047322 Ga0495680_0085434 Ga0495680_0085434_263_748 159
414 3300047443 Ga0495687_006553 Ga0495687_006553_3214_3693 159
415 3300047443 Ga0495687_007272 Ga0495687_007272_3337_3816 159
416 3300047444 Ga0495675_0096690 Ga0495675_0096690_274_759 159
417 3300047446 Ga0495679_000621 Ga0495679_000621_22654_23139 159
418 3300047446 Ga0495679_001278 Ga0495679_001278_776_1297 159
419 3300047469 Ga0495673_0000206 Ga0495673_0000206_51694_52191 159
420 3300047470 Ga0495681_0050287 Ga0495681_0050287_485_964 159
421 3300047472 Ga0495686_0000164 Ga0495686_0000164_34897_35376 159
422 3300047472 Ga0495686_0020430 Ga0495686_0020430_2114_2593 159
423 3300048903 Ga0496100_1362638 Ga0496100_1362638_66_545 159
424 3300048905 Ga0496102_1071710 Ga0496102_1071710_134_613 159
425 3300048907 Ga0496104_0015252 Ga0496104_0015252_630_1115 159
426 3300048908 Ga0496105_0014368 Ga0496105_0014368_3363_3848 159
427 3300048908 Ga0496105_0798120 Ga0496105_0798120_77_556 159
428 3300048915 Ga0496112_0070048 Ga0496112_0070048_2734_3258 159
429 3300048918 Ga0496115_0000354 Ga0496115_0000354_22609_23088 159
430 3300048919 Ga0496116_0392525 Ga0496116_0392525_72_551 159
431 3300048920 Ga0496117_0002014 Ga0496117_0002014_18721_19206 159
432 3300048920 Ga0496117_0015197 Ga0496117_0015197_5087_5593 159
433 3300048920 Ga0496117_0249103 Ga0496117_0249103_402_881 159
434 3300048921 Ga0496118_0008522 Ga0496118_0008522_6941_7426 159
435 3300048921 Ga0496118_0132302 Ga0496118_0132302_993_1499 159
436 3300048921 Ga0496118_0377394 Ga0496118_0377394_242_721 159
437 3300048922 Ga0496119_0066471 Ga0496119_0066471_654_1133 159
438 3300048922 Ga0496119_0108978 Ga0496119_0108978_560_1039 159
439 3300048922 Ga0496119_0323405 Ga0496119_0323405_157_642 159
440 3300048923 Ga0496120_0369228 Ga0496120_0369228_93_572 159
441 3300048924 Ga0496121_0000347 Ga0496121_0000347_27207_27686 159
442 3300048924 Ga0496121_0033933 Ga0496121_0033933_3988_4494 159
443 3300048924 Ga0496121_0055602 Ga0496121_0055602_1358_1837 159
444 3300048924 Ga0496121_0387085 Ga0496121_0387085_295_780 159
445 3300048924 Ga0496121_0400009 Ga0496121_0400009_117_602 159
446 3300048925 Ga0496122_0031067 Ga0496122_0031067_3535_4041 159
447 3300048925 Ga0496122_0039498 Ga0496122_0039498_595_1080 159
448 3300048925 Ga0496122_0285794 Ga0496122_0285794_332_811 159
449 3300048925 Ga0496122_0377026 Ga0496122_0377026_187_666 159
450 3300048926 Ga0496123_0031172 Ga0496123_0031172_2670_3155 159
451 3300048926 Ga0496123_0105617 Ga0496123_0105617_991_1497 159
452 3300048926 Ga0496123_0187787 Ga0496123_0187787_429_908 159
453 3300048926 Ga0496123_0212974 Ga0496123_0212974_411_890 159
454 3300048926 Ga0496123_0241589 Ga0496123_0241589_359_838 159
455 3300048928 Ga0496125_0024595 Ga0496125_0024595_757_1242 159
456 3300048928 Ga0496125_0058885 Ga0496125_0058885_2502_2981 159
457 3300048928 Ga0496125_0128811 Ga0496125_0128811_841_1320 159
458 3300048928 Ga0496125_0428338 Ga0496125_0428338_92_571 159
459 3300048929 Ga0496126_0064085 Ga0496126_0064085_2348_2827 159
460 3300048929 Ga0496126_1082153 Ga0496126_1082153_55_534 159
461 3300049460 Ga0495682_0000120 Ga0495682_0000120_22588_23073 159
462 3300049460 Ga0495682_0146768 Ga0495682_0146768_299_796 159
463 3300049758 Ga0501241_008763 Ga0501241_008763_51_530 159
464 3300049822 Ga0501035_0307231 Ga0501035_0307231_178_669 159
465 3300053077 Ga0495601_0216071 Ga0495601_0216071_249_731 159
466 3300053079 Ga0500610_0000163 Ga0500610_0000163_12794_13273 159
467 3300053080 Ga0500635_0097283 Ga0500635_0097283_91_576 159
468 3300053087 Ga0500643_002654 Ga0500643_002654_6256_6735 159
469 3300053091 Ga0500647_0219439 Ga0500647_0219439_319_804 159
470 3300053094 Ga0500566_0003363 Ga0500566_0003363_8877_9356 159
471 3300053096 Ga0500641_0033732 Ga0500641_0033732_717_1199 159
472 3300053096 Ga0500641_0045199 Ga0500641_0045199_51_530 159
473 3300053104 Ga0500556_0163221 Ga0500556_0163221_350_829 159
474 3300053108 Ga0500562_004683 Ga0500562_004683_2179_2658 159
475 3300053111 Ga0500572_000611 Ga0500572_000611_4387_4872 159
476 3300053118 Ga0500594_0026412 Ga0500594_0026412_843_1322 159
477 3300053119 Ga0500595_000516 Ga0500595_000516_3079_3558 159
478 3300053119 Ga0500595_132228 Ga0500595_132228_26_508 159
479 3300053122 Ga0500608_237060 Ga0500608_237060_68_553 159
480 3300053134 Ga0500658_0001066 Ga0500658_0001066_5087_5566 159
481 3300053134 Ga0500658_0003575 Ga0500658_0003575_5214_5693 159
482 3300053134 Ga0500658_0023997 Ga0500658_0023997_800_1279 159
483 3300053136 Ga0500559_0022135 Ga0500559_0022135_1386_1868 159
484 3300053136 Ga0500559_0043951 Ga0500559_0043951_1459_1938 159
485 3300053139 Ga0500568_0018274 Ga0500568_0018274_891_1373 159
486 3300053139 Ga0500568_0069989 Ga0500568_0069989_730_1209 159
487 3300053140 Ga0500573_0000061 Ga0500573_0000061_30880_31359 159
488 3300053140 Ga0500573_0240382 Ga0500573_0240382_29_508 159
489 3300053148 Ga0500590_040158 Ga0500590_040158_922_1407 159
490 3300053148 Ga0500590_130044 Ga0500590_130044_286_771 159
491 3300053151 Ga0500604_0005801 Ga0500604_0005801_2764_3243 159
492 3300053153 Ga0500616_0012043 Ga0500616_0012043_413_895 159
493 3300053158 Ga0500627_0379680 Ga0500627_0379680_43_522 159
494 3300053161 Ga0500634_0015519 Ga0500634_0015519_2679_3164 159
495 3300053177 Ga0500636_0001875 Ga0500636_0001875_8512_8991 159
496 3300053177 Ga0500636_0271111 Ga0500636_0271111_228_707 159
497 3300053730 Ga0500645_000692 Ga0500645_000692_17798_18277 159
498 3300053730 Ga0500645_002262 Ga0500645_002262_4378_4857 159
499 3300053730 Ga0500645_035363 Ga0500645_035363_96_581 159
500 3300061719 Ga0466962_0017128 Ga0466962_0017128_1693_2172 159

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00255

GSHPx

Glutathione peroxidase

2

109

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cmi-assembly1.cif.gz_A crystal structure of glutathione-dependent phospholipid peroxidase hyr1 from the yeast saccharomyces cerevisiae 0.9284 2 158
2wgr-assembly1.cif.gz_A combining crystallography and molecular dynamics: the case of schistosoma mansoni phospholipid glutathione peroxidase 0.918 1 158
2v1m-assembly1.cif.gz_A crystal structure of schistosoma mansoni glutathione peroxidase 0.9148 1 158
2vup-assembly1.cif.gz_A crystal structure of a type ii tryparedoxin-dependant peroxidase from trypanosoma brucei 0.9143 1 158
2wgr-assembly1.cif.gz_A combining crystallography and molecular dynamics: the case of schistosoma mansoni phospholipid glutathione peroxidase 0.9071 1 158
ID Description Score Start End Superfamily
af_A0A1D6K2D3_10_119_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.939 58 158 3.40.30.10
af_Q2FUZ6_1_164_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9366 2 158 3.40.30.10
af_O59858_1_158_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9279 1 159 3.40.30.10
af_Q7FS88_1_175_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9226 1 159 3.40.30.10
af_O59858_1_158_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9223 1 159 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A170PPZ0-F1-model_v4 Glutathione peroxidase family protein 0.9441 2 158 GO:0004601
GO:0034599
AF-A0A0W1QG68-F1-model_v4 Glutathione peroxidase 0.9434 1 159 GO:0004601
GO:0034599
AF-A0A835G3A4-F1-model_v4 Glutathione peroxidase 0.9417 2 159 GO:0004601
GO:0034599
AF-A0A3C1JE78-F1-model_v4 Glutathione peroxidase 0.9398 1 158 GO:0004601
GO:0034599
AF-A0A6G1LSU1-F1-model_v4 Glutathione peroxidase 0.9397 3 158 GO:0034599
GO:0140824

Feature Viewer

pLDDT pTM Quality
86.73 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map