F453353

General Info

Members Datasets Scaffolds Average Seq Length
486 299 470 99

Family's Representative Sequence

Representative Sequence 3300049586|Ga0501070_0027272|Ga0501070_0027272_509_820
Length 103
Sequence MIVAFSVSPLGADESVGAAVAEAVRVVRASGLPNETNAMFTNIEGEWDEVMDVVKRAVEAVTNSMAGPPRVSLVLKADIRPGHTGQLTAKVQRIGDVLDALGD

Samples

Sample ID Description Type Environment
1 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
2 2547132424 Nocardia nova SH22a Isolate Unclassified
3 2643221561 Nocardioides sp. Root151 Isolate Unclassified
4 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
5 2643221696 Nocardioides sp. Root140 Isolate Unclassified
6 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
7 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
8 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
9 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
10 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
11 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
12 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
13 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
14 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
15 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
16 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
17 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
18 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
19 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
63 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
66 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
69 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
77 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
93 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
154 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
155 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
156 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
157 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
158 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
159 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
160 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
161 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
162 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
163 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
164 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
165 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
166 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
167 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
168 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
169 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
170 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
171 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
172 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
174 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
177 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
178 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
179 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
180 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
181 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
182 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
183 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
184 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
185 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
186 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
187 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
188 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
189 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
190 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
191 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
192 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
193 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
194 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
195 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
196 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
197 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
198 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
199 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
200 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
201 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
202 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
203 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
204 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
205 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
206 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
207 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
208 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
209 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
210 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
211 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
212 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
213 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
214 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
215 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
216 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
217 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
218 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
219 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
220 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
221 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
222 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
223 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
224 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
225 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
226 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
227 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
228 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
229 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
230 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
231 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
232 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
233 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
234 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
235 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
236 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
237 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
238 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
239 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
240 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
241 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
242 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
243 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
244 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
245 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
246 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
247 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
248 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
249 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
250 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
251 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
252 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
253 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
254 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
255 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
256 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
257 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
258 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
259 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
260 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
262 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
268 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
269 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
270 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
271 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
272 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
273 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
274 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
275 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
276 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
277 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
278 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
279 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
280 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
281 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
282 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
283 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
284 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
285 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
286 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
287 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
288 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
289 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
290 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
291 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
292 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
293 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
294 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
295 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
296 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
297 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
298 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
299 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.68
Metatranscriptomes 1.03
Isolates 3.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.26
Nodule 0
Rhizoplane 7.41
Rhizosphere 75.72
Stem 0
Stem Tuber 0
Unclassified 7.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1022113 3300000546 Bacteria 678
2 JGI24740J21852_10022956 3300001979 Bacteria 2138
3 JGI24739J22299_10003327 3300001989 Bacteria 6131
4 Ga0055540_1001669 3300003792 Bacteria 12856
5 Ga0055540_1006159 3300003792 Bacteria 4824
6 Ga0070658_10001220 3300005327 Bacteria 22061
7 Ga0070658_10014474 3300005327 Bacteria 6330
8 Ga0070658_10719487 3300005327 Bacteria 867
9 Ga0070683_100760934 3300005329 Bacteria 928
10 Ga0070683_101325776 3300005329 Bacteria 692
11 Ga0070670_100185181 3300005331 Bacteria 1808
12 Ga0070680_100044480 3300005336 Bacteria 3608
13 Ga0070680_100189218 3300005336 Bacteria 1734
14 Ga0070680_100598506 3300005336 Bacteria 946
15 Ga0070680_100637227 3300005336 Bacteria 916
16 Ga0070680_100974534 3300005336 Bacteria 732
17 Ga0070660_100102751 3300005339 Bacteria 2266
18 Ga0070660_100789024 3300005339 Bacteria 798
19 Ga0070660_101587937 3300005339 Bacteria 557
20 Ga0070660_101597500 3300005339 Bacteria 555
21 Ga0070661_100529820 3300005344 Bacteria 946
22 Ga0070661_100795196 3300005344 Bacteria 776
23 Ga0070692_11197061 3300005345 Bacteria 541
24 Ga0070668_100137403 3300005347 Bacteria 1967
25 Ga0070668_100688026 3300005347 Bacteria 901
26 Ga0070669_100000385 3300005353 Bacteria 33896
27 Ga0070659_100477005 3300005366 Bacteria 1061
28 Ga0070667_100001420 3300005367 Bacteria 21453
29 Ga0070667_100105733 3300005367 Bacteria 2436
30 Ga0070709_10272498 3300005434 Bacteria 1227
31 Ga0070709_10317814 3300005434 Bacteria 1142
32 Ga0070714_100001167 3300005435 Bacteria 18932
33 Ga0070714_100008579 3300005435 Bacteria 7994
34 Ga0070714_100043352 3300005435 Bacteria 3805
35 Ga0070714_100538891 3300005435 Bacteria 1116
36 Ga0070714_101296271 3300005435 Bacteria 711
37 Ga0070713_100003036 3300005436 Bacteria 11032
38 Ga0070713_100557093 3300005436 Bacteria 1086
39 Ga0070710_10774974 3300005437 Bacteria 683
40 Ga0070710_11021002 3300005437 Bacteria 603
41 Ga0070711_100071831 3300005439 Bacteria 2440
42 Ga0070711_100121227 3300005439 Bacteria 1934
43 Ga0070711_100415105 3300005439 Bacteria 1095
44 Ga0070694_100461981 3300005444 Bacteria 1004
45 Ga0070708_101577434 3300005445 Bacteria 611
46 Ga0070663_102086920 3300005455 Bacteria 511
47 Ga0070678_100813902 3300005456 Bacteria 849
48 Ga0070681_11230669 3300005458 Bacteria 671
49 Ga0070681_11779556 3300005458 Bacteria 543
50 Ga0070679_100069305 3300005530 Bacteria 3518
51 Ga0070679_100293958 3300005530 Bacteria 1576
52 Ga0070679_100306981 3300005530 Bacteria 1537
53 Ga0070679_100916263 3300005530 Bacteria 820
54 Ga0070679_101343625 3300005530 Bacteria 661
55 Ga0070684_100366773 3300005535 Bacteria 1326
56 Ga0070684_100374224 3300005535 Bacteria 1311
57 Ga0068853_100866114 3300005539 Bacteria 867
58 Ga0070693_100598361 3300005547 Bacteria 796
59 Ga0070665_100023210 3300005548 Bacteria 6248
60 Ga0068855_100284807 3300005563 Bacteria 1834
61 Ga0068855_102535164 3300005563 Bacteria 510
62 Ga0068855_102612532 3300005563 Bacteria 501
63 Ga0068857_100107275 3300005577 Bacteria 2508
64 Ga0068857_100164088 3300005577 Bacteria 2017
65 Ga0068857_100940166 3300005577 Bacteria 830
66 Ga0068857_101052351 3300005577 Bacteria 784
67 Ga0068857_101543418 3300005577 Bacteria 648
68 Ga0068854_100992535 3300005578 Bacteria 743
69 Ga0070702_100320628 3300005615 Bacteria 1080
70 Ga0068852_102091731 3300005616 Bacteria 588
71 Ga0068859_100004438 3300005617 Bacteria 14317
72 Ga0068864_100339073 3300005618 Bacteria 1416
73 Ga0068864_101946077 3300005618 Bacteria 594
74 Ga0068861_100313479 3300005719 Bacteria 1364
75 Ga0068870_10582135 3300005840 Bacteria 758
76 Ga0068863_100000875 3300005841 Bacteria 30197
77 Ga0068858_100001397 3300005842 Bacteria 24846
78 Ga0068858_100102378 3300005842 Bacteria 2671
79 Ga0068860_100000155 3300005843 Bacteria 111737
80 Ga0068862_100000096 3300005844 Bacteria 104906
81 Ga0068862_100562684 3300005844 Bacteria 1090
82 Ga0081455_10374434 3300005937 Bacteria 997
83 Ga0070717_10247416 3300006028 Bacteria 1574
84 Ga0075365_10078992 3300006038 Bacteria 2226
85 Ga0075365_10263262 3300006038 Bacteria 1212
86 Ga0075365_10373525 3300006038 Bacteria 1006
87 Ga0075365_10721452 3300006038 Bacteria 704
88 Ga0075365_11212542 3300006038 Bacteria 531
89 Ga0075368_10106443 3300006042 Bacteria 1154
90 Ga0075363_100400475 3300006048 Bacteria 807
91 Ga0075363_100882697 3300006048 Bacteria 547
92 Ga0075364_10000623 3300006051 Bacteria 18228
93 Ga0075364_10045041 3300006051 Bacteria 2871
94 Ga0075364_10201234 3300006051 Bacteria 1350
95 Ga0075364_10722208 3300006051 Bacteria 680
96 Ga0075364_11062969 3300006051 Bacteria 550
97 Ga0075432_10051021 3300006058 Bacteria 1460
98 Ga0070715_10089240 3300006163 Bacteria 1415
99 Ga0070716_100038754 3300006173 Bacteria 2640
100 Ga0070716_100252176 3300006173 Bacteria 1203
101 Ga0075362_10026854 3300006177 Bacteria 2462
102 Ga0075369_10011839 3300006186 Bacteria 3436
103 Ga0075369_10017591 3300006186 Bacteria 2900
104 Ga0075369_10033429 3300006186 Bacteria 2179
105 Ga0075369_10048777 3300006186 Bacteria 1828
106 Ga0075369_10559289 3300006186 Bacteria 546
107 Ga0075428_100007534 3300006844 Bacteria 12066
108 Ga0075430_100333854 3300006846 Bacteria 1252
109 Ga0075431_100268074 3300006847 Bacteria 1731
110 Ga0075429_100037044 3300006880 Bacteria 4245
111 Ga0075429_101724296 3300006880 Bacteria 544
112 Ga0068865_100839032 3300006881 Bacteria 795
113 Ga0097620_100004438 3300006931 Bacteria 14317
114 Ga0099795_10145970 3300007788 Bacteria 965
115 Ga0105250_10273089 3300009092 Bacteria 726
116 Ga0105240_11347128 3300009093 Bacteria 751
117 Ga0111539_10252091 3300009094 Bacteria 2055
118 Ga0111539_11057609 3300009094 Bacteria 943
119 Ga0105245_10010824 3300009098 Bacteria 7935
120 Ga0105245_10143950 3300009098 Bacteria 2248
121 Ga0105245_11938504 3300009098 Bacteria 642
122 Ga0105247_10000040 3300009101 Bacteria 158975
123 Ga0105247_10198586 3300009101 Bacteria 1346
124 Ga0105247_10863720 3300009101 Bacteria 696
125 Ga0114129_10014442 3300009147 Bacteria 11253
126 Ga0105243_10125334 3300009148 Bacteria 2172
127 Ga0105243_10232686 3300009148 Bacteria 1636
128 Ga0105241_11759835 3300009174 Bacteria 604
129 Ga0105242_10463644 3300009176 Bacteria 1197
130 Ga0105242_12772285 3300009176 Bacteria 540
131 Ga0105248_10000095 3300009177 Bacteria 98093
132 Ga0105248_10341888 3300009177 Bacteria 1685
133 Ga0105248_11127203 3300009177 Bacteria 887
134 Ga0105238_10954422 3300009551 Bacteria 877
135 Ga0105238_11472715 3300009551 Bacteria 709
136 Ga0105249_10000069 3300009553 Bacteria 148118
137 Ga0105249_10369745 3300009553 Bacteria 1457
138 Ga0105249_10486266 3300009553 Bacteria 1278
139 Ga0105249_10662432 3300009553 Bacteria 1102
140 Ga0099796_10148609 3300010159 Bacteria 921
141 Ga0105239_10384647 3300010375 Bacteria 1587
142 Ga0105246_10106119 3300011119 Bacteria 2054
143 Ga0105246_10202399 3300011119 Bacteria 1544
144 Ga0157371_10895847 3300013102 Bacteria 672
145 Ga0157370_10564072 3300013104 Bacteria 1043
146 Ga0157370_10841522 3300013104 Bacteria 834
147 Ga0157370_11289286 3300013104 Bacteria 658
148 Ga0157374_11681296 3300013296 Bacteria 659
149 Ga0163162_10058166 3300013306 Bacteria 3894
150 Ga0163162_10107517 3300013306 Bacteria 2885
151 Ga0163162_10245695 3300013306 Bacteria 1921
152 Ga0163162_11364635 3300013306 Bacteria 806
153 Ga0163162_11817952 3300013306 Bacteria 697
154 Ga0157372_10020934 3300013307 Bacteria 7060
155 Ga0157372_10890847 3300013307 Bacteria 1033
156 Ga0157372_12387410 3300013307 Bacteria 607
157 Ga0157372_12599117 3300013307 Bacteria 581
158 Ga0157372_13330451 3300013307 Bacteria 512
159 Ga0157375_10105214 3300013308 Bacteria 2912
160 Ga0157375_10421408 3300013308 Bacteria 1501
161 Ga0157375_10458233 3300013308 Bacteria 1441
162 Ga0157375_13311825 3300013308 Bacteria 537
163 Ga0163163_10162942 3300014325 Bacteria 2276
164 Ga0163163_12631508 3300014325 Bacteria 560
165 Ga0163163_12730676 3300014325 Bacteria 551
166 Ga0157380_10566646 3300014326 Bacteria 1117
167 Ga0182008_10664837 3300014497 Bacteria 591
168 Ga0157377_10987995 3300014745 Bacteria 636
169 Ga0157377_11581162 3300014745 Bacteria 524
170 Ga0157379_10052071 3300014968 Bacteria 3656
171 Ga0157376_12452792 3300014969 Bacteria 561
172 Ga0163161_10800558 3300017792 Bacteria 792
173 Ga0197907_10232301 3300020069 Bacteria 829
174 Ga0206350_11431413 3300020080 Bacteria 520
175 Ga0224712_10669270 3300022467 Bacteria 510
176 Ga0209051_1001832 3300025303 Bacteria 16799
177 Ga0209051_1007207 3300025303 Bacteria 6116
178 Ga0207696_1039139 3300025711 Bacteria 1396
179 Ga0207710_10000050 3300025900 Bacteria 186453
180 Ga0207710_10308398 3300025900 Bacteria 801
181 Ga0207688_10357750 3300025901 Bacteria 900
182 Ga0207688_10576403 3300025901 Bacteria 708
183 Ga0207647_10011411 3300025904 Bacteria 6233
184 Ga0207699_10364421 3300025906 Bacteria 1023
185 Ga0207643_10440356 3300025908 Bacteria 828
186 Ga0207705_10000715 3300025909 Bacteria 27356
187 Ga0207705_10015850 3300025909 Bacteria 5413
188 Ga0207705_10504564 3300025909 Bacteria 940
189 Ga0207707_11061415 3300025912 Bacteria 662
190 Ga0207707_11490794 3300025912 Bacteria 536
191 Ga0207693_10102955 3300025915 Bacteria 2239
192 Ga0207663_11199136 3300025916 Bacteria 611
193 Ga0207660_10085393 3300025917 Bacteria 2328
194 Ga0207660_10146094 3300025917 Bacteria 1812
195 Ga0207660_10256024 3300025917 Bacteria 1382
196 Ga0207660_10737119 3300025917 Bacteria 804
197 Ga0207662_10111617 3300025918 Bacteria 1705
198 Ga0207657_10289403 3300025919 Bacteria 1299
199 Ga0207649_10587242 3300025920 Bacteria 856
200 Ga0207652_10244523 3300025921 Bacteria 1618
201 Ga0207652_10841944 3300025921 Bacteria 813
202 Ga0207652_11190184 3300025921 Bacteria 664
203 Ga0207681_10001659 3300025923 Bacteria 14337
204 Ga0207694_10367426 3300025924 Bacteria 1193
205 Ga0207659_10698254 3300025926 Bacteria 869
206 Ga0207687_10171216 3300025927 Bacteria 1675
207 Ga0207687_10533286 3300025927 Bacteria 983
208 Ga0207687_10539516 3300025927 Bacteria 977
209 Ga0207700_10011275 3300025928 Bacteria 5693
210 Ga0207664_10003184 3300025929 Bacteria 10906
211 Ga0207664_10047050 3300025929 Bacteria 3387
212 Ga0207664_11305840 3300025929 Bacteria 645
213 Ga0207644_10724531 3300025931 Bacteria 830
214 Ga0207706_10312210 3300025933 Bacteria 1369
215 Ga0207706_10847690 3300025933 Bacteria 774
216 Ga0207686_11011041 3300025934 Bacteria 675
217 Ga0207709_11252539 3300025935 Bacteria 612
218 Ga0207711_10000082 3300025941 Bacteria 102386
219 Ga0207711_11240593 3300025941 Bacteria 687
220 Ga0207711_11265953 3300025941 Bacteria 679
221 Ga0207661_10107843 3300025944 Bacteria 2350
222 Ga0207661_11297013 3300025944 Bacteria 669
223 Ga0207667_10300675 3300025949 Bacteria 1640
224 Ga0207712_10000084 3300025961 Bacteria 107789
225 Ga0207668_10013947 3300025972 Bacteria 4965
226 Ga0207668_10374424 3300025972 Bacteria 1197
227 Ga0207658_10494602 3300025986 Bacteria 1088
228 Ga0207658_10510067 3300025986 Bacteria 1072
229 Ga0207658_10543236 3300025986 Bacteria 1039
230 Ga0207658_10905426 3300025986 Bacteria 803
231 Ga0207677_10976288 3300026023 Bacteria 767
232 Ga0207703_10004642 3300026035 Bacteria 11224
233 Ga0207703_10345212 3300026035 Bacteria 1369
234 Ga0207639_10541402 3300026041 Bacteria 1068
235 Ga0207639_12286853 3300026041 Bacteria 502
236 Ga0207678_10034315 3300026067 Bacteria 4419
237 Ga0207678_10539976 3300026067 Bacteria 1019
238 Ga0207702_10411638 3300026078 Bacteria 1306
239 Ga0207641_10485820 3300026088 Bacteria 1197
240 Ga0207676_10223248 3300026095 Bacteria 1679
241 Ga0207676_10603944 3300026095 Bacteria 1054
242 Ga0207674_10015985 3300026116 Bacteria 8222
243 Ga0207674_10151248 3300026116 Bacteria 2278
244 Ga0207674_10697154 3300026116 Bacteria 980
245 Ga0207674_11326798 3300026116 Bacteria 689
246 Ga0207674_11432395 3300026116 Bacteria 660
247 Ga0207683_10477115 3300026121 Bacteria 1151
248 Ga0207683_11106859 3300026121 Bacteria 735
249 Ga0207683_11607208 3300026121 Bacteria 599
250 Ga0207428_10869881 3300027907 Bacteria 638
251 Ga0268266_10009054 3300028379 Bacteria 8798
252 Ga0268266_10146468 3300028379 Bacteria 2124
253 Ga0268266_11064510 3300028379 Bacteria 783
254 Ga0268265_10000106 3300028380 Bacteria 104924
255 Ga0268265_11002632 3300028380 Bacteria 825
256 Ga0268264_10000219 3300028381 Bacteria 111751
257 Ga0307517_10176748 3300028786 Bacteria 1388
258 Ga0307515_10680408 3300028794 Bacteria 643
259 Ga0314311_1166733 3300030733 Bacteria 513
260 Ga0316182_1344466 3300030745 Bacteria 886
261 Ga0307513_10058236 3300031456 Bacteria 4109
262 Ga0307513_10404494 3300031456 Bacteria 1099
263 Ga0307408_100480345 3300031548 Bacteria 1084
264 Ga0307405_10670777 3300031731 Bacteria 855
265 Ga0307405_10855969 3300031731 Bacteria 766
266 Ga0307413_10000116 3300031824 Bacteria 20564
267 Ga0307413_10796499 3300031824 Bacteria 794
268 Ga0307518_10477780 3300031838 Bacteria 653
269 Ga0307410_10075497 3300031852 Bacteria 2350
270 Ga0307410_10491713 3300031852 Bacteria 1008
271 Ga0307407_10110079 3300031903 Bacteria 1727
272 Ga0307407_10700625 3300031903 Bacteria 763
273 Ga0307409_100876252 3300031995 Bacteria 910
274 Ga0307416_101316754 3300032002 Bacteria 828
275 Ga0307416_102890969 3300032002 Bacteria 575
276 Ga0307416_103368222 3300032002 Bacteria 535
277 Ga0307414_11120585 3300032004 Bacteria 727
278 Ga0307411_10249788 3300032005 Bacteria 1394
279 Ga0307507_10364139 3300033179 Bacteria 842
280 Ga0373959_0150933 3300034820 Bacteria 588
281 Ga0373935_1082712 3300035692 Bacteria 596
282 Ga0373947_0070965 3300035725 Bacteria 2136
283 Ga0373925_1377662 3300037068 Bacteria 578
284 Ga0395900_0112550 3300037418 Bacteria 2795
285 Ga0395898_1245469 3300037466 Bacteria 674
286 Ga0395905_0041054 3300037471 Bacteria 4341
287 Ga0395905_1724652 3300037471 Bacteria 532
288 Ga0395901_0168656 3300038443 Bacteria 2297
289 Ga0436365_1589794 3300039437 Bacteria 540
290 Ga0439438_022064 3300041405 Bacteria 1770
291 Ga0439447_061134 3300041407 Bacteria 886
292 Ga0439461_0018265 3300041410 Bacteria 1371
293 Ga0439466_0021513 3300041411 Bacteria 2284
294 Ga0439465_0002086 3300041413 Bacteria 6567
295 Ga0439465_0077921 3300041413 Bacteria 1119
296 Ga0451787_056670 3300041441 Bacteria 592
297 Ga0451787_241977 3300041441 Bacteria 734
298 Ga0451793_0950694 3300041452 Bacteria 1031
299 Ga0451833_1058440 3300041491 Bacteria 533
300 Ga0451835_1064600 3300041492 Bacteria 517
301 Ga0451835_1141642 3300041492 Bacteria 908
302 Ga0451839_0415585 3300041496 Bacteria 645
303 Ga0451853_1262886 3300041512 Bacteria 682
304 Ga0439431_0006308 3300041997 Bacteria 2619
305 Ga0439431_0086151 3300041997 Bacteria 851
306 Ga0439445_0006023 3300042004 Bacteria 2779
307 Ga0439445_0023874 3300042004 Bacteria 1551
308 Ga0439449_0075728 3300042007 Bacteria 1240
309 Ga0439454_057090 3300042011 Bacteria 670
310 Ga0439446_0051695 3300042156 Bacteria 1228
311 Ga0439434_0025290 3300042435 Bacteria 1791
312 Ga0439434_0036387 3300042435 Bacteria 1506
313 Ga0466972_0003645 3300044658 Bacteria 7655
314 Ga0466972_0028632 3300044658 Bacteria 2747
315 Ga0466972_0101661 3300044658 Bacteria 1360
316 Ga0466965_0000485 3300044683 Bacteria 14118
317 Ga0466965_0445600 3300044683 Bacteria 720
318 Ga0466966_0800312 3300044684 Bacteria 568
319 Ga0466963_0510980 3300044694 Bacteria 848
320 Ga0466964_0055279 3300044706 Bacteria 1639
321 Ga0466971_0098722 3300044719 Bacteria 1341
322 Ga0466970_0002177 3300044765 Bacteria 9466
323 Ga0466970_0011803 3300044765 Bacteria 4456
324 Ga0466970_0104909 3300044765 Bacteria 1541
325 Ga0466970_0192526 3300044765 Bacteria 1133
326 Ga0466970_0377232 3300044765 Bacteria 807
327 Ga0466970_0445823 3300044765 Bacteria 742
328 Ga0466957_0311564 3300044842 Bacteria 1060
329 Ga0466957_0434314 3300044842 Bacteria 902
330 Ga0466960_0034220 3300044901 Bacteria 2366
331 Ga0466960_0057513 3300044901 Bacteria 1897
332 Ga0466960_0256257 3300044901 Bacteria 973
333 Ga0466960_0508068 3300044901 Bacteria 707
334 Ga0466967_0007567 3300045976 Bacteria 7851
335 Ga0466967_0289103 3300045976 Bacteria 1574
336 Ga0466967_0964753 3300045976 Bacteria 848
337 Ga0466967_1584865 3300045976 Bacteria 652
338 Ga0495627_011933 3300046453 Bacteria 3096
339 Ga0495603_0687161 3300046455 Bacteria 585
340 Ga0495629_0623144 3300046459 Bacteria 720
341 Ga0495638_0376968 3300046460 Bacteria 742
342 Ga0495641_0396649 3300046461 Bacteria 626
343 Ga0495650_0247474 3300046471 Bacteria 607
344 Ga0495605_0445623 3300046474 Bacteria 534
345 Ga0495662_0123938 3300046476 Bacteria 1269
346 Ga0495585_0262527 3300046492 Bacteria 858
347 Ga0495594_0088479 3300046499 Bacteria 1734
348 Ga0495596_0301742 3300046500 Bacteria 623
349 Ga0495640_0017541 3300046533 Bacteria 5334
350 Ga0495625_0457250 3300046660 Bacteria 788
351 Ga0495635_0549549 3300046663 Bacteria 757
352 Ga0495588_0459508 3300046674 Bacteria 668
353 Ga0495646_0218973 3300046680 Bacteria 1030
354 Ga0495647_0480738 3300046681 Bacteria 577
355 Ga0495658_0029885 3300046683 Bacteria 2954
356 Ga0495669_0001297 3300046684 Bacteria 10360
357 Ga0495624_0246397 3300046690 Bacteria 1081
358 Ga0495671_0334653 3300046692 Bacteria 727
359 Ga0495649_0393528 3300046694 Bacteria 696
360 Ga0495581_0059143 3300047315 Bacteria 2214
361 Ga0495604_0466634 3300047317 Bacteria 823
362 Ga0495674_1236164 3300047319 Bacteria 563
363 Ga0495676_0664493 3300047321 Bacteria 676
364 Ga0495679_104797 3300047446 Bacteria 783
365 Ga0495593_0004463 3300047673 Bacteria 8314
366 Ga0495614_0556400 3300048089 Bacteria 549
367 Ga0496100_0079427 3300048903 Bacteria 2211
368 Ga0496100_0135239 3300048903 Bacteria 1741
369 Ga0496101_0003023 3300048904 Bacteria 10370
370 Ga0496101_0405160 3300048904 Bacteria 1074
371 Ga0496102_0000206 3300048905 Bacteria 79436
372 Ga0496102_0033812 3300048905 Bacteria 4597
373 Ga0496102_0093803 3300048905 Bacteria 2781
374 Ga0496102_1377458 3300048905 Bacteria 624
375 Ga0496102_1785021 3300048905 Bacteria 532
376 Ga0496103_0000486 3300048906 Bacteria 33008
377 Ga0496104_0121590 3300048907 Bacteria 2507
378 Ga0496104_0390772 3300048907 Bacteria 1303
379 Ga0496105_0210709 3300048908 Bacteria 1584
380 Ga0496105_1346488 3300048908 Bacteria 519
381 Ga0496106_0250463 3300048909 Bacteria 1416
382 Ga0496107_0059620 3300048910 Bacteria 2762
383 Ga0496107_0159529 3300048910 Bacteria 1671
384 Ga0496108_0214377 3300048911 Bacteria 1672
385 Ga0496108_1438891 3300048911 Bacteria 575
386 Ga0496108_1663443 3300048911 Bacteria 526
387 Ga0496109_0940352 3300048912 Bacteria 802
388 Ga0496109_1140962 3300048912 Bacteria 716
389 Ga0496110_0176790 3300048913 Bacteria 1938
390 Ga0496110_0492306 3300048913 Bacteria 1117
391 Ga0496110_0527135 3300048913 Bacteria 1074
392 Ga0496111_0467474 3300048914 Bacteria 930
393 Ga0496112_0102633 3300048915 Bacteria 2830
394 Ga0496112_0358998 3300048915 Bacteria 1399
395 Ga0496113_0014696 3300048916 Bacteria 5352
396 Ga0496113_0108272 3300048916 Bacteria 2160
397 Ga0496113_0676422 3300048916 Bacteria 825
398 Ga0496113_1277762 3300048916 Bacteria 571
399 Ga0496114_0740379 3300048917 Bacteria 860
400 Ga0496116_0061031 3300048919 Bacteria 2442
401 Ga0496117_0000687 3300048920 Bacteria 54044
402 Ga0496118_0000962 3300048921 Bacteria 44975
403 Ga0496119_0007672 3300048922 Bacteria 9662
404 Ga0496119_0301432 3300048922 Bacteria 790
405 Ga0496120_0023454 3300048923 Bacteria 3863
406 Ga0496120_0056946 3300048923 Bacteria 2203
407 Ga0496120_0431138 3300048923 Bacteria 577
408 Ga0496121_0006530 3300048924 Bacteria 14419
409 Ga0496122_0075209 3300048925 Bacteria 2384
410 Ga0496123_0170728 3300048926 Bacteria 1147
411 Ga0496124_0156205 3300048927 Bacteria 1783
412 Ga0496125_0032958 3300048928 Bacteria 4592
413 Ga0496126_0009782 3300048929 Bacteria 10150
414 Ga0496126_0010035 3300048929 Bacteria 9993
415 Ga0496126_0011590 3300048929 Bacteria 9100
416 Ga0496126_0533444 3300048929 Bacteria 934
417 Ga0501321_013515 3300049537 Bacteria 939
418 Ga0501323_069105 3300049539 Bacteria 563
419 Ga0501031_0632012 3300049568 Bacteria 688
420 Ga0501039_0521498 3300049575 Bacteria 933
421 Ga0501040_0043732 3300049576 Bacteria 3054
422 Ga0501041_0717498 3300049577 Bacteria 640
423 Ga0501048_0136466 3300049582 Bacteria 1734
424 Ga0501067_0002751 3300049583 Bacteria 9673
425 Ga0501068_0320386 3300049584 Bacteria 994
426 Ga0501069_0348943 3300049585 Bacteria 872
427 Ga0501069_0521061 3300049585 Bacteria 710
428 Ga0501070_0027272 3300049586 Bacteria 4791
429 Ga0501070_0620031 3300049586 Bacteria 861
430 Ga0501071_1331188 3300049587 Bacteria 555
431 Ga0501072_0185372 3300049588 Bacteria 1660
432 Ga0501073_0210136 3300049589 Bacteria 1345
433 Ga0501076_0247391 3300049592 Bacteria 1459
434 Ga0501076_0571534 3300049592 Bacteria 932
435 Ga0501209_275243 3300049656 Bacteria 528
436 Ga0501079_0396275 3300049741 Bacteria 1083
437 Ga0501080_0103663 3300049742 Bacteria 2638
438 Ga0501044_0269519 3300049823 Bacteria 1639
439 nmdc:mga03683_12548_c1 3300050489 Bacteria 3098
440 nmdc:mga03n38_220103_c1 3300050490 Bacteria 990
441 nmdc:mga03n38_260315_c1 3300050490 Bacteria 919
442 nmdc:mga03n38_32166_c1 3300050490 Bacteria 2220
443 nmdc:mga03n38_876989_c1 3300050490 Bacteria 526
444 nmdc:mga00v17_3188_c1 3300050491 Bacteria 8453
445 nmdc:mga00v17_4806_c2 3300050491 Bacteria 4025
446 nmdc:mga0yw44_19214_c1 3300050492 Bacteria 3762
447 nmdc:mga0yw44_232313_c1 3300050492 Bacteria 1224
448 nmdc:mga0yw44_258794_c1 3300050492 Bacteria 1159
449 nmdc:mga0yw44_638105_c1 3300050492 Bacteria 724
450 nmdc:mga0yw44_782569_c1 3300050492 Bacteria 648
451 nmdc:mga06z11_92771_c1 3300050494 Bacteria 1642
452 nmdc:mga06z11_984468_c1 3300050494 Bacteria 514
453 nmdc:mga05p37_92997_c1 3300050507 Bacteria 3716
454 nmdc:mga09592_35250_c1 3300050508 Bacteria 4188
455 nmdc:mga0qj67_64299_c1 3300050509 Bacteria 2918
456 nmdc:mga06r32_2125_c1 3300050510 Bacteria 10141
457 nmdc:mga08y16_778750_c1 3300050511 Bacteria 951
458 nmdc:mga0sz30_1178_c1 3300050516 Bacteria 9369
459 nmdc:mga0sz30_5326_c1 3300050516 Bacteria 4713
460 nmdc:mga0sz30_65544_c1 3300050516 Bacteria 1557
461 Ga0495655_0100571 3300053083 Bacteria 855
462 Ga0495655_0159684 3300053083 Bacteria 714
463 Ga0495619_0224692 3300053085 Bacteria 1301
464 Ga0500643_133200 3300053087 Bacteria 668
465 Ga0500646_0151200 3300053090 Bacteria 769
466 Ga0500583_0592759 3300053092 Bacteria 510
467 Ga0500654_097640 3300053099 Bacteria 1271
468 Ga0500620_089868 3300053155 Bacteria 1070
469 Ga0466962_0038897 3300061719 Bacteria 2278
470 Ga0530510_1079887 3300061734 Bacteria 615

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005336 Ga0070680_100974534 Ga0070680_1009745341 91
2 3300005434 Ga0070709_10317814 Ga0070709_103178142 91
3 3300005435 Ga0070714_100538891 Ga0070714_1005388912 91
4 3300005437 Ga0070710_10774974 Ga0070710_107749741 91
5 3300005437 Ga0070710_11021002 Ga0070710_110210021 91
6 3300005439 Ga0070711_100415105 Ga0070711_1004151053 91
7 3300005535 Ga0070684_100374224 Ga0070684_1003742242 91
8 3300005577 Ga0068857_101052351 Ga0068857_1010523512 91
9 3300006163 Ga0070715_10089240 Ga0070715_100892402 91
10 3300006173 Ga0070716_100038754 Ga0070716_1000387545 91
11 3300025917 Ga0207660_10737119 Ga0207660_107371192 91
12 3300025944 Ga0207661_10107843 Ga0207661_101078431 91
13 3300048929 Ga0496126_0010035 Ga0496126_0010035_3244_3537 91
14 3300025934 Ga0207686_11011041 Ga0207686_110110412 92
15 3300025915 Ga0207693_10102955 Ga0207693_101029552 93
16 3300025916 Ga0207663_11199136 Ga0207663_111991361 93
17 iso_pu_bacteria 2547132424 2548698883 93
18 iso_pu_bacteria 2866612099 2866615594 93
19 iso_pu_bacteria 2791354901 2791910776 94
20 iso_pu_bacteria 2919713450 2919716842 94
21 3300009098 Ga0105245_11938504 Ga0105245_119385042 95
22 3300025918 Ga0207662_10111617 Ga0207662_101116173 95
23 iso_pu_bacteria 2515154155 2515852073 95
24 iso_pu_bacteria 2643221687 2644488997 95
25 iso_pu_bacteria 2643221715 2644639892 95
26 iso_pu_bacteria 2675903058 2676475906 95
27 iso_pu_bacteria 2795385470 2795783692 95
28 iso_pu_bacteria 2816332119 2816421549 95
29 iso_pu_bacteria 2827628540 2827630468 95
30 iso_pu_bacteria 2902810491 2902810963 95
31 iso_pu_bacteria 2929212328 2929212574 95
32 iso_pu_bacteria 8056207758 8056211845 95
33 3300005439 Ga0070711_100121227 Ga0070711_1001212273 96
34 3300009551 Ga0105238_10954422 Ga0105238_109544222 96
35 3300013308 Ga0157375_13311825 Ga0157375_133118251 96
36 3300014969 Ga0157376_12452792 Ga0157376_124527922 96
37 3300041512 Ga0451853_1262886 Ga0451853_1262886_51_344 96
38 3300044842 Ga0466957_0311564 Ga0466957_0311564_381_674 96
39 3300046663 Ga0495635_0549549 Ga0495635_0549549_73_366 96
40 3300047319 Ga0495674_1236164 Ga0495674_1236164_164_457 96
41 3300050490 nmdc:mga03n38_220103_c1 nmdc:mga03n38_220103_c1_490_783 96
42 3300005445 Ga0070708_101577434 Ga0070708_1015774342 97
43 3300005456 Ga0070678_100813902 Ga0070678_1008139022 97
44 3300006038 Ga0075365_10373525 Ga0075365_103735252 97
45 3300006042 Ga0075368_10106443 Ga0075368_101064432 97
46 3300006186 Ga0075369_10017591 Ga0075369_100175913 97
47 3300006186 Ga0075369_10048777 Ga0075369_100487772 97
48 3300013104 Ga0157370_10564072 Ga0157370_105640722 97
49 3300013306 Ga0163162_11817952 Ga0163162_118179521 97
50 3300013308 Ga0157375_10458233 Ga0157375_104582331 97
51 3300025927 Ga0207687_10539516 Ga0207687_105395162 97
52 3300025933 Ga0207706_10847690 Ga0207706_108476902 97
53 3300032002 Ga0307416_103368222 Ga0307416_1033682222 97
54 3300041492 Ga0451835_1141642 Ga0451835_1141642_347_643 97
55 3300041997 Ga0439431_0006308 Ga0439431_0006308_1268_1561 97
56 3300044901 Ga0466960_0508068 Ga0466960_0508068_120_413 97
57 3300046684 Ga0495669_0001297 Ga0495669_0001297_2207_2506 97
58 3300048903 Ga0496100_0079427 Ga0496100_0079427_134_430 97
59 3300048904 Ga0496101_0405160 Ga0496101_0405160_171_467 97
60 3300048907 Ga0496104_0390772 Ga0496104_0390772_693_989 97
61 3300050490 nmdc:mga03n38_876989_c1 nmdc:mga03n38_876989_c1_94_390 97
62 3300050492 nmdc:mga0yw44_782569_c1 nmdc:mga0yw44_782569_c1_204_500 97
63 3300050494 nmdc:mga06z11_92771_c1 nmdc:mga06z11_92771_c1_230_526 97
64 iso_pu_bacteria 2643221561 2643825720 97
65 iso_pu_bacteria 2643221696 2644531712 97
66 3300005327 Ga0070658_10014474 Ga0070658_100144746 98
67 3300005336 Ga0070680_100598506 Ga0070680_1005985062 98
68 3300005339 Ga0070660_101597500 Ga0070660_1015975001 98
69 3300005434 Ga0070709_10272498 Ga0070709_102724982 98
70 3300005435 Ga0070714_100001167 Ga0070714_10000116710 98
71 3300005436 Ga0070713_100003036 Ga0070713_1000030366 98
72 3300005563 Ga0068855_100284807 Ga0068855_1002848074 98
73 3300005577 Ga0068857_100940166 Ga0068857_1009401662 98
74 3300005616 Ga0068852_102091731 Ga0068852_1020917311 98
75 3300009093 Ga0105240_11347128 Ga0105240_113471282 98
76 3300009098 Ga0105245_10143950 Ga0105245_101439504 98
77 3300009148 Ga0105243_10125334 Ga0105243_101253343 98
78 3300013104 Ga0157370_10841522 Ga0157370_108415222 98
79 3300014497 Ga0182008_10664837 Ga0182008_106648372 98
80 3300025906 Ga0207699_10364421 Ga0207699_103644212 98
81 3300025909 Ga0207705_10015850 Ga0207705_100158506 98
82 3300025909 Ga0207705_10504564 Ga0207705_105045642 98
83 3300025927 Ga0207687_10533286 Ga0207687_105332862 98
84 3300025928 Ga0207700_10011275 Ga0207700_100112755 98
85 3300025929 Ga0207664_10047050 Ga0207664_100470501 98
86 3300025949 Ga0207667_10300675 Ga0207667_103006753 98
87 3300026041 Ga0207639_12286853 Ga0207639_122868531 98
88 3300026116 Ga0207674_10697154 Ga0207674_106971542 98
89 3300026116 Ga0207674_11326798 Ga0207674_113267982 98
90 3300026121 Ga0207683_10477115 Ga0207683_104771152 98
91 3300026121 Ga0207683_11106859 Ga0207683_111068592 98
92 3300031731 Ga0307405_10670777 Ga0307405_106707772 98
93 3300031824 Ga0307413_10796499 Ga0307413_107964992 98
94 3300031852 Ga0307410_10075497 Ga0307410_100754972 98
95 3300031903 Ga0307407_10110079 Ga0307407_101100792 98
96 3300032002 Ga0307416_101316754 Ga0307416_1013167542 98
97 3300032004 Ga0307414_11120585 Ga0307414_111205852 98
98 3300032005 Ga0307411_10249788 Ga0307411_102497883 98
99 3300033179 Ga0307507_10364139 Ga0307507_103641392 98
100 3300037418 Ga0395900_0112550 Ga0395900_0112550_2264_2569 98
101 3300037466 Ga0395898_1245469 Ga0395898_1245469_332_637 98
102 3300038443 Ga0395901_0168656 Ga0395901_0168656_1773_2078 98
103 3300044683 Ga0466965_0445600 Ga0466965_0445600_68_364 98
104 3300044765 Ga0466970_0011803 Ga0466970_0011803_1302_1598 98
105 3300044901 Ga0466960_0034220 Ga0466960_0034220_204_500 98
106 3300044901 Ga0466960_0057513 Ga0466960_0057513_1253_1549 98
107 3300046471 Ga0495650_0247474 Ga0495650_0247474_24_380 98
108 3300046500 Ga0495596_0301742 Ga0495596_0301742_146_442 98
109 3300048916 Ga0496113_1277762 Ga0496113_1277762_202_504 98
110 3300049537 Ga0501321_013515 Ga0501321_013515_617_913 98
111 3300049539 Ga0501323_069105 Ga0501323_069105_232_528 98
112 3300049583 Ga0501067_0002751 Ga0501067_0002751_3027_3332 98
113 3300049656 Ga0501209_275243 Ga0501209_275243_65_361 98
114 3300049823 Ga0501044_0269519 Ga0501044_0269519_90_389 98
115 3300050492 nmdc:mga0yw44_258794_c1 nmdc:mga0yw44_258794_c1_820_1116 98
116 3300053092 Ga0500583_0592759 Ga0500583_0592759_59_361 98
117 3300001979 JGI24740J21852_10022956 JGI24740J21852_100229562 99
118 3300001989 JGI24739J22299_10003327 JGI24739J22299_100033275 99
119 3300003792 Ga0055540_1006159 Ga0055540_10061593 99
120 3300005327 Ga0070658_10001220 Ga0070658_100012202 99
121 3300005331 Ga0070670_100185181 Ga0070670_1001851812 99
122 3300005336 Ga0070680_100044480 Ga0070680_1000444803 99
123 3300005336 Ga0070680_100189218 Ga0070680_1001892182 99
124 3300005339 Ga0070660_101587937 Ga0070660_1015879372 99
125 3300005344 Ga0070661_100529820 Ga0070661_1005298202 99
126 3300005344 Ga0070661_100795196 Ga0070661_1007951962 99
127 3300005345 Ga0070692_11197061 Ga0070692_111970612 99
128 3300005347 Ga0070668_100137403 Ga0070668_1001374032 99
129 3300005353 Ga0070669_100000385 Ga0070669_1000003858 99
130 3300005366 Ga0070659_100477005 Ga0070659_1004770051 99
131 3300005367 Ga0070667_100001420 Ga0070667_10000142023 99
132 3300005367 Ga0070667_100105733 Ga0070667_1001057332 99
133 3300005435 Ga0070714_100008579 Ga0070714_1000085794 99
134 3300005435 Ga0070714_101296271 Ga0070714_1012962711 99
135 3300005436 Ga0070713_100557093 Ga0070713_1005570931 99
136 3300005439 Ga0070711_100071831 Ga0070711_1000718313 99
137 3300005444 Ga0070694_100461981 Ga0070694_1004619812 99
138 3300005530 Ga0070679_100069305 Ga0070679_1000693054 99
139 3300005530 Ga0070679_100306981 Ga0070679_1003069814 99
140 3300005530 Ga0070679_100916263 Ga0070679_1009162631 99
141 3300005539 Ga0068853_100866114 Ga0068853_1008661142 99
142 3300005547 Ga0070693_100598361 Ga0070693_1005983613 99
143 3300005548 Ga0070665_100023210 Ga0070665_1000232103 99
144 3300005563 Ga0068855_102535164 Ga0068855_1025351642 99
145 3300005563 Ga0068855_102612532 Ga0068855_1026125321 99
146 3300005577 Ga0068857_100164088 Ga0068857_1001640882 99
147 3300005577 Ga0068857_101543418 Ga0068857_1015434182 99
148 3300005578 Ga0068854_100992535 Ga0068854_1009925352 99
149 3300005615 Ga0070702_100320628 Ga0070702_1003206283 99
150 3300005617 Ga0068859_100004438 Ga0068859_1000044384 99
151 3300005618 Ga0068864_100339073 Ga0068864_1003390732 99
152 3300005618 Ga0068864_101946077 Ga0068864_1019460772 99
153 3300005719 Ga0068861_100313479 Ga0068861_1003134793 99
154 3300005840 Ga0068870_10582135 Ga0068870_105821352 99
155 3300005841 Ga0068863_100000875 Ga0068863_1000008752 99
156 3300005842 Ga0068858_100001397 Ga0068858_10000139714 99
157 3300005842 Ga0068858_100102378 Ga0068858_1001023783 99
158 3300005843 Ga0068860_100000155 Ga0068860_10000015557 99
159 3300005844 Ga0068862_100000096 Ga0068862_10000009650 99
160 3300005844 Ga0068862_100562684 Ga0068862_1005626842 99
161 3300005937 Ga0081455_10374434 Ga0081455_103744342 99
162 3300006028 Ga0070717_10247416 Ga0070717_102474162 99
163 3300006038 Ga0075365_10078992 Ga0075365_100789922 99
164 3300006038 Ga0075365_10263262 Ga0075365_102632622 99
165 3300006038 Ga0075365_10721452 Ga0075365_107214522 99
166 3300006038 Ga0075365_11212542 Ga0075365_112125421 99
167 3300006048 Ga0075363_100400475 Ga0075363_1004004751 99
168 3300006048 Ga0075363_100882697 Ga0075363_1008826972 99
169 3300006051 Ga0075364_10000623 Ga0075364_1000062321 99
170 3300006051 Ga0075364_10045041 Ga0075364_100450414 99
171 3300006051 Ga0075364_10722208 Ga0075364_107222081 99
172 3300006058 Ga0075432_10051021 Ga0075432_100510213 99
173 3300006173 Ga0070716_100252176 Ga0070716_1002521762 99
174 3300006177 Ga0075362_10026854 Ga0075362_100268543 99
175 3300006186 Ga0075369_10011839 Ga0075369_100118394 99
176 3300006186 Ga0075369_10559289 Ga0075369_105592891 99
177 3300006844 Ga0075428_100007534 Ga0075428_1000075343 99
178 3300006846 Ga0075430_100333854 Ga0075430_1003338542 99
179 3300006880 Ga0075429_100037044 Ga0075429_1000370443 99
180 3300006880 Ga0075429_101724296 Ga0075429_1017242961 99
181 3300006931 Ga0097620_100004438 Ga0097620_1000044384 99
182 3300007788 Ga0099795_10145970 Ga0099795_101459702 99
183 3300009092 Ga0105250_10273089 Ga0105250_102730891 99
184 3300009094 Ga0111539_10252091 Ga0111539_102520913 99
185 3300009094 Ga0111539_11057609 Ga0111539_110576092 99
186 3300009101 Ga0105247_10000040 Ga0105247_10000040107 99
187 3300009101 Ga0105247_10198586 Ga0105247_101985863 99
188 3300009147 Ga0114129_10014442 Ga0114129_100144423 99
189 3300009174 Ga0105241_11759835 Ga0105241_117598352 99
190 3300009176 Ga0105242_12772285 Ga0105242_127722852 99
191 3300009177 Ga0105248_10000095 Ga0105248_1000009542 99
192 3300009177 Ga0105248_11127203 Ga0105248_111272032 99
193 3300009551 Ga0105238_11472715 Ga0105238_114727151 99
194 3300009553 Ga0105249_10000069 Ga0105249_1000006997 99
195 3300009553 Ga0105249_10369745 Ga0105249_103697451 99
196 3300009553 Ga0105249_10662432 Ga0105249_106624322 99
197 3300010375 Ga0105239_10384647 Ga0105239_103846472 99
198 3300011119 Ga0105246_10106119 Ga0105246_101061193 99
199 3300011119 Ga0105246_10202399 Ga0105246_102023992 99
200 3300013102 Ga0157371_10895847 Ga0157371_108958472 99
201 3300013296 Ga0157374_11681296 Ga0157374_116812962 99
202 3300013306 Ga0163162_10058166 Ga0163162_100581663 99
203 3300013306 Ga0163162_10107517 Ga0163162_101075173 99
204 3300013306 Ga0163162_10245695 Ga0163162_102456954 99
205 3300013307 Ga0157372_10020934 Ga0157372_100209345 99
206 3300013307 Ga0157372_10890847 Ga0157372_108908472 99
207 3300013307 Ga0157372_13330451 Ga0157372_133304512 99
208 3300014325 Ga0163163_10162942 Ga0163163_101629424 99
209 3300014325 Ga0163163_12631508 Ga0163163_126315082 99
210 3300014745 Ga0157377_10987995 Ga0157377_109879952 99
211 3300014745 Ga0157377_11581162 Ga0157377_115811622 99
212 3300014968 Ga0157379_10052071 Ga0157379_100520713 99
213 3300017792 Ga0163161_10800558 Ga0163161_108005582 99
214 3300022467 Ga0224712_10669270 Ga0224712_106692701 99
215 3300025303 Ga0209051_1001832 Ga0209051_100183214 99
216 3300025711 Ga0207696_1039139 Ga0207696_10391393 99
217 3300025900 Ga0207710_10000050 Ga0207710_10000050137 99
218 3300025900 Ga0207710_10308398 Ga0207710_103083982 99
219 3300025901 Ga0207688_10357750 Ga0207688_103577502 99
220 3300025904 Ga0207647_10011411 Ga0207647_100114112 99
221 3300025908 Ga0207643_10440356 Ga0207643_104403562 99
222 3300025909 Ga0207705_10000715 Ga0207705_1000071519 99
223 3300025917 Ga0207660_10146094 Ga0207660_101460942 99
224 3300025917 Ga0207660_10256024 Ga0207660_102560241 99
225 3300025920 Ga0207649_10587242 Ga0207649_105872422 99
226 3300025921 Ga0207652_10244523 Ga0207652_102445233 99
227 3300025921 Ga0207652_10841944 Ga0207652_108419441 99
228 3300025921 Ga0207652_11190184 Ga0207652_111901842 99
229 3300025923 Ga0207681_10001659 Ga0207681_1000165916 99
230 3300025926 Ga0207659_10698254 Ga0207659_106982542 99
231 3300025929 Ga0207664_10003184 Ga0207664_100031846 99
232 3300025931 Ga0207644_10724531 Ga0207644_107245312 99
233 3300025933 Ga0207706_10312210 Ga0207706_103122102 99
234 3300025941 Ga0207711_10000082 Ga0207711_1000008242 99
235 3300025941 Ga0207711_11240593 Ga0207711_112405932 99
236 3300025961 Ga0207712_10000084 Ga0207712_1000008496 99
237 3300025972 Ga0207668_10013947 Ga0207668_100139475 99
238 3300025972 Ga0207668_10374424 Ga0207668_103744242 99
239 3300025986 Ga0207658_10494602 Ga0207658_104946022 99
240 3300025986 Ga0207658_10510067 Ga0207658_105100672 99
241 3300025986 Ga0207658_10543236 Ga0207658_105432361 99
242 3300025986 Ga0207658_10905426 Ga0207658_109054262 99
243 3300026023 Ga0207677_10976288 Ga0207677_109762882 99
244 3300026035 Ga0207703_10004642 Ga0207703_1000464213 99
245 3300026035 Ga0207703_10345212 Ga0207703_103452123 99
246 3300026041 Ga0207639_10541402 Ga0207639_105414021 99
247 3300026067 Ga0207678_10034315 Ga0207678_100343157 99
248 3300026067 Ga0207678_10539976 Ga0207678_105399762 99
249 3300026078 Ga0207702_10411638 Ga0207702_104116382 99
250 3300026088 Ga0207641_10485820 Ga0207641_104858202 99
251 3300026095 Ga0207676_10223248 Ga0207676_102232484 99
252 3300026095 Ga0207676_10603944 Ga0207676_106039443 99
253 3300026116 Ga0207674_10015985 Ga0207674_100159857 99
254 3300026116 Ga0207674_11432395 Ga0207674_114323952 99
255 3300026121 Ga0207683_11607208 Ga0207683_116072082 99
256 3300027907 Ga0207428_10869881 Ga0207428_108698812 99
257 3300028379 Ga0268266_10009054 Ga0268266_100090547 99
258 3300028379 Ga0268266_11064510 Ga0268266_110645102 99
259 3300028380 Ga0268265_10000106 Ga0268265_1000010651 99
260 3300028380 Ga0268265_11002632 Ga0268265_110026321 99
261 3300028381 Ga0268264_10000219 Ga0268264_1000021956 99
262 3300028786 Ga0307517_10176748 Ga0307517_101767483 99
263 3300028794 Ga0307515_10680408 Ga0307515_106804082 99
264 3300031456 Ga0307513_10058236 Ga0307513_100582363 99
265 3300031456 Ga0307513_10404494 Ga0307513_104044942 99
266 3300031731 Ga0307405_10855969 Ga0307405_108559692 99
267 3300031838 Ga0307518_10477780 Ga0307518_104777802 99
268 3300031852 Ga0307410_10491713 Ga0307410_104917133 99
269 3300031903 Ga0307407_10700625 Ga0307407_107006252 99
270 3300031995 Ga0307409_100876252 Ga0307409_1008762522 99
271 3300032002 Ga0307416_102890969 Ga0307416_1028909691 99
272 3300034820 Ga0373959_0150933 Ga0373959_0150933_231_530 99
273 3300035692 Ga0373935_1082712 Ga0373935_1082712_215_514 99
274 3300035725 Ga0373947_0070965 Ga0373947_0070965_1474_1773 99
275 3300037068 Ga0373925_1377662 Ga0373925_1377662_108_407 99
276 3300037471 Ga0395905_0041054 Ga0395905_0041054_2952_3251 99
277 3300037471 Ga0395905_1724652 Ga0395905_1724652_179_478 99
278 3300039437 Ga0436365_1589794 Ga0436365_1589794_208_507 99
279 3300041405 Ga0439438_022064 Ga0439438_022064_783_1082 99
280 3300041407 Ga0439447_061134 Ga0439447_061134_221_520 99
281 3300041410 Ga0439461_0018265 Ga0439461_0018265_907_1206 99
282 3300041411 Ga0439466_0021513 Ga0439466_0021513_80_379 99
283 3300041413 Ga0439465_0002086 Ga0439465_0002086_3752_4051 99
284 3300041413 Ga0439465_0077921 Ga0439465_0077921_616_915 99
285 3300041441 Ga0451787_241977 Ga0451787_241977_217_516 99
286 3300041452 Ga0451793_0950694 Ga0451793_0950694_107_406 99
287 3300041491 Ga0451833_1058440 Ga0451833_1058440_56_355 99
288 3300041492 Ga0451835_1064600 Ga0451835_1064600_167_466 99
289 3300041496 Ga0451839_0415585 Ga0451839_0415585_183_488 99
290 3300041997 Ga0439431_0086151 Ga0439431_0086151_43_342 99
291 3300042004 Ga0439445_0006023 Ga0439445_0006023_1919_2218 99
292 3300042004 Ga0439445_0023874 Ga0439445_0023874_679_978 99
293 3300042007 Ga0439449_0075728 Ga0439449_0075728_321_620 99
294 3300042011 Ga0439454_057090 Ga0439454_057090_225_524 99
295 3300042156 Ga0439446_0051695 Ga0439446_0051695_344_643 99
296 3300042435 Ga0439434_0025290 Ga0439434_0025290_1249_1548 99
297 3300042435 Ga0439434_0036387 Ga0439434_0036387_802_1101 99
298 3300044658 Ga0466972_0003645 Ga0466972_0003645_1084_1383 99
299 3300044658 Ga0466972_0101661 Ga0466972_0101661_997_1296 99
300 3300044684 Ga0466966_0800312 Ga0466966_0800312_76_375 99
301 3300044765 Ga0466970_0002177 Ga0466970_0002177_8022_8321 99
302 3300044765 Ga0466970_0104909 Ga0466970_0104909_594_893 99
303 3300044765 Ga0466970_0377232 Ga0466970_0377232_60_359 99
304 3300044765 Ga0466970_0445823 Ga0466970_0445823_254_553 99
305 3300044901 Ga0466960_0256257 Ga0466960_0256257_71_370 99
306 3300045976 Ga0466967_1584865 Ga0466967_1584865_62_361 99
307 3300046453 Ga0495627_011933 Ga0495627_011933_880_1179 99
308 3300046455 Ga0495603_0687161 Ga0495603_0687161_234_533 99
309 3300046459 Ga0495629_0623144 Ga0495629_0623144_95_394 99
310 3300046460 Ga0495638_0376968 Ga0495638_0376968_206_505 99
311 3300046461 Ga0495641_0396649 Ga0495641_0396649_303_602 99
312 3300046474 Ga0495605_0445623 Ga0495605_0445623_80_379 99
313 3300046476 Ga0495662_0123938 Ga0495662_0123938_926_1225 99
314 3300046492 Ga0495585_0262527 Ga0495585_0262527_169_468 99
315 3300046499 Ga0495594_0088479 Ga0495594_0088479_1403_1702 99
316 3300046533 Ga0495640_0017541 Ga0495640_0017541_2867_3166 99
317 3300046660 Ga0495625_0457250 Ga0495625_0457250_199_498 99
318 3300046674 Ga0495588_0459508 Ga0495588_0459508_99_398 99
319 3300046680 Ga0495646_0218973 Ga0495646_0218973_544_843 99
320 3300046681 Ga0495647_0480738 Ga0495647_0480738_55_354 99
321 3300046683 Ga0495658_0029885 Ga0495658_0029885_903_1202 99
322 3300046690 Ga0495624_0246397 Ga0495624_0246397_400_699 99
323 3300046694 Ga0495649_0393528 Ga0495649_0393528_372_671 99
324 3300047315 Ga0495581_0059143 Ga0495581_0059143_154_453 99
325 3300047317 Ga0495604_0466634 Ga0495604_0466634_195_494 99
326 3300047321 Ga0495676_0664493 Ga0495676_0664493_366_665 99
327 3300047446 Ga0495679_104797 Ga0495679_104797_334_633 99
328 3300047673 Ga0495593_0004463 Ga0495593_0004463_7523_7822 99
329 3300048089 Ga0495614_0556400 Ga0495614_0556400_97_396 99
330 3300048903 Ga0496100_0135239 Ga0496100_0135239_36_335 99
331 3300048904 Ga0496101_0003023 Ga0496101_0003023_1216_1515 99
332 3300048905 Ga0496102_0000206 Ga0496102_0000206_56909_57208 99
333 3300048905 Ga0496102_0033812 Ga0496102_0033812_2612_2911 99
334 3300048905 Ga0496102_0093803 Ga0496102_0093803_1701_2000 99
335 3300048905 Ga0496102_1377458 Ga0496102_1377458_103_402 99
336 3300048905 Ga0496102_1785021 Ga0496102_1785021_94_393 99
337 3300048906 Ga0496103_0000486 Ga0496103_0000486_12797_13096 99
338 3300048907 Ga0496104_0121590 Ga0496104_0121590_1878_2177 99
339 3300048908 Ga0496105_1346488 Ga0496105_1346488_142_441 99
340 3300048909 Ga0496106_0250463 Ga0496106_0250463_943_1242 99
341 3300048910 Ga0496107_0059620 Ga0496107_0059620_820_1119 99
342 3300048910 Ga0496107_0159529 Ga0496107_0159529_309_608 99
343 3300048911 Ga0496108_0214377 Ga0496108_0214377_663_962 99
344 3300048911 Ga0496108_1438891 Ga0496108_1438891_124_423 99
345 3300048911 Ga0496108_1663443 Ga0496108_1663443_101_400 99
346 3300048912 Ga0496109_0940352 Ga0496109_0940352_371_670 99
347 3300048912 Ga0496109_1140962 Ga0496109_1140962_384_683 99
348 3300048913 Ga0496110_0176790 Ga0496110_0176790_1334_1633 99
349 3300048913 Ga0496110_0527135 Ga0496110_0527135_318_617 99
350 3300048914 Ga0496111_0467474 Ga0496111_0467474_114_413 99
351 3300048915 Ga0496112_0102633 Ga0496112_0102633_457_756 99
352 3300048915 Ga0496112_0358998 Ga0496112_0358998_384_683 99
353 3300048916 Ga0496113_0014696 Ga0496113_0014696_4580_4879 99
354 3300048916 Ga0496113_0108272 Ga0496113_0108272_166_465 99
355 3300048916 Ga0496113_0676422 Ga0496113_0676422_71_370 99
356 3300048919 Ga0496116_0061031 Ga0496116_0061031_810_1109 99
357 3300048920 Ga0496117_0000687 Ga0496117_0000687_42110_42409 99
358 3300048921 Ga0496118_0000962 Ga0496118_0000962_11485_11784 99
359 3300048922 Ga0496119_0007672 Ga0496119_0007672_1418_1717 99
360 3300048922 Ga0496119_0301432 Ga0496119_0301432_30_329 99
361 3300048923 Ga0496120_0023454 Ga0496120_0023454_3021_3320 99
362 3300048923 Ga0496120_0056946 Ga0496120_0056946_814_1113 99
363 3300048923 Ga0496120_0431138 Ga0496120_0431138_42_341 99
364 3300048924 Ga0496121_0006530 Ga0496121_0006530_11476_11775 99
365 3300048925 Ga0496122_0075209 Ga0496122_0075209_228_527 99
366 3300048926 Ga0496123_0170728 Ga0496123_0170728_621_920 99
367 3300048927 Ga0496124_0156205 Ga0496124_0156205_628_927 99
368 3300048928 Ga0496125_0032958 Ga0496125_0032958_383_682 99
369 3300048929 Ga0496126_0009782 Ga0496126_0009782_4615_4914 99
370 3300048929 Ga0496126_0011590 Ga0496126_0011590_4634_4933 99
371 3300049584 Ga0501068_0320386 Ga0501068_0320386_382_681 99
372 3300049586 Ga0501070_0027272 Ga0501070_0027272_509_820 99
373 3300049586 Ga0501070_0620031 Ga0501070_0620031_513_812 99
374 3300049588 Ga0501072_0185372 Ga0501072_0185372_85_396 99
375 3300049742 Ga0501080_0103663 Ga0501080_0103663_1234_1545 99
376 3300050489 nmdc:mga03683_12548_c1 nmdc:mga03683_12548_c1_385_684 99
377 3300050490 nmdc:mga03n38_260315_c1 nmdc:mga03n38_260315_c1_196_495 99
378 3300050490 nmdc:mga03n38_32166_c1 nmdc:mga03n38_32166_c1_1760_2059 99
379 3300050491 nmdc:mga00v17_3188_c1 nmdc:mga00v17_3188_c1_7291_7590 99
380 3300050491 nmdc:mga00v17_4806_c2 nmdc:mga00v17_4806_c2_1643_1942 99
381 3300050492 nmdc:mga0yw44_19214_c1 nmdc:mga0yw44_19214_c1_635_934 99
382 3300050492 nmdc:mga0yw44_232313_c1 nmdc:mga0yw44_232313_c1_163_462 99
383 3300050492 nmdc:mga0yw44_638105_c1 nmdc:mga0yw44_638105_c1_167_466 99
384 3300050494 nmdc:mga06z11_984468_c1 nmdc:mga06z11_984468_c1_191_490 99
385 3300050507 nmdc:mga05p37_92997_c1 nmdc:mga05p37_92997_c1_964_1263 99
386 3300050508 nmdc:mga09592_35250_c1 nmdc:mga09592_35250_c1_2437_2736 99
387 3300050509 nmdc:mga0qj67_64299_c1 nmdc:mga0qj67_64299_c1_517_816 99
388 3300050511 nmdc:mga08y16_778750_c1 nmdc:mga08y16_778750_c1_167_466 99
389 3300050516 nmdc:mga0sz30_1178_c1 nmdc:mga0sz30_1178_c1_1780_2079 99
390 3300050516 nmdc:mga0sz30_5326_c1 nmdc:mga0sz30_5326_c1_2787_3086 99
391 3300050516 nmdc:mga0sz30_65544_c1 nmdc:mga0sz30_65544_c1_1244_1543 99
392 3300053083 Ga0495655_0100571 Ga0495655_0100571_175_474 99
393 3300053083 Ga0495655_0159684 Ga0495655_0159684_112_411 99
394 3300053085 Ga0495619_0224692 Ga0495619_0224692_340_639 99
395 3300053087 Ga0500643_133200 Ga0500643_133200_19_318 99
396 3300053090 Ga0500646_0151200 Ga0500646_0151200_187_486 99
397 3300053099 Ga0500654_097640 Ga0500654_097640_214_513 99
398 3300053155 Ga0500620_089868 Ga0500620_089868_439_738 99
399 3300061734 Ga0530510_1079887 Ga0530510_1079887_139_438 99
400 3300003792 Ga0055540_1001669 Ga0055540_100166915 100
401 3300005329 Ga0070683_101325776 Ga0070683_1013257762 100
402 3300005535 Ga0070684_100366773 Ga0070684_1003667731 100
403 3300006051 Ga0075364_10201234 Ga0075364_102012343 100
404 3300006186 Ga0075369_10033429 Ga0075369_100334292 100
405 3300006847 Ga0075431_100268074 Ga0075431_1002680743 100
406 3300006881 Ga0068865_100839032 Ga0068865_1008390322 100
407 3300009098 Ga0105245_10010824 Ga0105245_100108242 100
408 3300009148 Ga0105243_10232686 Ga0105243_102326862 100
409 3300009176 Ga0105242_10463644 Ga0105242_104636442 100
410 3300009177 Ga0105248_10341888 Ga0105248_103418882 100
411 3300009553 Ga0105249_10486266 Ga0105249_104862662 100
412 3300010159 Ga0099796_10148609 Ga0099796_101486093 100
413 3300013306 Ga0163162_11364635 Ga0163162_113646351 100
414 3300013308 Ga0157375_10105214 Ga0157375_101052142 100
415 3300013308 Ga0157375_10421408 Ga0157375_104214082 100
416 3300014326 Ga0157380_10566646 Ga0157380_105666462 100
417 3300025303 Ga0209051_1007207 Ga0209051_10072078 100
418 3300025901 Ga0207688_10576403 Ga0207688_105764032 100
419 3300025924 Ga0207694_10367426 Ga0207694_103674262 100
420 3300025927 Ga0207687_10171216 Ga0207687_101712162 100
421 3300025935 Ga0207709_11252539 Ga0207709_112525391 100
422 3300025941 Ga0207711_11265953 Ga0207711_112659531 100
423 3300025944 Ga0207661_11297013 Ga0207661_112970132 100
424 3300028379 Ga0268266_10146468 Ga0268266_101464682 100
425 3300030733 Ga0314311_1166733 Ga0314311_11667331 100
426 3300030745 Ga0316182_1344466 Ga0316182_13444662 100
427 3300031824 Ga0307413_10000116 Ga0307413_100001166 100
428 3300048913 Ga0496110_0492306 Ga0496110_0492306_287_589 100
429 3300049585 Ga0501069_0348943 Ga0501069_0348943_213_515 100
430 3300049587 Ga0501071_1331188 Ga0501071_1331188_81_383 100
431 3300049589 Ga0501073_0210136 Ga0501073_0210136_648_950 100
432 3300050510 nmdc:mga06r32_2125_c1 nmdc:mga06r32_2125_c1_5304_5615 100
433 3300000546 LJNas_1022113 LJNas_10221131 101
434 3300005327 Ga0070658_10719487 Ga0070658_107194872 101
435 3300005329 Ga0070683_100760934 Ga0070683_1007609342 101
436 3300005336 Ga0070680_100637227 Ga0070680_1006372272 101
437 3300005339 Ga0070660_100102751 Ga0070660_1001027514 101
438 3300005339 Ga0070660_100789024 Ga0070660_1007890241 101
439 3300005347 Ga0070668_100688026 Ga0070668_1006880261 101
440 3300005435 Ga0070714_100043352 Ga0070714_1000433521 101
441 3300005455 Ga0070663_102086920 Ga0070663_1020869201 101
442 3300005458 Ga0070681_11230669 Ga0070681_112306692 101
443 3300005458 Ga0070681_11779556 Ga0070681_117795561 101
444 3300005530 Ga0070679_100293958 Ga0070679_1002939582 101
445 3300005530 Ga0070679_101343625 Ga0070679_1013436251 101
446 3300005577 Ga0068857_100107275 Ga0068857_1001072752 101
447 3300006051 Ga0075364_11062969 Ga0075364_110629691 101
448 3300009101 Ga0105247_10863720 Ga0105247_108637202 101
449 3300013104 Ga0157370_11289286 Ga0157370_112892862 101
450 3300013307 Ga0157372_12387410 Ga0157372_123874102 101
451 3300013307 Ga0157372_12599117 Ga0157372_125991172 101
452 3300014325 Ga0163163_12730676 Ga0163163_127306761 101
453 3300020069 Ga0197907_10232301 Ga0197907_102323012 101
454 3300020080 Ga0206350_11431413 Ga0206350_114314132 101
455 3300025912 Ga0207707_11061415 Ga0207707_110614152 101
456 3300025912 Ga0207707_11490794 Ga0207707_114907941 101
457 3300025917 Ga0207660_10085393 Ga0207660_100853933 101
458 3300025919 Ga0207657_10289403 Ga0207657_102894032 101
459 3300025929 Ga0207664_11305840 Ga0207664_113058402 101
460 3300026116 Ga0207674_10151248 Ga0207674_101512483 101
461 3300031548 Ga0307408_100480345 Ga0307408_1004803452 101
462 3300041441 Ga0451787_056670 Ga0451787_056670_164_469 101
463 3300044658 Ga0466972_0028632 Ga0466972_0028632_2188_2499 101
464 3300044683 Ga0466965_0000485 Ga0466965_0000485_8029_8334 101
465 3300044694 Ga0466963_0510980 Ga0466963_0510980_79_408 101
466 3300044706 Ga0466964_0055279 Ga0466964_0055279_622_933 101
467 3300044719 Ga0466971_0098722 Ga0466971_0098722_717_1028 101
468 3300044765 Ga0466970_0192526 Ga0466970_0192526_118_429 101
469 3300044842 Ga0466957_0434314 Ga0466957_0434314_14_325 101
470 3300045976 Ga0466967_0007567 Ga0466967_0007567_2546_2857 101
471 3300045976 Ga0466967_0289103 Ga0466967_0289103_965_1294 101
472 3300045976 Ga0466967_0964753 Ga0466967_0964753_267_596 101
473 3300046692 Ga0495671_0334653 Ga0495671_0334653_366_680 101
474 3300048908 Ga0496105_0210709 Ga0496105_0210709_1119_1424 101
475 3300048917 Ga0496114_0740379 Ga0496114_0740379_207_512 101
476 3300048929 Ga0496126_0533444 Ga0496126_0533444_270_575 101
477 3300049568 Ga0501031_0632012 Ga0501031_0632012_176_484 101
478 3300049575 Ga0501039_0521498 Ga0501039_0521498_132_440 101
479 3300049576 Ga0501040_0043732 Ga0501040_0043732_1822_2130 101
480 3300049577 Ga0501041_0717498 Ga0501041_0717498_304_612 101
481 3300049582 Ga0501048_0136466 Ga0501048_0136466_792_1100 101
482 3300049585 Ga0501069_0521061 Ga0501069_0521061_12_320 101
483 3300049592 Ga0501076_0247391 Ga0501076_0247391_628_933 101
484 3300049592 Ga0501076_0571534 Ga0501076_0571534_503_811 101
485 3300049741 Ga0501079_0396275 Ga0501079_0396275_686_994 101
486 3300061719 Ga0466962_0038897 Ga0466962_0038897_38_349 101

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01910

Thiamine_BP

Thiamine-binding protein

3

95

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1sbr-assembly1.cif.gz_B the structure and function of b. subtilis ykof gene product: the complex with thiamin 0.9118 2 74
1sbr-assembly1.cif.gz_A the structure and function of b. subtilis ykof gene product: the complex with thiamin 0.9089 2 74
1s7h-assembly2.cif.gz_D structural genomics, 2.2a crystal structure of protein ykof from bacillus subtilis 0.9077 2 74
1s99-assembly1.cif.gz_B the structure and function of b. subtilis ykof gene product: ligand free protein 0.9048 2 74
1s7h-assembly1.cif.gz_B structural genomics, 2.2a crystal structure of protein ykof from bacillus subtilis 0.904 2 74
ID Description Score Start End Superfamily
af_P9WFQ1_1_102_3.30.70.930 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9099 2 101 3.30.70.930
2ekyH00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8951 2 93 3.30.70.930
af_Q2FY28_1_104_3.30.70.930 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8918 2 97 3.30.70.930
af_P9WFQ1_1_102_3.30.70.930 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8841 2 101 3.30.70.930
1lxnD00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8611 1 96 3.30.70.930
ID Description Score Start End GO Terms
AF-A0A4D4N107-F1-model_v4 Thiamine-binding protein domain-containing protein 0.9794 19 97 GO:0005829
AF-A0A542ZDC0-F1-model_v4 Uncharacterized protein (TIGR00106 family) 0.9718 2 97 GO:0005829
AF-A0A7V8VAB3-F1-model_v4 Thiamine-binding protein domain-containing protein 0.9681 19 96 GO:0005829
AF-G7CDI6-F1-model_v4 Thiamine-binding protein domain-containing protein 0.968 2 99 GO:0005829
AF-A0A7W5A8K6-F1-model_v4 Uncharacterized protein (TIGR00106 family) 0.9676 1 98 GO:0005829

Feature Viewer

pLDDT pTM Quality
89.74 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map