F455015

General Info

Members Datasets Scaffolds Average Seq Length
497 280 488 118

Family's Representative Sequence

Representative Sequence 3300006847|Ga0075431_100152864|Ga0075431_1001528641
Length 128
Sequence VADKVGLREQARRRRQERVRKKVRGTPARPRLSVFKSAKHIYGQLIDDVHGHTVTAASSLGHLFRERTQGAEKVSGGNVAGAKIVGELLAEQARAMGISQIVFDRNGFLYHGRVKALAEGARGVGLEF

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
3 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
4 2890804823 Fluviicola sp. SGL-29 Isolate Rhizosphere
5 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
6 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
7 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
8 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
9 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
10 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
13 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
14 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
15 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
39 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
40 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
69 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
80 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
101 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
137 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
138 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
139 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
140 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
141 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
142 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
143 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
144 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
145 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
146 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
147 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
148 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
149 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
150 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
151 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
152 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
153 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
154 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
155 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
156 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
157 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
158 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
159 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
160 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
161 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
162 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
163 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
164 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
165 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
166 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
167 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
169 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
175 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
176 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
177 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
178 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
179 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
180 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
181 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
182 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
183 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
184 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
185 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
186 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
187 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
188 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
189 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
190 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
191 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
192 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
193 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
194 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
195 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
196 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
197 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
198 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
199 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
200 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
201 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
202 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
203 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
204 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
205 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
206 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
207 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
208 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
209 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
210 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
211 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
212 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
213 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
214 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
215 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
216 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
217 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
218 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
219 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
220 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
221 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
222 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
223 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
224 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
225 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
226 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
227 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
228 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
229 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
230 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
231 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
232 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
236 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
250 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
251 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
252 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
253 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
254 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
255 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
256 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
259 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
260 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
261 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
262 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
263 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
264 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
265 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
266 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
267 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
268 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
269 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
270 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
271 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
272 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
273 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
274 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
275 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
276 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
277 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
278 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
279 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
280 8015556637 Bdellovibrio reynosensis LBG001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.91
Metatranscriptomes 13.28
Isolates 1.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.41
Nodule 0
Rhizoplane 2.01
Rhizosphere 92.56
Stem 0
Stem Tuber 0
Unclassified 4.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1236195 2162886007 Bacteria 2077
2 SwRhRL2b_contig_1759361 2162886007 Bacteria 232727
3 JGI24746J21847_1001976 3300001977 Bacteria 3268
4 rootH2_10213043 3300003320 Bacteria 2744
5 Ga0058860_10952883 3300004801 Bacteria 623
6 Ga0065704_10070132 3300005289 Bacteria 1955461
7 Ga0065704_10087616 3300005289 Bacteria 3010
8 Ga0065704_10662305 3300005289 Bacteria 577
9 Ga0065704_10671097 3300005289 Bacteria 573
10 Ga0065712_10258776 3300005290 Bacteria 942
11 Ga0065712_10349739 3300005290 Unclassified 787
12 Ga0065712_10488693 3300005290 Bacteria 657
13 Ga0065715_10044442 3300005293 Bacteria 1355
14 Ga0065715_10139250 3300005293 Bacteria 1879
15 Ga0065715_10453653 3300005293 Bacteria 819
16 Ga0065707_10112725 3300005295 Bacteria 2351
17 Ga0070658_11204409 3300005327 Unclassified 658
18 Ga0070676_10969353 3300005328 Unclassified 637
19 Ga0070683_101978173 3300005329 Bacteria 560
20 Ga0070690_100009989 3300005330 Bacteria 5510
21 Ga0070690_100955241 3300005330 Bacteria 673
22 Ga0070670_100028507 3300005331 Bacteria 4805
23 Ga0070670_100048150 3300005331 Bacteria 3668
24 Ga0070670_100263191 3300005331 Bacteria 1503
25 Ga0070670_100340165 3300005331 Bacteria 1317
26 Ga0070670_100474089 3300005331 Bacteria 1111
27 Ga0070670_101208770 3300005331 Bacteria 691
28 Ga0068869_100038779 3300005334 Bacteria 3398
29 Ga0068869_100638244 3300005334 Bacteria 903
30 Ga0068869_101066677 3300005334 Bacteria 706
31 Ga0068869_102124312 3300005334 Bacteria 505
32 Ga0070680_100176844 3300005336 Bacteria 1797
33 Ga0070680_101201354 3300005336 Bacteria 656
34 Ga0070682_100962945 3300005337 Bacteria 706
35 Ga0068868_100009179 3300005338 Bacteria 7104
36 Ga0070689_100065428 3300005340 Bacteria 2831
37 Ga0070689_100312865 3300005340 Bacteria 1310
38 Ga0070689_101333301 3300005340 Bacteria 647
39 Ga0070668_100455506 3300005347 Bacteria 1100
40 Ga0070675_100004981 3300005354 Bacteria 10137
41 Ga0070675_100137064 3300005354 Bacteria 2089
42 Ga0070671_100958293 3300005355 Bacteria 749
43 Ga0070674_100349512 3300005356 Bacteria 1194
44 Ga0070673_100536521 3300005364 Bacteria 1061
45 Ga0070688_100287356 3300005365 Bacteria 1184
46 Ga0070688_100495081 3300005365 Bacteria 921
47 Ga0070688_100644452 3300005365 Bacteria 815
48 Ga0070659_101073494 3300005366 Unclassified 709
49 Ga0070703_10131497 3300005406 Bacteria 920
50 Ga0070709_10449199 3300005434 Bacteria 971
51 Ga0070714_100359198 3300005435 Bacteria 1369
52 Ga0070714_100561781 3300005435 Bacteria 1093
53 Ga0070714_100988134 3300005435 Bacteria 819
54 Ga0070713_100112089 3300005436 Bacteria 2380
55 Ga0070710_10235379 3300005437 Bacteria 1171
56 Ga0070711_100181071 3300005439 Bacteria 1613
57 Ga0070705_100323055 3300005440 Bacteria 1115
58 Ga0070705_100943982 3300005440 Bacteria 696
59 Ga0070700_100486052 3300005441 Bacteria 947
60 Ga0070708_100882390 3300005445 Bacteria 840
61 Ga0070708_100920839 3300005445 Bacteria 820
62 Ga0070708_101559404 3300005445 Bacteria 615
63 Ga0070681_10015671 3300005458 Bacteria 7551
64 Ga0068867_100022477 3300005459 Bacteria 4510
65 Ga0070706_100457162 3300005467 Bacteria 1188
66 Ga0070707_100320191 3300005468 Bacteria 1507
67 Ga0070698_100176682 3300005471 Bacteria 2075
68 Ga0070699_100196007 3300005518 Bacteria 1795
69 Ga0070699_100331450 3300005518 Bacteria 1369
70 Ga0070699_100862513 3300005518 Bacteria 829
71 Ga0070679_100094421 3300005530 Bacteria 2978
72 Ga0070684_101993222 3300005535 Bacteria 548
73 Ga0070697_100630890 3300005536 Bacteria 943
74 Ga0070672_100056997 3300005543 Bacteria 3066
75 Ga0070672_101476607 3300005543 Bacteria 609
76 Ga0070686_100142693 3300005544 Bacteria 1669
77 Ga0070686_101029047 3300005544 Unclassified 677
78 Ga0070696_100584172 3300005546 Bacteria 899
79 Ga0070696_101795437 3300005546 Bacteria 530
80 Ga0070665_101365798 3300005548 Bacteria 718
81 Ga0070664_100054522 3300005564 Bacteria 3392
82 Ga0068854_101134125 3300005578 Bacteria 698
83 Ga0068856_100009234 3300005614 Bacteria 9591
84 Ga0068856_100084547 3300005614 Bacteria 3152
85 Ga0068856_100177443 3300005614 Bacteria 2143
86 Ga0070702_100377569 3300005615 Bacteria 1007
87 Ga0068852_100868310 3300005616 Bacteria 918
88 Ga0068859_100207083 3300005617 Bacteria 2047
89 Ga0068859_102230661 3300005617 Bacteria 604
90 Ga0068866_11036445 3300005718 Bacteria 585
91 Ga0068861_101772624 3300005719 Bacteria 612
92 Ga0068863_100241757 3300005841 Bacteria 1742
93 Ga0068863_101007815 3300005841 Bacteria 836
94 Ga0068858_102259080 3300005842 Bacteria 538
95 Ga0068860_100754767 3300005843 Bacteria 985
96 Ga0068862_100217895 3300005844 Bacteria 1727
97 Ga0068862_100792921 3300005844 Bacteria 924
98 Ga0081538_10018238 3300005981 Bacteria 5283
99 Ga0075363_100040363 3300006048 Bacteria 2460
100 Ga0070712_100492208 3300006175 Bacteria 1027
101 Ga0097621_100033934 3300006237 Bacteria 4068
102 Ga0097621_100205340 3300006237 Bacteria 1712
103 Ga0068871_100080397 3300006358 Bacteria 2698
104 Ga0075428_100144695 3300006844 Bacteria 2584
105 Ga0075431_100152864 3300006847 Bacteria 2376
106 Ga0075431_100646824 3300006847 Bacteria 1038
107 Ga0075431_101073520 3300006847 Bacteria 770
108 Ga0075434_100881776 3300006871 Bacteria 910
109 Ga0075429_101893693 3300006880 Unclassified 517
110 Ga0068865_100173676 3300006881 Bacteria 1654
111 Ga0068865_101202351 3300006881 Bacteria 671
112 Ga0097620_100207084 3300006931 Bacteria 2047
113 Ga0097620_102231283 3300006931 Bacteria 604
114 Ga0099794_10025858 3300007265 Bacteria 2708
115 Ga0099794_10061038 3300007265 Bacteria 1831
116 Ga0099794_10362848 3300007265 Bacteria 754
117 Ga0099795_10236117 3300007788 Bacteria 783
118 Ga0111539_10001407 3300009094 Bacteria 32019
119 Ga0111539_10351319 3300009094 Bacteria 1716
120 Ga0111539_11079917 3300009094 Bacteria 933
121 Ga0105245_10735527 3300009098 Bacteria 1022
122 Ga0105247_10001485 3300009101 Bacteria 16868
123 Ga0114129_10023812 3300009147 Bacteria 8679
124 Ga0114129_10647964 3300009147 Bacteria 1364
125 Ga0114129_11727393 3300009147 Unclassified 763
126 Ga0114129_11917664 3300009147 Bacteria 718
127 Ga0105242_10060785 3300009176 Bacteria 3106
128 Ga0105242_12202278 3300009176 Bacteria 596
129 Ga0105248_10438659 3300009177 Bacteria 1471
130 Ga0105249_10547305 3300009553 Bacteria 1208
131 Ga0099796_10324831 3300010159 Bacteria 658
132 Ga0105246_10919574 3300011119 Bacteria 786
133 Ga0157371_10049464 3300013102 Bacteria 2986
134 Ga0157374_10078983 3300013296 Bacteria 3117
135 Ga0157378_10008303 3300013297 Bacteria 9048
136 Ga0163162_12845386 3300013306 Bacteria 557
137 Ga0157375_10022074 3300013308 Bacteria 5854
138 Ga0157375_10272859 3300013308 Bacteria 1853
139 Ga0157375_10690691 3300013308 Bacteria 1175
140 Ga0157375_11450753 3300013308 Bacteria 809
141 Ga0157375_11749456 3300013308 Bacteria 736
142 Ga0163163_11636377 3300014325 Bacteria 705
143 Ga0157380_10176610 3300014326 Bacteria 1872
144 Ga0157380_10547053 3300014326 Bacteria 1135
145 Ga0157380_11601935 3300014326 Bacteria 707
146 Ga0157380_12289382 3300014326 Bacteria 605
147 Ga0182008_10013172 3300014497 Bacteria 4349
148 Ga0157376_10114215 3300014969 Bacteria 2382
149 Ga0163161_10013535 3300017792 Bacteria 5680
150 Ga0163161_10087878 3300017792 Bacteria 2297
151 Ga0163161_10113969 3300017792 Bacteria 2024
152 Ga0213876_10410032 3300021384 Bacteria 721
153 Ga0207710_10001280 3300025900 Bacteria 12698
154 Ga0207680_11034000 3300025903 Bacteria 588
155 Ga0207699_10519874 3300025906 Bacteria 861
156 Ga0207645_10593800 3300025907 Bacteria 752
157 Ga0207645_10786146 3300025907 Bacteria 647
158 Ga0207684_10551507 3300025910 Bacteria 986
159 Ga0207707_10151218 3300025912 Bacteria 2029
160 Ga0207652_11355065 3300025921 Bacteria 614
161 Ga0207646_10259339 3300025922 Bacteria 1571
162 Ga0207681_10206811 3300025923 Bacteria 1510
163 Ga0207650_10058557 3300025925 Bacteria 2868
164 Ga0207650_11256903 3300025925 Bacteria 630
165 Ga0207664_10319870 3300025929 Bacteria 1369
166 Ga0207664_10609376 3300025929 Bacteria 981
167 Ga0207644_10013551 3300025931 Bacteria 5439
168 Ga0207706_10061033 3300025933 Bacteria 3320
169 Ga0207706_10500888 3300025933 Bacteria 1048
170 Ga0207686_10122408 3300025934 Bacteria 1772
171 Ga0207670_10180933 3300025936 Bacteria 1588
172 Ga0207704_10070728 3300025938 Bacteria 2211
173 Ga0207691_10046195 3300025940 Bacteria 4004
174 Ga0207689_10415586 3300025942 Bacteria 1122
175 Ga0207689_11164788 3300025942 Bacteria 649
176 Ga0207679_10541143 3300025945 Bacteria 1044
177 Ga0207651_10030950 3300025960 Bacteria 3415
178 Ga0207651_11216377 3300025960 Bacteria 676
179 Ga0207677_10000955 3300026023 Bacteria 16077
180 Ga0207678_10797950 3300026067 Bacteria 833
181 Ga0207708_11485467 3300026075 Bacteria 595
182 Ga0207702_10001471 3300026078 Bacteria 23360
183 Ga0207702_10135166 3300026078 Bacteria 2224
184 Ga0207641_10149375 3300026088 Bacteria 2115
185 Ga0207641_10584652 3300026088 Bacteria 1092
186 Ga0207648_10019210 3300026089 Bacteria 6167
187 Ga0207674_11926167 3300026116 Bacteria 557
188 Ga0207675_101227106 3300026118 Bacteria 770
189 Ga0207698_12588151 3300026142 Unclassified 517
190 Ga0210002_1032634 3300027617 Bacteria 869
191 Ga0209588_1038344 3300027671 Bacteria 1543
192 Ga0209971_1013410 3300027682 Bacteria 1942
193 Ga0207428_10003685 3300027907 Bacteria 14735
194 Ga0268266_10520008 3300028379 Bacteria 1138
195 Ga0268264_10639327 3300028381 Bacteria 1052
196 Ga0268264_10697664 3300028381 Bacteria 1008
197 Ga0265318_10050880 3300028577 Bacteria 1556
198 Ga0265336_10024336 3300028666 Bacteria 1914
199 Ga0307517_10012583 3300028786 Bacteria 11593
200 Ga0265338_10347722 3300028800 Bacteria 1067
201 Ga0265324_10131156 3300029957 Bacteria 851
202 Ga0265330_10142764 3300031235 Bacteria 1018
203 Ga0265332_10071292 3300031238 Bacteria 1479
204 Ga0265332_10073514 3300031238 Bacteria 1454
205 Ga0265320_10060260 3300031240 Bacteria 1813
206 Ga0265325_10250994 3300031241 Bacteria 801
207 Ga0265339_10209283 3300031249 Bacteria 958
208 Ga0265331_10002189 3300031250 Bacteria 13411
209 Ga0265327_10007434 3300031251 Bacteria 8453
210 Ga0265327_10039893 3300031251 Bacteria 2546
211 Ga0265327_10082108 3300031251 Bacteria 1589
212 Ga0265327_10082421 3300031251 Bacteria 1585
213 Ga0265327_10083805 3300031251 Bacteria 1568
214 Ga0265327_10457220 3300031251 Bacteria 552
215 Ga0265316_10009249 3300031344 Bacteria 9073
216 Ga0265316_10112364 3300031344 Bacteria 2062
217 Ga0265316_10191293 3300031344 Bacteria 1520
218 Ga0265316_10642383 3300031344 Bacteria 751
219 Ga0265316_11015696 3300031344 Unclassified 577
220 Ga0307408_100000648 3300031548 Bacteria 29197
221 Ga0265313_10075705 3300031595 Bacteria 1540
222 Ga0316575_10000149 3300031665 Bacteria 17798
223 Ga0316575_10004333 3300031665 Bacteria 4989
224 Ga0316575_10060066 3300031665 Bacteria 1518
225 Ga0316579_10003044 3300031691 Bacteria 6456
226 Ga0316579_10026105 3300031691 Bacteria 2642
227 Ga0316579_10274385 3300031691 Bacteria 815
228 Ga0265314_10163663 3300031711 Bacteria 1351
229 Ga0265342_10003312 3300031712 Bacteria 13303
230 Ga0316576_10010007 3300031727 Bacteria 6141
231 Ga0316576_10021296 3300031727 Bacteria 4482
232 Ga0316576_10118810 3300031727 Bacteria 1985
233 Ga0316576_10395171 3300031727 Bacteria 1025
234 Ga0316576_10396614 3300031727 Bacteria 1023
235 Ga0316576_10513723 3300031727 Bacteria 880
236 Ga0316576_10888152 3300031727 Bacteria 639
237 Ga0316578_10000551 3300031728 Bacteria 12895
238 Ga0316578_10007640 3300031728 Bacteria 5440
239 Ga0316578_10068396 3300031728 Bacteria 2100
240 Ga0316578_10230695 3300031728 Bacteria 1112
241 Ga0316578_10285758 3300031728 Bacteria 987
242 Ga0316578_10450536 3300031728 Bacteria 760
243 Ga0316578_10641845 3300031728 Bacteria 620
244 Ga0316578_10720647 3300031728 Bacteria 580
245 Ga0307405_10115046 3300031731 Bacteria 1829
246 Ga0316577_10020572 3300031733 Bacteria 3657
247 Ga0316577_10026420 3300031733 Bacteria 3233
248 Ga0316577_10075100 3300031733 Bacteria 1887
249 Ga0316577_10635458 3300031733 Unclassified 607
250 Ga0307410_10101011 3300031852 Bacteria 2067
251 Ga0307412_11064481 3300031911 Bacteria 718
252 Ga0307416_100430601 3300032002 Bacteria 1366
253 Ga0307416_101879697 3300032002 Bacteria 702
254 Ga0307414_10387532 3300032004 Bacteria 1210
255 Ga0307411_10134796 3300032005 Bacteria 1811
256 Ga0316583_10003219 3300032133 Bacteria 5745
257 Ga0316583_10007001 3300032133 Bacteria 4056
258 Ga0316583_10012515 3300032133 Bacteria 3062
259 Ga0316583_10051061 3300032133 Bacteria 1455
260 Ga0316583_10059033 3300032133 Bacteria 1346
261 Ga0316585_10006632 3300032137 Bacteria 3313
262 Ga0316585_10012723 3300032137 Bacteria 2497
263 Ga0316585_10035173 3300032137 Bacteria 1586
264 Ga0316580_10002359 3300032139 Bacteria 5179
265 Ga0316593_10000043 3300032168 Bacteria 13880
266 Ga0316593_10000056 3300032168 Bacteria 12817
267 Ga0316593_10000201 3300032168 Bacteria 9314
268 Ga0316593_10000581 3300032168 Bacteria 6919
269 Ga0316593_10000942 3300032168 Bacteria 5984
270 Ga0316593_10003721 3300032168 Bacteria 3827
271 Ga0316593_10005303 3300032168 Bacteria 3386
272 Ga0316593_10006570 3300032168 Bacteria 3147
273 Ga0316593_10008848 3300032168 Bacteria 2824
274 Ga0316593_10010384 3300032168 Bacteria 2668
275 Ga0316593_10015399 3300032168 Bacteria 2300
276 Ga0316593_10037922 3300032168 Bacteria 1594
277 Ga0316593_10040240 3300032168 Bacteria 1553
278 Ga0316593_10046261 3300032168 Unclassified 1460
279 Ga0316593_10087789 3300032168 Bacteria 1092
280 Ga0316593_10120540 3300032168 Unclassified 942
281 Ga0316593_10124421 3300032168 Bacteria 927
282 Ga0316593_10254814 3300032168 Unclassified 657
283 Ga0316593_10263367 3300032168 Bacteria 647
284 Ga0316593_10374435 3300032168 Unclassified 547
285 Ga0307510_10003892 3300033180 Bacteria 17498
286 Ga0316592_1000035 3300033524 Bacteria 10782
287 Ga0316592_1001202 3300033524 Bacteria 4083
288 Ga0316592_1010062 3300033524 Bacteria 1900
289 Ga0316592_1018250 3300033524 Unclassified 1477
290 Ga0316592_1050833 3300033524 Unclassified 925
291 Ga0316592_1090639 3300033524 Unclassified 699
292 Ga0316592_1105847 3300033524 Bacteria 649
293 Ga0316592_1152397 3300033524 Unclassified 546
294 Ga0316592_1176195 3300033524 Unclassified 510
295 Ga0316586_1004039 3300033527 Bacteria 1972
296 Ga0316588_1015722 3300033528 Bacteria 1670
297 Ga0316588_1046897 3300033528 Bacteria 1042
298 Ga0316587_1007748 3300033529 Bacteria 1675
299 Ga0316587_1032533 3300033529 Bacteria 925
300 Ga0316587_1033647 3300033529 Bacteria 912
301 Ga0316596_1000039 3300033541 Bacteria 13805
302 Ga0316596_1000208 3300033541 Bacteria 8714
303 Ga0316596_1000493 3300033541 Bacteria 6704
304 Ga0316596_1010386 3300033541 Bacteria 2251
305 Ga0316596_1015142 3300033541 Bacteria 1919
306 Ga0316596_1015790 3300033541 Bacteria 1886
307 Ga0316596_1023912 3300033541 Bacteria 1567
308 Ga0316596_1028651 3300033541 Unclassified 1440
309 Ga0316596_1030684 3300033541 Bacteria 1394
310 Ga0316596_1031691 3300033541 Bacteria 1374
311 Ga0316596_1037024 3300033541 Bacteria 1276
312 Ga0316596_1039817 3300033541 Bacteria 1233
313 Ga0316596_1047787 3300033541 Unclassified 1131
314 Ga0316596_1063681 3300033541 Bacteria 985
315 Ga0316596_1081290 3300033541 Bacteria 871
316 Ga0316596_1094070 3300033541 Bacteria 808
317 Ga0316596_1102168 3300033541 Bacteria 776
318 Ga0316596_1103074 3300033541 Bacteria 772
319 Ga0316596_1205231 3300033541 Bacteria 549
320 Ga0316596_1207948 3300033541 Bacteria 546
321 Ga0373958_0035823 3300034819 Bacteria 995
322 Ga0373951_0000260 3300035091 Bacteria 17321
323 Ga0373956_0311716 3300035119 Bacteria 750
324 Ga0373960_0457256 3300035121 Bacteria 501
325 Ga0316574_0000856 3300035398 Bacteria 13374
326 Ga0316574_0077983 3300035398 Unclassified 2100
327 Ga0316574_0081721 3300035398 Bacteria 2052
328 Ga0316574_0238352 3300035398 Bacteria 1163
329 Ga0316574_0482851 3300035398 Bacteria 774
330 Ga0373931_0970796 3300035691 Bacteria 574
331 Ga0373937_0068497 3300036401 Bacteria 3272
332 Ga0316582_0001586 3300036647 Bacteria 10123
333 Ga0316582_0347458 3300036647 Bacteria 1020
334 Ga0316582_0490802 3300036647 Bacteria 846
335 Ga0316582_0556040 3300036647 Bacteria 790
336 Ga0316584_0005236 3300036712 Bacteria 8675
337 Ga0316584_0007094 3300036712 Bacteria 7633
338 Ga0316584_0032070 3300036712 Bacteria 3887
339 Ga0316584_0055347 3300036712 Bacteria 2970
340 Ga0316584_0060549 3300036712 Bacteria 2836
341 Ga0316584_0152195 3300036712 Bacteria 1722
342 Ga0316584_0158760 3300036712 Bacteria 1681
343 Ga0316584_0186424 3300036712 Bacteria 1535
344 Ga0316584_0189728 3300036712 Bacteria 1520
345 Ga0373925_0566501 3300037068 Bacteria 935
346 Ga0395899_0770320 3300037312 Bacteria 597
347 Ga0395900_0001482 3300037418 Bacteria 28015
348 Ga0395901_0018865 3300038443 Bacteria 7051
349 Ga0400490_18978 3300038726 Bacteria 41932
350 Ga0400491_29253 3300038727 Bacteria 8022
351 Ga0400489_43192 3300039093 Bacteria 1048
352 Ga0436365_1519392 3300039437 Bacteria 721
353 Ga0436360_1293516 3300039438 Bacteria 610
354 Ga0436361_0943046 3300039447 Bacteria 1789
355 Ga0439436_0051846 3300041404 Bacteria 1158
356 Ga0451795_0004783 3300041456 Bacteria 1998
357 Ga0451795_0308341 3300041456 Bacteria 641
358 Ga0451795_0418658 3300041456 Bacteria 2008
359 Ga0451795_0429792 3300041456 Bacteria 927
360 Ga0451798_0398916 3300041458 Bacteria 786
361 Ga0451800_0765475 3300041459 Bacteria 625
362 Ga0451807_2570531 3300041486 Bacteria 982
363 Ga0451837_1058636 3300041494 Bacteria 1110
364 Ga0451837_1265030 3300041494 Bacteria 721
365 Ga0451841_0994727 3300041498 Bacteria 1678
366 Ga0451843_0236456 3300041509 Bacteria 771
367 Ga0451855_0308303 3300041511 Bacteria 1058
368 Ga0451855_0406082 3300041511 Bacteria 1466
369 Ga0451855_1986902 3300041511 Bacteria 543
370 Ga0439433_0078544 3300041999 Bacteria 801
371 Ga0450920_047281 3300042122 Bacteria 861
372 Ga0450907_049505 3300042146 Unclassified 722
373 Ga0439444_0066382 3300042437 Bacteria 764
374 Ga0450916_100141 3300042530 Bacteria 513
375 Ga0451577_0000828 3300042876 Bacteria 46284
376 Ga0451577_0011670 3300042876 Bacteria 8296
377 Ga0451577_0072044 3300042876 Bacteria 3082
378 Ga0451577_0091291 3300042876 Bacteria 2718
379 Ga0451577_0144367 3300042876 Bacteria 2139
380 Ga0451577_0455144 3300042876 Bacteria 1162
381 Ga0451577_0585721 3300042876 Bacteria 1012
382 Ga0451577_0589002 3300042876 Bacteria 1009
383 Ga0453683_0005086 3300044673 Bacteria 9225
384 Ga0453683_0188255 3300044673 Bacteria 1309
385 Ga0453683_0367974 3300044673 Bacteria 924
386 Ga0453684_0001835 3300044712 Bacteria 55524
387 Ga0453684_0009135 3300044712 Bacteria 17453
388 Ga0453684_0010045 3300044712 Bacteria 16285
389 Ga0453684_0010350 3300044712 Bacteria 15963
390 Ga0453684_0012498 3300044712 Bacteria 13983
391 Ga0453684_0032497 3300044712 Bacteria 7301
392 Ga0453684_0037245 3300044712 Bacteria 6679
393 Ga0453684_0117437 3300044712 Bacteria 3219
394 Ga0453684_0146662 3300044712 Bacteria 2810
395 Ga0453684_0268799 3300044712 Bacteria 1949
396 Ga0453684_0295765 3300044712 Bacteria 1842
397 Ga0453684_0432738 3300044712 Bacteria 1467
398 Ga0453684_0443799 3300044712 Bacteria 1445
399 Ga0453684_0452149 3300044712 Bacteria 1429
400 Ga0453684_0632333 3300044712 Bacteria 1170
401 Ga0453684_0883082 3300044712 Bacteria 958
402 Ga0466959_0038285 3300045049 Bacteria 3544
403 Ga0451576_0094369 3300045051 Bacteria 3111
404 Ga0451576_0169084 3300045051 Bacteria 2281
405 Ga0451576_0353029 3300045051 Bacteria 1539
406 Ga0451576_0605084 3300045051 Bacteria 1152
407 Ga0451576_2004260 3300045051 Bacteria 596
408 Ga0495638_0065559 3300046460 Bacteria 2235
409 Ga0495605_0046448 3300046474 Bacteria 2135
410 Ga0495583_0136352 3300046506 Bacteria 1024
411 Ga0495606_0006936 3300046507 Bacteria 10302
412 Ga0495606_0233375 3300046507 Bacteria 1030
413 Ga0495616_0006047 3300046513 Bacteria 7376
414 Ga0495631_0002385 3300046518 Bacteria 10650
415 Ga0495632_0099553 3300046519 Bacteria 1371
416 Ga0495598_0054209 3300046537 Bacteria 1217
417 Ga0495609_0412222 3300046538 Bacteria 540
418 Ga0495656_0000397 3300046615 Bacteria 14422
419 Ga0495656_0771929 3300046615 Bacteria 519
420 Ga0495611_0271672 3300046648 Bacteria 784
421 Ga0495625_0071465 3300046660 Bacteria 2435
422 Ga0495625_0085328 3300046660 Bacteria 2191
423 Ga0495661_0170204 3300046665 Bacteria 1162
424 Ga0495604_0264596 3300047317 Bacteria 1168
425 Ga0495636_0000893 3300047318 Bacteria 11074
426 Ga0495683_0017548 3300047323 Bacteria 3709
427 Ga0495687_000233 3300047443 Bacteria 77056
428 Ga0496104_0365254 3300048907 Bacteria 1356
429 Ga0496104_1531200 3300048907 Bacteria 570
430 Ga0496125_0080668 3300048928 Bacteria 2489
431 Ga0496126_0460207 3300048929 Bacteria 1022
432 Ga0501310_018367 3300049130 Bacteria 853
433 Ga0501305_053909 3300049161 Unclassified 680
434 Ga0501307_000268 3300049162 Bacteria 3155
435 Ga0495678_041088 3300049459 Bacteria 1853
436 Ga0501317_065940 3300049533 Bacteria 603
437 Ga0501031_0015262 3300049568 Bacteria 4987
438 Ga0501032_0002362 3300049569 Bacteria 14785
439 Ga0501032_0148801 3300049569 Bacteria 1540
440 Ga0501033_0000011 3300049570 Bacteria 259130
441 Ga0501034_0001265 3300049571 Bacteria 34324
442 Ga0501034_0104552 3300049571 Bacteria 2825
443 Ga0501037_0013217 3300049573 Bacteria 6084
444 Ga0501038_0002395 3300049574 Bacteria 17463
445 Ga0501039_0015938 3300049575 Bacteria 5754
446 Ga0501040_0258403 3300049576 Bacteria 1243
447 Ga0501042_0544330 3300049578 Bacteria 844
448 Ga0501043_0000733 3300049579 Bacteria 29055
449 Ga0501047_0046063 3300049581 Bacteria 4216
450 Ga0501048_0155004 3300049582 Bacteria 1620
451 Ga0501070_0629447 3300049586 Bacteria 853
452 Ga0501072_1536568 3300049588 Bacteria 513
453 Ga0501073_0059535 3300049589 Bacteria 2667
454 Ga0501074_1306007 3300049590 Bacteria 508
455 Ga0501077_0746569 3300049593 Bacteria 629
456 Ga0501223_002029 3300049663 Bacteria 4544
457 Ga0501081_1074509 3300049743 Bacteria 609
458 Ga0501081_1401187 3300049743 Bacteria 530
459 Ga0501035_0004622 3300049822 Bacteria 13050
460 Ga0501044_0001293 3300049823 Bacteria 29588
461 Ga0501045_0000053 3300049824 Bacteria 51403
462 nmdc:mga03683_483563_c1 3300050489 Bacteria 598
463 nmdc:mga05p37_1317213_c1 3300050507 Bacteria 735
464 nmdc:mga05p37_17293_c1 3300050507 Bacteria 8698
465 nmdc:mga05p37_634569_c1 3300050507 Bacteria 1199
466 nmdc:mga09592_1389958_c1 3300050508 Bacteria 574
467 nmdc:mga06r32_730858_c1 3300050510 Bacteria 954
468 nmdc:mga06r32_98282_c1 3300050510 Bacteria 2869
469 nmdc:mga08y16_10646_c1 3300050511 Bacteria 9652
470 nmdc:mga08y16_1627797_c1 3300050511 Bacteria 603
471 nmdc:mga08y16_1713884_c1 3300050511 Bacteria 583
472 nmdc:mga08y16_460608_c1 3300050511 Bacteria 1296
473 nmdc:mga0n895_519211_c1 3300050512 Bacteria 1199
474 nmdc:mga0rr50_788756_c1 3300050513 Bacteria 811
475 nmdc:mga08x19_336160_c1 3300050514 Bacteria 1053
476 Ga0500650_0209678 3300053098 Bacteria 885
477 Ga0500608_016071 3300053122 Bacteria 3374
478 Ga0500652_397128 3300053131 Bacteria 511
479 Ga0500564_061308 3300053138 Bacteria 1706
480 Ga0500579_242454 3300053143 Bacteria 596
481 Ga0501084_1785661 3300054114 Bacteria 514
482 Ga0587084_087900 3300059477 Bacteria 612
483 Ga0587077_055410 3300059493 Bacteria 843
484 Ga0587085_017856 3300059506 Bacteria 1045
485 Ga0587109_144336 3300059624 Bacteria 584
486 Ga0587068_024314 3300059641 Bacteria 1014
487 Ga0587111_0111703 3300060346 Bacteria 693
488 Ga0501082_0965166 3300060353 Bacteria 745

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300034819 Ga0373958_0035823 Ga0373958_0035823_714_974 80
2 3300042437 Ga0439444_0066382 Ga0439444_0066382_40_300 80
3 3300046615 Ga0495656_0771929 Ga0495656_0771929_50_310 80
4 3300049588 Ga0501072_1536568 Ga0501072_1536568_75_335 80
5 3300049590 Ga0501074_1306007 Ga0501074_1306007_40_300 80
6 3300050513 nmdc:mga0rr50_788756_c1 nmdc:mga0rr50_788756_c1_13_294 87
7 2162886007 SwRhRL2b_contig_1759361 SwRhRL2b_0440.00005980 90
8 3300005289 Ga0065704_10070132 Ga0065704_100701321326 90
9 3300036401 Ga0373937_0068497 Ga0373937_0068497_12_386 95
10 3300039438 Ga0436360_1293516 Ga0436360_1293516_25_393 95
11 3300038726 Ga0400490_18978 Ga0400490_18978_23090_23398 96
12 3300038727 Ga0400491_29253 Ga0400491_29253_3337_3645 96
13 3300005293 Ga0065715_10453653 Ga0065715_104536532 97
14 3300005334 Ga0068869_100038779 Ga0068869_1000387798 97
15 3300005340 Ga0070689_100312865 Ga0070689_1003128653 97
16 3300005546 Ga0070696_100584172 Ga0070696_1005841722 97
17 3300005578 Ga0068854_101134125 Ga0068854_1011341252 97
18 3300005615 Ga0070702_100377569 Ga0070702_1003775691 97
19 3300005718 Ga0068866_11036445 Ga0068866_110364452 97
20 3300005844 Ga0068862_100792921 Ga0068862_1007929212 97
21 3300009094 Ga0111539_10351319 Ga0111539_103513193 97
22 3300009553 Ga0105249_10547305 Ga0105249_105473052 97
23 3300025907 Ga0207645_10786146 Ga0207645_107861462 97
24 3300025933 Ga0207706_10061033 Ga0207706_100610333 97
25 3300050511 nmdc:mga08y16_460608_c1 nmdc:mga08y16_460608_c1_357_731 97
26 3300005331 Ga0070670_100048150 Ga0070670_1000481507 98
27 3300025942 Ga0207689_11164788 Ga0207689_111647882 98
28 3300027617 Ga0210002_1032634 Ga0210002_10326342 98
29 3300042530 Ga0450916_100141 Ga0450916_100141_180_494 98
30 3300046537 Ga0495598_0054209 Ga0495598_0054209_887_1201 98
31 3300048907 Ga0496104_1531200 Ga0496104_1531200_245_559 98
32 3300049593 Ga0501077_0746569 Ga0501077_0746569_76_390 98
33 3300049743 Ga0501081_1401187 Ga0501081_1401187_16_330 98
34 3300050511 nmdc:mga08y16_1627797_c1 nmdc:mga08y16_1627797_c1_19_333 98
35 3300050514 nmdc:mga08x19_336160_c1 nmdc:mga08x19_336160_c1_720_1034 98
36 3300054114 Ga0501084_1785661 Ga0501084_1785661_172_486 98
37 3300060353 Ga0501082_0965166 Ga0501082_0965166_406_720 98
38 3300005719 Ga0068861_101772624 Ga0068861_1017726242 99
39 3300026118 Ga0207675_101227106 Ga0207675_1012271062 99
40 3300032002 Ga0307416_100430601 Ga0307416_1004306012 99
41 3300032005 Ga0307411_10134796 Ga0307411_101347963 99
42 3300009147 Ga0114129_10023812 Ga0114129_1002381211 100
43 3300050507 nmdc:mga05p37_17293_c1 nmdc:mga05p37_17293_c1_3037_3411 100
44 3300005471 Ga0070698_100176682 Ga0070698_1001766821 101
45 3300005518 Ga0070699_100196007 Ga0070699_1001960075 101
46 3300006844 Ga0075428_100144695 Ga0075428_1001446955 101
47 3300031728 Ga0316578_10450536 Ga0316578_104505362 101
48 3300033541 Ga0316596_1094070 Ga0316596_10940702 101
49 3300036712 Ga0316584_0005236 Ga0316584_0005236_6920_7249 101
50 3300006847 Ga0075431_101073520 Ga0075431_1010735202 102
51 3300006880 Ga0075429_101893693 Ga0075429_1018936931 102
52 3300050508 nmdc:mga09592_1389958_c1 nmdc:mga09592_1389958_c1_67_435 102
53 3300050510 nmdc:mga06r32_98282_c1 nmdc:mga06r32_98282_c1_400_768 102
54 3300005356 Ga0070674_100349512 Ga0070674_1003495122 104
55 3300005435 Ga0070714_100988134 Ga0070714_1009881341 105
56 3300025907 Ga0207645_10593800 Ga0207645_105938002 105
57 3300025929 Ga0207664_10609376 Ga0207664_106093762 105
58 3300032168 Ga0316593_10000581 Ga0316593_100005812 105
59 3300033541 Ga0316596_1000493 Ga0316596_10004935 105
60 3300041404 Ga0439436_0051846 Ga0439436_0051846_649_1023 105
61 3300041999 Ga0439433_0078544 Ga0439433_0078544_342_716 105
62 3300042146 Ga0450907_049505 Ga0450907_049505_373_708 105
63 3300032168 Ga0316593_10040240 Ga0316593_100402402 106
64 3300005441 Ga0070700_100486052 Ga0070700_1004860522 107
65 3300033541 Ga0316596_1103074 Ga0316596_11030742 107
66 3300044673 Ga0453683_0188255 Ga0453683_0188255_610_969 107
67 3300044712 Ga0453684_0012498 Ga0453684_0012498_5443_5802 107
68 3300009147 Ga0114129_11727393 Ga0114129_117273932 108
69 3300032004 Ga0307414_10387532 Ga0307414_103875322 108
70 3300032168 Ga0316593_10120540 Ga0316593_101205401 108
71 3300050510 nmdc:mga06r32_730858_c1 nmdc:mga06r32_730858_c1_376_762 108
72 iso_pu_bacteria 8015556637 8015559916 109
73 3300005981 Ga0081538_10018238 Ga0081538_1001823812 110
74 3300046615 Ga0495656_0000397 Ga0495656_0000397_8198_8563 110
75 3300047318 Ga0495636_0000893 Ga0495636_0000893_528_893 110
76 3300048928 Ga0496125_0080668 Ga0496125_0080668_893_1258 110
77 3300048929 Ga0496126_0460207 Ga0496126_0460207_214_579 110
78 3300005334 Ga0068869_102124312 Ga0068869_1021243121 111
79 3300009101 Ga0105247_10001485 Ga0105247_1000148518 111
80 3300014497 Ga0182008_10013172 Ga0182008_1001317210 111
81 3300041494 Ga0451837_1058636 Ga0451837_1058636_530_883 111
82 iso_pu_bacteria 2599185184 2599479378 111
83 iso_pu_bacteria 2919437846 2919438021 111
84 iso_pu_bacteria 2928078545 2928082312 111
85 iso_pu_bacteria 2928147474 2928149109 111
86 iso_pu_bacteria 2932082852 2932085024 111
87 3300005330 Ga0070690_100955241 Ga0070690_1009552412 112
88 3300005331 Ga0070670_100340165 Ga0070670_1003401653 112
89 3300005334 Ga0068869_100638244 Ga0068869_1006382442 112
90 3300005338 Ga0068868_100009179 Ga0068868_1000091795 112
91 3300005340 Ga0070689_100065428 Ga0070689_1000654285 112
92 3300005459 Ga0068867_100022477 Ga0068867_1000224775 112
93 3300005543 Ga0070672_101476607 Ga0070672_1014766071 112
94 3300005617 Ga0068859_102230661 Ga0068859_1022306611 112
95 3300005841 Ga0068863_100241757 Ga0068863_1002417572 112
96 3300005842 Ga0068858_102259080 Ga0068858_1022590802 112
97 3300005843 Ga0068860_100754767 Ga0068860_1007547672 112
98 3300006048 Ga0075363_100040363 Ga0075363_1000403635 112
99 3300006237 Ga0097621_100033934 Ga0097621_10003393410 112
100 3300006358 Ga0068871_100080397 Ga0068871_1000803972 112
101 3300006881 Ga0068865_100173676 Ga0068865_1001736764 112
102 3300006881 Ga0068865_101202351 Ga0068865_1012023512 112
103 3300006931 Ga0097620_102231283 Ga0097620_1022312831 112
104 3300009176 Ga0105242_10060785 Ga0105242_100607853 112
105 3300009177 Ga0105248_10438659 Ga0105248_104386592 112
106 3300014969 Ga0157376_10114215 Ga0157376_101142154 112
107 3300025900 Ga0207710_10001280 Ga0207710_1000128010 112
108 3300025903 Ga0207680_11034000 Ga0207680_110340002 112
109 3300025934 Ga0207686_10122408 Ga0207686_101224082 112
110 3300025938 Ga0207704_10070728 Ga0207704_100707284 112
111 3300025942 Ga0207689_10415586 Ga0207689_104155862 112
112 3300026023 Ga0207677_10000955 Ga0207677_100009552 112
113 3300026075 Ga0207708_11485467 Ga0207708_114854671 112
114 3300026088 Ga0207641_10149375 Ga0207641_101493755 112
115 3300026089 Ga0207648_10019210 Ga0207648_100192105 112
116 3300028381 Ga0268264_10639327 Ga0268264_106393272 112
117 3300032168 Ga0316593_10003721 Ga0316593_100037212 112
118 3300032168 Ga0316593_10263367 Ga0316593_102633671 112
119 3300033541 Ga0316596_1063681 Ga0316596_10636812 112
120 3300035398 Ga0316574_0482851 Ga0316574_0482851_265_624 112
121 3300039447 Ga0436361_0943046 Ga0436361_0943046_536_895 112
122 3300041456 Ga0451795_0004783 Ga0451795_0004783_937_1281 112
123 3300041456 Ga0451795_0418658 Ga0451795_0418658_1298_1642 112
124 3300041456 Ga0451795_0429792 Ga0451795_0429792_166_510 112
125 3300041494 Ga0451837_1265030 Ga0451837_1265030_230_589 112
126 3300041498 Ga0451841_0994727 Ga0451841_0994727_1136_1495 112
127 3300044673 Ga0453683_0005086 Ga0453683_0005086_8104_8466 112
128 3300050489 nmdc:mga03683_483563_c1 nmdc:mga03683_483563_c1_132_482 112
129 3300059477 Ga0587084_087900 Ga0587084_087900_64_423 112
130 3300059493 Ga0587077_055410 Ga0587077_055410_355_714 112
131 3300059506 Ga0587085_017856 Ga0587085_017856_628_987 112
132 3300059624 Ga0587109_144336 Ga0587109_144336_41_400 112
133 3300059641 Ga0587068_024314 Ga0587068_024314_192_551 112
134 iso_pu_bacteria 2890737413 2890740659 112
135 iso_pu_bacteria 2896317667 2896320834 112
136 3300005336 Ga0070680_101201354 Ga0070680_1012013542 113
137 3300005434 Ga0070709_10449199 Ga0070709_104491992 113
138 3300005435 Ga0070714_100561781 Ga0070714_1005617812 113
139 3300005437 Ga0070710_10235379 Ga0070710_102353792 113
140 3300005439 Ga0070711_100181071 Ga0070711_1001810712 113
141 3300005445 Ga0070708_100882390 Ga0070708_1008823902 113
142 3300005458 Ga0070681_10015671 Ga0070681_1001567114 113
143 3300005467 Ga0070706_100457162 Ga0070706_1004571622 113
144 3300005468 Ga0070707_100320191 Ga0070707_1003201913 113
145 3300005518 Ga0070699_100331450 Ga0070699_1003314503 113
146 3300005518 Ga0070699_100862513 Ga0070699_1008625131 113
147 3300005530 Ga0070679_100094421 Ga0070679_1000944214 113
148 3300005536 Ga0070697_100630890 Ga0070697_1006308902 113
149 3300005544 Ga0070686_100142693 Ga0070686_1001426932 113
150 3300005546 Ga0070696_101795437 Ga0070696_1017954371 113
151 3300005616 Ga0068852_100868310 Ga0068852_1008683102 113
152 3300006175 Ga0070712_100492208 Ga0070712_1004922082 113
153 3300006847 Ga0075431_100646824 Ga0075431_1006468242 113
154 3300006871 Ga0075434_100881776 Ga0075434_1008817761 113
155 3300007265 Ga0099794_10025858 Ga0099794_100258585 113
156 3300007265 Ga0099794_10061038 Ga0099794_100610384 113
157 3300007265 Ga0099794_10362848 Ga0099794_103628481 113
158 3300007788 Ga0099795_10236117 Ga0099795_102361172 113
159 3300010159 Ga0099796_10324831 Ga0099796_103248311 113
160 3300025906 Ga0207699_10519874 Ga0207699_105198742 113
161 3300025910 Ga0207684_10551507 Ga0207684_105515072 113
162 3300025912 Ga0207707_10151218 Ga0207707_101512183 113
163 3300025922 Ga0207646_10259339 Ga0207646_102593392 113
164 3300027671 Ga0209588_1038344 Ga0209588_10383443 113
165 3300028666 Ga0265336_10024336 Ga0265336_100243362 113
166 3300029957 Ga0265324_10131156 Ga0265324_101311562 113
167 3300031235 Ga0265330_10142764 Ga0265330_101427642 113
168 3300031238 Ga0265332_10073514 Ga0265332_100735142 113
169 3300031241 Ga0265325_10250994 Ga0265325_102509942 113
170 3300031251 Ga0265327_10007434 Ga0265327_1000743415 113
171 3300031251 Ga0265327_10082108 Ga0265327_100821082 113
172 3300031251 Ga0265327_10082421 Ga0265327_100824211 113
173 3300031251 Ga0265327_10083805 Ga0265327_100838052 113
174 3300031251 Ga0265327_10457220 Ga0265327_104572201 113
175 3300031344 Ga0265316_10112364 Ga0265316_101123642 113
176 3300031344 Ga0265316_10191293 Ga0265316_101912934 113
177 3300031344 Ga0265316_10642383 Ga0265316_106423832 113
178 3300031691 Ga0316579_10274385 Ga0316579_102743852 113
179 3300031711 Ga0265314_10163663 Ga0265314_101636631 113
180 3300031727 Ga0316576_10888152 Ga0316576_108881522 113
181 3300031728 Ga0316578_10641845 Ga0316578_106418452 113
182 3300031733 Ga0316577_10075100 Ga0316577_100751002 113
183 3300032168 Ga0316593_10087789 Ga0316593_100877892 113
184 3300032168 Ga0316593_10254814 Ga0316593_102548142 113
185 3300033524 Ga0316592_1176195 Ga0316592_11761951 113
186 3300033541 Ga0316596_1037024 Ga0316596_10370242 113
187 3300033541 Ga0316596_1081290 Ga0316596_10812902 113
188 3300035091 Ga0373951_0000260 Ga0373951_0000260_9015_9377 113
189 3300036712 Ga0316584_0189728 Ga0316584_0189728_194_556 113
190 3300037068 Ga0373925_0566501 Ga0373925_0566501_244_606 113
191 3300041456 Ga0451795_0308341 Ga0451795_0308341_103_447 113
192 3300041511 Ga0451855_0406082 Ga0451855_0406082_124_468 113
193 3300041511 Ga0451855_1986902 Ga0451855_1986902_77_421 113
194 3300042876 Ga0451577_0000828 Ga0451577_0000828_34742_35104 113
195 3300042876 Ga0451577_0072044 Ga0451577_0072044_629_991 113
196 3300042876 Ga0451577_0091291 Ga0451577_0091291_2328_2690 113
197 3300042876 Ga0451577_0144367 Ga0451577_0144367_72_434 113
198 3300042876 Ga0451577_0585721 Ga0451577_0585721_487_849 113
199 3300042876 Ga0451577_0589002 Ga0451577_0589002_561_923 113
200 3300044712 Ga0453684_0010350 Ga0453684_0010350_13931_14293 113
201 3300044712 Ga0453684_0268799 Ga0453684_0268799_1090_1452 113
202 3300044712 Ga0453684_0432738 Ga0453684_0432738_690_1052 113
203 3300044712 Ga0453684_0443799 Ga0453684_0443799_283_645 113
204 3300044712 Ga0453684_0883082 Ga0453684_0883082_38_400 113
205 3300045051 Ga0451576_0094369 Ga0451576_0094369_182_544 113
206 3300045051 Ga0451576_0169084 Ga0451576_0169084_1328_1690 113
207 3300045051 Ga0451576_0353029 Ga0451576_0353029_864_1226 113
208 3300045051 Ga0451576_0605084 Ga0451576_0605084_163_531 113
209 3300046474 Ga0495605_0046448 Ga0495605_0046448_815_1159 113
210 3300046506 Ga0495583_0136352 Ga0495583_0136352_198_542 113
211 3300046665 Ga0495661_0170204 Ga0495661_0170204_369_713 113
212 3300049589 Ga0501073_0059535 Ga0501073_0059535_872_1225 113
213 3300050512 nmdc:mga0n895_519211_c1 nmdc:mga0n895_519211_c1_320_688 113
214 3300060346 Ga0587111_0111703 Ga0587111_0111703_84_446 113
215 iso_pu_bacteria 2890804823 2890807148 113
216 3300005327 Ga0070658_11204409 Ga0070658_112044091 114
217 3300005331 Ga0070670_100474089 Ga0070670_1004740892 114
218 3300005340 Ga0070689_101333301 Ga0070689_1013333012 114
219 3300005347 Ga0070668_100455506 Ga0070668_1004555062 114
220 3300005354 Ga0070675_100137064 Ga0070675_1001370642 114
221 3300005365 Ga0070688_100495081 Ga0070688_1004950812 114
222 3300005365 Ga0070688_100644452 Ga0070688_1006444522 114
223 3300005440 Ga0070705_100323055 Ga0070705_1003230551 114
224 3300005445 Ga0070708_100920839 Ga0070708_1009208391 114
225 3300005614 Ga0068856_100009234 Ga0068856_1000092345 114
226 3300005614 Ga0068856_100177443 Ga0068856_1001774432 114
227 3300005617 Ga0068859_100207083 Ga0068859_1002070832 114
228 3300006931 Ga0097620_100207084 Ga0097620_1002070844 114
229 3300009094 Ga0111539_10001407 Ga0111539_1000140723 114
230 3300013308 Ga0157375_10690691 Ga0157375_106906912 114
231 3300014326 Ga0157380_12289382 Ga0157380_122893822 114
232 3300026078 Ga0207702_10001471 Ga0207702_1000147114 114
233 3300026116 Ga0207674_11926167 Ga0207674_119261671 114
234 3300027907 Ga0207428_10003685 Ga0207428_1000368517 114
235 3300031344 Ga0265316_11015696 Ga0265316_110156962 114
236 3300031595 Ga0265313_10075705 Ga0265313_100757054 114
237 3300031665 Ga0316575_10000149 Ga0316575_1000014916 114
238 3300031665 Ga0316575_10004333 Ga0316575_100043332 114
239 3300031665 Ga0316575_10060066 Ga0316575_100600662 114
240 3300031691 Ga0316579_10003044 Ga0316579_100030447 114
241 3300031691 Ga0316579_10026105 Ga0316579_100261052 114
242 3300031727 Ga0316576_10010007 Ga0316576_100100079 114
243 3300031727 Ga0316576_10021296 Ga0316576_100212965 114
244 3300031727 Ga0316576_10118810 Ga0316576_101188105 114
245 3300031727 Ga0316576_10395171 Ga0316576_103951712 114
246 3300031727 Ga0316576_10396614 Ga0316576_103966142 114
247 3300031727 Ga0316576_10513723 Ga0316576_105137232 114
248 3300031728 Ga0316578_10000551 Ga0316578_1000055117 114
249 3300031728 Ga0316578_10007640 Ga0316578_100076409 114
250 3300031728 Ga0316578_10068396 Ga0316578_100683964 114
251 3300031728 Ga0316578_10230695 Ga0316578_102306952 114
252 3300031728 Ga0316578_10285758 Ga0316578_102857581 114
253 3300031728 Ga0316578_10720647 Ga0316578_107206471 114
254 3300031733 Ga0316577_10020572 Ga0316577_100205725 114
255 3300031733 Ga0316577_10026420 Ga0316577_100264204 114
256 3300031733 Ga0316577_10635458 Ga0316577_106354582 114
257 3300031911 Ga0307412_11064481 Ga0307412_110644812 114
258 3300032002 Ga0307416_101879697 Ga0307416_1018796972 114
259 3300032133 Ga0316583_10003219 Ga0316583_100032195 114
260 3300032133 Ga0316583_10007001 Ga0316583_100070015 114
261 3300032133 Ga0316583_10012515 Ga0316583_100125153 114
262 3300032133 Ga0316583_10051061 Ga0316583_100510612 114
263 3300032133 Ga0316583_10059033 Ga0316583_100590333 114
264 3300032137 Ga0316585_10006632 Ga0316585_100066322 114
265 3300032137 Ga0316585_10012723 Ga0316585_100127232 114
266 3300032137 Ga0316585_10035173 Ga0316585_100351731 114
267 3300032139 Ga0316580_10002359 Ga0316580_100023595 114
268 3300032168 Ga0316593_10000043 Ga0316593_1000004312 114
269 3300032168 Ga0316593_10000056 Ga0316593_1000005618 114
270 3300032168 Ga0316593_10000942 Ga0316593_1000094211 114
271 3300032168 Ga0316593_10005303 Ga0316593_100053037 114
272 3300032168 Ga0316593_10006570 Ga0316593_100065701 114
273 3300032168 Ga0316593_10008848 Ga0316593_100088485 114
274 3300032168 Ga0316593_10010384 Ga0316593_100103844 114
275 3300032168 Ga0316593_10015399 Ga0316593_100153995 114
276 3300032168 Ga0316593_10046261 Ga0316593_100462613 114
277 3300032168 Ga0316593_10124421 Ga0316593_101244212 114
278 3300032168 Ga0316593_10374435 Ga0316593_103744352 114
279 3300033524 Ga0316592_1000035 Ga0316592_100003517 114
280 3300033524 Ga0316592_1001202 Ga0316592_10012025 114
281 3300033524 Ga0316592_1010062 Ga0316592_10100625 114
282 3300033524 Ga0316592_1018250 Ga0316592_10182501 114
283 3300033524 Ga0316592_1050833 Ga0316592_10508332 114
284 3300033524 Ga0316592_1090639 Ga0316592_10906391 114
285 3300033524 Ga0316592_1152397 Ga0316592_11523971 114
286 3300033527 Ga0316586_1004039 Ga0316586_10040394 114
287 3300033528 Ga0316588_1015722 Ga0316588_10157222 114
288 3300033528 Ga0316588_1046897 Ga0316588_10468972 114
289 3300033529 Ga0316587_1007748 Ga0316587_10077482 114
290 3300033529 Ga0316587_1032533 Ga0316587_10325332 114
291 3300033529 Ga0316587_1033647 Ga0316587_10336472 114
292 3300033541 Ga0316596_1000039 Ga0316596_100003917 114
293 3300033541 Ga0316596_1000208 Ga0316596_100020818 114
294 3300033541 Ga0316596_1010386 Ga0316596_10103865 114
295 3300033541 Ga0316596_1015142 Ga0316596_10151423 114
296 3300033541 Ga0316596_1015790 Ga0316596_10157904 114
297 3300033541 Ga0316596_1023912 Ga0316596_10239122 114
298 3300033541 Ga0316596_1028651 Ga0316596_10286511 114
299 3300033541 Ga0316596_1030684 Ga0316596_10306842 114
300 3300033541 Ga0316596_1031691 Ga0316596_10316912 114
301 3300033541 Ga0316596_1039817 Ga0316596_10398172 114
302 3300033541 Ga0316596_1047787 Ga0316596_10477873 114
303 3300033541 Ga0316596_1102168 Ga0316596_11021682 114
304 3300033541 Ga0316596_1205231 Ga0316596_12052311 114
305 3300033541 Ga0316596_1207948 Ga0316596_12079481 114
306 3300035119 Ga0373956_0311716 Ga0373956_0311716_204_572 114
307 3300035398 Ga0316574_0000856 Ga0316574_0000856_9316_9684 114
308 3300035398 Ga0316574_0077983 Ga0316574_0077983_241_609 114
309 3300035398 Ga0316574_0081721 Ga0316574_0081721_1470_1838 114
310 3300035398 Ga0316574_0238352 Ga0316574_0238352_746_1114 114
311 3300035691 Ga0373931_0970796 Ga0373931_0970796_194_562 114
312 3300036647 Ga0316582_0001586 Ga0316582_0001586_1297_1665 114
313 3300036647 Ga0316582_0347458 Ga0316582_0347458_572_940 114
314 3300036647 Ga0316582_0490802 Ga0316582_0490802_454_822 114
315 3300036647 Ga0316582_0556040 Ga0316582_0556040_146_514 114
316 3300036712 Ga0316584_0007094 Ga0316584_0007094_3829_4197 114
317 3300036712 Ga0316584_0032070 Ga0316584_0032070_536_904 114
318 3300036712 Ga0316584_0055347 Ga0316584_0055347_2173_2541 114
319 3300036712 Ga0316584_0060549 Ga0316584_0060549_1050_1418 114
320 3300036712 Ga0316584_0152195 Ga0316584_0152195_432_812 114
321 3300036712 Ga0316584_0158760 Ga0316584_0158760_731_1099 114
322 3300036712 Ga0316584_0186424 Ga0316584_0186424_41_409 114
323 3300039093 Ga0400489_43192 Ga0400489_43192_430_798 114
324 3300041458 Ga0451798_0398916 Ga0451798_0398916_293_640 114
325 3300041459 Ga0451800_0765475 Ga0451800_0765475_66_413 114
326 3300041486 Ga0451807_2570531 Ga0451807_2570531_528_875 114
327 3300042876 Ga0451577_0011670 Ga0451577_0011670_6819_7184 114
328 3300042876 Ga0451577_0455144 Ga0451577_0455144_36_404 114
329 3300044712 Ga0453684_0001835 Ga0453684_0001835_32870_33235 114
330 3300044712 Ga0453684_0009135 Ga0453684_0009135_1357_1722 114
331 3300044712 Ga0453684_0010045 Ga0453684_0010045_7628_7996 114
332 3300044712 Ga0453684_0032497 Ga0453684_0032497_5144_5512 114
333 3300044712 Ga0453684_0037245 Ga0453684_0037245_4499_4864 114
334 3300044712 Ga0453684_0117437 Ga0453684_0117437_1551_1919 114
335 3300044712 Ga0453684_0452149 Ga0453684_0452149_620_985 114
336 3300044712 Ga0453684_0632333 Ga0453684_0632333_408_773 114
337 3300045051 Ga0451576_2004260 Ga0451576_2004260_170_535 114
338 3300048907 Ga0496104_0365254 Ga0496104_0365254_279_650 114
339 3300049161 Ga0501305_053909 Ga0501305_053909_56_403 114
340 3300049533 Ga0501317_065940 Ga0501317_065940_47_394 114
341 3300049743 Ga0501081_1074509 Ga0501081_1074509_234_599 114
342 3300050507 nmdc:mga05p37_634569_c1 nmdc:mga05p37_634569_c1_198_563 114
343 3300050511 nmdc:mga08y16_10646_c1 nmdc:mga08y16_10646_c1_3881_4246 114
344 3300004801 Ga0058860_10952883 Ga0058860_109528832 115
345 3300009098 Ga0105245_10735527 Ga0105245_107355272 115
346 3300009176 Ga0105242_12202278 Ga0105242_122022782 115
347 3300011119 Ga0105246_10919574 Ga0105246_109195741 115
348 3300013296 Ga0157374_10078983 Ga0157374_100789835 115
349 3300013297 Ga0157378_10008303 Ga0157378_100083035 115
350 3300013308 Ga0157375_10022074 Ga0157375_100220744 115
351 3300013308 Ga0157375_10272859 Ga0157375_102728593 115
352 3300017792 Ga0163161_10013535 Ga0163161_100135355 115
353 3300025931 Ga0207644_10013551 Ga0207644_100135513 115
354 3300025933 Ga0207706_10500888 Ga0207706_105008883 115
355 3300028381 Ga0268264_10697664 Ga0268264_106976642 115
356 3300028786 Ga0307517_10012583 Ga0307517_1001258312 115
357 3300033180 Ga0307510_10003892 Ga0307510_1000389220 115
358 3300037418 Ga0395900_0001482 Ga0395900_0001482_24121_24471 115
359 3300041511 Ga0451855_0308303 Ga0451855_0308303_484_834 115
360 3300045049 Ga0466959_0038285 Ga0466959_0038285_2176_2526 115
361 3300046460 Ga0495638_0065559 Ga0495638_0065559_1729_2079 115
362 3300046507 Ga0495606_0006936 Ga0495606_0006936_4724_5074 115
363 3300046507 Ga0495606_0233375 Ga0495606_0233375_334_684 115
364 3300046513 Ga0495616_0006047 Ga0495616_0006047_4637_4987 115
365 3300046518 Ga0495631_0002385 Ga0495631_0002385_225_575 115
366 3300046519 Ga0495632_0099553 Ga0495632_0099553_385_735 115
367 3300046538 Ga0495609_0412222 Ga0495609_0412222_161_511 115
368 3300046648 Ga0495611_0271672 Ga0495611_0271672_150_500 115
369 3300046660 Ga0495625_0071465 Ga0495625_0071465_655_1005 115
370 3300046660 Ga0495625_0085328 Ga0495625_0085328_1704_2054 115
371 3300047317 Ga0495604_0264596 Ga0495604_0264596_663_1013 115
372 3300047323 Ga0495683_0017548 Ga0495683_0017548_2023_2373 115
373 3300047443 Ga0495687_000233 Ga0495687_000233_57214_57564 115
374 3300049459 Ga0495678_041088 Ga0495678_041088_400_750 115
375 3300053098 Ga0500650_0209678 Ga0500650_0209678_195_545 115
376 3300053122 Ga0500608_016071 Ga0500608_016071_2085_2435 115
377 3300053131 Ga0500652_397128 Ga0500652_397128_94_444 115
378 3300053138 Ga0500564_061308 Ga0500564_061308_330_680 115
379 3300053143 Ga0500579_242454 Ga0500579_242454_156_506 115
380 3300017792 Ga0163161_10087878 Ga0163161_100878785 116
381 3300037312 Ga0395899_0770320 Ga0395899_0770320_133_492 116
382 3300038443 Ga0395901_0018865 Ga0395901_0018865_5615_5974 116
383 3300049568 Ga0501031_0015262 Ga0501031_0015262_2848_3201 116
384 3300049569 Ga0501032_0002362 Ga0501032_0002362_80_433 116
385 3300049569 Ga0501032_0148801 Ga0501032_0148801_80_433 116
386 3300049570 Ga0501033_0000011 Ga0501033_0000011_44975_45328 116
387 3300049571 Ga0501034_0001265 Ga0501034_0001265_9441_9794 116
388 3300049571 Ga0501034_0104552 Ga0501034_0104552_1852_2205 116
389 3300049573 Ga0501037_0013217 Ga0501037_0013217_5465_5818 116
390 3300049574 Ga0501038_0002395 Ga0501038_0002395_8836_9189 116
391 3300049575 Ga0501039_0015938 Ga0501039_0015938_3636_3989 116
392 3300049576 Ga0501040_0258403 Ga0501040_0258403_80_433 116
393 3300049579 Ga0501043_0000733 Ga0501043_0000733_3289_3642 116
394 3300049581 Ga0501047_0046063 Ga0501047_0046063_3722_4075 116
395 3300049582 Ga0501048_0155004 Ga0501048_0155004_104_457 116
396 3300049586 Ga0501070_0629447 Ga0501070_0629447_358_711 116
397 3300049822 Ga0501035_0004622 Ga0501035_0004622_10939_11292 116
398 3300049823 Ga0501044_0001293 Ga0501044_0001293_3069_3422 116
399 3300049824 Ga0501045_0000053 Ga0501045_0000053_9573_9926 116
400 2162886007 SwRhRL2b_contig_1236195 SwRhRL2b_0097.00002580 117
401 3300001977 JGI24746J21847_1001976 JGI24746J21847_10019766 117
402 3300003320 rootH2_10213043 rootH2_102130434 117
403 3300005289 Ga0065704_10087616 Ga0065704_100876165 117
404 3300005289 Ga0065704_10662305 Ga0065704_106623051 117
405 3300005289 Ga0065704_10671097 Ga0065704_106710972 117
406 3300005290 Ga0065712_10258776 Ga0065712_102587762 117
407 3300005290 Ga0065712_10349739 Ga0065712_103497392 117
408 3300005290 Ga0065712_10488693 Ga0065712_104886931 117
409 3300005293 Ga0065715_10044442 Ga0065715_100444423 117
410 3300005293 Ga0065715_10139250 Ga0065715_101392503 117
411 3300005295 Ga0065707_10112725 Ga0065707_101127254 117
412 3300005328 Ga0070676_10969353 Ga0070676_109693531 117
413 3300005329 Ga0070683_101978173 Ga0070683_1019781731 117
414 3300005330 Ga0070690_100009989 Ga0070690_1000099896 117
415 3300005331 Ga0070670_100028507 Ga0070670_1000285073 117
416 3300005331 Ga0070670_100263191 Ga0070670_1002631911 117
417 3300005331 Ga0070670_101208770 Ga0070670_1012087701 117
418 3300005334 Ga0068869_101066677 Ga0068869_1010666771 117
419 3300005336 Ga0070680_100176844 Ga0070680_1001768441 117
420 3300005337 Ga0070682_100962945 Ga0070682_1009629452 117
421 3300005354 Ga0070675_100004981 Ga0070675_10000498111 117
422 3300005355 Ga0070671_100958293 Ga0070671_1009582932 117
423 3300005364 Ga0070673_100536521 Ga0070673_1005365212 117
424 3300005365 Ga0070688_100287356 Ga0070688_1002873562 117
425 3300005366 Ga0070659_101073494 Ga0070659_1010734941 117
426 3300005406 Ga0070703_10131497 Ga0070703_101314972 117
427 3300005435 Ga0070714_100359198 Ga0070714_1003591982 117
428 3300005436 Ga0070713_100112089 Ga0070713_1001120892 117
429 3300005440 Ga0070705_100943982 Ga0070705_1009439821 117
430 3300005445 Ga0070708_101559404 Ga0070708_1015594041 117
431 3300005535 Ga0070684_101993222 Ga0070684_1019932221 117
432 3300005543 Ga0070672_100056997 Ga0070672_1000569974 117
433 3300005544 Ga0070686_101029047 Ga0070686_1010290471 117
434 3300005548 Ga0070665_101365798 Ga0070665_1013657982 117
435 3300005564 Ga0070664_100054522 Ga0070664_1000545224 117
436 3300005614 Ga0068856_100084547 Ga0068856_1000845475 117
437 3300005841 Ga0068863_101007815 Ga0068863_1010078152 117
438 3300005844 Ga0068862_100217895 Ga0068862_1002178952 117
439 3300006237 Ga0097621_100205340 Ga0097621_1002053404 117
440 3300006847 Ga0075431_100152864 Ga0075431_1001528641 117
441 3300009094 Ga0111539_11079917 Ga0111539_110799171 117
442 3300009147 Ga0114129_10647964 Ga0114129_106479642 117
443 3300009147 Ga0114129_11917664 Ga0114129_119176642 117
444 3300013102 Ga0157371_10049464 Ga0157371_100494642 117
445 3300013306 Ga0163162_12845386 Ga0163162_128453861 117
446 3300013308 Ga0157375_11450753 Ga0157375_114507532 117
447 3300013308 Ga0157375_11749456 Ga0157375_117494562 117
448 3300014325 Ga0163163_11636377 Ga0163163_116363772 117
449 3300014326 Ga0157380_10176610 Ga0157380_101766102 117
450 3300014326 Ga0157380_10547053 Ga0157380_105470531 117
451 3300014326 Ga0157380_11601935 Ga0157380_116019351 117
452 3300017792 Ga0163161_10113969 Ga0163161_101139694 117
453 3300021384 Ga0213876_10410032 Ga0213876_104100321 117
454 3300025921 Ga0207652_11355065 Ga0207652_113550652 117
455 3300025923 Ga0207681_10206811 Ga0207681_102068112 117
456 3300025925 Ga0207650_10058557 Ga0207650_100585575 117
457 3300025925 Ga0207650_11256903 Ga0207650_112569032 117
458 3300025929 Ga0207664_10319870 Ga0207664_103198702 117
459 3300025936 Ga0207670_10180933 Ga0207670_101809331 117
460 3300025940 Ga0207691_10046195 Ga0207691_100461951 117
461 3300025945 Ga0207679_10541143 Ga0207679_105411432 117
462 3300025960 Ga0207651_10030950 Ga0207651_100309507 117
463 3300025960 Ga0207651_11216377 Ga0207651_112163772 117
464 3300026067 Ga0207678_10797950 Ga0207678_107979502 117
465 3300026078 Ga0207702_10135166 Ga0207702_101351662 117
466 3300026088 Ga0207641_10584652 Ga0207641_105846522 117
467 3300026142 Ga0207698_12588151 Ga0207698_125881511 117
468 3300027682 Ga0209971_1013410 Ga0209971_10134102 117
469 3300028379 Ga0268266_10520008 Ga0268266_105200082 117
470 3300028577 Ga0265318_10050880 Ga0265318_100508802 117
471 3300028800 Ga0265338_10347722 Ga0265338_103477223 117
472 3300031238 Ga0265332_10071292 Ga0265332_100712922 117
473 3300031240 Ga0265320_10060260 Ga0265320_100602602 117
474 3300031249 Ga0265339_10209283 Ga0265339_102092832 117
475 3300031250 Ga0265331_10002189 Ga0265331_1000218910 117
476 3300031251 Ga0265327_10039893 Ga0265327_100398935 117
477 3300031344 Ga0265316_10009249 Ga0265316_1000924915 117
478 3300031548 Ga0307408_100000648 Ga0307408_1000006487 117
479 3300031712 Ga0265342_10003312 Ga0265342_100033123 117
480 3300031731 Ga0307405_10115046 Ga0307405_101150463 117
481 3300031852 Ga0307410_10101011 Ga0307410_101010114 117
482 3300032168 Ga0316593_10000201 Ga0316593_1000020111 117
483 3300032168 Ga0316593_10037922 Ga0316593_100379223 117
484 3300033524 Ga0316592_1105847 Ga0316592_11058472 117
485 3300035121 Ga0373960_0457256 Ga0373960_0457256_14_385 117
486 3300039437 Ga0436365_1519392 Ga0436365_1519392_284_643 117
487 3300041509 Ga0451843_0236456 Ga0451843_0236456_223_579 117
488 3300042122 Ga0450920_047281 Ga0450920_047281_211_585 117
489 3300044673 Ga0453683_0367974 Ga0453683_0367974_176_538 117
490 3300044712 Ga0453684_0146662 Ga0453684_0146662_1093_1461 117
491 3300044712 Ga0453684_0295765 Ga0453684_0295765_1102_1461 117
492 3300049130 Ga0501310_018367 Ga0501310_018367_485_838 117
493 3300049162 Ga0501307_000268 Ga0501307_000268_2004_2357 117
494 3300049578 Ga0501042_0544330 Ga0501042_0544330_264_638 117
495 3300049663 Ga0501223_002029 Ga0501223_002029_219_572 117
496 3300050507 nmdc:mga05p37_1317213_c1 nmdc:mga05p37_1317213_c1_162_533 117
497 3300050511 nmdc:mga08y16_1713884_c1 nmdc:mga08y16_1713884_c1_166_537 117

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00861

Ribosomal_L18p

Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast

7

128

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ily-assembly1.cif.gz_A solution structure of ribosomal protein l18 of thermus thermophilus 0.9093 27 117
7pib-assembly1.cif.gz_n 70s ribosome with ef-g, a/p- and p/e-site trnas in spectinomycin-treated mycoplasma pneumoniae cells 0.9003 26 117
5xym-assembly1.cif.gz_O large subunit of mycobacterium smegmatis 0.8978 6 117
7mt3-assembly1.cif.gz_O mtb 70s with p/e trna 0.8934 9 117
1ily-assembly1.cif.gz_A solution structure of ribosomal protein l18 of thermus thermophilus 0.8908 27 117
ID Description Score Start End Superfamily
5xymO01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.9636 19 117 3.30.420.100
5zetP01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.9554 19 117 3.30.420.100
5xymO01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.953 19 117 3.30.420.100
5zetP01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.937 19 117 3.30.420.100
6ddga01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.9364 24 117 3.30.420.100
ID Description Score Start End GO Terms
AF-A0A078SLA1-F1-model_v4 Large ribosomal subunit protein uL18 (50S ribosomal protein L18) 0.9937 30 117 GO:0003735
GO:0006412
GO:0008097
GO:0022625
AF-A0A1F5AYM9-F1-model_v4 Large ribosomal subunit protein uL18 (50S ribosomal protein L18) 0.9872 26 117 GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:0008097
GO:1990904
AF-A0A0G1DKC5-F1-model_v4 Large ribosomal subunit protein uL18 0.9853 20 117 GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:0008097
GO:1990904
AF-A0A3D0D8I8-F1-model_v4 Large ribosomal subunit protein uL18 (50S ribosomal protein L18) 0.9848 20 117 GO:0003735
GO:0006412
GO:0008097
GO:0022625
AF-A0A0G0S4I6-F1-model_v4 Large ribosomal subunit protein uL18 0.98 20 117 GO:0003735
GO:0006412
GO:0008097
GO:0022625

Feature Viewer

pLDDT pTM Quality
82.33 0.68 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map