F453811

General Info

Members Datasets Scaffolds Average Seq Length
489 287 978 161

Family's Representative Sequence

Representative Sequence 3300035692|Ga0373935_0333635|Ga0373935_0333635_443_916
Length 157
Sequence MEETLMARAKLDRIDRRILSDLQSNGRMTNVELAERAGISAPPCLRRVRIIKGYHAELSPEALGYSVSVFALVGLNSQAETDLKAFEELVSKWDEVRECHMLAGEADFLLKIVAETWDDYQKFLTTRLTSAPNVSHVKSMMVFRTAKQLPGVPISTD

Samples

Sample ID Description Type Environment
1 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
2 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
63 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
64 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
65 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
68 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
69 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
70 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
71 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
76 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
99 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
101 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
102 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
103 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
104 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
105 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
108 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
159 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
162 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
163 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
164 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
165 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
166 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
167 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
168 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
169 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
170 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
171 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
172 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
173 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
174 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
175 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
176 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
177 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
178 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
179 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
180 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
181 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
182 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
183 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
184 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
185 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
186 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
187 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
188 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
189 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
190 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
191 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
192 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
193 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
194 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
195 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
196 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
197 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
198 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
199 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
200 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
201 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
202 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
203 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
204 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
205 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
206 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
207 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
208 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
209 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
210 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
211 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
212 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
213 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
214 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
215 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
216 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
217 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
218 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
219 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
220 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
221 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
222 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
223 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
224 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
225 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
226 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
227 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
228 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
229 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
230 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
231 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
232 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
233 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
242 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
243 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
244 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
245 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
246 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
247 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
248 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
249 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
250 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
251 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
252 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
253 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
254 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
255 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
256 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
257 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
258 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
259 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
260 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
262 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
263 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
264 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
265 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
266 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
267 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
268 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
269 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
270 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
271 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
272 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
273 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
274 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
275 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
276 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
277 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
278 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
279 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
280 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
281 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
282 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
283 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
284 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
285 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
286 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
287 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.18
Metatranscriptomes 0.82
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.91
Nodule 0
Rhizoplane 0.61
Rhizosphere 81.6
Stem 0
Stem Tuber 0
Unclassified 0.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373935_0333635 3300035692 Bacteria 1078
2 Ga0006778J45830_1084215 3300003162 Bacteria 815
3 JGI25406J46586_10071057 3300003203 Bacteria 1092
4 rootL2_10101513 3300003322 Bacteria 1327
5 Ga0055542_1025901 3300003762 Unclassified 794
6 Ga0065704_10144393 3300005289 Bacteria 1486
7 Ga0065712_10386802 3300005290 Bacteria 746
8 Ga0070658_10001221 3300005327 Bacteria 22034
9 Ga0070676_10447431 3300005328 Bacteria 908
10 Ga0070690_100396494 3300005330 Bacteria 1012
11 Ga0070670_101158030 3300005331 Bacteria 706
12 Ga0070666_10236199 3300005335 Bacteria 1292
13 Ga0070680_100004632 3300005336 Bacteria 10338
14 Ga0070680_100080294 3300005336 Bacteria 2690
15 Ga0070680_100192891 3300005336 Bacteria 1717
16 Ga0070682_100318203 3300005337 Bacteria 1148
17 Ga0068868_100371386 3300005338 Bacteria 1229
18 Ga0070660_100482672 3300005339 Bacteria 1030
19 Ga0070689_100167714 3300005340 Bacteria 1778
20 Ga0070689_100206302 3300005340 Bacteria 1607
21 Ga0070689_100427788 3300005340 Bacteria 1123
22 Ga0070691_10109784 3300005341 Bacteria 1378
23 Ga0070692_10273916 3300005345 Bacteria 1020
24 Ga0070692_10582321 3300005345 Bacteria 738
25 Ga0070668_100754602 3300005347 Bacteria 862
26 Ga0070669_100794562 3300005353 Bacteria 804
27 Ga0070675_100085273 3300005354 Bacteria 2639
28 Ga0070671_100673023 3300005355 Bacteria 897
29 Ga0070674_100920976 3300005356 Bacteria 762
30 Ga0070659_100083948 3300005366 Bacteria 2546
31 Ga0070667_101031335 3300005367 Bacteria 768
32 Ga0070709_10206215 3300005434 Bacteria 1395
33 Ga0070714_100007835 3300005435 Bacteria 8319
34 Ga0070713_100003311 3300005436 Bacteria 10627
35 Ga0070713_100051718 3300005436 Bacteria 3399
36 Ga0070713_100530321 3300005436 Bacteria 1113
37 Ga0070713_100758625 3300005436 Bacteria 928
38 Ga0070713_101441407 3300005436 Bacteria 668
39 Ga0070710_10005364 3300005437 Bacteria 6081
40 Ga0070711_100021230 3300005439 Bacteria 4194
41 Ga0070711_100066941 3300005439 Bacteria 2518
42 Ga0070705_100899366 3300005440 Bacteria 712
43 Ga0070700_100165246 3300005441 Bacteria 1527
44 Ga0070708_100131108 3300005445 Bacteria 2320
45 Ga0070663_101688182 3300005455 Bacteria 566
46 Ga0070678_100004110 3300005456 Bacteria 8199
47 Ga0070681_10003960 3300005458 Bacteria 13964
48 Ga0070681_10960558 3300005458 Bacteria 774
49 Ga0070707_100539730 3300005468 Bacteria 1128
50 Ga0070698_100004129 3300005471 Bacteria 15969
51 Ga0070698_100115481 3300005471 Bacteria 2649
52 Ga0070698_100582134 3300005471 Bacteria 1059
53 Ga0070699_100019887 3300005518 Bacteria 5787
54 Ga0070699_100197323 3300005518 Bacteria 1789
55 Ga0070679_100005381 3300005530 Bacteria 11856
56 Ga0070684_100094096 3300005535 Bacteria 2669
57 Ga0070697_100785790 3300005536 Bacteria 842
58 Ga0070697_101286922 3300005536 Bacteria 652
59 Ga0068853_100424540 3300005539 Bacteria 1247
60 Ga0068853_100949197 3300005539 Bacteria 827
61 Ga0068853_101248652 3300005539 Bacteria 718
62 Ga0070672_100476129 3300005543 Bacteria 1078
63 Ga0070665_100009198 3300005548 Bacteria 10005
64 Ga0070665_100118556 3300005548 Bacteria 2649
65 Ga0070665_100202688 3300005548 Bacteria 1984
66 Ga0070665_100416202 3300005548 Bacteria 1353
67 Ga0070665_100758082 3300005548 Bacteria 984
68 Ga0068855_100057440 3300005563 Bacteria 4561
69 Ga0068855_100286460 3300005563 Bacteria 1827
70 Ga0070664_100201653 3300005564 Bacteria 1775
71 Ga0068857_100556790 3300005577 Bacteria 1081
72 Ga0068857_100657913 3300005577 Bacteria 993
73 Ga0068854_100199071 3300005578 Bacteria 1574
74 Ga0068856_100052708 3300005614 Bacteria 4012
75 Ga0068856_100132034 3300005614 Bacteria 2502
76 Ga0068856_100272390 3300005614 Bacteria 1709
77 Ga0068852_100004657 3300005616 Bacteria 9723
78 Ga0068852_100287680 3300005616 Bacteria 1586
79 Ga0068859_100564152 3300005617 Bacteria 1232
80 Ga0068859_100620610 3300005617 Bacteria 1174
81 Ga0068864_101046261 3300005618 Bacteria 811
82 Ga0068863_100579374 3300005841 Bacteria 1110
83 Ga0068863_100787582 3300005841 Bacteria 948
84 Ga0068858_101293207 3300005842 Bacteria 718
85 Ga0068862_100272867 3300005844 Bacteria 1547
86 Ga0081455_10004071 3300005937 Bacteria 16555
87 Ga0081455_10005773 3300005937 Bacteria 13495
88 Ga0081455_10122893 3300005937 Bacteria 2043
89 Ga0081455_10140228 3300005937 Bacteria 1878
90 Ga0081538_10054155 3300005981 Bacteria 2376
91 Ga0081539_10007444 3300005985 Bacteria 9980
92 Ga0081539_10008665 3300005985 Bacteria 8760
93 Ga0070717_10088692 3300006028 Bacteria 2608
94 Ga0075365_10006828 3300006038 Bacteria 6326
95 Ga0075365_10243041 3300006038 Bacteria 1264
96 Ga0075365_10344877 3300006038 Bacteria 1049
97 Ga0075365_10465007 3300006038 Bacteria 893
98 Ga0075365_10591011 3300006038 Bacteria 785
99 Ga0075368_10047364 3300006042 Bacteria 1701
100 Ga0075368_10079006 3300006042 Bacteria 1337
101 Ga0075368_10189728 3300006042 Bacteria 868
102 Ga0075363_100050666 3300006048 Bacteria 2213
103 Ga0075364_10319596 3300006051 Bacteria 1057
104 Ga0075364_10673044 3300006051 Bacteria 706
105 Ga0070712_100006409 3300006175 Bacteria 7297
106 Ga0070712_100083928 3300006175 Bacteria 2314
107 Ga0070712_100767427 3300006175 Bacteria 826
108 Ga0070712_101252490 3300006175 Bacteria 646
109 Ga0075362_10008737 3300006177 Bacteria 3891
110 Ga0075362_10079164 3300006177 Bacteria 1512
111 Ga0075362_10097772 3300006177 Bacteria 1369
112 Ga0075362_10105140 3300006177 Bacteria 1324
113 Ga0075362_10553801 3300006177 Bacteria 591
114 Ga0075367_10059884 3300006178 Bacteria 2268
115 Ga0075367_10251578 3300006178 Bacteria 1108
116 Ga0075369_10000614 3300006186 Bacteria 11283
117 Ga0075369_10032381 3300006186 Bacteria 2212
118 Ga0075369_10035378 3300006186 Bacteria 2122
119 Ga0075366_10027592 3300006195 Bacteria 3332
120 Ga0075366_10405168 3300006195 Bacteria 839
121 Ga0075370_10015236 3300006353 Bacteria 4111
122 Ga0075430_100794982 3300006846 Bacteria 780
123 Ga0068865_100294857 3300006881 Bacteria 1296
124 Ga0097620_100564156 3300006931 Bacteria 1232
125 Ga0097620_100620668 3300006931 Bacteria 1174
126 Ga0099794_10068848 3300007265 Bacteria 1731
127 Ga0099795_10059113 3300007788 Bacteria 1417
128 Ga0105240_10019952 3300009093 Bacteria 8950
129 Ga0105240_10595309 3300009093 Bacteria 1218
130 Ga0105240_10741909 3300009093 Bacteria 1068
131 Ga0111539_12466784 3300009094 Bacteria 603
132 Ga0105245_10543012 3300009098 Bacteria 1184
133 Ga0114129_10707108 3300009147 Bacteria 1294
134 Ga0114129_12155050 3300009147 Bacteria 671
135 Ga0105243_12359816 3300009148 Bacteria 570
136 Ga0105248_10226794 3300009177 Bacteria 2103
137 Ga0105248_10366147 3300009177 Bacteria 1623
138 Ga0105237_11266203 3300009545 Bacteria 744
139 Ga0105237_11629330 3300009545 Bacteria 652
140 Ga0105249_10994199 3300009553 Bacteria 908
141 Ga0105035_106107 3300009988 Bacteria 991
142 Ga0105239_10684270 3300010375 Bacteria 1172
143 Ga0105239_12688603 3300010375 Bacteria 581
144 Ga0105246_10671785 3300011119 Bacteria 904
145 Ga0105246_10812595 3300011119 Bacteria 831
146 Ga0157373_10363660 3300013100 Bacteria 1033
147 Ga0157371_10163519 3300013102 Bacteria 1589
148 Ga0157370_10031502 3300013104 Bacteria 5185
149 Ga0157370_10085525 3300013104 Bacteria 2963
150 Ga0157369_10004115 3300013105 Bacteria 17222
151 Ga0157369_10231351 3300013105 Bacteria 1932
152 Ga0157369_10343057 3300013105 Bacteria 1551
153 Ga0157374_10115819 3300013296 Bacteria 2582
154 Ga0157374_10931812 3300013296 Bacteria 887
155 Ga0157378_10529870 3300013297 Bacteria 1181
156 Ga0163162_10628645 3300013306 Bacteria 1198
157 Ga0157372_10693970 3300013307 Bacteria 1185
158 Ga0157375_10157134 3300013308 Bacteria 2413
159 Ga0157375_11208721 3300013308 Bacteria 887
160 Ga0157375_12938988 3300013308 Bacteria 569
161 Ga0157380_10096123 3300014326 Bacteria 2456
162 Ga0157380_10820730 3300014326 Bacteria 949
163 Ga0182008_10023771 3300014497 Bacteria 3124
164 Ga0206351_10033962 3300020077 Bacteria 796
165 Ga0154015_1649578 3300020610 Bacteria 1112
166 Ga0213874_10036823 3300021377 Bacteria 1444
167 Ga0213874_10159619 3300021377 Bacteria 791
168 Ga0213876_10078572 3300021384 Bacteria 1744
169 Ga0213875_10439677 3300021388 Bacteria 624
170 Ga0213871_10000277 3300021441 Bacteria 6351
171 Ga0213871_10139828 3300021441 Bacteria 732
172 Ga0209148_1000555 3300025254 Bacteria 35360
173 Ga0209455_1000388 3300025272 Bacteria 38902
174 Ga0207426_1009867 3300025302 Bacteria 3743
175 Ga0207426_1057270 3300025302 Bacteria 1135
176 Ga0207692_10001791 3300025898 Bacteria 8146
177 Ga0207699_10007144 3300025906 Bacteria 5447
178 Ga0207699_10089995 3300025906 Bacteria 1925
179 Ga0207645_10321643 3300025907 Bacteria 1032
180 Ga0207645_10499549 3300025907 Bacteria 823
181 Ga0207643_10234369 3300025908 Bacteria 1127
182 Ga0207705_10007558 3300025909 Bacteria 7987
183 Ga0207705_10100876 3300025909 Bacteria 2123
184 Ga0207684_10012850 3300025910 Bacteria 7253
185 Ga0207684_10077490 3300025910 Bacteria 2827
186 Ga0207654_10317740 3300025911 Bacteria 1064
187 Ga0207707_10002278 3300025912 Bacteria 17330
188 Ga0207707_10243085 3300025912 Bacteria 1564
189 Ga0207707_10253705 3300025912 Bacteria 1528
190 Ga0207707_10517669 3300025912 Bacteria 1016
191 Ga0207707_10596922 3300025912 Bacteria 935
192 Ga0207695_10048282 3300025913 Bacteria 4497
193 Ga0207695_10096063 3300025913 Bacteria 2966
194 Ga0207695_10315019 3300025913 Bacteria 1454
195 Ga0207693_10002561 3300025915 Bacteria 15808
196 Ga0207693_10014015 3300025915 Bacteria 6454
197 Ga0207693_10072969 3300025915 Bacteria 2687
198 Ga0207693_10310805 3300025915 Bacteria 1234
199 Ga0207663_10007287 3300025916 Bacteria 5725
200 Ga0207663_10294972 3300025916 Bacteria 1209
201 Ga0207660_10002361 3300025917 Bacteria 12424
202 Ga0207660_10165817 3300025917 Bacteria 1707
203 Ga0207660_10767687 3300025917 Bacteria 787
204 Ga0207660_10898485 3300025917 Bacteria 723
205 Ga0207657_10143313 3300025919 Bacteria 1951
206 Ga0207657_10428593 3300025919 Bacteria 1039
207 Ga0207649_10047325 3300025920 Bacteria 2646
208 Ga0207649_10410313 3300025920 Bacteria 1015
209 Ga0207652_10020703 3300025921 Bacteria 5421
210 Ga0207652_10788368 3300025921 Bacteria 844
211 Ga0207646_10231963 3300025922 Bacteria 1668
212 Ga0207646_10489531 3300025922 Bacteria 1109
213 Ga0207681_10172913 3300025923 Bacteria 1639
214 Ga0207694_10393078 3300025924 Bacteria 1152
215 Ga0207659_10097325 3300025926 Bacteria 2211
216 Ga0207700_10032759 3300025928 Bacteria 3710
217 Ga0207700_10091840 3300025928 Bacteria 2399
218 Ga0207700_10781899 3300025928 Bacteria 853
219 Ga0207664_10359123 3300025929 Bacteria 1290
220 Ga0207644_10033331 3300025931 Bacteria 3598
221 Ga0207644_10483512 3300025931 Bacteria 1020
222 Ga0207690_10540694 3300025932 Bacteria 946
223 Ga0207706_10439312 3300025933 Bacteria 1130
224 Ga0207686_10687232 3300025934 Bacteria 812
225 Ga0207670_10045273 3300025936 Bacteria 2916
226 Ga0207670_10907199 3300025936 Bacteria 738
227 Ga0207665_10228484 3300025939 Bacteria 1367
228 Ga0207665_10829577 3300025939 Bacteria 731
229 Ga0207691_10243014 3300025940 Bacteria 1556
230 Ga0207689_10447297 3300025942 Bacteria 1080
231 Ga0207661_10221784 3300025944 Bacteria 1671
232 Ga0207679_10553194 3300025945 Bacteria 1033
233 Ga0207667_10009156 3300025949 Bacteria 11695
234 Ga0207667_10242822 3300025949 Bacteria 1843
235 Ga0207651_11829322 3300025960 Bacteria 546
236 Ga0207640_10860126 3300025981 Bacteria 789
237 Ga0207658_10958839 3300025986 Bacteria 780
238 Ga0207677_10074292 3300026023 Bacteria 2411
239 Ga0207703_10593270 3300026035 Bacteria 1047
240 Ga0207703_11310965 3300026035 Bacteria 696
241 Ga0207639_10923614 3300026041 Bacteria 816
242 Ga0207678_10288138 3300026067 Bacteria 1410
243 Ga0207678_11184232 3300026067 Bacteria 677
244 Ga0207702_10177059 3300026078 Bacteria 1961
245 Ga0207702_10207134 3300026078 Bacteria 1821
246 Ga0207641_11031016 3300026088 Bacteria 820
247 Ga0207648_10775412 3300026089 Bacteria 891
248 Ga0207648_10934948 3300026089 Bacteria 811
249 Ga0207676_10398337 3300026095 Bacteria 1286
250 Ga0207676_10534622 3300026095 Bacteria 1118
251 Ga0207674_10066770 3300026116 Bacteria 3622
252 Ga0207674_10599126 3300026116 Bacteria 1064
253 Ga0207675_100293286 3300026118 Bacteria 1582
254 Ga0207683_10010785 3300026121 Bacteria 7793
255 Ga0207698_10008586 3300026142 Bacteria 6472
256 Ga0207698_11102052 3300026142 Bacteria 807
257 Ga0209179_1019179 3300027512 Bacteria 1314
258 Ga0209983_1024706 3300027665 Bacteria 1266
259 Ga0209588_1198704 3300027671 Bacteria 625
260 Ga0209813_10049854 3300027866 Bacteria 1304
261 Ga0209813_10088226 3300027866 Bacteria 1037
262 Ga0268266_10007884 3300028379 Bacteria 9536
263 Ga0268266_10595783 3300028379 Bacteria 1061
264 Ga0268266_11439133 3300028379 Bacteria 665
265 Ga0268266_11988485 3300028379 Bacteria 555
266 Ga0268265_10119449 3300028380 Bacteria 2169
267 Ga0268265_11345632 3300028380 Bacteria 715
268 Ga0265324_10008459 3300029957 Bacteria 4088
269 Ga0265332_10045257 3300031238 Bacteria 1897
270 Ga0265328_10042232 3300031239 Bacteria 1678
271 Ga0265325_10172740 3300031241 Bacteria 1010
272 Ga0265325_10281732 3300031241 Bacteria 745
273 Ga0265329_10144191 3300031242 Bacteria 770
274 Ga0265340_10232450 3300031247 Bacteria 824
275 Ga0265339_10151791 3300031249 Bacteria 1171
276 Ga0265331_10000019 3300031250 Bacteria 258837
277 Ga0265331_10007377 3300031250 Bacteria 6368
278 Ga0265327_10002988 3300031251 Bacteria 16792
279 Ga0307408_100189212 3300031548 Bacteria 1657
280 Ga0307408_100280752 3300031548 Bacteria 1387
281 Ga0265313_10006780 3300031595 Bacteria 8010
282 Ga0265313_10136435 3300031595 Bacteria 1058
283 Ga0265314_10155998 3300031711 Bacteria 1394
284 Ga0265314_10258954 3300031711 Bacteria 994
285 Ga0307412_10001178 3300031911 Bacteria 14921
286 Ga0307412_10991435 3300031911 Bacteria 742
287 Ga0307409_100216499 3300031995 Bacteria 1726
288 Ga0307416_101058310 3300032002 Bacteria 915
289 Ga0307416_101486827 3300032002 Bacteria 783
290 Ga0307414_10000914 3300032004 Bacteria 15107
291 Ga0307414_10457845 3300032004 Bacteria 1120
292 Ga0307414_10494297 3300032004 Bacteria 1081
293 Ga0307415_100456767 3300032126 Bacteria 1106
294 Ga0373928_0047463 3300035084 Bacteria 1005
295 Ga0373940_0255390 3300035088 Bacteria 592
296 Ga0373941_0027789 3300035115 Bacteria 1655
297 Ga0373941_0038915 3300035115 Bacteria 1459
298 Ga0373953_0175725 3300035117 Bacteria 923
299 Ga0373954_0088835 3300035118 Bacteria 1482
300 Ga0373954_0178837 3300035118 Bacteria 1040
301 Ga0373956_0056279 3300035119 Bacteria 1775
302 Ga0373956_0474429 3300035119 Bacteria 597
303 Ga0373960_0182595 3300035121 Bacteria 733
304 Ga0373946_0119282 3300035171 Bacteria 1203
305 Ga0373955_0008701 3300035172 Bacteria 4724
306 Ga0373955_0420599 3300035172 Bacteria 813
307 Ga0373955_0554292 3300035172 Bacteria 703
308 Ga0373961_0039722 3300035241 Bacteria 1353
309 Ga0373924_0451474 3300035410 Bacteria 576
310 Ga0373931_0073039 3300035691 Bacteria 1877
311 Ga0373931_0184815 3300035691 Bacteria 1237
312 Ga0373931_0233969 3300035691 Bacteria 1111
313 Ga0373927_0396142 3300035695 Bacteria 911
314 Ga0373933_0003617 3300035724 Bacteria 8568
315 Ga0373933_0125904 3300035724 Bacteria 1607
316 Ga0373937_0023906 3300036401 Bacteria 5510
317 Ga0373937_0067868 3300036401 Bacteria 3287
318 Ga0373937_0115130 3300036401 Bacteria 2503
319 Ga0373937_1264034 3300036401 Bacteria 686
320 Ga0373925_0716795 3300037068 Bacteria 825
321 Ga0395899_0006999 3300037312 Bacteria 8731
322 Ga0395899_0646211 3300037312 Bacteria 669
323 Ga0395900_0005314 3300037418 Bacteria 13497
324 Ga0395900_0016664 3300037418 Bacteria 7495
325 Ga0395900_0030731 3300037418 Bacteria 5515
326 Ga0395900_0453633 3300037418 Bacteria 1238
327 Ga0395898_0011542 3300037466 Bacteria 9177
328 Ga0395898_0032562 3300037466 Bacteria 5204
329 Ga0395898_0179065 3300037466 Bacteria 2026
330 Ga0395905_0294086 3300037471 Bacteria 1511
331 Ga0395905_0698266 3300037471 Bacteria 917
332 Ga0436364_0063332 3300037853 Bacteria 903
333 Ga0436364_0342353 3300037853 Bacteria 735
334 Ga0395901_0004771 3300038443 Bacteria 13679
335 Ga0395901_0007522 3300038443 Bacteria 10999
336 Ga0395901_0027014 3300038443 Bacteria 5894
337 Ga0395901_0051738 3300038443 Bacteria 4270
338 Ga0395901_0159905 3300038443 Bacteria 2366
339 Ga0395901_0373678 3300038443 Bacteria 1468
340 Ga0237819_00798 3300038705 Bacteria 10028
341 Ga0436365_0175844 3300039437 Bacteria 1443
342 Ga0436365_0362955 3300039437 Bacteria 1242
343 Ga0436365_0401421 3300039437 Bacteria 1007
344 Ga0436365_1091809 3300039437 Bacteria 2680
345 Ga0436365_1134916 3300039437 Bacteria 2091
346 Ga0436365_1516850 3300039437 Bacteria 12326
347 Ga0436360_0010558 3300039438 Bacteria 981
348 Ga0436360_0219750 3300039438 Bacteria 876
349 Ga0436360_0324599 3300039438 Bacteria 13432
350 Ga0436361_0070267 3300039447 Bacteria 20381
351 Ga0436361_0159128 3300039447 Bacteria 3542
352 Ga0436361_0524336 3300039447 Bacteria 690
353 Ga0436361_0666217 3300039447 Bacteria 5230
354 Ga0436361_0819040 3300039447 Bacteria 7493
355 Ga0436363_1054365 3300039450 Bacteria 722
356 Ga0436363_1193380 3300039450 Bacteria 1445
357 Ga0436363_1396010 3300039450 Bacteria 857
358 Ga0436362_0491208 3300039453 Bacteria 750
359 Ga0436362_0616550 3300039453 Bacteria 812
360 Ga0439447_042356 3300041407 Bacteria 1106
361 Ga0439461_0085761 3300041410 Bacteria 749
362 Ga0451807_0075221 3300041486 Bacteria 618
363 Ga0451851_0121853 3300041507 Bacteria 506
364 Ga0439441_015761 3300042001 Bacteria 1341
365 Ga0439445_0051882 3300042004 Bacteria 1109
366 Ga0450920_020608 3300042122 Bacteria 1271
367 Ga0439435_0312801 3300042436 Bacteria 540
368 Ga0453683_0327030 3300044673 Bacteria 983
369 Ga0466963_0550707 3300044694 Bacteria 815
370 Ga0466963_0663464 3300044694 Bacteria 736
371 Ga0466963_0943941 3300044694 Bacteria 608
372 Ga0466964_0161805 3300044706 Bacteria 1047
373 Ga0453684_0023051 3300044712 Bacteria 9198
374 Ga0466968_0065238 3300044735 Bacteria 1576
375 Ga0466957_0494860 3300044842 Bacteria 847
376 Ga0466959_0410006 3300045049 Bacteria 920
377 Ga0451576_0000056 3300045051 Bacteria 303398
378 Ga0451576_0000301 3300045051 Bacteria 119546
379 Ga0451576_0086996 3300045051 Bacteria 3250
380 Ga0451576_0118219 3300045051 Bacteria 2760
381 Ga0451576_0432319 3300045051 Bacteria 1381
382 Ga0466958_0154586 3300045836 Bacteria 1448
383 Ga0466967_0070802 3300045976 Bacteria 3120
384 Ga0466967_0165687 3300045976 Bacteria 2077
385 Ga0466967_0537511 3300045976 Bacteria 1149
386 Ga0466967_1263280 3300045976 Bacteria 735
387 Ga0495592_0319326 3300046454 Bacteria 1004
388 Ga0495628_0864360 3300046516 Bacteria 630
389 Ga0495630_0453138 3300046517 Bacteria 983
390 Ga0495640_0116665 3300046533 Bacteria 1739
391 Ga0495667_0018210 3300046559 Bacteria 4745
392 Ga0495658_0241791 3300046683 Bacteria 1134
393 Ga0496113_0565367 3300048916 Bacteria 912
394 Ga0496115_0717996 3300048918 Bacteria 784
395 Ga0496126_0054251 3300048929 Bacteria 3632
396 Ga0501314_002510 3300049530 Bacteria 1423
397 Ga0501034_0000538 3300049571 Bacteria 60200
398 Ga0501034_0002463 3300049571 Bacteria 22318
399 Ga0501034_0007655 3300049571 Bacteria 11492
400 Ga0501034_0012457 3300049571 Bacteria 8782
401 Ga0501034_0902920 3300049571 Bacteria 771
402 Ga0501036_0620627 3300049572 Bacteria 896
403 Ga0501037_0515551 3300049573 Bacteria 810
404 Ga0501039_0514319 3300049575 Bacteria 940
405 Ga0501041_0077731 3300049577 Bacteria 2042
406 Ga0501043_0092759 3300049579 Bacteria 2374
407 Ga0501043_0093411 3300049579 Bacteria 2365
408 Ga0501047_0326455 3300049581 Bacteria 1373
409 Ga0501047_0531581 3300049581 Bacteria 1001
410 Ga0501047_0951878 3300049581 Bacteria 672
411 Ga0501067_0438241 3300049583 Bacteria 729
412 Ga0501067_0446799 3300049583 Bacteria 722
413 Ga0501068_0051690 3300049584 Bacteria 2486
414 Ga0501068_0868791 3300049584 Bacteria 593
415 Ga0501069_0636026 3300049585 Bacteria 642
416 Ga0501070_0065514 3300049586 Bacteria 3008
417 Ga0501070_0168233 3300049586 Bacteria 1806
418 Ga0501070_0755721 3300049586 Bacteria 766
419 Ga0501070_0852502 3300049586 Bacteria 713
420 Ga0501070_1252403 3300049586 Bacteria 568
421 Ga0501071_0227287 3300049587 Bacteria 1405
422 Ga0501072_0213776 3300049588 Bacteria 1537
423 Ga0501073_0302719 3300049589 Bacteria 1103
424 Ga0501075_0050420 3300049591 Bacteria 3129
425 Ga0501075_0899913 3300049591 Bacteria 673
426 Ga0501076_0035552 3300049592 Bacteria 3897
427 Ga0501077_0036328 3300049593 Bacteria 3138
428 Ga0501223_000557 3300049663 Bacteria 9011
429 Ga0501224_000015 3300049664 Bacteria 90971
430 Ga0501233_001277 3300049668 Bacteria 4302
431 Ga0501225_0000038 3300049705 Bacteria 45168
432 Ga0501225_0120936 3300049705 Bacteria 778
433 Ga0501234_005743 3300049707 Bacteria 1939
434 Ga0501079_0418113 3300049741 Bacteria 1052
435 Ga0501080_0256463 3300049742 Bacteria 1594
436 Ga0501080_0331170 3300049742 Bacteria 1377
437 Ga0501080_0405330 3300049742 Bacteria 1226
438 Ga0501080_0512463 3300049742 Bacteria 1071
439 Ga0501081_0023109 3300049743 Bacteria 4166
440 Ga0501083_0018378 3300049744 Bacteria 4872
441 Ga0501083_0673533 3300049744 Bacteria 673
442 Ga0501044_0328202 3300049823 Bacteria 1453
443 Ga0501044_0469416 3300049823 Bacteria 1163
444 Ga0501044_1132266 3300049823 Bacteria 651
445 Ga0501226_000027 3300049853 Bacteria 89557
446 nmdc:mga03683_107979_c1 3300050489 Bacteria 1228
447 nmdc:mga03683_2494_c1 3300050489 Bacteria 1784
448 nmdc:mga03683_3201_c1 3300050489 Bacteria 5232
449 nmdc:mga03683_389801_c1 3300050489 Bacteria 664
450 nmdc:mga03683_95171_c1 3300050489 Bacteria 1303
451 nmdc:mga03n38_201174_c1 3300050490 Bacteria 1031
452 nmdc:mga03n38_639607_c1 3300050490 Bacteria 609
453 nmdc:mga00v17_199448_c1 3300050491 Bacteria 1293
454 nmdc:mga00v17_275796_c1 3300050491 Bacteria 1091
455 nmdc:mga0yw44_207603_c1 3300050492 Bacteria 1295
456 nmdc:mga0yw44_210989_c1 3300050492 Bacteria 1285
457 nmdc:mga0yw44_214145_c1 3300050492 Bacteria 1275
458 nmdc:mga0yw44_581338_c1 3300050492 Bacteria 761
459 nmdc:mga0k408_122775_c1 3300050493 Bacteria 1539
460 nmdc:mga0k408_55149_c1 3300050493 Bacteria 2304
461 nmdc:mga0k408_883990_c1 3300050493 Bacteria 519
462 nmdc:mga06z11_130519_c1 3300050494 Bacteria 1411
463 nmdc:mga06z11_35726_c1 3300050494 Bacteria 2448
464 nmdc:mga04h51_295034_c1 3300050495 Bacteria 659
465 nmdc:mga04h51_94226_c1 3300050495 Bacteria 1082
466 nmdc:mga07m45_282309_c1 3300050496 Bacteria 966
467 nmdc:mga0qj67_243483_c1 3300050509 Bacteria 1459
468 nmdc:mga08y16_474536_c1 3300050511 Bacteria 1273
469 nmdc:mga0sz30_10201_c1 3300050516 Bacteria 1649
470 nmdc:mga0sz30_12544_c1 3300050516 Bacteria 3300
471 nmdc:mga0sz30_749_c1 3300050516 Bacteria 11848
472 Ga0495619_0082874 3300053085 Bacteria 2162
473 Ga0500644_0030459 3300053088 Bacteria 1708
474 Ga0500647_0099659 3300053091 Bacteria 1387
475 Ga0500651_0043591 3300053093 Bacteria 2825
476 Ga0500651_0589384 3300053093 Bacteria 604
477 Ga0500641_0000107 3300053096 Bacteria 31822
478 Ga0500650_0260891 3300053098 Bacteria 775
479 Ga0500555_070952 3300053103 Bacteria 920
480 Ga0500562_017317 3300053108 Bacteria 1857
481 Ga0500658_0436311 3300053134 Bacteria 597
482 Ga0500616_0002487 3300053153 Bacteria 15279
483 Ga0500627_0372891 3300053158 Bacteria 613
484 Ga0500645_009443 3300053730 Bacteria 3276
485 Ga0500552_000168 3300053733 Bacteria 5789
486 Ga0501084_0140812 3300054114 Bacteria 2031
487 Ga0501082_0033655 3300060353 Bacteria 4421
488 Ga0501082_0099489 3300060353 Bacteria 2514
489 Ga0501082_0665607 3300060353 Bacteria 911
490 Ga0373935_0333635
491 Ga0006778J45830_1084215
492 JGI25406J46586_10071057
493 rootL2_10101513
494 Ga0055542_1025901
495 Ga0065704_10144393
496 Ga0065712_10386802
497 Ga0070658_10001221
498 Ga0070676_10447431
499 Ga0070690_100396494
500 Ga0070670_101158030
501 Ga0070666_10236199
502 Ga0070680_100004632
503 Ga0070680_100080294
504 Ga0070680_100192891
505 Ga0070682_100318203
506 Ga0068868_100371386
507 Ga0070660_100482672
508 Ga0070689_100167714
509 Ga0070689_100206302
510 Ga0070689_100427788
511 Ga0070691_10109784
512 Ga0070692_10273916
513 Ga0070692_10582321
514 Ga0070668_100754602
515 Ga0070669_100794562
516 Ga0070675_100085273
517 Ga0070671_100673023
518 Ga0070674_100920976
519 Ga0070659_100083948
520 Ga0070667_101031335
521 Ga0070709_10206215
522 Ga0070714_100007835
523 Ga0070713_100003311
524 Ga0070713_100051718
525 Ga0070713_100530321
526 Ga0070713_100758625
527 Ga0070713_101441407
528 Ga0070710_10005364
529 Ga0070711_100021230
530 Ga0070711_100066941
531 Ga0070705_100899366
532 Ga0070700_100165246
533 Ga0070708_100131108
534 Ga0070663_101688182
535 Ga0070678_100004110
536 Ga0070681_10003960
537 Ga0070681_10960558
538 Ga0070707_100539730
539 Ga0070698_100004129
540 Ga0070698_100115481
541 Ga0070698_100582134
542 Ga0070699_100019887
543 Ga0070699_100197323
544 Ga0070679_100005381
545 Ga0070684_100094096
546 Ga0070697_100785790
547 Ga0070697_101286922
548 Ga0068853_100424540
549 Ga0068853_100949197
550 Ga0068853_101248652
551 Ga0070672_100476129
552 Ga0070665_100009198
553 Ga0070665_100118556
554 Ga0070665_100202688
555 Ga0070665_100416202
556 Ga0070665_100758082
557 Ga0068855_100057440
558 Ga0068855_100286460
559 Ga0070664_100201653
560 Ga0068857_100556790
561 Ga0068857_100657913
562 Ga0068854_100199071
563 Ga0068856_100052708
564 Ga0068856_100132034
565 Ga0068856_100272390
566 Ga0068852_100004657
567 Ga0068852_100287680
568 Ga0068859_100564152
569 Ga0068859_100620610
570 Ga0068864_101046261
571 Ga0068863_100579374
572 Ga0068863_100787582
573 Ga0068858_101293207
574 Ga0068862_100272867
575 Ga0081455_10004071
576 Ga0081455_10005773
577 Ga0081455_10122893
578 Ga0081455_10140228
579 Ga0081538_10054155
580 Ga0081539_10007444
581 Ga0081539_10008665
582 Ga0070717_10088692
583 Ga0075365_10006828
584 Ga0075365_10243041
585 Ga0075365_10344877
586 Ga0075365_10465007
587 Ga0075365_10591011
588 Ga0075368_10047364
589 Ga0075368_10079006
590 Ga0075368_10189728
591 Ga0075363_100050666
592 Ga0075364_10319596
593 Ga0075364_10673044
594 Ga0070712_100006409
595 Ga0070712_100083928
596 Ga0070712_100767427
597 Ga0070712_101252490
598 Ga0075362_10008737
599 Ga0075362_10079164
600 Ga0075362_10097772
601 Ga0075362_10105140
602 Ga0075362_10553801
603 Ga0075367_10059884
604 Ga0075367_10251578
605 Ga0075369_10000614
606 Ga0075369_10032381
607 Ga0075369_10035378
608 Ga0075366_10027592
609 Ga0075366_10405168
610 Ga0075370_10015236
611 Ga0075430_100794982
612 Ga0068865_100294857
613 Ga0097620_100564156
614 Ga0097620_100620668
615 Ga0099794_10068848
616 Ga0099795_10059113
617 Ga0105240_10019952
618 Ga0105240_10595309
619 Ga0105240_10741909
620 Ga0111539_12466784
621 Ga0105245_10543012
622 Ga0114129_10707108
623 Ga0114129_12155050
624 Ga0105243_12359816
625 Ga0105248_10226794
626 Ga0105248_10366147
627 Ga0105237_11266203
628 Ga0105237_11629330
629 Ga0105249_10994199
630 Ga0105035_106107
631 Ga0105239_10684270
632 Ga0105239_12688603
633 Ga0105246_10671785
634 Ga0105246_10812595
635 Ga0157373_10363660
636 Ga0157371_10163519
637 Ga0157370_10031502
638 Ga0157370_10085525
639 Ga0157369_10004115
640 Ga0157369_10231351
641 Ga0157369_10343057
642 Ga0157374_10115819
643 Ga0157374_10931812
644 Ga0157378_10529870
645 Ga0163162_10628645
646 Ga0157372_10693970
647 Ga0157375_10157134
648 Ga0157375_11208721
649 Ga0157375_12938988
650 Ga0157380_10096123
651 Ga0157380_10820730
652 Ga0182008_10023771
653 Ga0206351_10033962
654 Ga0154015_1649578
655 Ga0213874_10036823
656 Ga0213874_10159619
657 Ga0213876_10078572
658 Ga0213875_10439677
659 Ga0213871_10000277
660 Ga0213871_10139828
661 Ga0209148_1000555
662 Ga0209455_1000388
663 Ga0207426_1009867
664 Ga0207426_1057270
665 Ga0207692_10001791
666 Ga0207699_10007144
667 Ga0207699_10089995
668 Ga0207645_10321643
669 Ga0207645_10499549
670 Ga0207643_10234369
671 Ga0207705_10007558
672 Ga0207705_10100876
673 Ga0207684_10012850
674 Ga0207684_10077490
675 Ga0207654_10317740
676 Ga0207707_10002278
677 Ga0207707_10243085
678 Ga0207707_10253705
679 Ga0207707_10517669
680 Ga0207707_10596922
681 Ga0207695_10048282
682 Ga0207695_10096063
683 Ga0207695_10315019
684 Ga0207693_10002561
685 Ga0207693_10014015
686 Ga0207693_10072969
687 Ga0207693_10310805
688 Ga0207663_10007287
689 Ga0207663_10294972
690 Ga0207660_10002361
691 Ga0207660_10165817
692 Ga0207660_10767687
693 Ga0207660_10898485
694 Ga0207657_10143313
695 Ga0207657_10428593
696 Ga0207649_10047325
697 Ga0207649_10410313
698 Ga0207652_10020703
699 Ga0207652_10788368
700 Ga0207646_10231963
701 Ga0207646_10489531
702 Ga0207681_10172913
703 Ga0207694_10393078
704 Ga0207659_10097325
705 Ga0207700_10032759
706 Ga0207700_10091840
707 Ga0207700_10781899
708 Ga0207664_10359123
709 Ga0207644_10033331
710 Ga0207644_10483512
711 Ga0207690_10540694
712 Ga0207706_10439312
713 Ga0207686_10687232
714 Ga0207670_10045273
715 Ga0207670_10907199
716 Ga0207665_10228484
717 Ga0207665_10829577
718 Ga0207691_10243014
719 Ga0207689_10447297
720 Ga0207661_10221784
721 Ga0207679_10553194
722 Ga0207667_10009156
723 Ga0207667_10242822
724 Ga0207651_11829322
725 Ga0207640_10860126
726 Ga0207658_10958839
727 Ga0207677_10074292
728 Ga0207703_10593270
729 Ga0207703_11310965
730 Ga0207639_10923614
731 Ga0207678_10288138
732 Ga0207678_11184232
733 Ga0207702_10177059
734 Ga0207702_10207134
735 Ga0207641_11031016
736 Ga0207648_10775412
737 Ga0207648_10934948
738 Ga0207676_10398337
739 Ga0207676_10534622
740 Ga0207674_10066770
741 Ga0207674_10599126
742 Ga0207675_100293286
743 Ga0207683_10010785
744 Ga0207698_10008586
745 Ga0207698_11102052
746 Ga0209179_1019179
747 Ga0209983_1024706
748 Ga0209588_1198704
749 Ga0209813_10049854
750 Ga0209813_10088226
751 Ga0268266_10007884
752 Ga0268266_10595783
753 Ga0268266_11439133
754 Ga0268266_11988485
755 Ga0268265_10119449
756 Ga0268265_11345632
757 Ga0265324_10008459
758 Ga0265332_10045257
759 Ga0265328_10042232
760 Ga0265325_10172740
761 Ga0265325_10281732
762 Ga0265329_10144191
763 Ga0265340_10232450
764 Ga0265339_10151791
765 Ga0265331_10000019
766 Ga0265331_10007377
767 Ga0265327_10002988
768 Ga0307408_100189212
769 Ga0307408_100280752
770 Ga0265313_10006780
771 Ga0265313_10136435
772 Ga0265314_10155998
773 Ga0265314_10258954
774 Ga0307412_10001178
775 Ga0307412_10991435
776 Ga0307409_100216499
777 Ga0307416_101058310
778 Ga0307416_101486827
779 Ga0307414_10000914
780 Ga0307414_10457845
781 Ga0307414_10494297
782 Ga0307415_100456767
783 Ga0373928_0047463
784 Ga0373940_0255390
785 Ga0373941_0027789
786 Ga0373941_0038915
787 Ga0373953_0175725
788 Ga0373954_0088835
789 Ga0373954_0178837
790 Ga0373956_0056279
791 Ga0373956_0474429
792 Ga0373960_0182595
793 Ga0373946_0119282
794 Ga0373955_0008701
795 Ga0373955_0420599
796 Ga0373955_0554292
797 Ga0373961_0039722
798 Ga0373924_0451474
799 Ga0373931_0073039
800 Ga0373931_0184815
801 Ga0373931_0233969
802 Ga0373927_0396142
803 Ga0373933_0003617
804 Ga0373933_0125904
805 Ga0373937_0023906
806 Ga0373937_0067868
807 Ga0373937_0115130
808 Ga0373937_1264034
809 Ga0373925_0716795
810 Ga0395899_0006999
811 Ga0395899_0646211
812 Ga0395900_0005314
813 Ga0395900_0016664
814 Ga0395900_0030731
815 Ga0395900_0453633
816 Ga0395898_0011542
817 Ga0395898_0032562
818 Ga0395898_0179065
819 Ga0395905_0294086
820 Ga0395905_0698266
821 Ga0436364_0063332
822 Ga0436364_0342353
823 Ga0395901_0004771
824 Ga0395901_0007522
825 Ga0395901_0027014
826 Ga0395901_0051738
827 Ga0395901_0159905
828 Ga0395901_0373678
829 Ga0237819_00798
830 Ga0436365_0175844
831 Ga0436365_0362955
832 Ga0436365_0401421
833 Ga0436365_1091809
834 Ga0436365_1134916
835 Ga0436365_1516850
836 Ga0436360_0010558
837 Ga0436360_0219750
838 Ga0436360_0324599
839 Ga0436361_0070267
840 Ga0436361_0159128
841 Ga0436361_0524336
842 Ga0436361_0666217
843 Ga0436361_0819040
844 Ga0436363_1054365
845 Ga0436363_1193380
846 Ga0436363_1396010
847 Ga0436362_0491208
848 Ga0436362_0616550
849 Ga0439447_042356
850 Ga0439461_0085761
851 Ga0451807_0075221
852 Ga0451851_0121853
853 Ga0439441_015761
854 Ga0439445_0051882
855 Ga0450920_020608
856 Ga0439435_0312801
857 Ga0453683_0327030
858 Ga0466963_0550707
859 Ga0466963_0663464
860 Ga0466963_0943941
861 Ga0466964_0161805
862 Ga0453684_0023051
863 Ga0466968_0065238
864 Ga0466957_0494860
865 Ga0466959_0410006
866 Ga0451576_0000056
867 Ga0451576_0000301
868 Ga0451576_0086996
869 Ga0451576_0118219
870 Ga0451576_0432319
871 Ga0466958_0154586
872 Ga0466967_0070802
873 Ga0466967_0165687
874 Ga0466967_0537511
875 Ga0466967_1263280
876 Ga0495592_0319326
877 Ga0495628_0864360
878 Ga0495630_0453138
879 Ga0495640_0116665
880 Ga0495667_0018210
881 Ga0495658_0241791
882 Ga0496113_0565367
883 Ga0496115_0717996
884 Ga0496126_0054251
885 Ga0501314_002510
886 Ga0501034_0000538
887 Ga0501034_0002463
888 Ga0501034_0007655
889 Ga0501034_0012457
890 Ga0501034_0902920
891 Ga0501036_0620627
892 Ga0501037_0515551
893 Ga0501039_0514319
894 Ga0501041_0077731
895 Ga0501043_0092759
896 Ga0501043_0093411
897 Ga0501047_0326455
898 Ga0501047_0531581
899 Ga0501047_0951878
900 Ga0501067_0438241
901 Ga0501067_0446799
902 Ga0501068_0051690
903 Ga0501068_0868791
904 Ga0501069_0636026
905 Ga0501070_0065514
906 Ga0501070_0168233
907 Ga0501070_0755721
908 Ga0501070_0852502
909 Ga0501070_1252403
910 Ga0501071_0227287
911 Ga0501072_0213776
912 Ga0501073_0302719
913 Ga0501075_0050420
914 Ga0501075_0899913
915 Ga0501076_0035552
916 Ga0501077_0036328
917 Ga0501223_000557
918 Ga0501224_000015
919 Ga0501233_001277
920 Ga0501225_0000038
921 Ga0501225_0120936
922 Ga0501234_005743
923 Ga0501079_0418113
924 Ga0501080_0256463
925 Ga0501080_0331170
926 Ga0501080_0405330
927 Ga0501080_0512463
928 Ga0501081_0023109
929 Ga0501083_0018378
930 Ga0501083_0673533
931 Ga0501044_0328202
932 Ga0501044_0469416
933 Ga0501044_1132266
934 Ga0501226_000027
935 nmdc:mga03683_107979_c1
936 nmdc:mga03683_2494_c1
937 nmdc:mga03683_3201_c1
938 nmdc:mga03683_389801_c1
939 nmdc:mga03683_95171_c1
940 nmdc:mga03n38_201174_c1
941 nmdc:mga03n38_639607_c1
942 nmdc:mga00v17_199448_c1
943 nmdc:mga00v17_275796_c1
944 nmdc:mga0yw44_207603_c1
945 nmdc:mga0yw44_210989_c1
946 nmdc:mga0yw44_214145_c1
947 nmdc:mga0yw44_581338_c1
948 nmdc:mga0k408_122775_c1
949 nmdc:mga0k408_55149_c1
950 nmdc:mga0k408_883990_c1
951 nmdc:mga06z11_130519_c1
952 nmdc:mga06z11_35726_c1
953 nmdc:mga04h51_295034_c1
954 nmdc:mga04h51_94226_c1
955 nmdc:mga07m45_282309_c1
956 nmdc:mga0qj67_243483_c1
957 nmdc:mga08y16_474536_c1
958 nmdc:mga0sz30_10201_c1
959 nmdc:mga0sz30_12544_c1
960 nmdc:mga0sz30_749_c1
961 Ga0495619_0082874
962 Ga0500644_0030459
963 Ga0500647_0099659
964 Ga0500651_0043591
965 Ga0500651_0589384
966 Ga0500641_0000107
967 Ga0500650_0260891
968 Ga0500555_070952
969 Ga0500562_017317
970 Ga0500658_0436311
971 Ga0500616_0002487
972 Ga0500627_0372891
973 Ga0500645_009443
974 Ga0500552_000168
975 Ga0501084_0140812
976 Ga0501082_0033655
977 Ga0501082_0099489
978 Ga0501082_0665607

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13404

HTH_AsnC-type

AsnC-type helix-turn-helix domain

11

50

0.98

PF13412

HTH_24

Winged helix-turn-helix DNA-binding

11

50

0.98

PF01037

AsnC_trans_reg

Lrp/AsnC ligand binding domain

71

145

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2e1a-assembly1.cif.gz_B crystal structure of ffrp-dm1 0.9206 68 144
2p5v-assembly1.cif.gz_A crystal structure of transcriptional regulator nmb0573 from neisseria meningitidis 0.9193 3 154
2gqq-assembly1.cif.gz_A-2 crystal structure of e. coli leucine-responsive regulatory protein (lrp) 0.9139 6 157
4rgr-assembly1.cif.gz_A crystal structure of putative marr family transcriptional regulator hcar from acinetobacter sp. adp 0.9119 6 50
2gqq-assembly1.cif.gz_A-2 crystal structure of e. coli leucine-responsive regulatory protein (lrp) 0.9028 6 157
ID Description Score Start End Superfamily
2p6sE01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9586 7 58 1.10.10.10
2gqqC01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9547 7 58 1.10.10.10
2p6sB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.952 7 58 1.10.10.10
2p5vE01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9517 7 58 1.10.10.10
2p6sF01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.951 7 58 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2S6TGD3-F1-model_v4 Leucine-responsive regulatory protein 0.9547 3 158 GO:0005829
GO:0043200
GO:0043565
AF-A0A537NDB8-F1-model_v4 Lrp/AsnC family transcriptional regulator 0.9545 1 158 GO:0005829
GO:0043200
GO:0043565
AF-A0A6M5JCV4-F1-model_v4 Lrp/AsnC family transcriptional regulator 0.9533 3 157 GO:0005829
GO:0043200
GO:0043565
AF-A0A5E7YCB1-F1-model_v4 Leucine-responsive regulatory protein 0.9531 3 154 GO:0005829
GO:0043200
GO:0043565
AF-A0A1G5YIL1-F1-model_v4 DNA-binding transcriptional regulator, Lrp family 0.9524 4 154 GO:0005829
GO:0043200
GO:0043565

Map