F452920
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 484 | 336 | 444 | 121 |
Family's Representative Sequence
| Representative Sequence | 3300009094|Ga0111539_10129178|Ga0111539_101291782 |
| Length | 134 |
| Sequence | VVQIRGIRMANIGYTKDHEWIRVDGDTGTVGISNYAQAQLGDVVYIELPAIGKAIGKGQEVAVVESVKAASEVYAPMAGEVIAVNSELEGAPAKVNEDAEGGGWFLKLRLANAAEFADLMNEEQYKAFLQTIDQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886006 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 | Metagenome | Rhizosphere |
| 2 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 3 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 4 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 5 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 6 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 7 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 8 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 9 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 10 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 11 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 12 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 13 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 14 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 15 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 16 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 17 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 18 | 2738543031 | Pleomorphomonas sp. CF100 | Isolate | Unclassified |
| 19 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 20 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 21 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 22 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 23 | 2837651117 | Pseudohoeflea suaedae YC6898 | Isolate | Unclassified |
| 24 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 25 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 26 | 2842333319 | Skermanella aerolata SEMIA 4010 | Isolate | Nodule |
| 27 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 28 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 29 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 30 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 31 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 32 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 33 | 2891088606 | Methylosinus sp. 3S-1 | Isolate | Rhizosphere |
| 34 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 35 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 36 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 37 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 38 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 39 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 40 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 41 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 42 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 43 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 44 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 45 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 46 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 47 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 48 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 49 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 50 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 51 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 52 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 53 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 56 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 58 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 72 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 73 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 75 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 76 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 77 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 78 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 81 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 82 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 83 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 84 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 85 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 86 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 87 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 88 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 89 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 91 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 93 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 94 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 95 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 96 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 97 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 98 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 100 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 116 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 118 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 119 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 120 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 121 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 126 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 127 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 128 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 130 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 162 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 166 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 167 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 168 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 169 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 170 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 171 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 172 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 173 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 174 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 175 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 176 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 177 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 178 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 179 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 180 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 181 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 182 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 183 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 184 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 185 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 186 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 187 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 188 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 189 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 190 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 191 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 192 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 193 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 194 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 195 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 196 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 197 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 198 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 199 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 200 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 201 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 202 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 203 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 204 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 205 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 206 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 207 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 208 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 209 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 210 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 211 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 212 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 213 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 214 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 215 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 216 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 217 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 218 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 219 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 220 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 221 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 244 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 245 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 246 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 247 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 248 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 249 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 250 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 251 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 252 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 253 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 254 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 255 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 256 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 257 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 258 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 259 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 260 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 261 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 262 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 263 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 264 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 265 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 266 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 267 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 268 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 269 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 270 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 283 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 284 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 304 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 305 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 306 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 307 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 308 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 310 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 311 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 312 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 313 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 314 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 315 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 316 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 317 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 318 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 319 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 320 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 321 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 322 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 323 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 324 | 3300059659 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 325 | 3300060247 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 61R_AD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 326 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 327 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 328 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 329 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 330 | 8002060224 | Methylocystis sp. Sn-Cys | Isolate | Unclassified |
| 331 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 332 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 333 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 334 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 335 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 336 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 87.4 |
| Metatranscriptomes | 4.13 |
| Isolates | 8.47 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.02 |
| Nodule | 3.1 |
| Rhizoplane | 9.5 |
| Rhizosphere | 68.18 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.19 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL3b_contig_1929186 | 2162886006 | Bacteria | 1118 |
| 2 | JGI24740J21852_10000493 | 3300001979 | Bacteria | 16930 |
| 3 | JGI25155J39150_1000215 | 3300002704 | Bacteria | 23334 |
| 4 | JGI25156J39149_1000491 | 3300002705 | Bacteria | 23712 |
| 5 | JGI25162J39368_1002390 | 3300002737 | Bacteria | 7381 |
| 6 | JGI25162J39368_1002612 | 3300002737 | Bacteria | 6743 |
| 7 | JGI25154J39366_1000407 | 3300002738 | Bacteria | 23364 |
| 8 | JGI25157J39369_1000515 | 3300002741 | Bacteria | 23712 |
| 9 | JGI25159J45721_1000220 | 3300002987 | Bacteria | 26975 |
| 10 | JGI25165J46597_1002236 | 3300003214 | Bacteria | 6742 |
| 11 | JGI25165J46597_1002365 | 3300003214 | Bacteria | 6313 |
| 12 | JGI25165J46597_1005170 | 3300003214 | Bacteria | 2580 |
| 13 | JGI25165J46597_1011613 | 3300003214 | Bacteria | 1254 |
| 14 | rootH1_10094521 | 3300003316 | Bacteria | 1112 |
| 15 | rootL2_10057180 | 3300003322 | Bacteria | 2012 |
| 16 | rootH1_10125481 | 3300003316 | Bacteria | 1680 |
| 17 | rootH1_10125481 | 3300003323 | Bacteria | 1709 |
| 18 | JGI25160J50197_1000010 | 3300003354 | Bacteria | 279365 |
| 19 | JGI25161J50226_1000006 | 3300003374 | Bacteria | 279563 |
| 20 | Ga0055539_1039994 | 3300003752 | Bacteria | 506 |
| 21 | Ga0055543_1000014 | 3300004625 | Bacteria | 177906 |
| 22 | Ga0065165_1000262 | 3300005262 | Bacteria | 90720 |
| 23 | Ga0065707_10106159 | 3300005295 | Bacteria | 2609 |
| 24 | Ga0065707_10499855 | 3300005295 | Bacteria | 758 |
| 25 | Ga0070676_10143794 | 3300005328 | Bacteria | 1521 |
| 26 | Ga0070670_102039229 | 3300005331 | Bacteria | 529 |
| 27 | Ga0068869_101482007 | 3300005334 | Bacteria | 602 |
| 28 | Ga0070680_100004467 | 3300005336 | Bacteria | 10538 |
| 29 | Ga0070689_100516306 | 3300005340 | Bacteria | 1025 |
| 30 | Ga0070668_100086464 | 3300005347 | Bacteria | 2465 |
| 31 | Ga0070669_100679790 | 3300005353 | Bacteria | 868 |
| 32 | Ga0070675_100302501 | 3300005354 | Bacteria | 1409 |
| 33 | Ga0070675_100637336 | 3300005354 | Bacteria | 968 |
| 34 | Ga0070671_100499752 | 3300005355 | Bacteria | 1046 |
| 35 | Ga0070667_100190717 | 3300005367 | Bacteria | 1816 |
| 36 | Ga0070714_100000322 | 3300005435 | Bacteria | 36166 |
| 37 | Ga0070713_100298912 | 3300005436 | Bacteria | 1481 |
| 38 | Ga0070713_101455234 | 3300005436 | Bacteria | 665 |
| 39 | Ga0070710_10072856 | 3300005437 | Bacteria | 1984 |
| 40 | Ga0070711_100914459 | 3300005439 | Bacteria | 749 |
| 41 | Ga0070705_101338340 | 3300005440 | Bacteria | 595 |
| 42 | Ga0070694_101123493 | 3300005444 | Bacteria | 656 |
| 43 | Ga0070678_100801747 | 3300005456 | Bacteria | 855 |
| 44 | Ga0070662_100494836 | 3300005457 | Bacteria | 1019 |
| 45 | Ga0070681_10005353 | 3300005458 | Bacteria | 12389 |
| 46 | Ga0068867_100202659 | 3300005459 | Bacteria | 1589 |
| 47 | Ga0068867_101124150 | 3300005459 | Bacteria | 718 |
| 48 | Ga0070699_100002280 | 3300005518 | Bacteria | 17267 |
| 49 | Ga0070679_100015110 | 3300005530 | Bacteria | 7420 |
| 50 | Ga0070684_100118245 | 3300005535 | Bacteria | 2382 |
| 51 | Ga0070684_100581834 | 3300005535 | Bacteria | 1040 |
| 52 | Ga0068853_101034159 | 3300005539 | Bacteria | 791 |
| 53 | Ga0070695_101345403 | 3300005545 | Bacteria | 591 |
| 54 | Ga0070696_101218710 | 3300005546 | Unclassified | 636 |
| 55 | Ga0070696_101706483 | 3300005546 | Bacteria | 543 |
| 56 | Ga0070665_100251843 | 3300005548 | Bacteria | 1767 |
| 57 | Ga0068855_100628731 | 3300005563 | Bacteria | 1155 |
| 58 | Ga0068857_102171808 | 3300005577 | Bacteria | 545 |
| 59 | Ga0068854_100034168 | 3300005578 | Bacteria | 3550 |
| 60 | Ga0068854_100125624 | 3300005578 | Bacteria | 1953 |
| 61 | Ga0068856_100127073 | 3300005614 | Bacteria | 2553 |
| 62 | Ga0068856_100220330 | 3300005614 | Bacteria | 1913 |
| 63 | Ga0068856_100334493 | 3300005614 | Bacteria | 1532 |
| 64 | Ga0068859_100172431 | 3300005617 | Unclassified | 2245 |
| 65 | Ga0068861_100663012 | 3300005719 | Bacteria | 965 |
| 66 | Ga0068861_100977076 | 3300005719 | Bacteria | 807 |
| 67 | Ga0068862_100125161 | 3300005844 | Bacteria | 2269 |
| 68 | Ga0081455_10295005 | 3300005937 | Bacteria | 1166 |
| 69 | Ga0081538_10001121 | 3300005981 | Bacteria | 28389 |
| 70 | Ga0070717_10104379 | 3300006028 | Bacteria | 2411 |
| 71 | Ga0070717_10601819 | 3300006028 | Bacteria | 997 |
| 72 | Ga0070715_10122700 | 3300006163 | Bacteria | 1240 |
| 73 | Ga0097621_100688634 | 3300006237 | Bacteria | 940 |
| 74 | Ga0075370_10183863 | 3300006353 | Bacteria | 1231 |
| 75 | Ga0075428_100001793 | 3300006844 | Bacteria | 22956 |
| 76 | Ga0075428_100285798 | 3300006844 | Bacteria | 1775 |
| 77 | Ga0075430_100126572 | 3300006846 | Bacteria | 2130 |
| 78 | Ga0075430_100174911 | 3300006846 | Bacteria | 1786 |
| 79 | Ga0075430_100874367 | 3300006846 | Bacteria | 741 |
| 80 | Ga0075431_100000136 | 3300006847 | Bacteria | 49311 |
| 81 | Ga0075433_11547976 | 3300006852 | Unclassified | 572 |
| 82 | Ga0075429_100003755 | 3300006880 | Bacteria | 12949 |
| 83 | Ga0097620_100172443 | 3300006931 | Unclassified | 2245 |
| 84 | Ga0075435_100476175 | 3300007076 | Bacteria | 1078 |
| 85 | Ga0105251_10312460 | 3300009011 | Bacteria | 713 |
| 86 | Ga0105240_10000005 | 3300009093 | Bacteria | 702630 |
| 87 | Ga0105240_10022753 | 3300009093 | Bacteria | 8303 |
| 88 | Ga0105240_10522214 | 3300009093 | Bacteria | 1317 |
| 89 | Ga0111539_10000405 | 3300009094 | Bacteria | 53738 |
| 90 | Ga0111539_10129178 | 3300009094 | Bacteria | 2959 |
| 91 | Ga0111539_12721879 | 3300009094 | Bacteria | 573 |
| 92 | Ga0114129_10002465 | 3300009147 | Bacteria | 25697 |
| 93 | Ga0105243_10764574 | 3300009148 | Bacteria | 949 |
| 94 | Ga0105248_10651662 | 3300009177 | Bacteria | 1188 |
| 95 | Ga0105237_10001882 | 3300009545 | Bacteria | 26776 |
| 96 | Ga0105239_10002014 | 3300010375 | Bacteria | 26368 |
| 97 | Ga0157373_11118647 | 3300013100 | Bacteria | 591 |
| 98 | Ga0157370_10000274 | 3300013104 | Bacteria | 65400 |
| 99 | Ga0157370_10007782 | 3300013104 | Bacteria | 11617 |
| 100 | Ga0157374_10161925 | 3300013296 | Bacteria | 2179 |
| 101 | Ga0163162_11516473 | 3300013306 | Bacteria | 764 |
| 102 | Ga0157372_10745210 | 3300013307 | Bacteria | 1139 |
| 103 | Ga0157375_13369553 | 3300013308 | Bacteria | 532 |
| 104 | Ga0163163_10047922 | 3300014325 | Bacteria | 4201 |
| 105 | Ga0163163_10452744 | 3300014325 | Bacteria | 1344 |
| 106 | Ga0163163_11221870 | 3300014325 | Unclassified | 814 |
| 107 | Ga0182008_10106857 | 3300014497 | Bacteria | 1385 |
| 108 | Ga0157379_10416956 | 3300014968 | Bacteria | 1236 |
| 109 | Ga0182007_10000711 | 3300015262 | Bacteria | 18942 |
| 110 | Ga0213872_10041927 | 3300021361 | Bacteria | 2088 |
| 111 | Ga0213875_10176050 | 3300021388 | Bacteria | 1005 |
| 112 | Ga0209435_100045 | 3300025206 | Bacteria | 96483 |
| 113 | Ga0209436_119376 | 3300025208 | Bacteria | 945 |
| 114 | Ga0209672_106967 | 3300025228 | Bacteria | 1788 |
| 115 | Ga0207427_105796 | 3300025231 | Bacteria | 1678 |
| 116 | Ga0207427_106984 | 3300025231 | Bacteria | 1367 |
| 117 | Ga0209437_100047 | 3300025233 | Bacteria | 405163 |
| 118 | Ga0209437_100683 | 3300025233 | Bacteria | 18100 |
| 119 | Ga0209646_1000154 | 3300025246 | Bacteria | 96483 |
| 120 | Ga0209646_1007550 | 3300025246 | Bacteria | 1771 |
| 121 | Ga0209026_1000177 | 3300025250 | Bacteria | 96629 |
| 122 | Ga0209677_100435 | 3300025253 | Bacteria | 24526 |
| 123 | Ga0209148_1015098 | 3300025254 | Bacteria | 1356 |
| 124 | Ga0209759_1000795 | 3300025256 | Bacteria | 25746 |
| 125 | Ga0209759_1023408 | 3300025256 | Bacteria | 1360 |
| 126 | Ga0209233_1000048 | 3300025261 | Bacteria | 453669 |
| 127 | Ga0209233_1000069 | 3300025261 | Bacteria | 367639 |
| 128 | Ga0209233_1000221 | 3300025261 | Bacteria | 104090 |
| 129 | Ga0209233_1000538 | 3300025261 | Bacteria | 21535 |
| 130 | Ga0209233_1025360 | 3300025261 | Bacteria | 1468 |
| 131 | Ga0209455_1019419 | 3300025272 | Bacteria | 1374 |
| 132 | Ga0209130_1000021 | 3300025284 | Bacteria | 374278 |
| 133 | Ga0207426_1000010 | 3300025302 | Bacteria | 796003 |
| 134 | Ga0207642_11155190 | 3300025899 | Bacteria | 502 |
| 135 | Ga0207688_10484093 | 3300025901 | Bacteria | 774 |
| 136 | Ga0207685_10068580 | 3300025905 | Bacteria | 1430 |
| 137 | Ga0207699_11163496 | 3300025906 | Bacteria | 571 |
| 138 | Ga0207645_10047498 | 3300025907 | Bacteria | 2741 |
| 139 | Ga0207707_10003185 | 3300025912 | Bacteria | 14568 |
| 140 | Ga0207695_10000011 | 3300025913 | Bacteria | 910221 |
| 141 | Ga0207695_10210683 | 3300025913 | Bacteria | 1854 |
| 142 | Ga0207695_10301706 | 3300025913 | Bacteria | 1493 |
| 143 | Ga0207671_10000314 | 3300025914 | Bacteria | 71414 |
| 144 | Ga0207652_10025552 | 3300025921 | Bacteria | 4911 |
| 145 | Ga0207681_10662281 | 3300025923 | Bacteria | 866 |
| 146 | Ga0207659_10640509 | 3300025926 | Bacteria | 908 |
| 147 | Ga0207664_10605423 | 3300025929 | Bacteria | 984 |
| 148 | Ga0207644_11261711 | 3300025931 | Bacteria | 621 |
| 149 | Ga0207706_10590149 | 3300025933 | Bacteria | 955 |
| 150 | Ga0207686_11447375 | 3300025934 | Bacteria | 566 |
| 151 | Ga0207665_10103211 | 3300025939 | Bacteria | 1994 |
| 152 | Ga0207665_10634332 | 3300025939 | Bacteria | 836 |
| 153 | Ga0207711_10265395 | 3300025941 | Bacteria | 1579 |
| 154 | Ga0207661_11417978 | 3300025944 | Bacteria | 637 |
| 155 | Ga0207667_10036003 | 3300025949 | Bacteria | 5307 |
| 156 | Ga0207667_12222600 | 3300025949 | Bacteria | 505 |
| 157 | Ga0207640_10139796 | 3300025981 | Bacteria | 1763 |
| 158 | Ga0207640_11033876 | 3300025981 | Bacteria | 724 |
| 159 | Ga0207658_10082837 | 3300025986 | Bacteria | 2464 |
| 160 | Ga0207702_10094154 | 3300026078 | Bacteria | 2629 |
| 161 | Ga0207702_10584365 | 3300026078 | Bacteria | 1095 |
| 162 | Ga0207648_10776405 | 3300026089 | Bacteria | 891 |
| 163 | Ga0207648_11408762 | 3300026089 | Bacteria | 655 |
| 164 | Ga0207676_10807849 | 3300026095 | Bacteria | 915 |
| 165 | Ga0207674_10457542 | 3300026116 | Bacteria | 1233 |
| 166 | Ga0207675_100479889 | 3300026118 | Bacteria | 1235 |
| 167 | Ga0207675_100673585 | 3300026118 | Bacteria | 1042 |
| 168 | Ga0209371_1008268 | 3300027312 | Bacteria | 3487 |
| 169 | Ga0209371_1073192 | 3300027312 | Bacteria | 605 |
| 170 | Ga0207428_10000994 | 3300027907 | Bacteria | 31445 |
| 171 | Ga0268266_10088839 | 3300028379 | Bacteria | 2705 |
| 172 | Ga0268266_10903027 | 3300028379 | Bacteria | 854 |
| 173 | Ga0268265_10118081 | 3300028380 | Bacteria | 2180 |
| 174 | Ga0268264_10129614 | 3300028381 | Bacteria | 2234 |
| 175 | Ga0265318_10103068 | 3300028577 | Unclassified | 1050 |
| 176 | Ga0268256_1005022 | 3300030500 | Bacteria | 5308 |
| 177 | Ga0268256_1081277 | 3300030500 | Bacteria | 606 |
| 178 | Ga0316176_1010088 | 3300030732 | Bacteria | 967 |
| 179 | Ga0314311_1239489 | 3300030733 | Bacteria | 1454 |
| 180 | Ga0265320_10005956 | 3300031240 | Bacteria | 7749 |
| 181 | Ga0265320_10128905 | 3300031240 | Bacteria | 1150 |
| 182 | Ga0265325_10018843 | 3300031241 | Bacteria | 3825 |
| 183 | Ga0265340_10011313 | 3300031247 | Bacteria | 4746 |
| 184 | Ga0265331_10149197 | 3300031250 | Bacteria | 1062 |
| 185 | Ga0265327_10229938 | 3300031251 | Bacteria | 831 |
| 186 | Ga0307509_10340691 | 3300031507 | Bacteria | 1227 |
| 187 | Ga0307408_100396530 | 3300031548 | Bacteria | 1184 |
| 188 | Ga0307408_100805747 | 3300031548 | Bacteria | 853 |
| 189 | Ga0307408_101545493 | 3300031548 | Bacteria | 629 |
| 190 | Ga0265313_10008025 | 3300031595 | Bacteria | 7080 |
| 191 | Ga0307508_10023185 | 3300031616 | Bacteria | 5638 |
| 192 | Ga0307508_10813788 | 3300031616 | Bacteria | 552 |
| 193 | Ga0265314_10009562 | 3300031711 | Bacteria | 8168 |
| 194 | Ga0265314_10038937 | 3300031711 | Bacteria | 3430 |
| 195 | Ga0265314_10104175 | 3300031711 | Bacteria | 1817 |
| 196 | Ga0265342_10046457 | 3300031712 | Bacteria | 2610 |
| 197 | Ga0316576_10170246 | 3300031727 | Bacteria | 1644 |
| 198 | Ga0316578_10171381 | 3300031728 | Bacteria | 1308 |
| 199 | Ga0307413_10734516 | 3300031824 | Bacteria | 824 |
| 200 | Ga0307406_10642276 | 3300031901 | Bacteria | 880 |
| 201 | Ga0307412_11085211 | 3300031911 | Bacteria | 712 |
| 202 | Ga0307412_12022277 | 3300031911 | Bacteria | 534 |
| 203 | Ga0307409_100138932 | 3300031995 | Bacteria | 2090 |
| 204 | Ga0307409_101028651 | 3300031995 | Bacteria | 843 |
| 205 | Ga0307416_100403081 | 3300032002 | Bacteria | 1406 |
| 206 | Ga0307414_10407181 | 3300032004 | Bacteria | 1183 |
| 207 | Ga0307411_11450148 | 3300032005 | Bacteria | 629 |
| 208 | Ga0307411_11601132 | 3300032005 | Bacteria | 601 |
| 209 | Ga0307415_101428852 | 3300032126 | Bacteria | 660 |
| 210 | Ga0373949_0095895 | 3300035090 | Unclassified | 807 |
| 211 | Ga0373951_0149095 | 3300035091 | Bacteria | 654 |
| 212 | Ga0373935_0041040 | 3300035692 | Bacteria | 2906 |
| 213 | Ga0373935_1298659 | 3300035692 | Bacteria | 543 |
| 214 | Ga0373927_0000343 | 3300035695 | Bacteria | 36640 |
| 215 | Ga0373947_0390934 | 3300035725 | Bacteria | 937 |
| 216 | Ga0373937_0423096 | 3300036401 | Bacteria | 1264 |
| 217 | Ga0316584_0100969 | 3300036712 | Bacteria | 2160 |
| 218 | Ga0373925_0006509 | 3300037068 | Bacteria | 8589 |
| 219 | Ga0373925_1264798 | 3300037068 | Bacteria | 606 |
| 220 | Ga0395899_0038881 | 3300037312 | Bacteria | 3562 |
| 221 | Ga0395900_0934227 | 3300037418 | Bacteria | 789 |
| 222 | Ga0436364_0179263 | 3300037853 | Bacteria | 1166 |
| 223 | Ga0436364_0619236 | 3300037853 | Bacteria | 15878 |
| 224 | Ga0395901_0032619 | 3300038443 | Bacteria | 5371 |
| 225 | Ga0436365_0615018 | 3300039437 | Bacteria | 1018 |
| 226 | Ga0436365_0620338 | 3300039437 | Unclassified | 527 |
| 227 | Ga0436365_1010111 | 3300039437 | Bacteria | 1326 |
| 228 | Ga0436365_1131824 | 3300039437 | Bacteria | 783 |
| 229 | Ga0436365_1171900 | 3300039437 | Bacteria | 4745 |
| 230 | Ga0436360_1293286 | 3300039438 | Bacteria | 872 |
| 231 | Ga0436361_0761415 | 3300039447 | Bacteria | 7443 |
| 232 | Ga0436363_0646758 | 3300039450 | Bacteria | 1414 |
| 233 | Ga0436363_1460995 | 3300039450 | Bacteria | 509 |
| 234 | Ga0451800_0092686 | 3300041459 | Bacteria | 1452 |
| 235 | Ga0451807_0176066 | 3300041486 | Bacteria | 864 |
| 236 | Ga0451837_1857841 | 3300041494 | Bacteria | 678 |
| 237 | Ga0439445_0109064 | 3300042004 | Bacteria | 789 |
| 238 | Ga0439448_0187424 | 3300042005 | Bacteria | 724 |
| 239 | Ga0439455_0003121 | 3300042012 | Bacteria | 3121 |
| 240 | Ga0450923_041826 | 3300042125 | Bacteria | 965 |
| 241 | Ga0450906_067842 | 3300042145 | Bacteria | 638 |
| 242 | Ga0439460_0061457 | 3300042461 | Bacteria | 1147 |
| 243 | Ga0451577_0048440 | 3300042876 | Bacteria | 3796 |
| 244 | Ga0451577_0335819 | 3300042876 | Bacteria | 1370 |
| 245 | Ga0453683_0068649 | 3300044673 | Bacteria | 2216 |
| 246 | Ga0453683_0400019 | 3300044673 | Bacteria | 885 |
| 247 | Ga0466964_0543623 | 3300044706 | Bacteria | 630 |
| 248 | Ga0453684_0048098 | 3300044712 | Bacteria | 5646 |
| 249 | Ga0453684_0080678 | 3300044712 | Bacteria | 4061 |
| 250 | Ga0453684_0120695 | 3300044712 | Bacteria | 3165 |
| 251 | Ga0453684_1085513 | 3300044712 | Bacteria | 846 |
| 252 | Ga0451576_0000301 | 3300045051 | Bacteria | 119546 |
| 253 | Ga0451576_0030825 | 3300045051 | Bacteria | 5723 |
| 254 | Ga0451576_0039487 | 3300045051 | Bacteria | 4995 |
| 255 | Ga0451576_0063884 | 3300045051 | Bacteria | 3836 |
| 256 | Ga0451576_0176824 | 3300045051 | Bacteria | 2228 |
| 257 | Ga0451576_0189678 | 3300045051 | Bacteria | 2147 |
| 258 | Ga0466958_1031968 | 3300045836 | Bacteria | 537 |
| 259 | Ga0495592_0185565 | 3300046454 | Bacteria | 1413 |
| 260 | Ga0495629_0032776 | 3300046459 | Bacteria | 3677 |
| 261 | Ga0495639_0352064 | 3300046475 | Bacteria | 739 |
| 262 | Ga0495606_0049506 | 3300046507 | Bacteria | 2755 |
| 263 | Ga0495606_0288339 | 3300046507 | Bacteria | 894 |
| 264 | Ga0495618_0417424 | 3300046514 | Bacteria | 819 |
| 265 | Ga0495628_0774549 | 3300046516 | Bacteria | 673 |
| 266 | Ga0495628_0836219 | 3300046516 | Bacteria | 642 |
| 267 | Ga0495643_0109188 | 3300046522 | Bacteria | 1408 |
| 268 | Ga0495640_0436119 | 3300046533 | Bacteria | 801 |
| 269 | Ga0495586_0138626 | 3300046535 | Bacteria | 1364 |
| 270 | Ga0495622_0024538 | 3300046557 | Bacteria | 2816 |
| 271 | Ga0495634_0089555 | 3300046642 | Bacteria | 2000 |
| 272 | Ga0495634_0533166 | 3300046642 | Bacteria | 686 |
| 273 | Ga0495635_0186022 | 3300046663 | Bacteria | 1411 |
| 274 | Ga0495588_0085293 | 3300046674 | Bacteria | 1651 |
| 275 | Ga0495657_0018964 | 3300046675 | Bacteria | 4970 |
| 276 | Ga0495658_0085790 | 3300046683 | Bacteria | 1856 |
| 277 | Ga0495624_0039465 | 3300046690 | Bacteria | 3027 |
| 278 | Ga0495670_0232613 | 3300046691 | Bacteria | 980 |
| 279 | Ga0495600_0072162 | 3300046809 | Bacteria | 2255 |
| 280 | Ga0495600_0893438 | 3300046809 | Bacteria | 525 |
| 281 | Ga0495581_0078819 | 3300047315 | Bacteria | 1906 |
| 282 | Ga0495604_0077315 | 3300047317 | Bacteria | 2501 |
| 283 | Ga0495674_0273018 | 3300047319 | Bacteria | 1387 |
| 284 | Ga0495593_0100348 | 3300047673 | Bacteria | 1485 |
| 285 | Ga0496100_0028499 | 3300048903 | Bacteria | 3445 |
| 286 | Ga0496100_0173746 | 3300048903 | Bacteria | 1554 |
| 287 | Ga0496100_0532169 | 3300048903 | Bacteria | 908 |
| 288 | Ga0496100_0797121 | 3300048903 | Bacteria | 740 |
| 289 | Ga0496101_0024916 | 3300048904 | Bacteria | 4147 |
| 290 | Ga0496101_0104368 | 3300048904 | Bacteria | 2126 |
| 291 | Ga0496101_0292011 | 3300048904 | Bacteria | 1276 |
| 292 | Ga0496102_0051810 | 3300048905 | Bacteria | 3739 |
| 293 | Ga0496102_0056767 | 3300048905 | Bacteria | 3573 |
| 294 | Ga0496102_0616606 | 3300048905 | Bacteria | 1008 |
| 295 | Ga0496103_0024597 | 3300048906 | Bacteria | 3635 |
| 296 | Ga0496103_0138319 | 3300048906 | Bacteria | 1557 |
| 297 | Ga0496104_0000042 | 3300048907 | Bacteria | 155859 |
| 298 | Ga0496104_0036532 | 3300048907 | Bacteria | 4593 |
| 299 | Ga0496104_0199005 | 3300048907 | Bacteria | 1915 |
| 300 | Ga0496104_0435970 | 3300048907 | Bacteria | 1222 |
| 301 | Ga0496104_0583201 | 3300048907 | Bacteria | 1028 |
| 302 | Ga0496104_1594838 | 3300048907 | Bacteria | 555 |
| 303 | Ga0496105_0000046 | 3300048908 | Bacteria | 101134 |
| 304 | Ga0496105_0004982 | 3300048908 | Bacteria | 10047 |
| 305 | Ga0496105_0010856 | 3300048908 | Bacteria | 7172 |
| 306 | Ga0496105_0067827 | 3300048908 | Bacteria | 2945 |
| 307 | Ga0496105_0068832 | 3300048908 | Bacteria | 2924 |
| 308 | Ga0496105_0074279 | 3300048908 | Bacteria | 2808 |
| 309 | Ga0496105_0708083 | 3300048908 | Bacteria | 772 |
| 310 | Ga0496106_0087927 | 3300048909 | Bacteria | 2395 |
| 311 | Ga0496107_0199195 | 3300048910 | Bacteria | 1488 |
| 312 | Ga0496108_0001365 | 3300048911 | Bacteria | 19198 |
| 313 | Ga0496108_0020691 | 3300048911 | Bacteria | 5407 |
| 314 | Ga0496110_0044229 | 3300048913 | Bacteria | 3889 |
| 315 | Ga0496110_0090787 | 3300048913 | Bacteria | 2731 |
| 316 | Ga0496110_0601452 | 3300048913 | Bacteria | 997 |
| 317 | Ga0496111_0000226 | 3300048914 | Bacteria | 26937 |
| 318 | Ga0496112_0007460 | 3300048915 | Bacteria | 9712 |
| 319 | Ga0496112_0101461 | 3300048915 | Bacteria | 2847 |
| 320 | Ga0496112_0168426 | 3300048915 | Bacteria | 2156 |
| 321 | Ga0496112_0240216 | 3300048915 | Bacteria | 1764 |
| 322 | Ga0496113_0004784 | 3300048916 | Bacteria | 8365 |
| 323 | Ga0496113_0077691 | 3300048916 | Bacteria | 2538 |
| 324 | Ga0496113_0142658 | 3300048916 | Bacteria | 1885 |
| 325 | Ga0496114_0129872 | 3300048917 | Bacteria | 2175 |
| 326 | Ga0496115_0006892 | 3300048918 | Bacteria | 8347 |
| 327 | Ga0496115_1155935 | 3300048918 | Bacteria | 584 |
| 328 | Ga0496116_0031573 | 3300048919 | Bacteria | 3789 |
| 329 | Ga0496117_0000641 | 3300048920 | Bacteria | 56335 |
| 330 | Ga0496118_0002328 | 3300048921 | Bacteria | 25774 |
| 331 | Ga0496119_0000343 | 3300048922 | Bacteria | 65175 |
| 332 | Ga0496119_0007704 | 3300048922 | Bacteria | 9634 |
| 333 | Ga0496119_0044327 | 3300048922 | Bacteria | 2802 |
| 334 | Ga0496120_0013368 | 3300048923 | Bacteria | 5532 |
| 335 | Ga0496120_0489326 | 3300048923 | Bacteria | 530 |
| 336 | Ga0496121_0004370 | 3300048924 | Bacteria | 19103 |
| 337 | Ga0496122_0023168 | 3300048925 | Bacteria | 5485 |
| 338 | Ga0496122_0073872 | 3300048925 | Bacteria | 2415 |
| 339 | Ga0496123_0024172 | 3300048926 | Bacteria | 4626 |
| 340 | Ga0496123_0048441 | 3300048926 | Bacteria | 2859 |
| 341 | Ga0496124_0010738 | 3300048927 | Bacteria | 9233 |
| 342 | Ga0496125_0046959 | 3300048928 | Bacteria | 3617 |
| 343 | Ga0496125_0079656 | 3300048928 | Bacteria | 2512 |
| 344 | Ga0496125_0317572 | 3300048928 | Bacteria | 946 |
| 345 | Ga0496126_0033052 | 3300048929 | Bacteria | 4868 |
| 346 | Ga0496126_0376922 | 3300048929 | Bacteria | 1156 |
| 347 | Ga0496126_0445890 | 3300048929 | Bacteria | 1042 |
| 348 | Ga0496126_0641260 | 3300048929 | Bacteria | 832 |
| 349 | Ga0496126_0771912 | 3300048929 | Bacteria | 740 |
| 350 | Ga0501318_077973 | 3300049534 | Bacteria | 533 |
| 351 | Ga0501032_0186723 | 3300049569 | Bacteria | 1356 |
| 352 | Ga0501032_0352143 | 3300049569 | Bacteria | 949 |
| 353 | Ga0501033_0258522 | 3300049570 | Bacteria | 1233 |
| 354 | Ga0501033_0686645 | 3300049570 | Bacteria | 697 |
| 355 | Ga0501034_0025068 | 3300049571 | Bacteria | 6069 |
| 356 | Ga0501034_0131294 | 3300049571 | Bacteria | 2488 |
| 357 | Ga0501034_0440653 | 3300049571 | Bacteria | 1221 |
| 358 | Ga0501034_0452261 | 3300049571 | Bacteria | 1202 |
| 359 | Ga0501034_0634382 | 3300049571 | Bacteria | 971 |
| 360 | Ga0501036_0107400 | 3300049572 | Bacteria | 2360 |
| 361 | Ga0501036_0234433 | 3300049572 | Bacteria | 1540 |
| 362 | Ga0501036_0449870 | 3300049572 | Bacteria | 1073 |
| 363 | Ga0501038_0147897 | 3300049574 | Bacteria | 1917 |
| 364 | Ga0501038_0151685 | 3300049574 | Bacteria | 1889 |
| 365 | Ga0501038_0500873 | 3300049574 | Bacteria | 929 |
| 366 | Ga0501038_0773757 | 3300049574 | Bacteria | 715 |
| 367 | Ga0501039_0353444 | 3300049575 | Bacteria | 1155 |
| 368 | Ga0501040_0668066 | 3300049576 | Bacteria | 751 |
| 369 | Ga0501042_0386036 | 3300049578 | Bacteria | 1014 |
| 370 | Ga0501043_0082162 | 3300049579 | Bacteria | 2532 |
| 371 | Ga0501043_0134382 | 3300049579 | Bacteria | 1938 |
| 372 | Ga0501046_1059690 | 3300049580 | Bacteria | 561 |
| 373 | Ga0501047_0162551 | 3300049581 | Bacteria | 2104 |
| 374 | Ga0501047_0267404 | 3300049581 | Bacteria | 1556 |
| 375 | Ga0501048_0474952 | 3300049582 | Bacteria | 896 |
| 376 | Ga0501067_0398445 | 3300049583 | Bacteria | 768 |
| 377 | Ga0501069_0412664 | 3300049585 | Bacteria | 800 |
| 378 | Ga0501070_0048830 | 3300049586 | Bacteria | 3515 |
| 379 | Ga0501070_0156652 | 3300049586 | Bacteria | 1878 |
| 380 | Ga0501070_0228458 | 3300049586 | Bacteria | 1525 |
| 381 | Ga0501070_0338983 | 3300049586 | Bacteria | 1221 |
| 382 | Ga0501071_0018571 | 3300049587 | Bacteria | 4817 |
| 383 | Ga0501071_0506632 | 3300049587 | Bacteria | 926 |
| 384 | Ga0501072_0089064 | 3300049588 | Bacteria | 2449 |
| 385 | Ga0501073_0063487 | 3300049589 | Bacteria | 2576 |
| 386 | Ga0501073_0117728 | 3300049589 | Bacteria | 1841 |
| 387 | Ga0501073_0647205 | 3300049589 | Bacteria | 730 |
| 388 | Ga0501075_0041783 | 3300049591 | Bacteria | 3437 |
| 389 | Ga0501075_1244935 | 3300049591 | Bacteria | 564 |
| 390 | Ga0501076_0011306 | 3300049592 | Bacteria | 6644 |
| 391 | Ga0501077_0091604 | 3300049593 | Bacteria | 1926 |
| 392 | Ga0501080_0087351 | 3300049742 | Bacteria | 2897 |
| 393 | Ga0501080_0154453 | 3300049742 | Bacteria | 2120 |
| 394 | Ga0501080_0553053 | 3300049742 | Bacteria | 1025 |
| 395 | Ga0501080_0904527 | 3300049742 | Bacteria | 769 |
| 396 | Ga0501081_0037297 | 3300049743 | Bacteria | 3316 |
| 397 | Ga0501035_0082371 | 3300049822 | Bacteria | 2839 |
| 398 | Ga0501035_0247919 | 3300049822 | Bacteria | 1513 |
| 399 | Ga0501035_0531725 | 3300049822 | Bacteria | 965 |
| 400 | Ga0501044_0046132 | 3300049823 | Bacteria | 4513 |
| 401 | Ga0501044_0196016 | 3300049823 | Bacteria | 1980 |
| 402 | Ga0501044_0409179 | 3300049823 | Bacteria | 1268 |
| 403 | Ga0501045_0092474 | 3300049824 | Bacteria | 2237 |
| 404 | Ga0501045_1345385 | 3300049824 | Bacteria | 519 |
| 405 | nmdc:mga05p37_2000190_c1 | 3300050507 | Bacteria | 548 |
| 406 | nmdc:mga05p37_74_c1 | 3300050507 | Bacteria | 87063 |
| 407 | nmdc:mga09592_142436_c1 | 3300050508 | Bacteria | 2067 |
| 408 | nmdc:mga09592_3887_c1 | 3300050508 | Bacteria | 12035 |
| 409 | nmdc:mga0qj67_1383460_c1 | 3300050509 | Unclassified | 543 |
| 410 | nmdc:mga0qj67_29405_c1 | 3300050509 | Bacteria | 4268 |
| 411 | nmdc:mga0qj67_677782_c1 | 3300050509 | Bacteria | 821 |
| 412 | nmdc:mga06r32_2556_c1 | 3300050510 | Bacteria | 16281 |
| 413 | nmdc:mga08y16_373_c1 | 3300050511 | Bacteria | 40656 |
| 414 | nmdc:mga0rr50_156504_c1 | 3300050513 | Bacteria | 1846 |
| 415 | nmdc:mga0a205_275638_c1 | 3300050515 | Unclassified | 1558 |
| 416 | Ga0500644_0090260 | 3300053088 | Bacteria | 1145 |
| 417 | Ga0500650_0225000 | 3300053098 | Bacteria | 848 |
| 418 | Ga0500608_004923 | 3300053122 | Bacteria | 5234 |
| 419 | Ga0500622_0000830 | 3300053156 | Bacteria | 26470 |
| 420 | Ga0500627_0258898 | 3300053158 | Bacteria | 768 |
| 421 | Ga0501084_0336302 | 3300054114 | Bacteria | 1275 |
| 422 | Ga0587070_033407 | 3300059491 | Bacteria | 946 |
| 423 | Ga0587082_112808 | 3300059504 | Bacteria | 606 |
| 424 | Ga0587083_0098640 | 3300059505 | Bacteria | 724 |
| 425 | Ga0587088_059501 | 3300059508 | Bacteria | 770 |
| 426 | Ga0587090_013757 | 3300059510 | Bacteria | 1174 |
| 427 | Ga0587091_022963 | 3300059511 | Bacteria | 1106 |
| 428 | Ga0587092_107772 | 3300059512 | Bacteria | 582 |
| 429 | Ga0587106_017787 | 3300059605 | Bacteria | 1020 |
| 430 | Ga0587068_098900 | 3300059641 | Bacteria | 610 |
| 431 | Ga0587069_019447 | 3300059642 | Bacteria | 1004 |
| 432 | Ga0587072_015969 | 3300059643 | Bacteria | 1281 |
| 433 | Ga0587075_011359 | 3300059644 | Bacteria | 1193 |
| 434 | Ga0587076_003992 | 3300059645 | Bacteria | 1809 |
| 435 | Ga0587079_020181 | 3300059647 | Bacteria | 1187 |
| 436 | Ga0587107_042627 | 3300059652 | Bacteria | 740 |
| 437 | Ga0587120_013485 | 3300059659 | Bacteria | 722 |
| 438 | Ga0587096_04485 | 3300060247 | Bacteria | 592 |
| 439 | Ga0587071_018194 | 3300060344 | Bacteria | 1261 |
| 440 | Ga0587111_0144204 | 3300060346 | Bacteria | 634 |
| 441 | Ga0466962_0043823 | 3300061719 | Bacteria | 2141 |
| 442 | Ga0466962_0221092 | 3300061719 | Bacteria | 928 |
| 443 | Ga0530510_0053458 | 3300061734 | Bacteria | 2919 |
| 444 | Ga0530510_0506140 | 3300061734 | Bacteria | 916 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046535 | Ga0495586_0138626 | Ga0495586_0138626_12_323 | 85 |
| 2 | 3300048923 | Ga0496120_0489326 | Ga0496120_0489326_17_322 | 101 |
| 3 | 3300035692 | Ga0373935_1298659 | Ga0373935_1298659_147_521 | 104 |
| 4 | 3300036401 | Ga0373937_0423096 | Ga0373937_0423096_514_888 | 104 |
| 5 | 3300046516 | Ga0495628_0836219 | Ga0495628_0836219_156_530 | 104 |
| 6 | 3300047319 | Ga0495674_0273018 | Ga0495674_0273018_162_536 | 104 |
| 7 | 3300039437 | Ga0436365_1131824 | Ga0436365_1131824_188_565 | 105 |
| 8 | 3300005328 | Ga0070676_10143794 | Ga0070676_101437942 | 106 |
| 9 | 3300005347 | Ga0070668_100086464 | Ga0070668_1000864643 | 106 |
| 10 | 3300005353 | Ga0070669_100679790 | Ga0070669_1006797902 | 106 |
| 11 | 3300005354 | Ga0070675_100637336 | Ga0070675_1006373362 | 106 |
| 12 | 3300005355 | Ga0070671_100499752 | Ga0070671_1004997522 | 106 |
| 13 | 3300005367 | Ga0070667_100190717 | Ga0070667_1001907172 | 106 |
| 14 | 3300005457 | Ga0070662_100494836 | Ga0070662_1004948362 | 106 |
| 15 | 3300005459 | Ga0068867_100202659 | Ga0068867_1002026592 | 106 |
| 16 | 3300005577 | Ga0068857_102171808 | Ga0068857_1021718082 | 106 |
| 17 | 3300005719 | Ga0068861_100977076 | Ga0068861_1009770762 | 106 |
| 18 | 3300006353 | Ga0075370_10183863 | Ga0075370_101838632 | 106 |
| 19 | 3300009094 | Ga0111539_12721879 | Ga0111539_127218792 | 106 |
| 20 | 3300009148 | Ga0105243_10764574 | Ga0105243_107645742 | 106 |
| 21 | 3300025899 | Ga0207642_11155190 | Ga0207642_111551902 | 106 |
| 22 | 3300025901 | Ga0207688_10484093 | Ga0207688_104840932 | 106 |
| 23 | 3300025907 | Ga0207645_10047498 | Ga0207645_100474982 | 106 |
| 24 | 3300025923 | Ga0207681_10662281 | Ga0207681_106622812 | 106 |
| 25 | 3300025926 | Ga0207659_10640509 | Ga0207659_106405092 | 106 |
| 26 | 3300025931 | Ga0207644_11261711 | Ga0207644_112617111 | 106 |
| 27 | 3300025933 | Ga0207706_10590149 | Ga0207706_105901492 | 106 |
| 28 | 3300025986 | Ga0207658_10082837 | Ga0207658_100828372 | 106 |
| 29 | 3300026089 | Ga0207648_11408762 | Ga0207648_114087622 | 106 |
| 30 | 3300026116 | Ga0207674_10457542 | Ga0207674_104575422 | 106 |
| 31 | 3300026118 | Ga0207675_100673585 | Ga0207675_1006735852 | 106 |
| 32 | 3300028379 | Ga0268266_10088839 | Ga0268266_100888392 | 106 |
| 33 | 3300028381 | Ga0268264_10129614 | Ga0268264_101296142 | 106 |
| 34 | 3300031548 | Ga0307408_100396530 | Ga0307408_1003965302 | 106 |
| 35 | 3300042005 | Ga0439448_0187424 | Ga0439448_0187424_25_396 | 106 |
| 36 | 3300042012 | Ga0439455_0003121 | Ga0439455_0003121_318_689 | 106 |
| 37 | 3300021388 | Ga0213875_10176050 | Ga0213875_101760502 | 107 |
| 38 | 3300037853 | Ga0436364_0179263 | Ga0436364_0179263_182_559 | 107 |
| 39 | 3300048905 | Ga0496102_0056767 | Ga0496102_0056767_1288_1659 | 107 |
| 40 | 3300044673 | Ga0453683_0400019 | Ga0453683_0400019_17_376 | 114 |
| 41 | 3300044712 | Ga0453684_0120695 | Ga0453684_0120695_2790_3149 | 114 |
| 42 | 3300005295 | Ga0065707_10499855 | Ga0065707_104998552 | 115 |
| 43 | 3300005340 | Ga0070689_100516306 | Ga0070689_1005163061 | 115 |
| 44 | 3300005444 | Ga0070694_101123493 | Ga0070694_1011234931 | 115 |
| 45 | 3300005518 | Ga0070699_100002280 | Ga0070699_1000022803 | 115 |
| 46 | 3300005546 | Ga0070696_101218710 | Ga0070696_1012187101 | 115 |
| 47 | 3300005617 | Ga0068859_100172431 | Ga0068859_1001724312 | 115 |
| 48 | 3300005719 | Ga0068861_100663012 | Ga0068861_1006630122 | 115 |
| 49 | 3300005844 | Ga0068862_100125161 | Ga0068862_1001251613 | 115 |
| 50 | 3300006844 | Ga0075428_100285798 | Ga0075428_1002857984 | 115 |
| 51 | 3300006846 | Ga0075430_100874367 | Ga0075430_1008743671 | 115 |
| 52 | 3300006852 | Ga0075433_11547976 | Ga0075433_115479761 | 115 |
| 53 | 3300006931 | Ga0097620_100172443 | Ga0097620_1001724432 | 115 |
| 54 | 3300026118 | Ga0207675_100479889 | Ga0207675_1004798892 | 115 |
| 55 | 3300028380 | Ga0268265_10118081 | Ga0268265_101180812 | 115 |
| 56 | 3300028577 | Ga0265318_10103068 | Ga0265318_101030682 | 115 |
| 57 | 3300041459 | Ga0451800_0092686 | Ga0451800_0092686_82_459 | 115 |
| 58 | 3300041486 | Ga0451807_0176066 | Ga0451807_0176066_305_682 | 115 |
| 59 | 3300042876 | Ga0451577_0048440 | Ga0451577_0048440_3402_3779 | 115 |
| 60 | 3300042876 | Ga0451577_0335819 | Ga0451577_0335819_139_516 | 115 |
| 61 | 3300044712 | Ga0453684_0080678 | Ga0453684_0080678_3405_3782 | 115 |
| 62 | 3300044712 | Ga0453684_1085513 | Ga0453684_1085513_365_742 | 115 |
| 63 | 3300045051 | Ga0451576_0039487 | Ga0451576_0039487_1982_2359 | 115 |
| 64 | 3300045051 | Ga0451576_0189678 | Ga0451576_0189678_233_610 | 115 |
| 65 | 3300048904 | Ga0496101_0104368 | Ga0496101_0104368_1145_1507 | 115 |
| 66 | 3300048907 | Ga0496104_0199005 | Ga0496104_0199005_59_421 | 115 |
| 67 | 3300048908 | Ga0496105_0010856 | Ga0496105_0010856_4729_5091 | 115 |
| 68 | 3300048910 | Ga0496107_0199195 | Ga0496107_0199195_584_946 | 115 |
| 69 | 3300048911 | Ga0496108_0020691 | Ga0496108_0020691_1975_2337 | 115 |
| 70 | 3300048915 | Ga0496112_0168426 | Ga0496112_0168426_141_503 | 115 |
| 71 | 3300050508 | nmdc:mga09592_142436_c1 | nmdc:mga09592_142436_c1_1631_2008 | 115 |
| 72 | 3300050509 | nmdc:mga0qj67_1383460_c1 | nmdc:mga0qj67_1383460_c1_15_392 | 115 |
| 73 | 3300050515 | nmdc:mga0a205_275638_c1 | nmdc:mga0a205_275638_c1_512_889 | 115 |
| 74 | iso_pu_bacteria | 2510917022 | 2511135032 | 116 |
| 75 | iso_pu_bacteria | 2524023209 | 2524460358 | 116 |
| 76 | iso_pu_bacteria | 2582581307 | 2585270771 | 116 |
| 77 | iso_pu_bacteria | 2582581308 | 2585277125 | 116 |
| 78 | iso_pu_bacteria | 2582581315 | 2585323867 | 116 |
| 79 | iso_pu_bacteria | 2582581316 | 2585331845 | 116 |
| 80 | iso_pu_bacteria | 2585427527 | 2585534139 | 116 |
| 81 | iso_pu_bacteria | 2585427530 | 2585552009 | 116 |
| 82 | iso_pu_bacteria | 2585427531 | 2585558494 | 116 |
| 83 | iso_pu_bacteria | 2585427608 | 2585897863 | 116 |
| 84 | iso_pu_bacteria | 2585427609 | 2585904536 | 116 |
| 85 | iso_pu_bacteria | 2585428125 | 2587980348 | 116 |
| 86 | iso_pu_bacteria | 2615840626 | 2616308502 | 116 |
| 87 | iso_pu_bacteria | 2615840698 | 2616557197 | 116 |
| 88 | iso_pu_bacteria | 2617270742 | 2617385682 | 116 |
| 89 | iso_pu_bacteria | 2667528174 | 2671111794 | 116 |
| 90 | iso_pu_bacteria | 2775507049 | 2776913607 | 116 |
| 91 | iso_pu_bacteria | 2775507266 | 2778173938 | 116 |
| 92 | iso_pu_bacteria | 2818991448 | 2819612906 | 116 |
| 93 | iso_pu_bacteria | 2818991453 | 2819637987 | 116 |
| 94 | iso_pu_bacteria | 2837651117 | 2837651963 | 116 |
| 95 | iso_pu_bacteria | 2838029111 | 2838030173 | 116 |
| 96 | iso_pu_bacteria | 2842298080 | 2842302124 | 116 |
| 97 | iso_pu_bacteria | 2842357229 | 2842357409 | 116 |
| 98 | iso_pu_bacteria | 2842475841 | 2842476542 | 116 |
| 99 | iso_pu_bacteria | 2842482326 | 2842484916 | 116 |
| 100 | iso_pu_bacteria | 2842502639 | 2842503701 | 116 |
| 101 | iso_pu_bacteria | 2842509118 | 2842515210 | 116 |
| 102 | iso_pu_bacteria | 2852387548 | 2852389815 | 116 |
| 103 | iso_pu_bacteria | 2919408235 | 2919411767 | 116 |
| 104 | iso_pu_bacteria | 3005416602 | 3005420183 | 116 |
| 105 | iso_pu_bacteria | 8002060224 | 8002061210 | 116 |
| 106 | iso_pu_bacteria | 8005314921 | 8005317134 | 116 |
| 107 | iso_pu_bacteria | 8005484373 | 8005485068 | 116 |
| 108 | iso_pu_bacteria | 8005645114 | 8005648802 | 116 |
| 109 | iso_pu_bacteria | 8005682033 | 8005683269 | 116 |
| 110 | iso_pu_bacteria | 8046767195 | 8046773872 | 116 |
| 111 | iso_pu_bacteria | 8057575449 | 8057576752 | 116 |
| 112 | iso_pu_bacteria | 2738543031 | 2739350087 | 117 |
| 113 | 3300031727 | Ga0316576_10170246 | Ga0316576_101702461 | 118 |
| 114 | 3300031728 | Ga0316578_10171381 | Ga0316578_101713812 | 118 |
| 115 | 3300036712 | Ga0316584_0100969 | Ga0316584_0100969_519_893 | 118 |
| 116 | 3300045051 | Ga0451576_0030825 | Ga0451576_0030825_588_956 | 118 |
| 117 | 3300045051 | Ga0451576_0063884 | Ga0451576_0063884_2394_2759 | 118 |
| 118 | iso_pu_bacteria | 2842333319 | 2842335608 | 118 |
| 119 | iso_pu_bacteria | 2891088606 | 2891090093 | 118 |
| 120 | 3300005334 | Ga0068869_101482007 | Ga0068869_1014820071 | 119 |
| 121 | 3300005440 | Ga0070705_101338340 | Ga0070705_1013383402 | 119 |
| 122 | 3300005456 | Ga0070678_100801747 | Ga0070678_1008017472 | 119 |
| 123 | 3300005459 | Ga0068867_101124150 | Ga0068867_1011241502 | 119 |
| 124 | 3300005546 | Ga0070696_101706483 | Ga0070696_1017064831 | 119 |
| 125 | 3300006237 | Ga0097621_100688634 | Ga0097621_1006886342 | 119 |
| 126 | 3300013296 | Ga0157374_10161925 | Ga0157374_101619252 | 119 |
| 127 | 3300025934 | Ga0207686_11447375 | Ga0207686_114473751 | 119 |
| 128 | 3300026089 | Ga0207648_10776405 | Ga0207648_107764052 | 119 |
| 129 | 3300030732 | Ga0316176_1010088 | Ga0316176_10100882 | 119 |
| 130 | 3300030733 | Ga0314311_1239489 | Ga0314311_12394892 | 119 |
| 131 | 3300031240 | Ga0265320_10128905 | Ga0265320_101289052 | 119 |
| 132 | 3300031241 | Ga0265325_10018843 | Ga0265325_100188432 | 119 |
| 133 | 3300031247 | Ga0265340_10011313 | Ga0265340_100113132 | 119 |
| 134 | 3300031250 | Ga0265331_10149197 | Ga0265331_101491972 | 119 |
| 135 | 3300031251 | Ga0265327_10229938 | Ga0265327_102299382 | 119 |
| 136 | 3300031595 | Ga0265313_10008025 | Ga0265313_100080253 | 119 |
| 137 | 3300031711 | Ga0265314_10038937 | Ga0265314_100389371 | 119 |
| 138 | 3300031911 | Ga0307412_12022277 | Ga0307412_120222771 | 119 |
| 139 | 3300032005 | Ga0307411_11450148 | Ga0307411_114501481 | 119 |
| 140 | 3300041494 | Ga0451837_1857841 | Ga0451837_1857841_112_483 | 119 |
| 141 | 3300045836 | Ga0466958_1031968 | Ga0466958_1031968_32_406 | 119 |
| 142 | 3300046516 | Ga0495628_0774549 | Ga0495628_0774549_134_499 | 119 |
| 143 | 3300046642 | Ga0495634_0533166 | Ga0495634_0533166_43_408 | 119 |
| 144 | 3300049569 | Ga0501032_0186723 | Ga0501032_0186723_97_468 | 119 |
| 145 | 3300049569 | Ga0501032_0352143 | Ga0501032_0352143_516_890 | 119 |
| 146 | 3300049570 | Ga0501033_0258522 | Ga0501033_0258522_455_829 | 119 |
| 147 | 3300049570 | Ga0501033_0686645 | Ga0501033_0686645_312_686 | 119 |
| 148 | 3300049571 | Ga0501034_0025068 | Ga0501034_0025068_3546_3917 | 119 |
| 149 | 3300049571 | Ga0501034_0440653 | Ga0501034_0440653_245_616 | 119 |
| 150 | 3300049571 | Ga0501034_0452261 | Ga0501034_0452261_379_750 | 119 |
| 151 | 3300049571 | Ga0501034_0634382 | Ga0501034_0634382_414_785 | 119 |
| 152 | 3300049572 | Ga0501036_0234433 | Ga0501036_0234433_1071_1436 | 119 |
| 153 | 3300049572 | Ga0501036_0449870 | Ga0501036_0449870_363_734 | 119 |
| 154 | 3300049574 | Ga0501038_0147897 | Ga0501038_0147897_624_995 | 119 |
| 155 | 3300049574 | Ga0501038_0500873 | Ga0501038_0500873_324_689 | 119 |
| 156 | 3300049579 | Ga0501043_0082162 | Ga0501043_0082162_1695_2060 | 119 |
| 157 | 3300049581 | Ga0501047_0162551 | Ga0501047_0162551_287_652 | 119 |
| 158 | 3300049581 | Ga0501047_0267404 | Ga0501047_0267404_760_1131 | 119 |
| 159 | 3300049582 | Ga0501048_0474952 | Ga0501048_0474952_175_549 | 119 |
| 160 | 3300049583 | Ga0501067_0398445 | Ga0501067_0398445_60_431 | 119 |
| 161 | 3300049585 | Ga0501069_0412664 | Ga0501069_0412664_183_551 | 119 |
| 162 | 3300049586 | Ga0501070_0048830 | Ga0501070_0048830_1129_1497 | 119 |
| 163 | 3300049586 | Ga0501070_0156652 | Ga0501070_0156652_974_1345 | 119 |
| 164 | 3300049586 | Ga0501070_0228458 | Ga0501070_0228458_158_532 | 119 |
| 165 | 3300049586 | Ga0501070_0338983 | Ga0501070_0338983_222_593 | 119 |
| 166 | 3300049589 | Ga0501073_0063487 | Ga0501073_0063487_1274_1645 | 119 |
| 167 | 3300049589 | Ga0501073_0647205 | Ga0501073_0647205_145_513 | 119 |
| 168 | 3300049591 | Ga0501075_1244935 | Ga0501075_1244935_26_391 | 119 |
| 169 | 3300049742 | Ga0501080_0154453 | Ga0501080_0154453_544_915 | 119 |
| 170 | 3300049742 | Ga0501080_0553053 | Ga0501080_0553053_354_722 | 119 |
| 171 | 3300049742 | Ga0501080_0904527 | Ga0501080_0904527_155_520 | 119 |
| 172 | 3300049822 | Ga0501035_0082371 | Ga0501035_0082371_1798_2163 | 119 |
| 173 | 3300049822 | Ga0501035_0247919 | Ga0501035_0247919_19_393 | 119 |
| 174 | 3300049822 | Ga0501035_0531725 | Ga0501035_0531725_276_650 | 119 |
| 175 | 3300049823 | Ga0501044_0046132 | Ga0501044_0046132_14_379 | 119 |
| 176 | 3300049823 | Ga0501044_0196016 | Ga0501044_0196016_1206_1580 | 119 |
| 177 | 3300049823 | Ga0501044_0409179 | Ga0501044_0409179_76_450 | 119 |
| 178 | 3300053098 | Ga0500650_0225000 | Ga0500650_0225000_400_777 | 119 |
| 179 | 2162886006 | SwRhRL3b_contig_1929186 | SwRhRL3b_0869.00001330 | 120 |
| 180 | 3300001979 | JGI24740J21852_10000493 | JGI24740J21852_1000049312 | 120 |
| 181 | 3300002704 | JGI25155J39150_1000215 | JGI25155J39150_100021514 | 120 |
| 182 | 3300002705 | JGI25156J39149_1000491 | JGI25156J39149_100049114 | 120 |
| 183 | 3300002737 | JGI25162J39368_1002390 | JGI25162J39368_10023907 | 120 |
| 184 | 3300002737 | JGI25162J39368_1002612 | JGI25162J39368_10026122 | 120 |
| 185 | 3300002738 | JGI25154J39366_1000407 | JGI25154J39366_100040714 | 120 |
| 186 | 3300002741 | JGI25157J39369_1000515 | JGI25157J39369_100051514 | 120 |
| 187 | 3300002987 | JGI25159J45721_1000220 | JGI25159J45721_100022011 | 120 |
| 188 | 3300003214 | JGI25165J46597_1002236 | JGI25165J46597_10022366 | 120 |
| 189 | 3300003214 | JGI25165J46597_1002365 | JGI25165J46597_10023652 | 120 |
| 190 | 3300003214 | JGI25165J46597_1005170 | JGI25165J46597_10051702 | 120 |
| 191 | 3300003214 | JGI25165J46597_1011613 | JGI25165J46597_10116132 | 120 |
| 192 | 3300003316 | rootH1_10094521 | rootH1_100945212 | 120 |
| 193 | 3300003322 | rootL2_10057180 | rootL2_100571801 | 120 |
| 194 | 3300003323 | rootH1_10125481 | rootH1_101254812 | 120 |
| 195 | 3300003354 | JGI25160J50197_1000010 | JGI25160J50197_1000010180 | 120 |
| 196 | 3300003374 | JGI25161J50226_1000006 | JGI25161J50226_1000006180 | 120 |
| 197 | 3300003752 | Ga0055539_1039994 | Ga0055539_10399941 | 120 |
| 198 | 3300004625 | Ga0055543_1000014 | Ga0055543_100001486 | 120 |
| 199 | 3300005262 | Ga0065165_1000262 | Ga0065165_100026291 | 120 |
| 200 | 3300005295 | Ga0065707_10106159 | Ga0065707_101061592 | 120 |
| 201 | 3300005331 | Ga0070670_102039229 | Ga0070670_1020392291 | 120 |
| 202 | 3300005336 | Ga0070680_100004467 | Ga0070680_1000044677 | 120 |
| 203 | 3300005354 | Ga0070675_100302501 | Ga0070675_1003025011 | 120 |
| 204 | 3300005435 | Ga0070714_100000322 | Ga0070714_10000032218 | 120 |
| 205 | 3300005436 | Ga0070713_100298912 | Ga0070713_1002989122 | 120 |
| 206 | 3300005436 | Ga0070713_101455234 | Ga0070713_1014552341 | 120 |
| 207 | 3300005437 | Ga0070710_10072856 | Ga0070710_100728562 | 120 |
| 208 | 3300005439 | Ga0070711_100914459 | Ga0070711_1009144591 | 120 |
| 209 | 3300005458 | Ga0070681_10005353 | Ga0070681_1000535312 | 120 |
| 210 | 3300005530 | Ga0070679_100015110 | Ga0070679_1000151102 | 120 |
| 211 | 3300005535 | Ga0070684_100118245 | Ga0070684_1001182452 | 120 |
| 212 | 3300005535 | Ga0070684_100581834 | Ga0070684_1005818342 | 120 |
| 213 | 3300005539 | Ga0068853_101034159 | Ga0068853_1010341592 | 120 |
| 214 | 3300005545 | Ga0070695_101345403 | Ga0070695_1013454031 | 120 |
| 215 | 3300005548 | Ga0070665_100251843 | Ga0070665_1002518432 | 120 |
| 216 | 3300005563 | Ga0068855_100628731 | Ga0068855_1006287312 | 120 |
| 217 | 3300005578 | Ga0068854_100034168 | Ga0068854_1000341683 | 120 |
| 218 | 3300005578 | Ga0068854_100125624 | Ga0068854_1001256242 | 120 |
| 219 | 3300005614 | Ga0068856_100127073 | Ga0068856_1001270732 | 120 |
| 220 | 3300005614 | Ga0068856_100220330 | Ga0068856_1002203302 | 120 |
| 221 | 3300005614 | Ga0068856_100334493 | Ga0068856_1003344932 | 120 |
| 222 | 3300005937 | Ga0081455_10295005 | Ga0081455_102950052 | 120 |
| 223 | 3300005981 | Ga0081538_10001121 | Ga0081538_1000112116 | 120 |
| 224 | 3300006028 | Ga0070717_10104379 | Ga0070717_101043793 | 120 |
| 225 | 3300006028 | Ga0070717_10601819 | Ga0070717_106018192 | 120 |
| 226 | 3300006163 | Ga0070715_10122700 | Ga0070715_101227002 | 120 |
| 227 | 3300006844 | Ga0075428_100001793 | Ga0075428_1000017936 | 120 |
| 228 | 3300006846 | Ga0075430_100126572 | Ga0075430_1001265723 | 120 |
| 229 | 3300006846 | Ga0075430_100174911 | Ga0075430_1001749113 | 120 |
| 230 | 3300006847 | Ga0075431_100000136 | Ga0075431_10000013624 | 120 |
| 231 | 3300006880 | Ga0075429_100003755 | Ga0075429_1000037554 | 120 |
| 232 | 3300007076 | Ga0075435_100476175 | Ga0075435_1004761752 | 120 |
| 233 | 3300009011 | Ga0105251_10312460 | Ga0105251_103124601 | 120 |
| 234 | 3300009093 | Ga0105240_10000005 | Ga0105240_10000005517 | 120 |
| 235 | 3300009093 | Ga0105240_10022753 | Ga0105240_100227533 | 120 |
| 236 | 3300009093 | Ga0105240_10522214 | Ga0105240_105222142 | 120 |
| 237 | 3300009094 | Ga0111539_10000405 | Ga0111539_1000040542 | 120 |
| 238 | 3300009094 | Ga0111539_10129178 | Ga0111539_101291782 | 120 |
| 239 | 3300009147 | Ga0114129_10002465 | Ga0114129_1000246525 | 120 |
| 240 | 3300009177 | Ga0105248_10651662 | Ga0105248_106516622 | 120 |
| 241 | 3300009545 | Ga0105237_10001882 | Ga0105237_100018828 | 120 |
| 242 | 3300010375 | Ga0105239_10002014 | Ga0105239_100020148 | 120 |
| 243 | 3300013100 | Ga0157373_11118647 | Ga0157373_111186472 | 120 |
| 244 | 3300013104 | Ga0157370_10000274 | Ga0157370_1000027438 | 120 |
| 245 | 3300013104 | Ga0157370_10007782 | Ga0157370_100077827 | 120 |
| 246 | 3300013306 | Ga0163162_11516473 | Ga0163162_115164732 | 120 |
| 247 | 3300013307 | Ga0157372_10745210 | Ga0157372_107452102 | 120 |
| 248 | 3300013308 | Ga0157375_13369553 | Ga0157375_133695531 | 120 |
| 249 | 3300014325 | Ga0163163_10047922 | Ga0163163_100479225 | 120 |
| 250 | 3300014325 | Ga0163163_10452744 | Ga0163163_104527442 | 120 |
| 251 | 3300014325 | Ga0163163_11221870 | Ga0163163_112218702 | 120 |
| 252 | 3300014497 | Ga0182008_10106857 | Ga0182008_101068572 | 120 |
| 253 | 3300014968 | Ga0157379_10416956 | Ga0157379_104169562 | 120 |
| 254 | 3300015262 | Ga0182007_10000711 | Ga0182007_1000071111 | 120 |
| 255 | 3300021361 | Ga0213872_10041927 | Ga0213872_100419272 | 120 |
| 256 | 3300025206 | Ga0209435_100045 | Ga0209435_10004514 | 120 |
| 257 | 3300025208 | Ga0209436_119376 | Ga0209436_1193762 | 120 |
| 258 | 3300025228 | Ga0209672_106967 | Ga0209672_1069672 | 120 |
| 259 | 3300025231 | Ga0207427_105796 | Ga0207427_1057962 | 120 |
| 260 | 3300025231 | Ga0207427_106984 | Ga0207427_1069842 | 120 |
| 261 | 3300025233 | Ga0209437_100047 | Ga0209437_100047304 | 120 |
| 262 | 3300025233 | Ga0209437_100683 | Ga0209437_1006838 | 120 |
| 263 | 3300025246 | Ga0209646_1000154 | Ga0209646_100015414 | 120 |
| 264 | 3300025246 | Ga0209646_1007550 | Ga0209646_10075501 | 120 |
| 265 | 3300025250 | Ga0209026_1000177 | Ga0209026_100017714 | 120 |
| 266 | 3300025253 | Ga0209677_100435 | Ga0209677_1004352 | 120 |
| 267 | 3300025254 | Ga0209148_1015098 | Ga0209148_10150982 | 120 |
| 268 | 3300025256 | Ga0209759_1000795 | Ga0209759_100079514 | 120 |
| 269 | 3300025256 | Ga0209759_1023408 | Ga0209759_10234082 | 120 |
| 270 | 3300025261 | Ga0209233_1000048 | Ga0209233_100004898 | 120 |
| 271 | 3300025261 | Ga0209233_1000069 | Ga0209233_1000069340 | 120 |
| 272 | 3300025261 | Ga0209233_1000221 | Ga0209233_100022143 | 120 |
| 273 | 3300025261 | Ga0209233_1000538 | Ga0209233_100053812 | 120 |
| 274 | 3300025261 | Ga0209233_1025360 | Ga0209233_10253602 | 120 |
| 275 | 3300025272 | Ga0209455_1019419 | Ga0209455_10194192 | 120 |
| 276 | 3300025284 | Ga0209130_1000021 | Ga0209130_100002188 | 120 |
| 277 | 3300025302 | Ga0207426_1000010 | Ga0207426_1000010270 | 120 |
| 278 | 3300025905 | Ga0207685_10068580 | Ga0207685_100685803 | 120 |
| 279 | 3300025906 | Ga0207699_11163496 | Ga0207699_111634962 | 120 |
| 280 | 3300025912 | Ga0207707_10003185 | Ga0207707_100031858 | 120 |
| 281 | 3300025913 | Ga0207695_10000011 | Ga0207695_10000011401 | 120 |
| 282 | 3300025913 | Ga0207695_10210683 | Ga0207695_102106832 | 120 |
| 283 | 3300025913 | Ga0207695_10301706 | Ga0207695_103017062 | 120 |
| 284 | 3300025914 | Ga0207671_10000314 | Ga0207671_1000031446 | 120 |
| 285 | 3300025921 | Ga0207652_10025552 | Ga0207652_100255522 | 120 |
| 286 | 3300025929 | Ga0207664_10605423 | Ga0207664_106054232 | 120 |
| 287 | 3300025939 | Ga0207665_10103211 | Ga0207665_101032112 | 120 |
| 288 | 3300025939 | Ga0207665_10634332 | Ga0207665_106343321 | 120 |
| 289 | 3300025941 | Ga0207711_10265395 | Ga0207711_102653952 | 120 |
| 290 | 3300025944 | Ga0207661_11417978 | Ga0207661_114179782 | 120 |
| 291 | 3300025949 | Ga0207667_10036003 | Ga0207667_100360034 | 120 |
| 292 | 3300025949 | Ga0207667_12222600 | Ga0207667_122226001 | 120 |
| 293 | 3300025981 | Ga0207640_10139796 | Ga0207640_101397962 | 120 |
| 294 | 3300025981 | Ga0207640_11033876 | Ga0207640_110338762 | 120 |
| 295 | 3300026078 | Ga0207702_10094154 | Ga0207702_100941543 | 120 |
| 296 | 3300026078 | Ga0207702_10584365 | Ga0207702_105843652 | 120 |
| 297 | 3300026095 | Ga0207676_10807849 | Ga0207676_108078492 | 120 |
| 298 | 3300027312 | Ga0209371_1008268 | Ga0209371_10082682 | 120 |
| 299 | 3300027312 | Ga0209371_1073192 | Ga0209371_10731922 | 120 |
| 300 | 3300027907 | Ga0207428_10000994 | Ga0207428_100009946 | 120 |
| 301 | 3300028379 | Ga0268266_10903027 | Ga0268266_109030272 | 120 |
| 302 | 3300030500 | Ga0268256_1005022 | Ga0268256_10050224 | 120 |
| 303 | 3300030500 | Ga0268256_1081277 | Ga0268256_10812772 | 120 |
| 304 | 3300031240 | Ga0265320_10005956 | Ga0265320_100059562 | 120 |
| 305 | 3300031507 | Ga0307509_10340691 | Ga0307509_103406912 | 120 |
| 306 | 3300031548 | Ga0307408_100805747 | Ga0307408_1008057472 | 120 |
| 307 | 3300031548 | Ga0307408_101545493 | Ga0307408_1015454932 | 120 |
| 308 | 3300031616 | Ga0307508_10023185 | Ga0307508_100231852 | 120 |
| 309 | 3300031616 | Ga0307508_10813788 | Ga0307508_108137881 | 120 |
| 310 | 3300031711 | Ga0265314_10009562 | Ga0265314_100095622 | 120 |
| 311 | 3300031711 | Ga0265314_10104175 | Ga0265314_101041753 | 120 |
| 312 | 3300031712 | Ga0265342_10046457 | Ga0265342_100464573 | 120 |
| 313 | 3300031824 | Ga0307413_10734516 | Ga0307413_107345162 | 120 |
| 314 | 3300031901 | Ga0307406_10642276 | Ga0307406_106422761 | 120 |
| 315 | 3300031911 | Ga0307412_11085211 | Ga0307412_110852112 | 120 |
| 316 | 3300031995 | Ga0307409_100138932 | Ga0307409_1001389322 | 120 |
| 317 | 3300031995 | Ga0307409_101028651 | Ga0307409_1010286512 | 120 |
| 318 | 3300032002 | Ga0307416_100403081 | Ga0307416_1004030812 | 120 |
| 319 | 3300032004 | Ga0307414_10407181 | Ga0307414_104071812 | 120 |
| 320 | 3300032005 | Ga0307411_11601132 | Ga0307411_116011322 | 120 |
| 321 | 3300032126 | Ga0307415_101428852 | Ga0307415_1014288522 | 120 |
| 322 | 3300035090 | Ga0373949_0095895 | Ga0373949_0095895_361_723 | 120 |
| 323 | 3300035091 | Ga0373951_0149095 | Ga0373951_0149095_51_413 | 120 |
| 324 | 3300035692 | Ga0373935_0041040 | Ga0373935_0041040_1694_2056 | 120 |
| 325 | 3300035695 | Ga0373927_0000343 | Ga0373927_0000343_28026_28388 | 120 |
| 326 | 3300035725 | Ga0373947_0390934 | Ga0373947_0390934_238_600 | 120 |
| 327 | 3300037068 | Ga0373925_0006509 | Ga0373925_0006509_4380_4742 | 120 |
| 328 | 3300037068 | Ga0373925_1264798 | Ga0373925_1264798_162_539 | 120 |
| 329 | 3300037312 | Ga0395899_0038881 | Ga0395899_0038881_2426_2803 | 120 |
| 330 | 3300037418 | Ga0395900_0934227 | Ga0395900_0934227_357_734 | 120 |
| 331 | 3300037853 | Ga0436364_0619236 | Ga0436364_0619236_6526_6903 | 120 |
| 332 | 3300038443 | Ga0395901_0032619 | Ga0395901_0032619_3631_4008 | 120 |
| 333 | 3300039437 | Ga0436365_0615018 | Ga0436365_0615018_331_708 | 120 |
| 334 | 3300039437 | Ga0436365_0620338 | Ga0436365_0620338_119_496 | 120 |
| 335 | 3300039437 | Ga0436365_1010111 | Ga0436365_1010111_481_858 | 120 |
| 336 | 3300039437 | Ga0436365_1171900 | Ga0436365_1171900_3258_3635 | 120 |
| 337 | 3300039438 | Ga0436360_1293286 | Ga0436360_1293286_326_703 | 120 |
| 338 | 3300039447 | Ga0436361_0761415 | Ga0436361_0761415_6496_6873 | 120 |
| 339 | 3300039450 | Ga0436363_0646758 | Ga0436363_0646758_764_1138 | 120 |
| 340 | 3300039450 | Ga0436363_1460995 | Ga0436363_1460995_22_399 | 120 |
| 341 | 3300042004 | Ga0439445_0109064 | Ga0439445_0109064_53_415 | 120 |
| 342 | 3300042125 | Ga0450923_041826 | Ga0450923_041826_132_509 | 120 |
| 343 | 3300042145 | Ga0450906_067842 | Ga0450906_067842_120_497 | 120 |
| 344 | 3300042461 | Ga0439460_0061457 | Ga0439460_0061457_191_568 | 120 |
| 345 | 3300044673 | Ga0453683_0068649 | Ga0453683_0068649_902_1279 | 120 |
| 346 | 3300044706 | Ga0466964_0543623 | Ga0466964_0543623_103_489 | 120 |
| 347 | 3300044712 | Ga0453684_0048098 | Ga0453684_0048098_2839_3216 | 120 |
| 348 | 3300045051 | Ga0451576_0000301 | Ga0451576_0000301_31464_31841 | 120 |
| 349 | 3300045051 | Ga0451576_0176824 | Ga0451576_0176824_761_1138 | 120 |
| 350 | 3300046454 | Ga0495592_0185565 | Ga0495592_0185565_456_818 | 120 |
| 351 | 3300046459 | Ga0495629_0032776 | Ga0495629_0032776_1473_1835 | 120 |
| 352 | 3300046475 | Ga0495639_0352064 | Ga0495639_0352064_101_478 | 120 |
| 353 | 3300046507 | Ga0495606_0049506 | Ga0495606_0049506_2380_2742 | 120 |
| 354 | 3300046507 | Ga0495606_0288339 | Ga0495606_0288339_503_865 | 120 |
| 355 | 3300046514 | Ga0495618_0417424 | Ga0495618_0417424_293_670 | 120 |
| 356 | 3300046522 | Ga0495643_0109188 | Ga0495643_0109188_843_1205 | 120 |
| 357 | 3300046533 | Ga0495640_0436119 | Ga0495640_0436119_303_665 | 120 |
| 358 | 3300046557 | Ga0495622_0024538 | Ga0495622_0024538_890_1252 | 120 |
| 359 | 3300046642 | Ga0495634_0089555 | Ga0495634_0089555_93_458 | 120 |
| 360 | 3300046663 | Ga0495635_0186022 | Ga0495635_0186022_447_809 | 120 |
| 361 | 3300046674 | Ga0495588_0085293 | Ga0495588_0085293_254_616 | 120 |
| 362 | 3300046675 | Ga0495657_0018964 | Ga0495657_0018964_1408_1770 | 120 |
| 363 | 3300046683 | Ga0495658_0085790 | Ga0495658_0085790_1091_1456 | 120 |
| 364 | 3300046690 | Ga0495624_0039465 | Ga0495624_0039465_1726_2088 | 120 |
| 365 | 3300046691 | Ga0495670_0232613 | Ga0495670_0232613_335_697 | 120 |
| 366 | 3300046809 | Ga0495600_0072162 | Ga0495600_0072162_1087_1452 | 120 |
| 367 | 3300046809 | Ga0495600_0893438 | Ga0495600_0893438_92_469 | 120 |
| 368 | 3300047315 | Ga0495581_0078819 | Ga0495581_0078819_887_1264 | 120 |
| 369 | 3300047317 | Ga0495604_0077315 | Ga0495604_0077315_357_719 | 120 |
| 370 | 3300047673 | Ga0495593_0100348 | Ga0495593_0100348_827_1189 | 120 |
| 371 | 3300048903 | Ga0496100_0028499 | Ga0496100_0028499_257_619 | 120 |
| 372 | 3300048903 | Ga0496100_0173746 | Ga0496100_0173746_118_495 | 120 |
| 373 | 3300048903 | Ga0496100_0532169 | Ga0496100_0532169_188_565 | 120 |
| 374 | 3300048903 | Ga0496100_0797121 | Ga0496100_0797121_261_623 | 120 |
| 375 | 3300048904 | Ga0496101_0024916 | Ga0496101_0024916_2773_3150 | 120 |
| 376 | 3300048904 | Ga0496101_0292011 | Ga0496101_0292011_726_1103 | 120 |
| 377 | 3300048905 | Ga0496102_0051810 | Ga0496102_0051810_415_777 | 120 |
| 378 | 3300048905 | Ga0496102_0616606 | Ga0496102_0616606_578_955 | 120 |
| 379 | 3300048906 | Ga0496103_0024597 | Ga0496103_0024597_2806_3168 | 120 |
| 380 | 3300048906 | Ga0496103_0138319 | Ga0496103_0138319_204_581 | 120 |
| 381 | 3300048907 | Ga0496104_0000042 | Ga0496104_0000042_24103_24480 | 120 |
| 382 | 3300048907 | Ga0496104_0036532 | Ga0496104_0036532_1852_2229 | 120 |
| 383 | 3300048907 | Ga0496104_0435970 | Ga0496104_0435970_611_973 | 120 |
| 384 | 3300048907 | Ga0496104_0583201 | Ga0496104_0583201_582_959 | 120 |
| 385 | 3300048907 | Ga0496104_1594838 | Ga0496104_1594838_152_529 | 120 |
| 386 | 3300048908 | Ga0496105_0000046 | Ga0496105_0000046_56199_56576 | 120 |
| 387 | 3300048908 | Ga0496105_0004982 | Ga0496105_0004982_5004_5381 | 120 |
| 388 | 3300048908 | Ga0496105_0067827 | Ga0496105_0067827_582_959 | 120 |
| 389 | 3300048908 | Ga0496105_0068832 | Ga0496105_0068832_754_1131 | 120 |
| 390 | 3300048908 | Ga0496105_0074279 | Ga0496105_0074279_1725_2102 | 120 |
| 391 | 3300048908 | Ga0496105_0708083 | Ga0496105_0708083_46_423 | 120 |
| 392 | 3300048909 | Ga0496106_0087927 | Ga0496106_0087927_1494_1871 | 120 |
| 393 | 3300048911 | Ga0496108_0001365 | Ga0496108_0001365_3082_3459 | 120 |
| 394 | 3300048913 | Ga0496110_0044229 | Ga0496110_0044229_2087_2464 | 120 |
| 395 | 3300048913 | Ga0496110_0090787 | Ga0496110_0090787_1247_1624 | 120 |
| 396 | 3300048913 | Ga0496110_0601452 | Ga0496110_0601452_276_653 | 120 |
| 397 | 3300048914 | Ga0496111_0000226 | Ga0496111_0000226_23479_23856 | 120 |
| 398 | 3300048915 | Ga0496112_0007460 | Ga0496112_0007460_9173_9550 | 120 |
| 399 | 3300048915 | Ga0496112_0101461 | Ga0496112_0101461_215_592 | 120 |
| 400 | 3300048915 | Ga0496112_0240216 | Ga0496112_0240216_1203_1580 | 120 |
| 401 | 3300048916 | Ga0496113_0004784 | Ga0496113_0004784_1155_1532 | 120 |
| 402 | 3300048916 | Ga0496113_0077691 | Ga0496113_0077691_1818_2195 | 120 |
| 403 | 3300048916 | Ga0496113_0142658 | Ga0496113_0142658_1307_1684 | 120 |
| 404 | 3300048917 | Ga0496114_0129872 | Ga0496114_0129872_1466_1828 | 120 |
| 405 | 3300048918 | Ga0496115_0006892 | Ga0496115_0006892_5207_5584 | 120 |
| 406 | 3300048918 | Ga0496115_1155935 | Ga0496115_1155935_96_458 | 120 |
| 407 | 3300048919 | Ga0496116_0031573 | Ga0496116_0031573_1682_2044 | 120 |
| 408 | 3300048920 | Ga0496117_0000641 | Ga0496117_0000641_6082_6444 | 120 |
| 409 | 3300048921 | Ga0496118_0002328 | Ga0496118_0002328_18119_18481 | 120 |
| 410 | 3300048922 | Ga0496119_0000343 | Ga0496119_0000343_38688_39065 | 120 |
| 411 | 3300048922 | Ga0496119_0007704 | Ga0496119_0007704_5605_5967 | 120 |
| 412 | 3300048922 | Ga0496119_0044327 | Ga0496119_0044327_1800_2162 | 120 |
| 413 | 3300048923 | Ga0496120_0013368 | Ga0496120_0013368_1902_2264 | 120 |
| 414 | 3300048924 | Ga0496121_0004370 | Ga0496121_0004370_2359_2721 | 120 |
| 415 | 3300048925 | Ga0496122_0023168 | Ga0496122_0023168_3191_3553 | 120 |
| 416 | 3300048925 | Ga0496122_0073872 | Ga0496122_0073872_1719_2081 | 120 |
| 417 | 3300048926 | Ga0496123_0024172 | Ga0496123_0024172_1416_1778 | 120 |
| 418 | 3300048926 | Ga0496123_0048441 | Ga0496123_0048441_594_956 | 120 |
| 419 | 3300048927 | Ga0496124_0010738 | Ga0496124_0010738_3051_3413 | 120 |
| 420 | 3300048928 | Ga0496125_0046959 | Ga0496125_0046959_398_760 | 120 |
| 421 | 3300048928 | Ga0496125_0079656 | Ga0496125_0079656_1671_2048 | 120 |
| 422 | 3300048928 | Ga0496125_0317572 | Ga0496125_0317572_15_377 | 120 |
| 423 | 3300048929 | Ga0496126_0033052 | Ga0496126_0033052_1742_2104 | 120 |
| 424 | 3300048929 | Ga0496126_0376922 | Ga0496126_0376922_41_412 | 120 |
| 425 | 3300048929 | Ga0496126_0445890 | Ga0496126_0445890_446_808 | 120 |
| 426 | 3300048929 | Ga0496126_0641260 | Ga0496126_0641260_149_526 | 120 |
| 427 | 3300048929 | Ga0496126_0771912 | Ga0496126_0771912_237_599 | 120 |
| 428 | 3300049534 | Ga0501318_077973 | Ga0501318_077973_142_519 | 120 |
| 429 | 3300049571 | Ga0501034_0131294 | Ga0501034_0131294_1175_1552 | 120 |
| 430 | 3300049572 | Ga0501036_0107400 | Ga0501036_0107400_504_881 | 120 |
| 431 | 3300049574 | Ga0501038_0151685 | Ga0501038_0151685_963_1340 | 120 |
| 432 | 3300049574 | Ga0501038_0773757 | Ga0501038_0773757_25_402 | 120 |
| 433 | 3300049575 | Ga0501039_0353444 | Ga0501039_0353444_421_798 | 120 |
| 434 | 3300049576 | Ga0501040_0668066 | Ga0501040_0668066_315_692 | 120 |
| 435 | 3300049578 | Ga0501042_0386036 | Ga0501042_0386036_397_774 | 120 |
| 436 | 3300049579 | Ga0501043_0134382 | Ga0501043_0134382_897_1274 | 120 |
| 437 | 3300049580 | Ga0501046_1059690 | Ga0501046_1059690_154_531 | 120 |
| 438 | 3300049587 | Ga0501071_0018571 | Ga0501071_0018571_619_996 | 120 |
| 439 | 3300049587 | Ga0501071_0506632 | Ga0501071_0506632_483_860 | 120 |
| 440 | 3300049588 | Ga0501072_0089064 | Ga0501072_0089064_1210_1587 | 120 |
| 441 | 3300049589 | Ga0501073_0117728 | Ga0501073_0117728_407_784 | 120 |
| 442 | 3300049591 | Ga0501075_0041783 | Ga0501075_0041783_967_1344 | 120 |
| 443 | 3300049592 | Ga0501076_0011306 | Ga0501076_0011306_2361_2738 | 120 |
| 444 | 3300049593 | Ga0501077_0091604 | Ga0501077_0091604_19_396 | 120 |
| 445 | 3300049742 | Ga0501080_0087351 | Ga0501080_0087351_750_1127 | 120 |
| 446 | 3300049743 | Ga0501081_0037297 | Ga0501081_0037297_1106_1483 | 120 |
| 447 | 3300049824 | Ga0501045_0092474 | Ga0501045_0092474_849_1226 | 120 |
| 448 | 3300049824 | Ga0501045_1345385 | Ga0501045_1345385_81_464 | 120 |
| 449 | 3300050507 | nmdc:mga05p37_2000190_c1 | nmdc:mga05p37_2000190_c1_91_453 | 120 |
| 450 | 3300050507 | nmdc:mga05p37_74_c1 | nmdc:mga05p37_74_c1_34327_34704 | 120 |
| 451 | 3300050508 | nmdc:mga09592_3887_c1 | nmdc:mga09592_3887_c1_9950_10327 | 120 |
| 452 | 3300050509 | nmdc:mga0qj67_29405_c1 | nmdc:mga0qj67_29405_c1_1781_2158 | 120 |
| 453 | 3300050509 | nmdc:mga0qj67_677782_c1 | nmdc:mga0qj67_677782_c1_77_454 | 120 |
| 454 | 3300050510 | nmdc:mga06r32_2556_c1 | nmdc:mga06r32_2556_c1_10410_10787 | 120 |
| 455 | 3300050511 | nmdc:mga08y16_373_c1 | nmdc:mga08y16_373_c1_5119_5496 | 120 |
| 456 | 3300050513 | nmdc:mga0rr50_156504_c1 | nmdc:mga0rr50_156504_c1_1309_1671 | 120 |
| 457 | 3300053088 | Ga0500644_0090260 | Ga0500644_0090260_571_933 | 120 |
| 458 | 3300053122 | Ga0500608_004923 | Ga0500608_004923_2832_3194 | 120 |
| 459 | 3300053156 | Ga0500622_0000830 | Ga0500622_0000830_9846_10208 | 120 |
| 460 | 3300053158 | Ga0500627_0258898 | Ga0500627_0258898_383_745 | 120 |
| 461 | 3300054114 | Ga0501084_0336302 | Ga0501084_0336302_411_788 | 120 |
| 462 | 3300059491 | Ga0587070_033407 | Ga0587070_033407_158_520 | 120 |
| 463 | 3300059504 | Ga0587082_112808 | Ga0587082_112808_222_584 | 120 |
| 464 | 3300059505 | Ga0587083_0098640 | Ga0587083_0098640_159_521 | 120 |
| 465 | 3300059508 | Ga0587088_059501 | Ga0587088_059501_243_605 | 120 |
| 466 | 3300059510 | Ga0587090_013757 | Ga0587090_013757_203_565 | 120 |
| 467 | 3300059511 | Ga0587091_022963 | Ga0587091_022963_542_904 | 120 |
| 468 | 3300059512 | Ga0587092_107772 | Ga0587092_107772_29_391 | 120 |
| 469 | 3300059605 | Ga0587106_017787 | Ga0587106_017787_442_804 | 120 |
| 470 | 3300059641 | Ga0587068_098900 | Ga0587068_098900_138_500 | 120 |
| 471 | 3300059642 | Ga0587069_019447 | Ga0587069_019447_465_827 | 120 |
| 472 | 3300059643 | Ga0587072_015969 | Ga0587072_015969_594_956 | 120 |
| 473 | 3300059644 | Ga0587075_011359 | Ga0587075_011359_211_573 | 120 |
| 474 | 3300059645 | Ga0587076_003992 | Ga0587076_003992_162_524 | 120 |
| 475 | 3300059647 | Ga0587079_020181 | Ga0587079_020181_575_937 | 120 |
| 476 | 3300059652 | Ga0587107_042627 | Ga0587107_042627_205_567 | 120 |
| 477 | 3300059659 | Ga0587120_013485 | Ga0587120_013485_69_431 | 120 |
| 478 | 3300060247 | Ga0587096_04485 | Ga0587096_04485_203_565 | 120 |
| 479 | 3300060344 | Ga0587071_018194 | Ga0587071_018194_548_910 | 120 |
| 480 | 3300060346 | Ga0587111_0144204 | Ga0587111_0144204_211_573 | 120 |
| 481 | 3300061719 | Ga0466962_0043823 | Ga0466962_0043823_638_1000 | 120 |
| 482 | 3300061719 | Ga0466962_0221092 | Ga0466962_0221092_363_740 | 120 |
| 483 | 3300061734 | Ga0530510_0053458 | Ga0530510_0053458_530_907 | 120 |
| 484 | 3300061734 | Ga0530510_0506140 | Ga0530510_0506140_344_721 | 120 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1onl-assembly3.cif.gz_C | crystal structure of thermus thermophilus hb8 h-protein of the glycine cleavage system | 0.9863 | 2 | 119 |
| 1zko-assembly1.cif.gz_A | crystal structure of glycine cleavage system h protein (tm0212) from thermotoga maritima at 1.65 a resolution | 0.9813 | 1 | 118 |
| 3wdn-assembly1.cif.gz_A | high-resolution x-ray crystal structure of bovine h-protein using a high-pressure cryocooling method | 0.977 | 1 | 119 |
| 1htp-assembly1.cif.gz_A | refined structures at 2 angstroms and 2.2 angstroms of the two forms of the h-protein, a lipoamide-containing protein of the glycine decarboxylase complex | 0.9762 | 2 | 117 |
| 3a7a-assembly1.cif.gz_B | crystal structure of e. coli lipoate-protein ligase a in complex with octyl-amp and apoh-protein | 0.9637 | 2 | 119 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q5AKX1_36_173_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9819 | 1 | 119 | 2.40.50.100 |
| af_Q20634_6_139_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9788 | 2 | 118 | 2.40.50.100 |
| 3wdnA00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9763 | 1 | 119 | 2.40.50.100 |
| af_Q9U616_24_160_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.974 | 2 | 120 | 2.40.50.100 |
| af_Q54JV8_6_144_2.40.50.100 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain | 0.9736 | 2 | 120 | 2.40.50.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7S3GD37-F1-model_v4 | Glycine cleavage system H protein | 0.9942 | 1 | 102 |
GO:0005739
GO:0005960 GO:0019464 |
| AF-A0A356TLI4-F1-model_v4 | Glycine cleavage system H protein | 0.9911 | 2 | 119 |
GO:0005829
GO:0005960 GO:0019464 |
| AF-A0A2U2DT81-F1-model_v4 | Glycine cleavage system H protein | 0.9908 | 1 | 120 |
GO:0005737
GO:0005960 GO:0019464 |
| AF-A0A077X1S6-F1-model_v4 | Glycine cleavage system H protein | 0.9908 | 1 | 118 |
GO:0005739
GO:0005960 GO:0019464 |
| AF-A0A3B8UCB1-F1-model_v4 | Glycine cleavage system H protein | 0.9906 | 3 | 101 |
GO:0005737
GO:0005960 GO:0019464 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar