F453353
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 486 | 299 | 470 | 99 |
Family's Representative Sequence
| Representative Sequence | 3300049586|Ga0501070_0027272|Ga0501070_0027272_509_820 |
| Length | 103 |
| Sequence | MIVAFSVSPLGADESVGAAVAEAVRVVRASGLPNETNAMFTNIEGEWDEVMDVVKRAVEAVTNSMAGPPRVSLVLKADIRPGHTGQLTAKVQRIGDVLDALGD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2515154155 | Actinopolymorpha alba DSM 45243 | Isolate | Rhizosphere |
| 2 | 2547132424 | Nocardia nova SH22a | Isolate | Unclassified |
| 3 | 2643221561 | Nocardioides sp. Root151 | Isolate | Unclassified |
| 4 | 2643221687 | Mycobacterium sp. Root135 | Isolate | Unclassified |
| 5 | 2643221696 | Nocardioides sp. Root140 | Isolate | Unclassified |
| 6 | 2643221715 | Mycobacterium sp. Root265 | Isolate | Unclassified |
| 7 | 2675903058 | Actinopolymorpha cephalotaxi CPCC 202808 | Isolate | Rhizosphere |
| 8 | 2791354901 | Actinophytocola xanthii 11-183 | Isolate | Rhizosphere |
| 9 | 2795385470 | Labedaea rhizosphaerae DSM 45361 | Isolate | Rhizosphere |
| 10 | 2816332119 | Kribbella amoyensis DSM 24683 | Isolate | Rhizosphere |
| 11 | 2827628540 | Actinopolymorpha cephalotaxi DSM 45117 | Isolate | Rhizosphere |
| 12 | 2866612099 | Amycolatopsis suaedae 8-3EHSu | Isolate | Unclassified |
| 13 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 14 | 2919713450 | Nocardia kruczakiae 4272 | Isolate | Rhizosphere |
| 15 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 16 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 17 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 18 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 19 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 20 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 47 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 48 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 49 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 51 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 52 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 53 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 54 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 55 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 56 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 57 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 58 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 59 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 60 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 62 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 63 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 64 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 65 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 66 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 67 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 69 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 70 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 71 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 72 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 73 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 74 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 75 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 77 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 90 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 101 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 106 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 107 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 108 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 150 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 154 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 155 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 156 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 157 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 158 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 159 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 160 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 161 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 162 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 163 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 164 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 165 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 166 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 167 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 168 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 169 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 170 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 171 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 172 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 173 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 174 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 175 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 176 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 177 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 178 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 179 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 180 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 181 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 182 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 183 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 184 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 185 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 186 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 187 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 188 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 189 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 190 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 191 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 192 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 193 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 194 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 195 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 196 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 197 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 198 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 199 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 200 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 201 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 202 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 203 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 204 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 205 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 235 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 236 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 237 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 238 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 239 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 240 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 241 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 242 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 243 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 244 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 245 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 246 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 247 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 248 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 249 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 250 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 251 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 252 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 253 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 254 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 255 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 256 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 257 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 258 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 259 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 260 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 261 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 262 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 276 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 280 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 281 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 282 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 283 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 284 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 290 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 293 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 294 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 295 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 296 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 297 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 298 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 299 | 8056207758 | Saccharopolyspora indica KCTC 29208 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.68 |
| Metatranscriptomes | 1.03 |
| Isolates | 3.29 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.26 |
| Nodule | 0 |
| Rhizoplane | 7.41 |
| Rhizosphere | 75.72 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.61 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1022113 | 3300000546 | Bacteria | 678 |
| 2 | JGI24740J21852_10022956 | 3300001979 | Bacteria | 2138 |
| 3 | JGI24739J22299_10003327 | 3300001989 | Bacteria | 6131 |
| 4 | Ga0055540_1001669 | 3300003792 | Bacteria | 12856 |
| 5 | Ga0055540_1006159 | 3300003792 | Bacteria | 4824 |
| 6 | Ga0070658_10001220 | 3300005327 | Bacteria | 22061 |
| 7 | Ga0070658_10014474 | 3300005327 | Bacteria | 6330 |
| 8 | Ga0070658_10719487 | 3300005327 | Bacteria | 867 |
| 9 | Ga0070683_100760934 | 3300005329 | Bacteria | 928 |
| 10 | Ga0070683_101325776 | 3300005329 | Bacteria | 692 |
| 11 | Ga0070670_100185181 | 3300005331 | Bacteria | 1808 |
| 12 | Ga0070680_100044480 | 3300005336 | Bacteria | 3608 |
| 13 | Ga0070680_100189218 | 3300005336 | Bacteria | 1734 |
| 14 | Ga0070680_100598506 | 3300005336 | Bacteria | 946 |
| 15 | Ga0070680_100637227 | 3300005336 | Bacteria | 916 |
| 16 | Ga0070680_100974534 | 3300005336 | Bacteria | 732 |
| 17 | Ga0070660_100102751 | 3300005339 | Bacteria | 2266 |
| 18 | Ga0070660_100789024 | 3300005339 | Bacteria | 798 |
| 19 | Ga0070660_101587937 | 3300005339 | Bacteria | 557 |
| 20 | Ga0070660_101597500 | 3300005339 | Bacteria | 555 |
| 21 | Ga0070661_100529820 | 3300005344 | Bacteria | 946 |
| 22 | Ga0070661_100795196 | 3300005344 | Bacteria | 776 |
| 23 | Ga0070692_11197061 | 3300005345 | Bacteria | 541 |
| 24 | Ga0070668_100137403 | 3300005347 | Bacteria | 1967 |
| 25 | Ga0070668_100688026 | 3300005347 | Bacteria | 901 |
| 26 | Ga0070669_100000385 | 3300005353 | Bacteria | 33896 |
| 27 | Ga0070659_100477005 | 3300005366 | Bacteria | 1061 |
| 28 | Ga0070667_100001420 | 3300005367 | Bacteria | 21453 |
| 29 | Ga0070667_100105733 | 3300005367 | Bacteria | 2436 |
| 30 | Ga0070709_10272498 | 3300005434 | Bacteria | 1227 |
| 31 | Ga0070709_10317814 | 3300005434 | Bacteria | 1142 |
| 32 | Ga0070714_100001167 | 3300005435 | Bacteria | 18932 |
| 33 | Ga0070714_100008579 | 3300005435 | Bacteria | 7994 |
| 34 | Ga0070714_100043352 | 3300005435 | Bacteria | 3805 |
| 35 | Ga0070714_100538891 | 3300005435 | Bacteria | 1116 |
| 36 | Ga0070714_101296271 | 3300005435 | Bacteria | 711 |
| 37 | Ga0070713_100003036 | 3300005436 | Bacteria | 11032 |
| 38 | Ga0070713_100557093 | 3300005436 | Bacteria | 1086 |
| 39 | Ga0070710_10774974 | 3300005437 | Bacteria | 683 |
| 40 | Ga0070710_11021002 | 3300005437 | Bacteria | 603 |
| 41 | Ga0070711_100071831 | 3300005439 | Bacteria | 2440 |
| 42 | Ga0070711_100121227 | 3300005439 | Bacteria | 1934 |
| 43 | Ga0070711_100415105 | 3300005439 | Bacteria | 1095 |
| 44 | Ga0070694_100461981 | 3300005444 | Bacteria | 1004 |
| 45 | Ga0070708_101577434 | 3300005445 | Bacteria | 611 |
| 46 | Ga0070663_102086920 | 3300005455 | Bacteria | 511 |
| 47 | Ga0070678_100813902 | 3300005456 | Bacteria | 849 |
| 48 | Ga0070681_11230669 | 3300005458 | Bacteria | 671 |
| 49 | Ga0070681_11779556 | 3300005458 | Bacteria | 543 |
| 50 | Ga0070679_100069305 | 3300005530 | Bacteria | 3518 |
| 51 | Ga0070679_100293958 | 3300005530 | Bacteria | 1576 |
| 52 | Ga0070679_100306981 | 3300005530 | Bacteria | 1537 |
| 53 | Ga0070679_100916263 | 3300005530 | Bacteria | 820 |
| 54 | Ga0070679_101343625 | 3300005530 | Bacteria | 661 |
| 55 | Ga0070684_100366773 | 3300005535 | Bacteria | 1326 |
| 56 | Ga0070684_100374224 | 3300005535 | Bacteria | 1311 |
| 57 | Ga0068853_100866114 | 3300005539 | Bacteria | 867 |
| 58 | Ga0070693_100598361 | 3300005547 | Bacteria | 796 |
| 59 | Ga0070665_100023210 | 3300005548 | Bacteria | 6248 |
| 60 | Ga0068855_100284807 | 3300005563 | Bacteria | 1834 |
| 61 | Ga0068855_102535164 | 3300005563 | Bacteria | 510 |
| 62 | Ga0068855_102612532 | 3300005563 | Bacteria | 501 |
| 63 | Ga0068857_100107275 | 3300005577 | Bacteria | 2508 |
| 64 | Ga0068857_100164088 | 3300005577 | Bacteria | 2017 |
| 65 | Ga0068857_100940166 | 3300005577 | Bacteria | 830 |
| 66 | Ga0068857_101052351 | 3300005577 | Bacteria | 784 |
| 67 | Ga0068857_101543418 | 3300005577 | Bacteria | 648 |
| 68 | Ga0068854_100992535 | 3300005578 | Bacteria | 743 |
| 69 | Ga0070702_100320628 | 3300005615 | Bacteria | 1080 |
| 70 | Ga0068852_102091731 | 3300005616 | Bacteria | 588 |
| 71 | Ga0068859_100004438 | 3300005617 | Bacteria | 14317 |
| 72 | Ga0068864_100339073 | 3300005618 | Bacteria | 1416 |
| 73 | Ga0068864_101946077 | 3300005618 | Bacteria | 594 |
| 74 | Ga0068861_100313479 | 3300005719 | Bacteria | 1364 |
| 75 | Ga0068870_10582135 | 3300005840 | Bacteria | 758 |
| 76 | Ga0068863_100000875 | 3300005841 | Bacteria | 30197 |
| 77 | Ga0068858_100001397 | 3300005842 | Bacteria | 24846 |
| 78 | Ga0068858_100102378 | 3300005842 | Bacteria | 2671 |
| 79 | Ga0068860_100000155 | 3300005843 | Bacteria | 111737 |
| 80 | Ga0068862_100000096 | 3300005844 | Bacteria | 104906 |
| 81 | Ga0068862_100562684 | 3300005844 | Bacteria | 1090 |
| 82 | Ga0081455_10374434 | 3300005937 | Bacteria | 997 |
| 83 | Ga0070717_10247416 | 3300006028 | Bacteria | 1574 |
| 84 | Ga0075365_10078992 | 3300006038 | Bacteria | 2226 |
| 85 | Ga0075365_10263262 | 3300006038 | Bacteria | 1212 |
| 86 | Ga0075365_10373525 | 3300006038 | Bacteria | 1006 |
| 87 | Ga0075365_10721452 | 3300006038 | Bacteria | 704 |
| 88 | Ga0075365_11212542 | 3300006038 | Bacteria | 531 |
| 89 | Ga0075368_10106443 | 3300006042 | Bacteria | 1154 |
| 90 | Ga0075363_100400475 | 3300006048 | Bacteria | 807 |
| 91 | Ga0075363_100882697 | 3300006048 | Bacteria | 547 |
| 92 | Ga0075364_10000623 | 3300006051 | Bacteria | 18228 |
| 93 | Ga0075364_10045041 | 3300006051 | Bacteria | 2871 |
| 94 | Ga0075364_10201234 | 3300006051 | Bacteria | 1350 |
| 95 | Ga0075364_10722208 | 3300006051 | Bacteria | 680 |
| 96 | Ga0075364_11062969 | 3300006051 | Bacteria | 550 |
| 97 | Ga0075432_10051021 | 3300006058 | Bacteria | 1460 |
| 98 | Ga0070715_10089240 | 3300006163 | Bacteria | 1415 |
| 99 | Ga0070716_100038754 | 3300006173 | Bacteria | 2640 |
| 100 | Ga0070716_100252176 | 3300006173 | Bacteria | 1203 |
| 101 | Ga0075362_10026854 | 3300006177 | Bacteria | 2462 |
| 102 | Ga0075369_10011839 | 3300006186 | Bacteria | 3436 |
| 103 | Ga0075369_10017591 | 3300006186 | Bacteria | 2900 |
| 104 | Ga0075369_10033429 | 3300006186 | Bacteria | 2179 |
| 105 | Ga0075369_10048777 | 3300006186 | Bacteria | 1828 |
| 106 | Ga0075369_10559289 | 3300006186 | Bacteria | 546 |
| 107 | Ga0075428_100007534 | 3300006844 | Bacteria | 12066 |
| 108 | Ga0075430_100333854 | 3300006846 | Bacteria | 1252 |
| 109 | Ga0075431_100268074 | 3300006847 | Bacteria | 1731 |
| 110 | Ga0075429_100037044 | 3300006880 | Bacteria | 4245 |
| 111 | Ga0075429_101724296 | 3300006880 | Bacteria | 544 |
| 112 | Ga0068865_100839032 | 3300006881 | Bacteria | 795 |
| 113 | Ga0097620_100004438 | 3300006931 | Bacteria | 14317 |
| 114 | Ga0099795_10145970 | 3300007788 | Bacteria | 965 |
| 115 | Ga0105250_10273089 | 3300009092 | Bacteria | 726 |
| 116 | Ga0105240_11347128 | 3300009093 | Bacteria | 751 |
| 117 | Ga0111539_10252091 | 3300009094 | Bacteria | 2055 |
| 118 | Ga0111539_11057609 | 3300009094 | Bacteria | 943 |
| 119 | Ga0105245_10010824 | 3300009098 | Bacteria | 7935 |
| 120 | Ga0105245_10143950 | 3300009098 | Bacteria | 2248 |
| 121 | Ga0105245_11938504 | 3300009098 | Bacteria | 642 |
| 122 | Ga0105247_10000040 | 3300009101 | Bacteria | 158975 |
| 123 | Ga0105247_10198586 | 3300009101 | Bacteria | 1346 |
| 124 | Ga0105247_10863720 | 3300009101 | Bacteria | 696 |
| 125 | Ga0114129_10014442 | 3300009147 | Bacteria | 11253 |
| 126 | Ga0105243_10125334 | 3300009148 | Bacteria | 2172 |
| 127 | Ga0105243_10232686 | 3300009148 | Bacteria | 1636 |
| 128 | Ga0105241_11759835 | 3300009174 | Bacteria | 604 |
| 129 | Ga0105242_10463644 | 3300009176 | Bacteria | 1197 |
| 130 | Ga0105242_12772285 | 3300009176 | Bacteria | 540 |
| 131 | Ga0105248_10000095 | 3300009177 | Bacteria | 98093 |
| 132 | Ga0105248_10341888 | 3300009177 | Bacteria | 1685 |
| 133 | Ga0105248_11127203 | 3300009177 | Bacteria | 887 |
| 134 | Ga0105238_10954422 | 3300009551 | Bacteria | 877 |
| 135 | Ga0105238_11472715 | 3300009551 | Bacteria | 709 |
| 136 | Ga0105249_10000069 | 3300009553 | Bacteria | 148118 |
| 137 | Ga0105249_10369745 | 3300009553 | Bacteria | 1457 |
| 138 | Ga0105249_10486266 | 3300009553 | Bacteria | 1278 |
| 139 | Ga0105249_10662432 | 3300009553 | Bacteria | 1102 |
| 140 | Ga0099796_10148609 | 3300010159 | Bacteria | 921 |
| 141 | Ga0105239_10384647 | 3300010375 | Bacteria | 1587 |
| 142 | Ga0105246_10106119 | 3300011119 | Bacteria | 2054 |
| 143 | Ga0105246_10202399 | 3300011119 | Bacteria | 1544 |
| 144 | Ga0157371_10895847 | 3300013102 | Bacteria | 672 |
| 145 | Ga0157370_10564072 | 3300013104 | Bacteria | 1043 |
| 146 | Ga0157370_10841522 | 3300013104 | Bacteria | 834 |
| 147 | Ga0157370_11289286 | 3300013104 | Bacteria | 658 |
| 148 | Ga0157374_11681296 | 3300013296 | Bacteria | 659 |
| 149 | Ga0163162_10058166 | 3300013306 | Bacteria | 3894 |
| 150 | Ga0163162_10107517 | 3300013306 | Bacteria | 2885 |
| 151 | Ga0163162_10245695 | 3300013306 | Bacteria | 1921 |
| 152 | Ga0163162_11364635 | 3300013306 | Bacteria | 806 |
| 153 | Ga0163162_11817952 | 3300013306 | Bacteria | 697 |
| 154 | Ga0157372_10020934 | 3300013307 | Bacteria | 7060 |
| 155 | Ga0157372_10890847 | 3300013307 | Bacteria | 1033 |
| 156 | Ga0157372_12387410 | 3300013307 | Bacteria | 607 |
| 157 | Ga0157372_12599117 | 3300013307 | Bacteria | 581 |
| 158 | Ga0157372_13330451 | 3300013307 | Bacteria | 512 |
| 159 | Ga0157375_10105214 | 3300013308 | Bacteria | 2912 |
| 160 | Ga0157375_10421408 | 3300013308 | Bacteria | 1501 |
| 161 | Ga0157375_10458233 | 3300013308 | Bacteria | 1441 |
| 162 | Ga0157375_13311825 | 3300013308 | Bacteria | 537 |
| 163 | Ga0163163_10162942 | 3300014325 | Bacteria | 2276 |
| 164 | Ga0163163_12631508 | 3300014325 | Bacteria | 560 |
| 165 | Ga0163163_12730676 | 3300014325 | Bacteria | 551 |
| 166 | Ga0157380_10566646 | 3300014326 | Bacteria | 1117 |
| 167 | Ga0182008_10664837 | 3300014497 | Bacteria | 591 |
| 168 | Ga0157377_10987995 | 3300014745 | Bacteria | 636 |
| 169 | Ga0157377_11581162 | 3300014745 | Bacteria | 524 |
| 170 | Ga0157379_10052071 | 3300014968 | Bacteria | 3656 |
| 171 | Ga0157376_12452792 | 3300014969 | Bacteria | 561 |
| 172 | Ga0163161_10800558 | 3300017792 | Bacteria | 792 |
| 173 | Ga0197907_10232301 | 3300020069 | Bacteria | 829 |
| 174 | Ga0206350_11431413 | 3300020080 | Bacteria | 520 |
| 175 | Ga0224712_10669270 | 3300022467 | Bacteria | 510 |
| 176 | Ga0209051_1001832 | 3300025303 | Bacteria | 16799 |
| 177 | Ga0209051_1007207 | 3300025303 | Bacteria | 6116 |
| 178 | Ga0207696_1039139 | 3300025711 | Bacteria | 1396 |
| 179 | Ga0207710_10000050 | 3300025900 | Bacteria | 186453 |
| 180 | Ga0207710_10308398 | 3300025900 | Bacteria | 801 |
| 181 | Ga0207688_10357750 | 3300025901 | Bacteria | 900 |
| 182 | Ga0207688_10576403 | 3300025901 | Bacteria | 708 |
| 183 | Ga0207647_10011411 | 3300025904 | Bacteria | 6233 |
| 184 | Ga0207699_10364421 | 3300025906 | Bacteria | 1023 |
| 185 | Ga0207643_10440356 | 3300025908 | Bacteria | 828 |
| 186 | Ga0207705_10000715 | 3300025909 | Bacteria | 27356 |
| 187 | Ga0207705_10015850 | 3300025909 | Bacteria | 5413 |
| 188 | Ga0207705_10504564 | 3300025909 | Bacteria | 940 |
| 189 | Ga0207707_11061415 | 3300025912 | Bacteria | 662 |
| 190 | Ga0207707_11490794 | 3300025912 | Bacteria | 536 |
| 191 | Ga0207693_10102955 | 3300025915 | Bacteria | 2239 |
| 192 | Ga0207663_11199136 | 3300025916 | Bacteria | 611 |
| 193 | Ga0207660_10085393 | 3300025917 | Bacteria | 2328 |
| 194 | Ga0207660_10146094 | 3300025917 | Bacteria | 1812 |
| 195 | Ga0207660_10256024 | 3300025917 | Bacteria | 1382 |
| 196 | Ga0207660_10737119 | 3300025917 | Bacteria | 804 |
| 197 | Ga0207662_10111617 | 3300025918 | Bacteria | 1705 |
| 198 | Ga0207657_10289403 | 3300025919 | Bacteria | 1299 |
| 199 | Ga0207649_10587242 | 3300025920 | Bacteria | 856 |
| 200 | Ga0207652_10244523 | 3300025921 | Bacteria | 1618 |
| 201 | Ga0207652_10841944 | 3300025921 | Bacteria | 813 |
| 202 | Ga0207652_11190184 | 3300025921 | Bacteria | 664 |
| 203 | Ga0207681_10001659 | 3300025923 | Bacteria | 14337 |
| 204 | Ga0207694_10367426 | 3300025924 | Bacteria | 1193 |
| 205 | Ga0207659_10698254 | 3300025926 | Bacteria | 869 |
| 206 | Ga0207687_10171216 | 3300025927 | Bacteria | 1675 |
| 207 | Ga0207687_10533286 | 3300025927 | Bacteria | 983 |
| 208 | Ga0207687_10539516 | 3300025927 | Bacteria | 977 |
| 209 | Ga0207700_10011275 | 3300025928 | Bacteria | 5693 |
| 210 | Ga0207664_10003184 | 3300025929 | Bacteria | 10906 |
| 211 | Ga0207664_10047050 | 3300025929 | Bacteria | 3387 |
| 212 | Ga0207664_11305840 | 3300025929 | Bacteria | 645 |
| 213 | Ga0207644_10724531 | 3300025931 | Bacteria | 830 |
| 214 | Ga0207706_10312210 | 3300025933 | Bacteria | 1369 |
| 215 | Ga0207706_10847690 | 3300025933 | Bacteria | 774 |
| 216 | Ga0207686_11011041 | 3300025934 | Bacteria | 675 |
| 217 | Ga0207709_11252539 | 3300025935 | Bacteria | 612 |
| 218 | Ga0207711_10000082 | 3300025941 | Bacteria | 102386 |
| 219 | Ga0207711_11240593 | 3300025941 | Bacteria | 687 |
| 220 | Ga0207711_11265953 | 3300025941 | Bacteria | 679 |
| 221 | Ga0207661_10107843 | 3300025944 | Bacteria | 2350 |
| 222 | Ga0207661_11297013 | 3300025944 | Bacteria | 669 |
| 223 | Ga0207667_10300675 | 3300025949 | Bacteria | 1640 |
| 224 | Ga0207712_10000084 | 3300025961 | Bacteria | 107789 |
| 225 | Ga0207668_10013947 | 3300025972 | Bacteria | 4965 |
| 226 | Ga0207668_10374424 | 3300025972 | Bacteria | 1197 |
| 227 | Ga0207658_10494602 | 3300025986 | Bacteria | 1088 |
| 228 | Ga0207658_10510067 | 3300025986 | Bacteria | 1072 |
| 229 | Ga0207658_10543236 | 3300025986 | Bacteria | 1039 |
| 230 | Ga0207658_10905426 | 3300025986 | Bacteria | 803 |
| 231 | Ga0207677_10976288 | 3300026023 | Bacteria | 767 |
| 232 | Ga0207703_10004642 | 3300026035 | Bacteria | 11224 |
| 233 | Ga0207703_10345212 | 3300026035 | Bacteria | 1369 |
| 234 | Ga0207639_10541402 | 3300026041 | Bacteria | 1068 |
| 235 | Ga0207639_12286853 | 3300026041 | Bacteria | 502 |
| 236 | Ga0207678_10034315 | 3300026067 | Bacteria | 4419 |
| 237 | Ga0207678_10539976 | 3300026067 | Bacteria | 1019 |
| 238 | Ga0207702_10411638 | 3300026078 | Bacteria | 1306 |
| 239 | Ga0207641_10485820 | 3300026088 | Bacteria | 1197 |
| 240 | Ga0207676_10223248 | 3300026095 | Bacteria | 1679 |
| 241 | Ga0207676_10603944 | 3300026095 | Bacteria | 1054 |
| 242 | Ga0207674_10015985 | 3300026116 | Bacteria | 8222 |
| 243 | Ga0207674_10151248 | 3300026116 | Bacteria | 2278 |
| 244 | Ga0207674_10697154 | 3300026116 | Bacteria | 980 |
| 245 | Ga0207674_11326798 | 3300026116 | Bacteria | 689 |
| 246 | Ga0207674_11432395 | 3300026116 | Bacteria | 660 |
| 247 | Ga0207683_10477115 | 3300026121 | Bacteria | 1151 |
| 248 | Ga0207683_11106859 | 3300026121 | Bacteria | 735 |
| 249 | Ga0207683_11607208 | 3300026121 | Bacteria | 599 |
| 250 | Ga0207428_10869881 | 3300027907 | Bacteria | 638 |
| 251 | Ga0268266_10009054 | 3300028379 | Bacteria | 8798 |
| 252 | Ga0268266_10146468 | 3300028379 | Bacteria | 2124 |
| 253 | Ga0268266_11064510 | 3300028379 | Bacteria | 783 |
| 254 | Ga0268265_10000106 | 3300028380 | Bacteria | 104924 |
| 255 | Ga0268265_11002632 | 3300028380 | Bacteria | 825 |
| 256 | Ga0268264_10000219 | 3300028381 | Bacteria | 111751 |
| 257 | Ga0307517_10176748 | 3300028786 | Bacteria | 1388 |
| 258 | Ga0307515_10680408 | 3300028794 | Bacteria | 643 |
| 259 | Ga0314311_1166733 | 3300030733 | Bacteria | 513 |
| 260 | Ga0316182_1344466 | 3300030745 | Bacteria | 886 |
| 261 | Ga0307513_10058236 | 3300031456 | Bacteria | 4109 |
| 262 | Ga0307513_10404494 | 3300031456 | Bacteria | 1099 |
| 263 | Ga0307408_100480345 | 3300031548 | Bacteria | 1084 |
| 264 | Ga0307405_10670777 | 3300031731 | Bacteria | 855 |
| 265 | Ga0307405_10855969 | 3300031731 | Bacteria | 766 |
| 266 | Ga0307413_10000116 | 3300031824 | Bacteria | 20564 |
| 267 | Ga0307413_10796499 | 3300031824 | Bacteria | 794 |
| 268 | Ga0307518_10477780 | 3300031838 | Bacteria | 653 |
| 269 | Ga0307410_10075497 | 3300031852 | Bacteria | 2350 |
| 270 | Ga0307410_10491713 | 3300031852 | Bacteria | 1008 |
| 271 | Ga0307407_10110079 | 3300031903 | Bacteria | 1727 |
| 272 | Ga0307407_10700625 | 3300031903 | Bacteria | 763 |
| 273 | Ga0307409_100876252 | 3300031995 | Bacteria | 910 |
| 274 | Ga0307416_101316754 | 3300032002 | Bacteria | 828 |
| 275 | Ga0307416_102890969 | 3300032002 | Bacteria | 575 |
| 276 | Ga0307416_103368222 | 3300032002 | Bacteria | 535 |
| 277 | Ga0307414_11120585 | 3300032004 | Bacteria | 727 |
| 278 | Ga0307411_10249788 | 3300032005 | Bacteria | 1394 |
| 279 | Ga0307507_10364139 | 3300033179 | Bacteria | 842 |
| 280 | Ga0373959_0150933 | 3300034820 | Bacteria | 588 |
| 281 | Ga0373935_1082712 | 3300035692 | Bacteria | 596 |
| 282 | Ga0373947_0070965 | 3300035725 | Bacteria | 2136 |
| 283 | Ga0373925_1377662 | 3300037068 | Bacteria | 578 |
| 284 | Ga0395900_0112550 | 3300037418 | Bacteria | 2795 |
| 285 | Ga0395898_1245469 | 3300037466 | Bacteria | 674 |
| 286 | Ga0395905_0041054 | 3300037471 | Bacteria | 4341 |
| 287 | Ga0395905_1724652 | 3300037471 | Bacteria | 532 |
| 288 | Ga0395901_0168656 | 3300038443 | Bacteria | 2297 |
| 289 | Ga0436365_1589794 | 3300039437 | Bacteria | 540 |
| 290 | Ga0439438_022064 | 3300041405 | Bacteria | 1770 |
| 291 | Ga0439447_061134 | 3300041407 | Bacteria | 886 |
| 292 | Ga0439461_0018265 | 3300041410 | Bacteria | 1371 |
| 293 | Ga0439466_0021513 | 3300041411 | Bacteria | 2284 |
| 294 | Ga0439465_0002086 | 3300041413 | Bacteria | 6567 |
| 295 | Ga0439465_0077921 | 3300041413 | Bacteria | 1119 |
| 296 | Ga0451787_056670 | 3300041441 | Bacteria | 592 |
| 297 | Ga0451787_241977 | 3300041441 | Bacteria | 734 |
| 298 | Ga0451793_0950694 | 3300041452 | Bacteria | 1031 |
| 299 | Ga0451833_1058440 | 3300041491 | Bacteria | 533 |
| 300 | Ga0451835_1064600 | 3300041492 | Bacteria | 517 |
| 301 | Ga0451835_1141642 | 3300041492 | Bacteria | 908 |
| 302 | Ga0451839_0415585 | 3300041496 | Bacteria | 645 |
| 303 | Ga0451853_1262886 | 3300041512 | Bacteria | 682 |
| 304 | Ga0439431_0006308 | 3300041997 | Bacteria | 2619 |
| 305 | Ga0439431_0086151 | 3300041997 | Bacteria | 851 |
| 306 | Ga0439445_0006023 | 3300042004 | Bacteria | 2779 |
| 307 | Ga0439445_0023874 | 3300042004 | Bacteria | 1551 |
| 308 | Ga0439449_0075728 | 3300042007 | Bacteria | 1240 |
| 309 | Ga0439454_057090 | 3300042011 | Bacteria | 670 |
| 310 | Ga0439446_0051695 | 3300042156 | Bacteria | 1228 |
| 311 | Ga0439434_0025290 | 3300042435 | Bacteria | 1791 |
| 312 | Ga0439434_0036387 | 3300042435 | Bacteria | 1506 |
| 313 | Ga0466972_0003645 | 3300044658 | Bacteria | 7655 |
| 314 | Ga0466972_0028632 | 3300044658 | Bacteria | 2747 |
| 315 | Ga0466972_0101661 | 3300044658 | Bacteria | 1360 |
| 316 | Ga0466965_0000485 | 3300044683 | Bacteria | 14118 |
| 317 | Ga0466965_0445600 | 3300044683 | Bacteria | 720 |
| 318 | Ga0466966_0800312 | 3300044684 | Bacteria | 568 |
| 319 | Ga0466963_0510980 | 3300044694 | Bacteria | 848 |
| 320 | Ga0466964_0055279 | 3300044706 | Bacteria | 1639 |
| 321 | Ga0466971_0098722 | 3300044719 | Bacteria | 1341 |
| 322 | Ga0466970_0002177 | 3300044765 | Bacteria | 9466 |
| 323 | Ga0466970_0011803 | 3300044765 | Bacteria | 4456 |
| 324 | Ga0466970_0104909 | 3300044765 | Bacteria | 1541 |
| 325 | Ga0466970_0192526 | 3300044765 | Bacteria | 1133 |
| 326 | Ga0466970_0377232 | 3300044765 | Bacteria | 807 |
| 327 | Ga0466970_0445823 | 3300044765 | Bacteria | 742 |
| 328 | Ga0466957_0311564 | 3300044842 | Bacteria | 1060 |
| 329 | Ga0466957_0434314 | 3300044842 | Bacteria | 902 |
| 330 | Ga0466960_0034220 | 3300044901 | Bacteria | 2366 |
| 331 | Ga0466960_0057513 | 3300044901 | Bacteria | 1897 |
| 332 | Ga0466960_0256257 | 3300044901 | Bacteria | 973 |
| 333 | Ga0466960_0508068 | 3300044901 | Bacteria | 707 |
| 334 | Ga0466967_0007567 | 3300045976 | Bacteria | 7851 |
| 335 | Ga0466967_0289103 | 3300045976 | Bacteria | 1574 |
| 336 | Ga0466967_0964753 | 3300045976 | Bacteria | 848 |
| 337 | Ga0466967_1584865 | 3300045976 | Bacteria | 652 |
| 338 | Ga0495627_011933 | 3300046453 | Bacteria | 3096 |
| 339 | Ga0495603_0687161 | 3300046455 | Bacteria | 585 |
| 340 | Ga0495629_0623144 | 3300046459 | Bacteria | 720 |
| 341 | Ga0495638_0376968 | 3300046460 | Bacteria | 742 |
| 342 | Ga0495641_0396649 | 3300046461 | Bacteria | 626 |
| 343 | Ga0495650_0247474 | 3300046471 | Bacteria | 607 |
| 344 | Ga0495605_0445623 | 3300046474 | Bacteria | 534 |
| 345 | Ga0495662_0123938 | 3300046476 | Bacteria | 1269 |
| 346 | Ga0495585_0262527 | 3300046492 | Bacteria | 858 |
| 347 | Ga0495594_0088479 | 3300046499 | Bacteria | 1734 |
| 348 | Ga0495596_0301742 | 3300046500 | Bacteria | 623 |
| 349 | Ga0495640_0017541 | 3300046533 | Bacteria | 5334 |
| 350 | Ga0495625_0457250 | 3300046660 | Bacteria | 788 |
| 351 | Ga0495635_0549549 | 3300046663 | Bacteria | 757 |
| 352 | Ga0495588_0459508 | 3300046674 | Bacteria | 668 |
| 353 | Ga0495646_0218973 | 3300046680 | Bacteria | 1030 |
| 354 | Ga0495647_0480738 | 3300046681 | Bacteria | 577 |
| 355 | Ga0495658_0029885 | 3300046683 | Bacteria | 2954 |
| 356 | Ga0495669_0001297 | 3300046684 | Bacteria | 10360 |
| 357 | Ga0495624_0246397 | 3300046690 | Bacteria | 1081 |
| 358 | Ga0495671_0334653 | 3300046692 | Bacteria | 727 |
| 359 | Ga0495649_0393528 | 3300046694 | Bacteria | 696 |
| 360 | Ga0495581_0059143 | 3300047315 | Bacteria | 2214 |
| 361 | Ga0495604_0466634 | 3300047317 | Bacteria | 823 |
| 362 | Ga0495674_1236164 | 3300047319 | Bacteria | 563 |
| 363 | Ga0495676_0664493 | 3300047321 | Bacteria | 676 |
| 364 | Ga0495679_104797 | 3300047446 | Bacteria | 783 |
| 365 | Ga0495593_0004463 | 3300047673 | Bacteria | 8314 |
| 366 | Ga0495614_0556400 | 3300048089 | Bacteria | 549 |
| 367 | Ga0496100_0079427 | 3300048903 | Bacteria | 2211 |
| 368 | Ga0496100_0135239 | 3300048903 | Bacteria | 1741 |
| 369 | Ga0496101_0003023 | 3300048904 | Bacteria | 10370 |
| 370 | Ga0496101_0405160 | 3300048904 | Bacteria | 1074 |
| 371 | Ga0496102_0000206 | 3300048905 | Bacteria | 79436 |
| 372 | Ga0496102_0033812 | 3300048905 | Bacteria | 4597 |
| 373 | Ga0496102_0093803 | 3300048905 | Bacteria | 2781 |
| 374 | Ga0496102_1377458 | 3300048905 | Bacteria | 624 |
| 375 | Ga0496102_1785021 | 3300048905 | Bacteria | 532 |
| 376 | Ga0496103_0000486 | 3300048906 | Bacteria | 33008 |
| 377 | Ga0496104_0121590 | 3300048907 | Bacteria | 2507 |
| 378 | Ga0496104_0390772 | 3300048907 | Bacteria | 1303 |
| 379 | Ga0496105_0210709 | 3300048908 | Bacteria | 1584 |
| 380 | Ga0496105_1346488 | 3300048908 | Bacteria | 519 |
| 381 | Ga0496106_0250463 | 3300048909 | Bacteria | 1416 |
| 382 | Ga0496107_0059620 | 3300048910 | Bacteria | 2762 |
| 383 | Ga0496107_0159529 | 3300048910 | Bacteria | 1671 |
| 384 | Ga0496108_0214377 | 3300048911 | Bacteria | 1672 |
| 385 | Ga0496108_1438891 | 3300048911 | Bacteria | 575 |
| 386 | Ga0496108_1663443 | 3300048911 | Bacteria | 526 |
| 387 | Ga0496109_0940352 | 3300048912 | Bacteria | 802 |
| 388 | Ga0496109_1140962 | 3300048912 | Bacteria | 716 |
| 389 | Ga0496110_0176790 | 3300048913 | Bacteria | 1938 |
| 390 | Ga0496110_0492306 | 3300048913 | Bacteria | 1117 |
| 391 | Ga0496110_0527135 | 3300048913 | Bacteria | 1074 |
| 392 | Ga0496111_0467474 | 3300048914 | Bacteria | 930 |
| 393 | Ga0496112_0102633 | 3300048915 | Bacteria | 2830 |
| 394 | Ga0496112_0358998 | 3300048915 | Bacteria | 1399 |
| 395 | Ga0496113_0014696 | 3300048916 | Bacteria | 5352 |
| 396 | Ga0496113_0108272 | 3300048916 | Bacteria | 2160 |
| 397 | Ga0496113_0676422 | 3300048916 | Bacteria | 825 |
| 398 | Ga0496113_1277762 | 3300048916 | Bacteria | 571 |
| 399 | Ga0496114_0740379 | 3300048917 | Bacteria | 860 |
| 400 | Ga0496116_0061031 | 3300048919 | Bacteria | 2442 |
| 401 | Ga0496117_0000687 | 3300048920 | Bacteria | 54044 |
| 402 | Ga0496118_0000962 | 3300048921 | Bacteria | 44975 |
| 403 | Ga0496119_0007672 | 3300048922 | Bacteria | 9662 |
| 404 | Ga0496119_0301432 | 3300048922 | Bacteria | 790 |
| 405 | Ga0496120_0023454 | 3300048923 | Bacteria | 3863 |
| 406 | Ga0496120_0056946 | 3300048923 | Bacteria | 2203 |
| 407 | Ga0496120_0431138 | 3300048923 | Bacteria | 577 |
| 408 | Ga0496121_0006530 | 3300048924 | Bacteria | 14419 |
| 409 | Ga0496122_0075209 | 3300048925 | Bacteria | 2384 |
| 410 | Ga0496123_0170728 | 3300048926 | Bacteria | 1147 |
| 411 | Ga0496124_0156205 | 3300048927 | Bacteria | 1783 |
| 412 | Ga0496125_0032958 | 3300048928 | Bacteria | 4592 |
| 413 | Ga0496126_0009782 | 3300048929 | Bacteria | 10150 |
| 414 | Ga0496126_0010035 | 3300048929 | Bacteria | 9993 |
| 415 | Ga0496126_0011590 | 3300048929 | Bacteria | 9100 |
| 416 | Ga0496126_0533444 | 3300048929 | Bacteria | 934 |
| 417 | Ga0501321_013515 | 3300049537 | Bacteria | 939 |
| 418 | Ga0501323_069105 | 3300049539 | Bacteria | 563 |
| 419 | Ga0501031_0632012 | 3300049568 | Bacteria | 688 |
| 420 | Ga0501039_0521498 | 3300049575 | Bacteria | 933 |
| 421 | Ga0501040_0043732 | 3300049576 | Bacteria | 3054 |
| 422 | Ga0501041_0717498 | 3300049577 | Bacteria | 640 |
| 423 | Ga0501048_0136466 | 3300049582 | Bacteria | 1734 |
| 424 | Ga0501067_0002751 | 3300049583 | Bacteria | 9673 |
| 425 | Ga0501068_0320386 | 3300049584 | Bacteria | 994 |
| 426 | Ga0501069_0348943 | 3300049585 | Bacteria | 872 |
| 427 | Ga0501069_0521061 | 3300049585 | Bacteria | 710 |
| 428 | Ga0501070_0027272 | 3300049586 | Bacteria | 4791 |
| 429 | Ga0501070_0620031 | 3300049586 | Bacteria | 861 |
| 430 | Ga0501071_1331188 | 3300049587 | Bacteria | 555 |
| 431 | Ga0501072_0185372 | 3300049588 | Bacteria | 1660 |
| 432 | Ga0501073_0210136 | 3300049589 | Bacteria | 1345 |
| 433 | Ga0501076_0247391 | 3300049592 | Bacteria | 1459 |
| 434 | Ga0501076_0571534 | 3300049592 | Bacteria | 932 |
| 435 | Ga0501209_275243 | 3300049656 | Bacteria | 528 |
| 436 | Ga0501079_0396275 | 3300049741 | Bacteria | 1083 |
| 437 | Ga0501080_0103663 | 3300049742 | Bacteria | 2638 |
| 438 | Ga0501044_0269519 | 3300049823 | Bacteria | 1639 |
| 439 | nmdc:mga03683_12548_c1 | 3300050489 | Bacteria | 3098 |
| 440 | nmdc:mga03n38_220103_c1 | 3300050490 | Bacteria | 990 |
| 441 | nmdc:mga03n38_260315_c1 | 3300050490 | Bacteria | 919 |
| 442 | nmdc:mga03n38_32166_c1 | 3300050490 | Bacteria | 2220 |
| 443 | nmdc:mga03n38_876989_c1 | 3300050490 | Bacteria | 526 |
| 444 | nmdc:mga00v17_3188_c1 | 3300050491 | Bacteria | 8453 |
| 445 | nmdc:mga00v17_4806_c2 | 3300050491 | Bacteria | 4025 |
| 446 | nmdc:mga0yw44_19214_c1 | 3300050492 | Bacteria | 3762 |
| 447 | nmdc:mga0yw44_232313_c1 | 3300050492 | Bacteria | 1224 |
| 448 | nmdc:mga0yw44_258794_c1 | 3300050492 | Bacteria | 1159 |
| 449 | nmdc:mga0yw44_638105_c1 | 3300050492 | Bacteria | 724 |
| 450 | nmdc:mga0yw44_782569_c1 | 3300050492 | Bacteria | 648 |
| 451 | nmdc:mga06z11_92771_c1 | 3300050494 | Bacteria | 1642 |
| 452 | nmdc:mga06z11_984468_c1 | 3300050494 | Bacteria | 514 |
| 453 | nmdc:mga05p37_92997_c1 | 3300050507 | Bacteria | 3716 |
| 454 | nmdc:mga09592_35250_c1 | 3300050508 | Bacteria | 4188 |
| 455 | nmdc:mga0qj67_64299_c1 | 3300050509 | Bacteria | 2918 |
| 456 | nmdc:mga06r32_2125_c1 | 3300050510 | Bacteria | 10141 |
| 457 | nmdc:mga08y16_778750_c1 | 3300050511 | Bacteria | 951 |
| 458 | nmdc:mga0sz30_1178_c1 | 3300050516 | Bacteria | 9369 |
| 459 | nmdc:mga0sz30_5326_c1 | 3300050516 | Bacteria | 4713 |
| 460 | nmdc:mga0sz30_65544_c1 | 3300050516 | Bacteria | 1557 |
| 461 | Ga0495655_0100571 | 3300053083 | Bacteria | 855 |
| 462 | Ga0495655_0159684 | 3300053083 | Bacteria | 714 |
| 463 | Ga0495619_0224692 | 3300053085 | Bacteria | 1301 |
| 464 | Ga0500643_133200 | 3300053087 | Bacteria | 668 |
| 465 | Ga0500646_0151200 | 3300053090 | Bacteria | 769 |
| 466 | Ga0500583_0592759 | 3300053092 | Bacteria | 510 |
| 467 | Ga0500654_097640 | 3300053099 | Bacteria | 1271 |
| 468 | Ga0500620_089868 | 3300053155 | Bacteria | 1070 |
| 469 | Ga0466962_0038897 | 3300061719 | Bacteria | 2278 |
| 470 | Ga0530510_1079887 | 3300061734 | Bacteria | 615 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005336 | Ga0070680_100974534 | Ga0070680_1009745341 | 91 |
| 2 | 3300005434 | Ga0070709_10317814 | Ga0070709_103178142 | 91 |
| 3 | 3300005435 | Ga0070714_100538891 | Ga0070714_1005388912 | 91 |
| 4 | 3300005437 | Ga0070710_10774974 | Ga0070710_107749741 | 91 |
| 5 | 3300005437 | Ga0070710_11021002 | Ga0070710_110210021 | 91 |
| 6 | 3300005439 | Ga0070711_100415105 | Ga0070711_1004151053 | 91 |
| 7 | 3300005535 | Ga0070684_100374224 | Ga0070684_1003742242 | 91 |
| 8 | 3300005577 | Ga0068857_101052351 | Ga0068857_1010523512 | 91 |
| 9 | 3300006163 | Ga0070715_10089240 | Ga0070715_100892402 | 91 |
| 10 | 3300006173 | Ga0070716_100038754 | Ga0070716_1000387545 | 91 |
| 11 | 3300025917 | Ga0207660_10737119 | Ga0207660_107371192 | 91 |
| 12 | 3300025944 | Ga0207661_10107843 | Ga0207661_101078431 | 91 |
| 13 | 3300048929 | Ga0496126_0010035 | Ga0496126_0010035_3244_3537 | 91 |
| 14 | 3300025934 | Ga0207686_11011041 | Ga0207686_110110412 | 92 |
| 15 | 3300025915 | Ga0207693_10102955 | Ga0207693_101029552 | 93 |
| 16 | 3300025916 | Ga0207663_11199136 | Ga0207663_111991361 | 93 |
| 17 | iso_pu_bacteria | 2547132424 | 2548698883 | 93 |
| 18 | iso_pu_bacteria | 2866612099 | 2866615594 | 93 |
| 19 | iso_pu_bacteria | 2791354901 | 2791910776 | 94 |
| 20 | iso_pu_bacteria | 2919713450 | 2919716842 | 94 |
| 21 | 3300009098 | Ga0105245_11938504 | Ga0105245_119385042 | 95 |
| 22 | 3300025918 | Ga0207662_10111617 | Ga0207662_101116173 | 95 |
| 23 | iso_pu_bacteria | 2515154155 | 2515852073 | 95 |
| 24 | iso_pu_bacteria | 2643221687 | 2644488997 | 95 |
| 25 | iso_pu_bacteria | 2643221715 | 2644639892 | 95 |
| 26 | iso_pu_bacteria | 2675903058 | 2676475906 | 95 |
| 27 | iso_pu_bacteria | 2795385470 | 2795783692 | 95 |
| 28 | iso_pu_bacteria | 2816332119 | 2816421549 | 95 |
| 29 | iso_pu_bacteria | 2827628540 | 2827630468 | 95 |
| 30 | iso_pu_bacteria | 2902810491 | 2902810963 | 95 |
| 31 | iso_pu_bacteria | 2929212328 | 2929212574 | 95 |
| 32 | iso_pu_bacteria | 8056207758 | 8056211845 | 95 |
| 33 | 3300005439 | Ga0070711_100121227 | Ga0070711_1001212273 | 96 |
| 34 | 3300009551 | Ga0105238_10954422 | Ga0105238_109544222 | 96 |
| 35 | 3300013308 | Ga0157375_13311825 | Ga0157375_133118251 | 96 |
| 36 | 3300014969 | Ga0157376_12452792 | Ga0157376_124527922 | 96 |
| 37 | 3300041512 | Ga0451853_1262886 | Ga0451853_1262886_51_344 | 96 |
| 38 | 3300044842 | Ga0466957_0311564 | Ga0466957_0311564_381_674 | 96 |
| 39 | 3300046663 | Ga0495635_0549549 | Ga0495635_0549549_73_366 | 96 |
| 40 | 3300047319 | Ga0495674_1236164 | Ga0495674_1236164_164_457 | 96 |
| 41 | 3300050490 | nmdc:mga03n38_220103_c1 | nmdc:mga03n38_220103_c1_490_783 | 96 |
| 42 | 3300005445 | Ga0070708_101577434 | Ga0070708_1015774342 | 97 |
| 43 | 3300005456 | Ga0070678_100813902 | Ga0070678_1008139022 | 97 |
| 44 | 3300006038 | Ga0075365_10373525 | Ga0075365_103735252 | 97 |
| 45 | 3300006042 | Ga0075368_10106443 | Ga0075368_101064432 | 97 |
| 46 | 3300006186 | Ga0075369_10017591 | Ga0075369_100175913 | 97 |
| 47 | 3300006186 | Ga0075369_10048777 | Ga0075369_100487772 | 97 |
| 48 | 3300013104 | Ga0157370_10564072 | Ga0157370_105640722 | 97 |
| 49 | 3300013306 | Ga0163162_11817952 | Ga0163162_118179521 | 97 |
| 50 | 3300013308 | Ga0157375_10458233 | Ga0157375_104582331 | 97 |
| 51 | 3300025927 | Ga0207687_10539516 | Ga0207687_105395162 | 97 |
| 52 | 3300025933 | Ga0207706_10847690 | Ga0207706_108476902 | 97 |
| 53 | 3300032002 | Ga0307416_103368222 | Ga0307416_1033682222 | 97 |
| 54 | 3300041492 | Ga0451835_1141642 | Ga0451835_1141642_347_643 | 97 |
| 55 | 3300041997 | Ga0439431_0006308 | Ga0439431_0006308_1268_1561 | 97 |
| 56 | 3300044901 | Ga0466960_0508068 | Ga0466960_0508068_120_413 | 97 |
| 57 | 3300046684 | Ga0495669_0001297 | Ga0495669_0001297_2207_2506 | 97 |
| 58 | 3300048903 | Ga0496100_0079427 | Ga0496100_0079427_134_430 | 97 |
| 59 | 3300048904 | Ga0496101_0405160 | Ga0496101_0405160_171_467 | 97 |
| 60 | 3300048907 | Ga0496104_0390772 | Ga0496104_0390772_693_989 | 97 |
| 61 | 3300050490 | nmdc:mga03n38_876989_c1 | nmdc:mga03n38_876989_c1_94_390 | 97 |
| 62 | 3300050492 | nmdc:mga0yw44_782569_c1 | nmdc:mga0yw44_782569_c1_204_500 | 97 |
| 63 | 3300050494 | nmdc:mga06z11_92771_c1 | nmdc:mga06z11_92771_c1_230_526 | 97 |
| 64 | iso_pu_bacteria | 2643221561 | 2643825720 | 97 |
| 65 | iso_pu_bacteria | 2643221696 | 2644531712 | 97 |
| 66 | 3300005327 | Ga0070658_10014474 | Ga0070658_100144746 | 98 |
| 67 | 3300005336 | Ga0070680_100598506 | Ga0070680_1005985062 | 98 |
| 68 | 3300005339 | Ga0070660_101597500 | Ga0070660_1015975001 | 98 |
| 69 | 3300005434 | Ga0070709_10272498 | Ga0070709_102724982 | 98 |
| 70 | 3300005435 | Ga0070714_100001167 | Ga0070714_10000116710 | 98 |
| 71 | 3300005436 | Ga0070713_100003036 | Ga0070713_1000030366 | 98 |
| 72 | 3300005563 | Ga0068855_100284807 | Ga0068855_1002848074 | 98 |
| 73 | 3300005577 | Ga0068857_100940166 | Ga0068857_1009401662 | 98 |
| 74 | 3300005616 | Ga0068852_102091731 | Ga0068852_1020917311 | 98 |
| 75 | 3300009093 | Ga0105240_11347128 | Ga0105240_113471282 | 98 |
| 76 | 3300009098 | Ga0105245_10143950 | Ga0105245_101439504 | 98 |
| 77 | 3300009148 | Ga0105243_10125334 | Ga0105243_101253343 | 98 |
| 78 | 3300013104 | Ga0157370_10841522 | Ga0157370_108415222 | 98 |
| 79 | 3300014497 | Ga0182008_10664837 | Ga0182008_106648372 | 98 |
| 80 | 3300025906 | Ga0207699_10364421 | Ga0207699_103644212 | 98 |
| 81 | 3300025909 | Ga0207705_10015850 | Ga0207705_100158506 | 98 |
| 82 | 3300025909 | Ga0207705_10504564 | Ga0207705_105045642 | 98 |
| 83 | 3300025927 | Ga0207687_10533286 | Ga0207687_105332862 | 98 |
| 84 | 3300025928 | Ga0207700_10011275 | Ga0207700_100112755 | 98 |
| 85 | 3300025929 | Ga0207664_10047050 | Ga0207664_100470501 | 98 |
| 86 | 3300025949 | Ga0207667_10300675 | Ga0207667_103006753 | 98 |
| 87 | 3300026041 | Ga0207639_12286853 | Ga0207639_122868531 | 98 |
| 88 | 3300026116 | Ga0207674_10697154 | Ga0207674_106971542 | 98 |
| 89 | 3300026116 | Ga0207674_11326798 | Ga0207674_113267982 | 98 |
| 90 | 3300026121 | Ga0207683_10477115 | Ga0207683_104771152 | 98 |
| 91 | 3300026121 | Ga0207683_11106859 | Ga0207683_111068592 | 98 |
| 92 | 3300031731 | Ga0307405_10670777 | Ga0307405_106707772 | 98 |
| 93 | 3300031824 | Ga0307413_10796499 | Ga0307413_107964992 | 98 |
| 94 | 3300031852 | Ga0307410_10075497 | Ga0307410_100754972 | 98 |
| 95 | 3300031903 | Ga0307407_10110079 | Ga0307407_101100792 | 98 |
| 96 | 3300032002 | Ga0307416_101316754 | Ga0307416_1013167542 | 98 |
| 97 | 3300032004 | Ga0307414_11120585 | Ga0307414_111205852 | 98 |
| 98 | 3300032005 | Ga0307411_10249788 | Ga0307411_102497883 | 98 |
| 99 | 3300033179 | Ga0307507_10364139 | Ga0307507_103641392 | 98 |
| 100 | 3300037418 | Ga0395900_0112550 | Ga0395900_0112550_2264_2569 | 98 |
| 101 | 3300037466 | Ga0395898_1245469 | Ga0395898_1245469_332_637 | 98 |
| 102 | 3300038443 | Ga0395901_0168656 | Ga0395901_0168656_1773_2078 | 98 |
| 103 | 3300044683 | Ga0466965_0445600 | Ga0466965_0445600_68_364 | 98 |
| 104 | 3300044765 | Ga0466970_0011803 | Ga0466970_0011803_1302_1598 | 98 |
| 105 | 3300044901 | Ga0466960_0034220 | Ga0466960_0034220_204_500 | 98 |
| 106 | 3300044901 | Ga0466960_0057513 | Ga0466960_0057513_1253_1549 | 98 |
| 107 | 3300046471 | Ga0495650_0247474 | Ga0495650_0247474_24_380 | 98 |
| 108 | 3300046500 | Ga0495596_0301742 | Ga0495596_0301742_146_442 | 98 |
| 109 | 3300048916 | Ga0496113_1277762 | Ga0496113_1277762_202_504 | 98 |
| 110 | 3300049537 | Ga0501321_013515 | Ga0501321_013515_617_913 | 98 |
| 111 | 3300049539 | Ga0501323_069105 | Ga0501323_069105_232_528 | 98 |
| 112 | 3300049583 | Ga0501067_0002751 | Ga0501067_0002751_3027_3332 | 98 |
| 113 | 3300049656 | Ga0501209_275243 | Ga0501209_275243_65_361 | 98 |
| 114 | 3300049823 | Ga0501044_0269519 | Ga0501044_0269519_90_389 | 98 |
| 115 | 3300050492 | nmdc:mga0yw44_258794_c1 | nmdc:mga0yw44_258794_c1_820_1116 | 98 |
| 116 | 3300053092 | Ga0500583_0592759 | Ga0500583_0592759_59_361 | 98 |
| 117 | 3300001979 | JGI24740J21852_10022956 | JGI24740J21852_100229562 | 99 |
| 118 | 3300001989 | JGI24739J22299_10003327 | JGI24739J22299_100033275 | 99 |
| 119 | 3300003792 | Ga0055540_1006159 | Ga0055540_10061593 | 99 |
| 120 | 3300005327 | Ga0070658_10001220 | Ga0070658_100012202 | 99 |
| 121 | 3300005331 | Ga0070670_100185181 | Ga0070670_1001851812 | 99 |
| 122 | 3300005336 | Ga0070680_100044480 | Ga0070680_1000444803 | 99 |
| 123 | 3300005336 | Ga0070680_100189218 | Ga0070680_1001892182 | 99 |
| 124 | 3300005339 | Ga0070660_101587937 | Ga0070660_1015879372 | 99 |
| 125 | 3300005344 | Ga0070661_100529820 | Ga0070661_1005298202 | 99 |
| 126 | 3300005344 | Ga0070661_100795196 | Ga0070661_1007951962 | 99 |
| 127 | 3300005345 | Ga0070692_11197061 | Ga0070692_111970612 | 99 |
| 128 | 3300005347 | Ga0070668_100137403 | Ga0070668_1001374032 | 99 |
| 129 | 3300005353 | Ga0070669_100000385 | Ga0070669_1000003858 | 99 |
| 130 | 3300005366 | Ga0070659_100477005 | Ga0070659_1004770051 | 99 |
| 131 | 3300005367 | Ga0070667_100001420 | Ga0070667_10000142023 | 99 |
| 132 | 3300005367 | Ga0070667_100105733 | Ga0070667_1001057332 | 99 |
| 133 | 3300005435 | Ga0070714_100008579 | Ga0070714_1000085794 | 99 |
| 134 | 3300005435 | Ga0070714_101296271 | Ga0070714_1012962711 | 99 |
| 135 | 3300005436 | Ga0070713_100557093 | Ga0070713_1005570931 | 99 |
| 136 | 3300005439 | Ga0070711_100071831 | Ga0070711_1000718313 | 99 |
| 137 | 3300005444 | Ga0070694_100461981 | Ga0070694_1004619812 | 99 |
| 138 | 3300005530 | Ga0070679_100069305 | Ga0070679_1000693054 | 99 |
| 139 | 3300005530 | Ga0070679_100306981 | Ga0070679_1003069814 | 99 |
| 140 | 3300005530 | Ga0070679_100916263 | Ga0070679_1009162631 | 99 |
| 141 | 3300005539 | Ga0068853_100866114 | Ga0068853_1008661142 | 99 |
| 142 | 3300005547 | Ga0070693_100598361 | Ga0070693_1005983613 | 99 |
| 143 | 3300005548 | Ga0070665_100023210 | Ga0070665_1000232103 | 99 |
| 144 | 3300005563 | Ga0068855_102535164 | Ga0068855_1025351642 | 99 |
| 145 | 3300005563 | Ga0068855_102612532 | Ga0068855_1026125321 | 99 |
| 146 | 3300005577 | Ga0068857_100164088 | Ga0068857_1001640882 | 99 |
| 147 | 3300005577 | Ga0068857_101543418 | Ga0068857_1015434182 | 99 |
| 148 | 3300005578 | Ga0068854_100992535 | Ga0068854_1009925352 | 99 |
| 149 | 3300005615 | Ga0070702_100320628 | Ga0070702_1003206283 | 99 |
| 150 | 3300005617 | Ga0068859_100004438 | Ga0068859_1000044384 | 99 |
| 151 | 3300005618 | Ga0068864_100339073 | Ga0068864_1003390732 | 99 |
| 152 | 3300005618 | Ga0068864_101946077 | Ga0068864_1019460772 | 99 |
| 153 | 3300005719 | Ga0068861_100313479 | Ga0068861_1003134793 | 99 |
| 154 | 3300005840 | Ga0068870_10582135 | Ga0068870_105821352 | 99 |
| 155 | 3300005841 | Ga0068863_100000875 | Ga0068863_1000008752 | 99 |
| 156 | 3300005842 | Ga0068858_100001397 | Ga0068858_10000139714 | 99 |
| 157 | 3300005842 | Ga0068858_100102378 | Ga0068858_1001023783 | 99 |
| 158 | 3300005843 | Ga0068860_100000155 | Ga0068860_10000015557 | 99 |
| 159 | 3300005844 | Ga0068862_100000096 | Ga0068862_10000009650 | 99 |
| 160 | 3300005844 | Ga0068862_100562684 | Ga0068862_1005626842 | 99 |
| 161 | 3300005937 | Ga0081455_10374434 | Ga0081455_103744342 | 99 |
| 162 | 3300006028 | Ga0070717_10247416 | Ga0070717_102474162 | 99 |
| 163 | 3300006038 | Ga0075365_10078992 | Ga0075365_100789922 | 99 |
| 164 | 3300006038 | Ga0075365_10263262 | Ga0075365_102632622 | 99 |
| 165 | 3300006038 | Ga0075365_10721452 | Ga0075365_107214522 | 99 |
| 166 | 3300006038 | Ga0075365_11212542 | Ga0075365_112125421 | 99 |
| 167 | 3300006048 | Ga0075363_100400475 | Ga0075363_1004004751 | 99 |
| 168 | 3300006048 | Ga0075363_100882697 | Ga0075363_1008826972 | 99 |
| 169 | 3300006051 | Ga0075364_10000623 | Ga0075364_1000062321 | 99 |
| 170 | 3300006051 | Ga0075364_10045041 | Ga0075364_100450414 | 99 |
| 171 | 3300006051 | Ga0075364_10722208 | Ga0075364_107222081 | 99 |
| 172 | 3300006058 | Ga0075432_10051021 | Ga0075432_100510213 | 99 |
| 173 | 3300006173 | Ga0070716_100252176 | Ga0070716_1002521762 | 99 |
| 174 | 3300006177 | Ga0075362_10026854 | Ga0075362_100268543 | 99 |
| 175 | 3300006186 | Ga0075369_10011839 | Ga0075369_100118394 | 99 |
| 176 | 3300006186 | Ga0075369_10559289 | Ga0075369_105592891 | 99 |
| 177 | 3300006844 | Ga0075428_100007534 | Ga0075428_1000075343 | 99 |
| 178 | 3300006846 | Ga0075430_100333854 | Ga0075430_1003338542 | 99 |
| 179 | 3300006880 | Ga0075429_100037044 | Ga0075429_1000370443 | 99 |
| 180 | 3300006880 | Ga0075429_101724296 | Ga0075429_1017242961 | 99 |
| 181 | 3300006931 | Ga0097620_100004438 | Ga0097620_1000044384 | 99 |
| 182 | 3300007788 | Ga0099795_10145970 | Ga0099795_101459702 | 99 |
| 183 | 3300009092 | Ga0105250_10273089 | Ga0105250_102730891 | 99 |
| 184 | 3300009094 | Ga0111539_10252091 | Ga0111539_102520913 | 99 |
| 185 | 3300009094 | Ga0111539_11057609 | Ga0111539_110576092 | 99 |
| 186 | 3300009101 | Ga0105247_10000040 | Ga0105247_10000040107 | 99 |
| 187 | 3300009101 | Ga0105247_10198586 | Ga0105247_101985863 | 99 |
| 188 | 3300009147 | Ga0114129_10014442 | Ga0114129_100144423 | 99 |
| 189 | 3300009174 | Ga0105241_11759835 | Ga0105241_117598352 | 99 |
| 190 | 3300009176 | Ga0105242_12772285 | Ga0105242_127722852 | 99 |
| 191 | 3300009177 | Ga0105248_10000095 | Ga0105248_1000009542 | 99 |
| 192 | 3300009177 | Ga0105248_11127203 | Ga0105248_111272032 | 99 |
| 193 | 3300009551 | Ga0105238_11472715 | Ga0105238_114727151 | 99 |
| 194 | 3300009553 | Ga0105249_10000069 | Ga0105249_1000006997 | 99 |
| 195 | 3300009553 | Ga0105249_10369745 | Ga0105249_103697451 | 99 |
| 196 | 3300009553 | Ga0105249_10662432 | Ga0105249_106624322 | 99 |
| 197 | 3300010375 | Ga0105239_10384647 | Ga0105239_103846472 | 99 |
| 198 | 3300011119 | Ga0105246_10106119 | Ga0105246_101061193 | 99 |
| 199 | 3300011119 | Ga0105246_10202399 | Ga0105246_102023992 | 99 |
| 200 | 3300013102 | Ga0157371_10895847 | Ga0157371_108958472 | 99 |
| 201 | 3300013296 | Ga0157374_11681296 | Ga0157374_116812962 | 99 |
| 202 | 3300013306 | Ga0163162_10058166 | Ga0163162_100581663 | 99 |
| 203 | 3300013306 | Ga0163162_10107517 | Ga0163162_101075173 | 99 |
| 204 | 3300013306 | Ga0163162_10245695 | Ga0163162_102456954 | 99 |
| 205 | 3300013307 | Ga0157372_10020934 | Ga0157372_100209345 | 99 |
| 206 | 3300013307 | Ga0157372_10890847 | Ga0157372_108908472 | 99 |
| 207 | 3300013307 | Ga0157372_13330451 | Ga0157372_133304512 | 99 |
| 208 | 3300014325 | Ga0163163_10162942 | Ga0163163_101629424 | 99 |
| 209 | 3300014325 | Ga0163163_12631508 | Ga0163163_126315082 | 99 |
| 210 | 3300014745 | Ga0157377_10987995 | Ga0157377_109879952 | 99 |
| 211 | 3300014745 | Ga0157377_11581162 | Ga0157377_115811622 | 99 |
| 212 | 3300014968 | Ga0157379_10052071 | Ga0157379_100520713 | 99 |
| 213 | 3300017792 | Ga0163161_10800558 | Ga0163161_108005582 | 99 |
| 214 | 3300022467 | Ga0224712_10669270 | Ga0224712_106692701 | 99 |
| 215 | 3300025303 | Ga0209051_1001832 | Ga0209051_100183214 | 99 |
| 216 | 3300025711 | Ga0207696_1039139 | Ga0207696_10391393 | 99 |
| 217 | 3300025900 | Ga0207710_10000050 | Ga0207710_10000050137 | 99 |
| 218 | 3300025900 | Ga0207710_10308398 | Ga0207710_103083982 | 99 |
| 219 | 3300025901 | Ga0207688_10357750 | Ga0207688_103577502 | 99 |
| 220 | 3300025904 | Ga0207647_10011411 | Ga0207647_100114112 | 99 |
| 221 | 3300025908 | Ga0207643_10440356 | Ga0207643_104403562 | 99 |
| 222 | 3300025909 | Ga0207705_10000715 | Ga0207705_1000071519 | 99 |
| 223 | 3300025917 | Ga0207660_10146094 | Ga0207660_101460942 | 99 |
| 224 | 3300025917 | Ga0207660_10256024 | Ga0207660_102560241 | 99 |
| 225 | 3300025920 | Ga0207649_10587242 | Ga0207649_105872422 | 99 |
| 226 | 3300025921 | Ga0207652_10244523 | Ga0207652_102445233 | 99 |
| 227 | 3300025921 | Ga0207652_10841944 | Ga0207652_108419441 | 99 |
| 228 | 3300025921 | Ga0207652_11190184 | Ga0207652_111901842 | 99 |
| 229 | 3300025923 | Ga0207681_10001659 | Ga0207681_1000165916 | 99 |
| 230 | 3300025926 | Ga0207659_10698254 | Ga0207659_106982542 | 99 |
| 231 | 3300025929 | Ga0207664_10003184 | Ga0207664_100031846 | 99 |
| 232 | 3300025931 | Ga0207644_10724531 | Ga0207644_107245312 | 99 |
| 233 | 3300025933 | Ga0207706_10312210 | Ga0207706_103122102 | 99 |
| 234 | 3300025941 | Ga0207711_10000082 | Ga0207711_1000008242 | 99 |
| 235 | 3300025941 | Ga0207711_11240593 | Ga0207711_112405932 | 99 |
| 236 | 3300025961 | Ga0207712_10000084 | Ga0207712_1000008496 | 99 |
| 237 | 3300025972 | Ga0207668_10013947 | Ga0207668_100139475 | 99 |
| 238 | 3300025972 | Ga0207668_10374424 | Ga0207668_103744242 | 99 |
| 239 | 3300025986 | Ga0207658_10494602 | Ga0207658_104946022 | 99 |
| 240 | 3300025986 | Ga0207658_10510067 | Ga0207658_105100672 | 99 |
| 241 | 3300025986 | Ga0207658_10543236 | Ga0207658_105432361 | 99 |
| 242 | 3300025986 | Ga0207658_10905426 | Ga0207658_109054262 | 99 |
| 243 | 3300026023 | Ga0207677_10976288 | Ga0207677_109762882 | 99 |
| 244 | 3300026035 | Ga0207703_10004642 | Ga0207703_1000464213 | 99 |
| 245 | 3300026035 | Ga0207703_10345212 | Ga0207703_103452123 | 99 |
| 246 | 3300026041 | Ga0207639_10541402 | Ga0207639_105414021 | 99 |
| 247 | 3300026067 | Ga0207678_10034315 | Ga0207678_100343157 | 99 |
| 248 | 3300026067 | Ga0207678_10539976 | Ga0207678_105399762 | 99 |
| 249 | 3300026078 | Ga0207702_10411638 | Ga0207702_104116382 | 99 |
| 250 | 3300026088 | Ga0207641_10485820 | Ga0207641_104858202 | 99 |
| 251 | 3300026095 | Ga0207676_10223248 | Ga0207676_102232484 | 99 |
| 252 | 3300026095 | Ga0207676_10603944 | Ga0207676_106039443 | 99 |
| 253 | 3300026116 | Ga0207674_10015985 | Ga0207674_100159857 | 99 |
| 254 | 3300026116 | Ga0207674_11432395 | Ga0207674_114323952 | 99 |
| 255 | 3300026121 | Ga0207683_11607208 | Ga0207683_116072082 | 99 |
| 256 | 3300027907 | Ga0207428_10869881 | Ga0207428_108698812 | 99 |
| 257 | 3300028379 | Ga0268266_10009054 | Ga0268266_100090547 | 99 |
| 258 | 3300028379 | Ga0268266_11064510 | Ga0268266_110645102 | 99 |
| 259 | 3300028380 | Ga0268265_10000106 | Ga0268265_1000010651 | 99 |
| 260 | 3300028380 | Ga0268265_11002632 | Ga0268265_110026321 | 99 |
| 261 | 3300028381 | Ga0268264_10000219 | Ga0268264_1000021956 | 99 |
| 262 | 3300028786 | Ga0307517_10176748 | Ga0307517_101767483 | 99 |
| 263 | 3300028794 | Ga0307515_10680408 | Ga0307515_106804082 | 99 |
| 264 | 3300031456 | Ga0307513_10058236 | Ga0307513_100582363 | 99 |
| 265 | 3300031456 | Ga0307513_10404494 | Ga0307513_104044942 | 99 |
| 266 | 3300031731 | Ga0307405_10855969 | Ga0307405_108559692 | 99 |
| 267 | 3300031838 | Ga0307518_10477780 | Ga0307518_104777802 | 99 |
| 268 | 3300031852 | Ga0307410_10491713 | Ga0307410_104917133 | 99 |
| 269 | 3300031903 | Ga0307407_10700625 | Ga0307407_107006252 | 99 |
| 270 | 3300031995 | Ga0307409_100876252 | Ga0307409_1008762522 | 99 |
| 271 | 3300032002 | Ga0307416_102890969 | Ga0307416_1028909691 | 99 |
| 272 | 3300034820 | Ga0373959_0150933 | Ga0373959_0150933_231_530 | 99 |
| 273 | 3300035692 | Ga0373935_1082712 | Ga0373935_1082712_215_514 | 99 |
| 274 | 3300035725 | Ga0373947_0070965 | Ga0373947_0070965_1474_1773 | 99 |
| 275 | 3300037068 | Ga0373925_1377662 | Ga0373925_1377662_108_407 | 99 |
| 276 | 3300037471 | Ga0395905_0041054 | Ga0395905_0041054_2952_3251 | 99 |
| 277 | 3300037471 | Ga0395905_1724652 | Ga0395905_1724652_179_478 | 99 |
| 278 | 3300039437 | Ga0436365_1589794 | Ga0436365_1589794_208_507 | 99 |
| 279 | 3300041405 | Ga0439438_022064 | Ga0439438_022064_783_1082 | 99 |
| 280 | 3300041407 | Ga0439447_061134 | Ga0439447_061134_221_520 | 99 |
| 281 | 3300041410 | Ga0439461_0018265 | Ga0439461_0018265_907_1206 | 99 |
| 282 | 3300041411 | Ga0439466_0021513 | Ga0439466_0021513_80_379 | 99 |
| 283 | 3300041413 | Ga0439465_0002086 | Ga0439465_0002086_3752_4051 | 99 |
| 284 | 3300041413 | Ga0439465_0077921 | Ga0439465_0077921_616_915 | 99 |
| 285 | 3300041441 | Ga0451787_241977 | Ga0451787_241977_217_516 | 99 |
| 286 | 3300041452 | Ga0451793_0950694 | Ga0451793_0950694_107_406 | 99 |
| 287 | 3300041491 | Ga0451833_1058440 | Ga0451833_1058440_56_355 | 99 |
| 288 | 3300041492 | Ga0451835_1064600 | Ga0451835_1064600_167_466 | 99 |
| 289 | 3300041496 | Ga0451839_0415585 | Ga0451839_0415585_183_488 | 99 |
| 290 | 3300041997 | Ga0439431_0086151 | Ga0439431_0086151_43_342 | 99 |
| 291 | 3300042004 | Ga0439445_0006023 | Ga0439445_0006023_1919_2218 | 99 |
| 292 | 3300042004 | Ga0439445_0023874 | Ga0439445_0023874_679_978 | 99 |
| 293 | 3300042007 | Ga0439449_0075728 | Ga0439449_0075728_321_620 | 99 |
| 294 | 3300042011 | Ga0439454_057090 | Ga0439454_057090_225_524 | 99 |
| 295 | 3300042156 | Ga0439446_0051695 | Ga0439446_0051695_344_643 | 99 |
| 296 | 3300042435 | Ga0439434_0025290 | Ga0439434_0025290_1249_1548 | 99 |
| 297 | 3300042435 | Ga0439434_0036387 | Ga0439434_0036387_802_1101 | 99 |
| 298 | 3300044658 | Ga0466972_0003645 | Ga0466972_0003645_1084_1383 | 99 |
| 299 | 3300044658 | Ga0466972_0101661 | Ga0466972_0101661_997_1296 | 99 |
| 300 | 3300044684 | Ga0466966_0800312 | Ga0466966_0800312_76_375 | 99 |
| 301 | 3300044765 | Ga0466970_0002177 | Ga0466970_0002177_8022_8321 | 99 |
| 302 | 3300044765 | Ga0466970_0104909 | Ga0466970_0104909_594_893 | 99 |
| 303 | 3300044765 | Ga0466970_0377232 | Ga0466970_0377232_60_359 | 99 |
| 304 | 3300044765 | Ga0466970_0445823 | Ga0466970_0445823_254_553 | 99 |
| 305 | 3300044901 | Ga0466960_0256257 | Ga0466960_0256257_71_370 | 99 |
| 306 | 3300045976 | Ga0466967_1584865 | Ga0466967_1584865_62_361 | 99 |
| 307 | 3300046453 | Ga0495627_011933 | Ga0495627_011933_880_1179 | 99 |
| 308 | 3300046455 | Ga0495603_0687161 | Ga0495603_0687161_234_533 | 99 |
| 309 | 3300046459 | Ga0495629_0623144 | Ga0495629_0623144_95_394 | 99 |
| 310 | 3300046460 | Ga0495638_0376968 | Ga0495638_0376968_206_505 | 99 |
| 311 | 3300046461 | Ga0495641_0396649 | Ga0495641_0396649_303_602 | 99 |
| 312 | 3300046474 | Ga0495605_0445623 | Ga0495605_0445623_80_379 | 99 |
| 313 | 3300046476 | Ga0495662_0123938 | Ga0495662_0123938_926_1225 | 99 |
| 314 | 3300046492 | Ga0495585_0262527 | Ga0495585_0262527_169_468 | 99 |
| 315 | 3300046499 | Ga0495594_0088479 | Ga0495594_0088479_1403_1702 | 99 |
| 316 | 3300046533 | Ga0495640_0017541 | Ga0495640_0017541_2867_3166 | 99 |
| 317 | 3300046660 | Ga0495625_0457250 | Ga0495625_0457250_199_498 | 99 |
| 318 | 3300046674 | Ga0495588_0459508 | Ga0495588_0459508_99_398 | 99 |
| 319 | 3300046680 | Ga0495646_0218973 | Ga0495646_0218973_544_843 | 99 |
| 320 | 3300046681 | Ga0495647_0480738 | Ga0495647_0480738_55_354 | 99 |
| 321 | 3300046683 | Ga0495658_0029885 | Ga0495658_0029885_903_1202 | 99 |
| 322 | 3300046690 | Ga0495624_0246397 | Ga0495624_0246397_400_699 | 99 |
| 323 | 3300046694 | Ga0495649_0393528 | Ga0495649_0393528_372_671 | 99 |
| 324 | 3300047315 | Ga0495581_0059143 | Ga0495581_0059143_154_453 | 99 |
| 325 | 3300047317 | Ga0495604_0466634 | Ga0495604_0466634_195_494 | 99 |
| 326 | 3300047321 | Ga0495676_0664493 | Ga0495676_0664493_366_665 | 99 |
| 327 | 3300047446 | Ga0495679_104797 | Ga0495679_104797_334_633 | 99 |
| 328 | 3300047673 | Ga0495593_0004463 | Ga0495593_0004463_7523_7822 | 99 |
| 329 | 3300048089 | Ga0495614_0556400 | Ga0495614_0556400_97_396 | 99 |
| 330 | 3300048903 | Ga0496100_0135239 | Ga0496100_0135239_36_335 | 99 |
| 331 | 3300048904 | Ga0496101_0003023 | Ga0496101_0003023_1216_1515 | 99 |
| 332 | 3300048905 | Ga0496102_0000206 | Ga0496102_0000206_56909_57208 | 99 |
| 333 | 3300048905 | Ga0496102_0033812 | Ga0496102_0033812_2612_2911 | 99 |
| 334 | 3300048905 | Ga0496102_0093803 | Ga0496102_0093803_1701_2000 | 99 |
| 335 | 3300048905 | Ga0496102_1377458 | Ga0496102_1377458_103_402 | 99 |
| 336 | 3300048905 | Ga0496102_1785021 | Ga0496102_1785021_94_393 | 99 |
| 337 | 3300048906 | Ga0496103_0000486 | Ga0496103_0000486_12797_13096 | 99 |
| 338 | 3300048907 | Ga0496104_0121590 | Ga0496104_0121590_1878_2177 | 99 |
| 339 | 3300048908 | Ga0496105_1346488 | Ga0496105_1346488_142_441 | 99 |
| 340 | 3300048909 | Ga0496106_0250463 | Ga0496106_0250463_943_1242 | 99 |
| 341 | 3300048910 | Ga0496107_0059620 | Ga0496107_0059620_820_1119 | 99 |
| 342 | 3300048910 | Ga0496107_0159529 | Ga0496107_0159529_309_608 | 99 |
| 343 | 3300048911 | Ga0496108_0214377 | Ga0496108_0214377_663_962 | 99 |
| 344 | 3300048911 | Ga0496108_1438891 | Ga0496108_1438891_124_423 | 99 |
| 345 | 3300048911 | Ga0496108_1663443 | Ga0496108_1663443_101_400 | 99 |
| 346 | 3300048912 | Ga0496109_0940352 | Ga0496109_0940352_371_670 | 99 |
| 347 | 3300048912 | Ga0496109_1140962 | Ga0496109_1140962_384_683 | 99 |
| 348 | 3300048913 | Ga0496110_0176790 | Ga0496110_0176790_1334_1633 | 99 |
| 349 | 3300048913 | Ga0496110_0527135 | Ga0496110_0527135_318_617 | 99 |
| 350 | 3300048914 | Ga0496111_0467474 | Ga0496111_0467474_114_413 | 99 |
| 351 | 3300048915 | Ga0496112_0102633 | Ga0496112_0102633_457_756 | 99 |
| 352 | 3300048915 | Ga0496112_0358998 | Ga0496112_0358998_384_683 | 99 |
| 353 | 3300048916 | Ga0496113_0014696 | Ga0496113_0014696_4580_4879 | 99 |
| 354 | 3300048916 | Ga0496113_0108272 | Ga0496113_0108272_166_465 | 99 |
| 355 | 3300048916 | Ga0496113_0676422 | Ga0496113_0676422_71_370 | 99 |
| 356 | 3300048919 | Ga0496116_0061031 | Ga0496116_0061031_810_1109 | 99 |
| 357 | 3300048920 | Ga0496117_0000687 | Ga0496117_0000687_42110_42409 | 99 |
| 358 | 3300048921 | Ga0496118_0000962 | Ga0496118_0000962_11485_11784 | 99 |
| 359 | 3300048922 | Ga0496119_0007672 | Ga0496119_0007672_1418_1717 | 99 |
| 360 | 3300048922 | Ga0496119_0301432 | Ga0496119_0301432_30_329 | 99 |
| 361 | 3300048923 | Ga0496120_0023454 | Ga0496120_0023454_3021_3320 | 99 |
| 362 | 3300048923 | Ga0496120_0056946 | Ga0496120_0056946_814_1113 | 99 |
| 363 | 3300048923 | Ga0496120_0431138 | Ga0496120_0431138_42_341 | 99 |
| 364 | 3300048924 | Ga0496121_0006530 | Ga0496121_0006530_11476_11775 | 99 |
| 365 | 3300048925 | Ga0496122_0075209 | Ga0496122_0075209_228_527 | 99 |
| 366 | 3300048926 | Ga0496123_0170728 | Ga0496123_0170728_621_920 | 99 |
| 367 | 3300048927 | Ga0496124_0156205 | Ga0496124_0156205_628_927 | 99 |
| 368 | 3300048928 | Ga0496125_0032958 | Ga0496125_0032958_383_682 | 99 |
| 369 | 3300048929 | Ga0496126_0009782 | Ga0496126_0009782_4615_4914 | 99 |
| 370 | 3300048929 | Ga0496126_0011590 | Ga0496126_0011590_4634_4933 | 99 |
| 371 | 3300049584 | Ga0501068_0320386 | Ga0501068_0320386_382_681 | 99 |
| 372 | 3300049586 | Ga0501070_0027272 | Ga0501070_0027272_509_820 | 99 |
| 373 | 3300049586 | Ga0501070_0620031 | Ga0501070_0620031_513_812 | 99 |
| 374 | 3300049588 | Ga0501072_0185372 | Ga0501072_0185372_85_396 | 99 |
| 375 | 3300049742 | Ga0501080_0103663 | Ga0501080_0103663_1234_1545 | 99 |
| 376 | 3300050489 | nmdc:mga03683_12548_c1 | nmdc:mga03683_12548_c1_385_684 | 99 |
| 377 | 3300050490 | nmdc:mga03n38_260315_c1 | nmdc:mga03n38_260315_c1_196_495 | 99 |
| 378 | 3300050490 | nmdc:mga03n38_32166_c1 | nmdc:mga03n38_32166_c1_1760_2059 | 99 |
| 379 | 3300050491 | nmdc:mga00v17_3188_c1 | nmdc:mga00v17_3188_c1_7291_7590 | 99 |
| 380 | 3300050491 | nmdc:mga00v17_4806_c2 | nmdc:mga00v17_4806_c2_1643_1942 | 99 |
| 381 | 3300050492 | nmdc:mga0yw44_19214_c1 | nmdc:mga0yw44_19214_c1_635_934 | 99 |
| 382 | 3300050492 | nmdc:mga0yw44_232313_c1 | nmdc:mga0yw44_232313_c1_163_462 | 99 |
| 383 | 3300050492 | nmdc:mga0yw44_638105_c1 | nmdc:mga0yw44_638105_c1_167_466 | 99 |
| 384 | 3300050494 | nmdc:mga06z11_984468_c1 | nmdc:mga06z11_984468_c1_191_490 | 99 |
| 385 | 3300050507 | nmdc:mga05p37_92997_c1 | nmdc:mga05p37_92997_c1_964_1263 | 99 |
| 386 | 3300050508 | nmdc:mga09592_35250_c1 | nmdc:mga09592_35250_c1_2437_2736 | 99 |
| 387 | 3300050509 | nmdc:mga0qj67_64299_c1 | nmdc:mga0qj67_64299_c1_517_816 | 99 |
| 388 | 3300050511 | nmdc:mga08y16_778750_c1 | nmdc:mga08y16_778750_c1_167_466 | 99 |
| 389 | 3300050516 | nmdc:mga0sz30_1178_c1 | nmdc:mga0sz30_1178_c1_1780_2079 | 99 |
| 390 | 3300050516 | nmdc:mga0sz30_5326_c1 | nmdc:mga0sz30_5326_c1_2787_3086 | 99 |
| 391 | 3300050516 | nmdc:mga0sz30_65544_c1 | nmdc:mga0sz30_65544_c1_1244_1543 | 99 |
| 392 | 3300053083 | Ga0495655_0100571 | Ga0495655_0100571_175_474 | 99 |
| 393 | 3300053083 | Ga0495655_0159684 | Ga0495655_0159684_112_411 | 99 |
| 394 | 3300053085 | Ga0495619_0224692 | Ga0495619_0224692_340_639 | 99 |
| 395 | 3300053087 | Ga0500643_133200 | Ga0500643_133200_19_318 | 99 |
| 396 | 3300053090 | Ga0500646_0151200 | Ga0500646_0151200_187_486 | 99 |
| 397 | 3300053099 | Ga0500654_097640 | Ga0500654_097640_214_513 | 99 |
| 398 | 3300053155 | Ga0500620_089868 | Ga0500620_089868_439_738 | 99 |
| 399 | 3300061734 | Ga0530510_1079887 | Ga0530510_1079887_139_438 | 99 |
| 400 | 3300003792 | Ga0055540_1001669 | Ga0055540_100166915 | 100 |
| 401 | 3300005329 | Ga0070683_101325776 | Ga0070683_1013257762 | 100 |
| 402 | 3300005535 | Ga0070684_100366773 | Ga0070684_1003667731 | 100 |
| 403 | 3300006051 | Ga0075364_10201234 | Ga0075364_102012343 | 100 |
| 404 | 3300006186 | Ga0075369_10033429 | Ga0075369_100334292 | 100 |
| 405 | 3300006847 | Ga0075431_100268074 | Ga0075431_1002680743 | 100 |
| 406 | 3300006881 | Ga0068865_100839032 | Ga0068865_1008390322 | 100 |
| 407 | 3300009098 | Ga0105245_10010824 | Ga0105245_100108242 | 100 |
| 408 | 3300009148 | Ga0105243_10232686 | Ga0105243_102326862 | 100 |
| 409 | 3300009176 | Ga0105242_10463644 | Ga0105242_104636442 | 100 |
| 410 | 3300009177 | Ga0105248_10341888 | Ga0105248_103418882 | 100 |
| 411 | 3300009553 | Ga0105249_10486266 | Ga0105249_104862662 | 100 |
| 412 | 3300010159 | Ga0099796_10148609 | Ga0099796_101486093 | 100 |
| 413 | 3300013306 | Ga0163162_11364635 | Ga0163162_113646351 | 100 |
| 414 | 3300013308 | Ga0157375_10105214 | Ga0157375_101052142 | 100 |
| 415 | 3300013308 | Ga0157375_10421408 | Ga0157375_104214082 | 100 |
| 416 | 3300014326 | Ga0157380_10566646 | Ga0157380_105666462 | 100 |
| 417 | 3300025303 | Ga0209051_1007207 | Ga0209051_10072078 | 100 |
| 418 | 3300025901 | Ga0207688_10576403 | Ga0207688_105764032 | 100 |
| 419 | 3300025924 | Ga0207694_10367426 | Ga0207694_103674262 | 100 |
| 420 | 3300025927 | Ga0207687_10171216 | Ga0207687_101712162 | 100 |
| 421 | 3300025935 | Ga0207709_11252539 | Ga0207709_112525391 | 100 |
| 422 | 3300025941 | Ga0207711_11265953 | Ga0207711_112659531 | 100 |
| 423 | 3300025944 | Ga0207661_11297013 | Ga0207661_112970132 | 100 |
| 424 | 3300028379 | Ga0268266_10146468 | Ga0268266_101464682 | 100 |
| 425 | 3300030733 | Ga0314311_1166733 | Ga0314311_11667331 | 100 |
| 426 | 3300030745 | Ga0316182_1344466 | Ga0316182_13444662 | 100 |
| 427 | 3300031824 | Ga0307413_10000116 | Ga0307413_100001166 | 100 |
| 428 | 3300048913 | Ga0496110_0492306 | Ga0496110_0492306_287_589 | 100 |
| 429 | 3300049585 | Ga0501069_0348943 | Ga0501069_0348943_213_515 | 100 |
| 430 | 3300049587 | Ga0501071_1331188 | Ga0501071_1331188_81_383 | 100 |
| 431 | 3300049589 | Ga0501073_0210136 | Ga0501073_0210136_648_950 | 100 |
| 432 | 3300050510 | nmdc:mga06r32_2125_c1 | nmdc:mga06r32_2125_c1_5304_5615 | 100 |
| 433 | 3300000546 | LJNas_1022113 | LJNas_10221131 | 101 |
| 434 | 3300005327 | Ga0070658_10719487 | Ga0070658_107194872 | 101 |
| 435 | 3300005329 | Ga0070683_100760934 | Ga0070683_1007609342 | 101 |
| 436 | 3300005336 | Ga0070680_100637227 | Ga0070680_1006372272 | 101 |
| 437 | 3300005339 | Ga0070660_100102751 | Ga0070660_1001027514 | 101 |
| 438 | 3300005339 | Ga0070660_100789024 | Ga0070660_1007890241 | 101 |
| 439 | 3300005347 | Ga0070668_100688026 | Ga0070668_1006880261 | 101 |
| 440 | 3300005435 | Ga0070714_100043352 | Ga0070714_1000433521 | 101 |
| 441 | 3300005455 | Ga0070663_102086920 | Ga0070663_1020869201 | 101 |
| 442 | 3300005458 | Ga0070681_11230669 | Ga0070681_112306692 | 101 |
| 443 | 3300005458 | Ga0070681_11779556 | Ga0070681_117795561 | 101 |
| 444 | 3300005530 | Ga0070679_100293958 | Ga0070679_1002939582 | 101 |
| 445 | 3300005530 | Ga0070679_101343625 | Ga0070679_1013436251 | 101 |
| 446 | 3300005577 | Ga0068857_100107275 | Ga0068857_1001072752 | 101 |
| 447 | 3300006051 | Ga0075364_11062969 | Ga0075364_110629691 | 101 |
| 448 | 3300009101 | Ga0105247_10863720 | Ga0105247_108637202 | 101 |
| 449 | 3300013104 | Ga0157370_11289286 | Ga0157370_112892862 | 101 |
| 450 | 3300013307 | Ga0157372_12387410 | Ga0157372_123874102 | 101 |
| 451 | 3300013307 | Ga0157372_12599117 | Ga0157372_125991172 | 101 |
| 452 | 3300014325 | Ga0163163_12730676 | Ga0163163_127306761 | 101 |
| 453 | 3300020069 | Ga0197907_10232301 | Ga0197907_102323012 | 101 |
| 454 | 3300020080 | Ga0206350_11431413 | Ga0206350_114314132 | 101 |
| 455 | 3300025912 | Ga0207707_11061415 | Ga0207707_110614152 | 101 |
| 456 | 3300025912 | Ga0207707_11490794 | Ga0207707_114907941 | 101 |
| 457 | 3300025917 | Ga0207660_10085393 | Ga0207660_100853933 | 101 |
| 458 | 3300025919 | Ga0207657_10289403 | Ga0207657_102894032 | 101 |
| 459 | 3300025929 | Ga0207664_11305840 | Ga0207664_113058402 | 101 |
| 460 | 3300026116 | Ga0207674_10151248 | Ga0207674_101512483 | 101 |
| 461 | 3300031548 | Ga0307408_100480345 | Ga0307408_1004803452 | 101 |
| 462 | 3300041441 | Ga0451787_056670 | Ga0451787_056670_164_469 | 101 |
| 463 | 3300044658 | Ga0466972_0028632 | Ga0466972_0028632_2188_2499 | 101 |
| 464 | 3300044683 | Ga0466965_0000485 | Ga0466965_0000485_8029_8334 | 101 |
| 465 | 3300044694 | Ga0466963_0510980 | Ga0466963_0510980_79_408 | 101 |
| 466 | 3300044706 | Ga0466964_0055279 | Ga0466964_0055279_622_933 | 101 |
| 467 | 3300044719 | Ga0466971_0098722 | Ga0466971_0098722_717_1028 | 101 |
| 468 | 3300044765 | Ga0466970_0192526 | Ga0466970_0192526_118_429 | 101 |
| 469 | 3300044842 | Ga0466957_0434314 | Ga0466957_0434314_14_325 | 101 |
| 470 | 3300045976 | Ga0466967_0007567 | Ga0466967_0007567_2546_2857 | 101 |
| 471 | 3300045976 | Ga0466967_0289103 | Ga0466967_0289103_965_1294 | 101 |
| 472 | 3300045976 | Ga0466967_0964753 | Ga0466967_0964753_267_596 | 101 |
| 473 | 3300046692 | Ga0495671_0334653 | Ga0495671_0334653_366_680 | 101 |
| 474 | 3300048908 | Ga0496105_0210709 | Ga0496105_0210709_1119_1424 | 101 |
| 475 | 3300048917 | Ga0496114_0740379 | Ga0496114_0740379_207_512 | 101 |
| 476 | 3300048929 | Ga0496126_0533444 | Ga0496126_0533444_270_575 | 101 |
| 477 | 3300049568 | Ga0501031_0632012 | Ga0501031_0632012_176_484 | 101 |
| 478 | 3300049575 | Ga0501039_0521498 | Ga0501039_0521498_132_440 | 101 |
| 479 | 3300049576 | Ga0501040_0043732 | Ga0501040_0043732_1822_2130 | 101 |
| 480 | 3300049577 | Ga0501041_0717498 | Ga0501041_0717498_304_612 | 101 |
| 481 | 3300049582 | Ga0501048_0136466 | Ga0501048_0136466_792_1100 | 101 |
| 482 | 3300049585 | Ga0501069_0521061 | Ga0501069_0521061_12_320 | 101 |
| 483 | 3300049592 | Ga0501076_0247391 | Ga0501076_0247391_628_933 | 101 |
| 484 | 3300049592 | Ga0501076_0571534 | Ga0501076_0571534_503_811 | 101 |
| 485 | 3300049741 | Ga0501079_0396275 | Ga0501079_0396275_686_994 | 101 |
| 486 | 3300061719 | Ga0466962_0038897 | Ga0466962_0038897_38_349 | 101 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1sbr-assembly1.cif.gz_B | the structure and function of b. subtilis ykof gene product: the complex with thiamin | 0.9118 | 2 | 74 |
| 1sbr-assembly1.cif.gz_A | the structure and function of b. subtilis ykof gene product: the complex with thiamin | 0.9089 | 2 | 74 |
| 1s7h-assembly2.cif.gz_D | structural genomics, 2.2a crystal structure of protein ykof from bacillus subtilis | 0.9077 | 2 | 74 |
| 1s99-assembly1.cif.gz_B | the structure and function of b. subtilis ykof gene product: ligand free protein | 0.9048 | 2 | 74 |
| 1s7h-assembly1.cif.gz_B | structural genomics, 2.2a crystal structure of protein ykof from bacillus subtilis | 0.904 | 2 | 74 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WFQ1_1_102_3.30.70.930 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9099 | 2 | 101 | 3.30.70.930 |
| 2ekyH00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.8951 | 2 | 93 | 3.30.70.930 |
| af_Q2FY28_1_104_3.30.70.930 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.8918 | 2 | 97 | 3.30.70.930 |
| af_P9WFQ1_1_102_3.30.70.930 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.8841 | 2 | 101 | 3.30.70.930 |
| 1lxnD00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.8611 | 1 | 96 | 3.30.70.930 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4D4N107-F1-model_v4 | Thiamine-binding protein domain-containing protein | 0.9794 | 19 | 97 |
GO:0005829
|
| AF-A0A542ZDC0-F1-model_v4 | Uncharacterized protein (TIGR00106 family) | 0.9718 | 2 | 97 |
GO:0005829
|
| AF-A0A7V8VAB3-F1-model_v4 | Thiamine-binding protein domain-containing protein | 0.9681 | 19 | 96 |
GO:0005829
|
| AF-G7CDI6-F1-model_v4 | Thiamine-binding protein domain-containing protein | 0.968 | 2 | 99 |
GO:0005829
|
| AF-A0A7W5A8K6-F1-model_v4 | Uncharacterized protein (TIGR00106 family) | 0.9676 | 1 | 98 |
GO:0005829
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar