F452920

General Info

Members Datasets Scaffolds Average Seq Length
484 336 444 121

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10129178|Ga0111539_101291782
Length 134
Sequence VVQIRGIRMANIGYTKDHEWIRVDGDTGTVGISNYAQAQLGDVVYIELPAIGKAIGKGQEVAVVESVKAASEVYAPMAGEVIAVNSELEGAPAKVNEDAEGGGWFLKLRLANAAEFADLMNEEQYKAFLQTIDQ

Samples

Sample ID Description Type Environment
1 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
2 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
3 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
4 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
5 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
6 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
7 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
8 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
9 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
10 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
11 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
12 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
13 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
14 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
15 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
16 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
17 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
18 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
19 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
20 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
21 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
22 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
23 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
24 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
25 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
26 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
27 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
28 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
29 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
30 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
31 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
32 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
33 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere
34 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
35 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
36 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
37 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
38 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
39 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
40 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
41 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
42 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
43 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
44 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
45 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
46 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
47 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
48 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
49 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
50 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
51 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
52 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
53 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
54 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
55 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
56 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
57 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
58 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
59 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
60 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
61 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
62 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
63 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
64 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
65 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
66 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
67 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
68 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
69 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
70 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
71 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
72 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
73 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
74 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
75 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
76 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
77 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
78 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
79 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
80 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
81 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
82 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
83 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
84 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
85 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
86 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
87 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
88 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
89 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
90 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
91 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
93 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
94 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
95 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
96 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
97 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
98 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
100 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
101 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
102 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
105 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
106 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
109 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
110 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
115 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
118 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
119 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
120 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
121 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
122 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
124 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
125 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
126 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
127 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
130 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
131 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
133 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
134 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
162 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
166 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
167 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
168 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
169 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
170 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
171 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
172 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
173 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
174 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
175 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
176 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
177 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
178 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
179 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
180 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
181 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
182 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
183 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
184 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
185 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
186 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
187 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
188 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
189 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
190 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
191 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
192 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
193 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
194 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
195 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
196 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
197 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
198 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
199 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
200 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
201 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
202 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
203 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
204 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
205 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
206 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
207 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
208 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
209 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
210 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
211 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
212 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
213 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
214 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
215 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
216 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
217 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
218 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
219 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
220 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
221 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
222 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
223 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
224 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
225 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
226 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
227 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
228 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
229 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
230 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
231 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
232 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
233 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
234 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
235 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
236 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
237 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
238 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
239 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
240 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
241 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
242 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
243 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
244 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
245 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
246 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
247 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
248 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
249 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
250 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
251 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
252 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
253 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
254 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
255 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
256 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
257 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
258 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
259 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
260 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
261 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
262 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
263 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
264 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
265 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
266 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
267 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
268 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
269 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
270 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
283 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
284 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
285 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
286 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
287 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
288 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
289 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
290 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
291 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
292 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
293 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
296 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
297 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
298 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
299 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
300 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
301 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
302 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
303 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
304 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
305 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
306 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
307 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
308 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
309 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
310 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
311 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
312 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
313 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
314 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
315 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
316 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
317 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
318 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
319 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
320 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
321 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
322 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
323 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
324 3300059659 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
325 3300060247 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 61R_AD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
326 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
327 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
328 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
329 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
330 8002060224 Methylocystis sp. Sn-Cys Isolate Unclassified
331 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
332 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
333 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
334 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
335 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
336 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.4
Metatranscriptomes 4.13
Isolates 8.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.02
Nodule 3.1
Rhizoplane 9.5
Rhizosphere 68.18
Stem 0
Stem Tuber 0
Unclassified 12.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL3b_contig_1929186 2162886006 Bacteria 1118
2 JGI24740J21852_10000493 3300001979 Bacteria 16930
3 JGI25155J39150_1000215 3300002704 Bacteria 23334
4 JGI25156J39149_1000491 3300002705 Bacteria 23712
5 JGI25162J39368_1002390 3300002737 Bacteria 7381
6 JGI25162J39368_1002612 3300002737 Bacteria 6743
7 JGI25154J39366_1000407 3300002738 Bacteria 23364
8 JGI25157J39369_1000515 3300002741 Bacteria 23712
9 JGI25159J45721_1000220 3300002987 Bacteria 26975
10 JGI25165J46597_1002236 3300003214 Bacteria 6742
11 JGI25165J46597_1002365 3300003214 Bacteria 6313
12 JGI25165J46597_1005170 3300003214 Bacteria 2580
13 JGI25165J46597_1011613 3300003214 Bacteria 1254
14 rootH1_10094521 3300003316 Bacteria 1112
15 rootL2_10057180 3300003322 Bacteria 2012
16 rootH1_10125481 3300003316 Bacteria 1680
17 rootH1_10125481 3300003323 Bacteria 1709
18 JGI25160J50197_1000010 3300003354 Bacteria 279365
19 JGI25161J50226_1000006 3300003374 Bacteria 279563
20 Ga0055539_1039994 3300003752 Bacteria 506
21 Ga0055543_1000014 3300004625 Bacteria 177906
22 Ga0065165_1000262 3300005262 Bacteria 90720
23 Ga0065707_10106159 3300005295 Bacteria 2609
24 Ga0065707_10499855 3300005295 Bacteria 758
25 Ga0070676_10143794 3300005328 Bacteria 1521
26 Ga0070670_102039229 3300005331 Bacteria 529
27 Ga0068869_101482007 3300005334 Bacteria 602
28 Ga0070680_100004467 3300005336 Bacteria 10538
29 Ga0070689_100516306 3300005340 Bacteria 1025
30 Ga0070668_100086464 3300005347 Bacteria 2465
31 Ga0070669_100679790 3300005353 Bacteria 868
32 Ga0070675_100302501 3300005354 Bacteria 1409
33 Ga0070675_100637336 3300005354 Bacteria 968
34 Ga0070671_100499752 3300005355 Bacteria 1046
35 Ga0070667_100190717 3300005367 Bacteria 1816
36 Ga0070714_100000322 3300005435 Bacteria 36166
37 Ga0070713_100298912 3300005436 Bacteria 1481
38 Ga0070713_101455234 3300005436 Bacteria 665
39 Ga0070710_10072856 3300005437 Bacteria 1984
40 Ga0070711_100914459 3300005439 Bacteria 749
41 Ga0070705_101338340 3300005440 Bacteria 595
42 Ga0070694_101123493 3300005444 Bacteria 656
43 Ga0070678_100801747 3300005456 Bacteria 855
44 Ga0070662_100494836 3300005457 Bacteria 1019
45 Ga0070681_10005353 3300005458 Bacteria 12389
46 Ga0068867_100202659 3300005459 Bacteria 1589
47 Ga0068867_101124150 3300005459 Bacteria 718
48 Ga0070699_100002280 3300005518 Bacteria 17267
49 Ga0070679_100015110 3300005530 Bacteria 7420
50 Ga0070684_100118245 3300005535 Bacteria 2382
51 Ga0070684_100581834 3300005535 Bacteria 1040
52 Ga0068853_101034159 3300005539 Bacteria 791
53 Ga0070695_101345403 3300005545 Bacteria 591
54 Ga0070696_101218710 3300005546 Unclassified 636
55 Ga0070696_101706483 3300005546 Bacteria 543
56 Ga0070665_100251843 3300005548 Bacteria 1767
57 Ga0068855_100628731 3300005563 Bacteria 1155
58 Ga0068857_102171808 3300005577 Bacteria 545
59 Ga0068854_100034168 3300005578 Bacteria 3550
60 Ga0068854_100125624 3300005578 Bacteria 1953
61 Ga0068856_100127073 3300005614 Bacteria 2553
62 Ga0068856_100220330 3300005614 Bacteria 1913
63 Ga0068856_100334493 3300005614 Bacteria 1532
64 Ga0068859_100172431 3300005617 Unclassified 2245
65 Ga0068861_100663012 3300005719 Bacteria 965
66 Ga0068861_100977076 3300005719 Bacteria 807
67 Ga0068862_100125161 3300005844 Bacteria 2269
68 Ga0081455_10295005 3300005937 Bacteria 1166
69 Ga0081538_10001121 3300005981 Bacteria 28389
70 Ga0070717_10104379 3300006028 Bacteria 2411
71 Ga0070717_10601819 3300006028 Bacteria 997
72 Ga0070715_10122700 3300006163 Bacteria 1240
73 Ga0097621_100688634 3300006237 Bacteria 940
74 Ga0075370_10183863 3300006353 Bacteria 1231
75 Ga0075428_100001793 3300006844 Bacteria 22956
76 Ga0075428_100285798 3300006844 Bacteria 1775
77 Ga0075430_100126572 3300006846 Bacteria 2130
78 Ga0075430_100174911 3300006846 Bacteria 1786
79 Ga0075430_100874367 3300006846 Bacteria 741
80 Ga0075431_100000136 3300006847 Bacteria 49311
81 Ga0075433_11547976 3300006852 Unclassified 572
82 Ga0075429_100003755 3300006880 Bacteria 12949
83 Ga0097620_100172443 3300006931 Unclassified 2245
84 Ga0075435_100476175 3300007076 Bacteria 1078
85 Ga0105251_10312460 3300009011 Bacteria 713
86 Ga0105240_10000005 3300009093 Bacteria 702630
87 Ga0105240_10022753 3300009093 Bacteria 8303
88 Ga0105240_10522214 3300009093 Bacteria 1317
89 Ga0111539_10000405 3300009094 Bacteria 53738
90 Ga0111539_10129178 3300009094 Bacteria 2959
91 Ga0111539_12721879 3300009094 Bacteria 573
92 Ga0114129_10002465 3300009147 Bacteria 25697
93 Ga0105243_10764574 3300009148 Bacteria 949
94 Ga0105248_10651662 3300009177 Bacteria 1188
95 Ga0105237_10001882 3300009545 Bacteria 26776
96 Ga0105239_10002014 3300010375 Bacteria 26368
97 Ga0157373_11118647 3300013100 Bacteria 591
98 Ga0157370_10000274 3300013104 Bacteria 65400
99 Ga0157370_10007782 3300013104 Bacteria 11617
100 Ga0157374_10161925 3300013296 Bacteria 2179
101 Ga0163162_11516473 3300013306 Bacteria 764
102 Ga0157372_10745210 3300013307 Bacteria 1139
103 Ga0157375_13369553 3300013308 Bacteria 532
104 Ga0163163_10047922 3300014325 Bacteria 4201
105 Ga0163163_10452744 3300014325 Bacteria 1344
106 Ga0163163_11221870 3300014325 Unclassified 814
107 Ga0182008_10106857 3300014497 Bacteria 1385
108 Ga0157379_10416956 3300014968 Bacteria 1236
109 Ga0182007_10000711 3300015262 Bacteria 18942
110 Ga0213872_10041927 3300021361 Bacteria 2088
111 Ga0213875_10176050 3300021388 Bacteria 1005
112 Ga0209435_100045 3300025206 Bacteria 96483
113 Ga0209436_119376 3300025208 Bacteria 945
114 Ga0209672_106967 3300025228 Bacteria 1788
115 Ga0207427_105796 3300025231 Bacteria 1678
116 Ga0207427_106984 3300025231 Bacteria 1367
117 Ga0209437_100047 3300025233 Bacteria 405163
118 Ga0209437_100683 3300025233 Bacteria 18100
119 Ga0209646_1000154 3300025246 Bacteria 96483
120 Ga0209646_1007550 3300025246 Bacteria 1771
121 Ga0209026_1000177 3300025250 Bacteria 96629
122 Ga0209677_100435 3300025253 Bacteria 24526
123 Ga0209148_1015098 3300025254 Bacteria 1356
124 Ga0209759_1000795 3300025256 Bacteria 25746
125 Ga0209759_1023408 3300025256 Bacteria 1360
126 Ga0209233_1000048 3300025261 Bacteria 453669
127 Ga0209233_1000069 3300025261 Bacteria 367639
128 Ga0209233_1000221 3300025261 Bacteria 104090
129 Ga0209233_1000538 3300025261 Bacteria 21535
130 Ga0209233_1025360 3300025261 Bacteria 1468
131 Ga0209455_1019419 3300025272 Bacteria 1374
132 Ga0209130_1000021 3300025284 Bacteria 374278
133 Ga0207426_1000010 3300025302 Bacteria 796003
134 Ga0207642_11155190 3300025899 Bacteria 502
135 Ga0207688_10484093 3300025901 Bacteria 774
136 Ga0207685_10068580 3300025905 Bacteria 1430
137 Ga0207699_11163496 3300025906 Bacteria 571
138 Ga0207645_10047498 3300025907 Bacteria 2741
139 Ga0207707_10003185 3300025912 Bacteria 14568
140 Ga0207695_10000011 3300025913 Bacteria 910221
141 Ga0207695_10210683 3300025913 Bacteria 1854
142 Ga0207695_10301706 3300025913 Bacteria 1493
143 Ga0207671_10000314 3300025914 Bacteria 71414
144 Ga0207652_10025552 3300025921 Bacteria 4911
145 Ga0207681_10662281 3300025923 Bacteria 866
146 Ga0207659_10640509 3300025926 Bacteria 908
147 Ga0207664_10605423 3300025929 Bacteria 984
148 Ga0207644_11261711 3300025931 Bacteria 621
149 Ga0207706_10590149 3300025933 Bacteria 955
150 Ga0207686_11447375 3300025934 Bacteria 566
151 Ga0207665_10103211 3300025939 Bacteria 1994
152 Ga0207665_10634332 3300025939 Bacteria 836
153 Ga0207711_10265395 3300025941 Bacteria 1579
154 Ga0207661_11417978 3300025944 Bacteria 637
155 Ga0207667_10036003 3300025949 Bacteria 5307
156 Ga0207667_12222600 3300025949 Bacteria 505
157 Ga0207640_10139796 3300025981 Bacteria 1763
158 Ga0207640_11033876 3300025981 Bacteria 724
159 Ga0207658_10082837 3300025986 Bacteria 2464
160 Ga0207702_10094154 3300026078 Bacteria 2629
161 Ga0207702_10584365 3300026078 Bacteria 1095
162 Ga0207648_10776405 3300026089 Bacteria 891
163 Ga0207648_11408762 3300026089 Bacteria 655
164 Ga0207676_10807849 3300026095 Bacteria 915
165 Ga0207674_10457542 3300026116 Bacteria 1233
166 Ga0207675_100479889 3300026118 Bacteria 1235
167 Ga0207675_100673585 3300026118 Bacteria 1042
168 Ga0209371_1008268 3300027312 Bacteria 3487
169 Ga0209371_1073192 3300027312 Bacteria 605
170 Ga0207428_10000994 3300027907 Bacteria 31445
171 Ga0268266_10088839 3300028379 Bacteria 2705
172 Ga0268266_10903027 3300028379 Bacteria 854
173 Ga0268265_10118081 3300028380 Bacteria 2180
174 Ga0268264_10129614 3300028381 Bacteria 2234
175 Ga0265318_10103068 3300028577 Unclassified 1050
176 Ga0268256_1005022 3300030500 Bacteria 5308
177 Ga0268256_1081277 3300030500 Bacteria 606
178 Ga0316176_1010088 3300030732 Bacteria 967
179 Ga0314311_1239489 3300030733 Bacteria 1454
180 Ga0265320_10005956 3300031240 Bacteria 7749
181 Ga0265320_10128905 3300031240 Bacteria 1150
182 Ga0265325_10018843 3300031241 Bacteria 3825
183 Ga0265340_10011313 3300031247 Bacteria 4746
184 Ga0265331_10149197 3300031250 Bacteria 1062
185 Ga0265327_10229938 3300031251 Bacteria 831
186 Ga0307509_10340691 3300031507 Bacteria 1227
187 Ga0307408_100396530 3300031548 Bacteria 1184
188 Ga0307408_100805747 3300031548 Bacteria 853
189 Ga0307408_101545493 3300031548 Bacteria 629
190 Ga0265313_10008025 3300031595 Bacteria 7080
191 Ga0307508_10023185 3300031616 Bacteria 5638
192 Ga0307508_10813788 3300031616 Bacteria 552
193 Ga0265314_10009562 3300031711 Bacteria 8168
194 Ga0265314_10038937 3300031711 Bacteria 3430
195 Ga0265314_10104175 3300031711 Bacteria 1817
196 Ga0265342_10046457 3300031712 Bacteria 2610
197 Ga0316576_10170246 3300031727 Bacteria 1644
198 Ga0316578_10171381 3300031728 Bacteria 1308
199 Ga0307413_10734516 3300031824 Bacteria 824
200 Ga0307406_10642276 3300031901 Bacteria 880
201 Ga0307412_11085211 3300031911 Bacteria 712
202 Ga0307412_12022277 3300031911 Bacteria 534
203 Ga0307409_100138932 3300031995 Bacteria 2090
204 Ga0307409_101028651 3300031995 Bacteria 843
205 Ga0307416_100403081 3300032002 Bacteria 1406
206 Ga0307414_10407181 3300032004 Bacteria 1183
207 Ga0307411_11450148 3300032005 Bacteria 629
208 Ga0307411_11601132 3300032005 Bacteria 601
209 Ga0307415_101428852 3300032126 Bacteria 660
210 Ga0373949_0095895 3300035090 Unclassified 807
211 Ga0373951_0149095 3300035091 Bacteria 654
212 Ga0373935_0041040 3300035692 Bacteria 2906
213 Ga0373935_1298659 3300035692 Bacteria 543
214 Ga0373927_0000343 3300035695 Bacteria 36640
215 Ga0373947_0390934 3300035725 Bacteria 937
216 Ga0373937_0423096 3300036401 Bacteria 1264
217 Ga0316584_0100969 3300036712 Bacteria 2160
218 Ga0373925_0006509 3300037068 Bacteria 8589
219 Ga0373925_1264798 3300037068 Bacteria 606
220 Ga0395899_0038881 3300037312 Bacteria 3562
221 Ga0395900_0934227 3300037418 Bacteria 789
222 Ga0436364_0179263 3300037853 Bacteria 1166
223 Ga0436364_0619236 3300037853 Bacteria 15878
224 Ga0395901_0032619 3300038443 Bacteria 5371
225 Ga0436365_0615018 3300039437 Bacteria 1018
226 Ga0436365_0620338 3300039437 Unclassified 527
227 Ga0436365_1010111 3300039437 Bacteria 1326
228 Ga0436365_1131824 3300039437 Bacteria 783
229 Ga0436365_1171900 3300039437 Bacteria 4745
230 Ga0436360_1293286 3300039438 Bacteria 872
231 Ga0436361_0761415 3300039447 Bacteria 7443
232 Ga0436363_0646758 3300039450 Bacteria 1414
233 Ga0436363_1460995 3300039450 Bacteria 509
234 Ga0451800_0092686 3300041459 Bacteria 1452
235 Ga0451807_0176066 3300041486 Bacteria 864
236 Ga0451837_1857841 3300041494 Bacteria 678
237 Ga0439445_0109064 3300042004 Bacteria 789
238 Ga0439448_0187424 3300042005 Bacteria 724
239 Ga0439455_0003121 3300042012 Bacteria 3121
240 Ga0450923_041826 3300042125 Bacteria 965
241 Ga0450906_067842 3300042145 Bacteria 638
242 Ga0439460_0061457 3300042461 Bacteria 1147
243 Ga0451577_0048440 3300042876 Bacteria 3796
244 Ga0451577_0335819 3300042876 Bacteria 1370
245 Ga0453683_0068649 3300044673 Bacteria 2216
246 Ga0453683_0400019 3300044673 Bacteria 885
247 Ga0466964_0543623 3300044706 Bacteria 630
248 Ga0453684_0048098 3300044712 Bacteria 5646
249 Ga0453684_0080678 3300044712 Bacteria 4061
250 Ga0453684_0120695 3300044712 Bacteria 3165
251 Ga0453684_1085513 3300044712 Bacteria 846
252 Ga0451576_0000301 3300045051 Bacteria 119546
253 Ga0451576_0030825 3300045051 Bacteria 5723
254 Ga0451576_0039487 3300045051 Bacteria 4995
255 Ga0451576_0063884 3300045051 Bacteria 3836
256 Ga0451576_0176824 3300045051 Bacteria 2228
257 Ga0451576_0189678 3300045051 Bacteria 2147
258 Ga0466958_1031968 3300045836 Bacteria 537
259 Ga0495592_0185565 3300046454 Bacteria 1413
260 Ga0495629_0032776 3300046459 Bacteria 3677
261 Ga0495639_0352064 3300046475 Bacteria 739
262 Ga0495606_0049506 3300046507 Bacteria 2755
263 Ga0495606_0288339 3300046507 Bacteria 894
264 Ga0495618_0417424 3300046514 Bacteria 819
265 Ga0495628_0774549 3300046516 Bacteria 673
266 Ga0495628_0836219 3300046516 Bacteria 642
267 Ga0495643_0109188 3300046522 Bacteria 1408
268 Ga0495640_0436119 3300046533 Bacteria 801
269 Ga0495586_0138626 3300046535 Bacteria 1364
270 Ga0495622_0024538 3300046557 Bacteria 2816
271 Ga0495634_0089555 3300046642 Bacteria 2000
272 Ga0495634_0533166 3300046642 Bacteria 686
273 Ga0495635_0186022 3300046663 Bacteria 1411
274 Ga0495588_0085293 3300046674 Bacteria 1651
275 Ga0495657_0018964 3300046675 Bacteria 4970
276 Ga0495658_0085790 3300046683 Bacteria 1856
277 Ga0495624_0039465 3300046690 Bacteria 3027
278 Ga0495670_0232613 3300046691 Bacteria 980
279 Ga0495600_0072162 3300046809 Bacteria 2255
280 Ga0495600_0893438 3300046809 Bacteria 525
281 Ga0495581_0078819 3300047315 Bacteria 1906
282 Ga0495604_0077315 3300047317 Bacteria 2501
283 Ga0495674_0273018 3300047319 Bacteria 1387
284 Ga0495593_0100348 3300047673 Bacteria 1485
285 Ga0496100_0028499 3300048903 Bacteria 3445
286 Ga0496100_0173746 3300048903 Bacteria 1554
287 Ga0496100_0532169 3300048903 Bacteria 908
288 Ga0496100_0797121 3300048903 Bacteria 740
289 Ga0496101_0024916 3300048904 Bacteria 4147
290 Ga0496101_0104368 3300048904 Bacteria 2126
291 Ga0496101_0292011 3300048904 Bacteria 1276
292 Ga0496102_0051810 3300048905 Bacteria 3739
293 Ga0496102_0056767 3300048905 Bacteria 3573
294 Ga0496102_0616606 3300048905 Bacteria 1008
295 Ga0496103_0024597 3300048906 Bacteria 3635
296 Ga0496103_0138319 3300048906 Bacteria 1557
297 Ga0496104_0000042 3300048907 Bacteria 155859
298 Ga0496104_0036532 3300048907 Bacteria 4593
299 Ga0496104_0199005 3300048907 Bacteria 1915
300 Ga0496104_0435970 3300048907 Bacteria 1222
301 Ga0496104_0583201 3300048907 Bacteria 1028
302 Ga0496104_1594838 3300048907 Bacteria 555
303 Ga0496105_0000046 3300048908 Bacteria 101134
304 Ga0496105_0004982 3300048908 Bacteria 10047
305 Ga0496105_0010856 3300048908 Bacteria 7172
306 Ga0496105_0067827 3300048908 Bacteria 2945
307 Ga0496105_0068832 3300048908 Bacteria 2924
308 Ga0496105_0074279 3300048908 Bacteria 2808
309 Ga0496105_0708083 3300048908 Bacteria 772
310 Ga0496106_0087927 3300048909 Bacteria 2395
311 Ga0496107_0199195 3300048910 Bacteria 1488
312 Ga0496108_0001365 3300048911 Bacteria 19198
313 Ga0496108_0020691 3300048911 Bacteria 5407
314 Ga0496110_0044229 3300048913 Bacteria 3889
315 Ga0496110_0090787 3300048913 Bacteria 2731
316 Ga0496110_0601452 3300048913 Bacteria 997
317 Ga0496111_0000226 3300048914 Bacteria 26937
318 Ga0496112_0007460 3300048915 Bacteria 9712
319 Ga0496112_0101461 3300048915 Bacteria 2847
320 Ga0496112_0168426 3300048915 Bacteria 2156
321 Ga0496112_0240216 3300048915 Bacteria 1764
322 Ga0496113_0004784 3300048916 Bacteria 8365
323 Ga0496113_0077691 3300048916 Bacteria 2538
324 Ga0496113_0142658 3300048916 Bacteria 1885
325 Ga0496114_0129872 3300048917 Bacteria 2175
326 Ga0496115_0006892 3300048918 Bacteria 8347
327 Ga0496115_1155935 3300048918 Bacteria 584
328 Ga0496116_0031573 3300048919 Bacteria 3789
329 Ga0496117_0000641 3300048920 Bacteria 56335
330 Ga0496118_0002328 3300048921 Bacteria 25774
331 Ga0496119_0000343 3300048922 Bacteria 65175
332 Ga0496119_0007704 3300048922 Bacteria 9634
333 Ga0496119_0044327 3300048922 Bacteria 2802
334 Ga0496120_0013368 3300048923 Bacteria 5532
335 Ga0496120_0489326 3300048923 Bacteria 530
336 Ga0496121_0004370 3300048924 Bacteria 19103
337 Ga0496122_0023168 3300048925 Bacteria 5485
338 Ga0496122_0073872 3300048925 Bacteria 2415
339 Ga0496123_0024172 3300048926 Bacteria 4626
340 Ga0496123_0048441 3300048926 Bacteria 2859
341 Ga0496124_0010738 3300048927 Bacteria 9233
342 Ga0496125_0046959 3300048928 Bacteria 3617
343 Ga0496125_0079656 3300048928 Bacteria 2512
344 Ga0496125_0317572 3300048928 Bacteria 946
345 Ga0496126_0033052 3300048929 Bacteria 4868
346 Ga0496126_0376922 3300048929 Bacteria 1156
347 Ga0496126_0445890 3300048929 Bacteria 1042
348 Ga0496126_0641260 3300048929 Bacteria 832
349 Ga0496126_0771912 3300048929 Bacteria 740
350 Ga0501318_077973 3300049534 Bacteria 533
351 Ga0501032_0186723 3300049569 Bacteria 1356
352 Ga0501032_0352143 3300049569 Bacteria 949
353 Ga0501033_0258522 3300049570 Bacteria 1233
354 Ga0501033_0686645 3300049570 Bacteria 697
355 Ga0501034_0025068 3300049571 Bacteria 6069
356 Ga0501034_0131294 3300049571 Bacteria 2488
357 Ga0501034_0440653 3300049571 Bacteria 1221
358 Ga0501034_0452261 3300049571 Bacteria 1202
359 Ga0501034_0634382 3300049571 Bacteria 971
360 Ga0501036_0107400 3300049572 Bacteria 2360
361 Ga0501036_0234433 3300049572 Bacteria 1540
362 Ga0501036_0449870 3300049572 Bacteria 1073
363 Ga0501038_0147897 3300049574 Bacteria 1917
364 Ga0501038_0151685 3300049574 Bacteria 1889
365 Ga0501038_0500873 3300049574 Bacteria 929
366 Ga0501038_0773757 3300049574 Bacteria 715
367 Ga0501039_0353444 3300049575 Bacteria 1155
368 Ga0501040_0668066 3300049576 Bacteria 751
369 Ga0501042_0386036 3300049578 Bacteria 1014
370 Ga0501043_0082162 3300049579 Bacteria 2532
371 Ga0501043_0134382 3300049579 Bacteria 1938
372 Ga0501046_1059690 3300049580 Bacteria 561
373 Ga0501047_0162551 3300049581 Bacteria 2104
374 Ga0501047_0267404 3300049581 Bacteria 1556
375 Ga0501048_0474952 3300049582 Bacteria 896
376 Ga0501067_0398445 3300049583 Bacteria 768
377 Ga0501069_0412664 3300049585 Bacteria 800
378 Ga0501070_0048830 3300049586 Bacteria 3515
379 Ga0501070_0156652 3300049586 Bacteria 1878
380 Ga0501070_0228458 3300049586 Bacteria 1525
381 Ga0501070_0338983 3300049586 Bacteria 1221
382 Ga0501071_0018571 3300049587 Bacteria 4817
383 Ga0501071_0506632 3300049587 Bacteria 926
384 Ga0501072_0089064 3300049588 Bacteria 2449
385 Ga0501073_0063487 3300049589 Bacteria 2576
386 Ga0501073_0117728 3300049589 Bacteria 1841
387 Ga0501073_0647205 3300049589 Bacteria 730
388 Ga0501075_0041783 3300049591 Bacteria 3437
389 Ga0501075_1244935 3300049591 Bacteria 564
390 Ga0501076_0011306 3300049592 Bacteria 6644
391 Ga0501077_0091604 3300049593 Bacteria 1926
392 Ga0501080_0087351 3300049742 Bacteria 2897
393 Ga0501080_0154453 3300049742 Bacteria 2120
394 Ga0501080_0553053 3300049742 Bacteria 1025
395 Ga0501080_0904527 3300049742 Bacteria 769
396 Ga0501081_0037297 3300049743 Bacteria 3316
397 Ga0501035_0082371 3300049822 Bacteria 2839
398 Ga0501035_0247919 3300049822 Bacteria 1513
399 Ga0501035_0531725 3300049822 Bacteria 965
400 Ga0501044_0046132 3300049823 Bacteria 4513
401 Ga0501044_0196016 3300049823 Bacteria 1980
402 Ga0501044_0409179 3300049823 Bacteria 1268
403 Ga0501045_0092474 3300049824 Bacteria 2237
404 Ga0501045_1345385 3300049824 Bacteria 519
405 nmdc:mga05p37_2000190_c1 3300050507 Bacteria 548
406 nmdc:mga05p37_74_c1 3300050507 Bacteria 87063
407 nmdc:mga09592_142436_c1 3300050508 Bacteria 2067
408 nmdc:mga09592_3887_c1 3300050508 Bacteria 12035
409 nmdc:mga0qj67_1383460_c1 3300050509 Unclassified 543
410 nmdc:mga0qj67_29405_c1 3300050509 Bacteria 4268
411 nmdc:mga0qj67_677782_c1 3300050509 Bacteria 821
412 nmdc:mga06r32_2556_c1 3300050510 Bacteria 16281
413 nmdc:mga08y16_373_c1 3300050511 Bacteria 40656
414 nmdc:mga0rr50_156504_c1 3300050513 Bacteria 1846
415 nmdc:mga0a205_275638_c1 3300050515 Unclassified 1558
416 Ga0500644_0090260 3300053088 Bacteria 1145
417 Ga0500650_0225000 3300053098 Bacteria 848
418 Ga0500608_004923 3300053122 Bacteria 5234
419 Ga0500622_0000830 3300053156 Bacteria 26470
420 Ga0500627_0258898 3300053158 Bacteria 768
421 Ga0501084_0336302 3300054114 Bacteria 1275
422 Ga0587070_033407 3300059491 Bacteria 946
423 Ga0587082_112808 3300059504 Bacteria 606
424 Ga0587083_0098640 3300059505 Bacteria 724
425 Ga0587088_059501 3300059508 Bacteria 770
426 Ga0587090_013757 3300059510 Bacteria 1174
427 Ga0587091_022963 3300059511 Bacteria 1106
428 Ga0587092_107772 3300059512 Bacteria 582
429 Ga0587106_017787 3300059605 Bacteria 1020
430 Ga0587068_098900 3300059641 Bacteria 610
431 Ga0587069_019447 3300059642 Bacteria 1004
432 Ga0587072_015969 3300059643 Bacteria 1281
433 Ga0587075_011359 3300059644 Bacteria 1193
434 Ga0587076_003992 3300059645 Bacteria 1809
435 Ga0587079_020181 3300059647 Bacteria 1187
436 Ga0587107_042627 3300059652 Bacteria 740
437 Ga0587120_013485 3300059659 Bacteria 722
438 Ga0587096_04485 3300060247 Bacteria 592
439 Ga0587071_018194 3300060344 Bacteria 1261
440 Ga0587111_0144204 3300060346 Bacteria 634
441 Ga0466962_0043823 3300061719 Bacteria 2141
442 Ga0466962_0221092 3300061719 Bacteria 928
443 Ga0530510_0053458 3300061734 Bacteria 2919
444 Ga0530510_0506140 3300061734 Bacteria 916

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046535 Ga0495586_0138626 Ga0495586_0138626_12_323 85
2 3300048923 Ga0496120_0489326 Ga0496120_0489326_17_322 101
3 3300035692 Ga0373935_1298659 Ga0373935_1298659_147_521 104
4 3300036401 Ga0373937_0423096 Ga0373937_0423096_514_888 104
5 3300046516 Ga0495628_0836219 Ga0495628_0836219_156_530 104
6 3300047319 Ga0495674_0273018 Ga0495674_0273018_162_536 104
7 3300039437 Ga0436365_1131824 Ga0436365_1131824_188_565 105
8 3300005328 Ga0070676_10143794 Ga0070676_101437942 106
9 3300005347 Ga0070668_100086464 Ga0070668_1000864643 106
10 3300005353 Ga0070669_100679790 Ga0070669_1006797902 106
11 3300005354 Ga0070675_100637336 Ga0070675_1006373362 106
12 3300005355 Ga0070671_100499752 Ga0070671_1004997522 106
13 3300005367 Ga0070667_100190717 Ga0070667_1001907172 106
14 3300005457 Ga0070662_100494836 Ga0070662_1004948362 106
15 3300005459 Ga0068867_100202659 Ga0068867_1002026592 106
16 3300005577 Ga0068857_102171808 Ga0068857_1021718082 106
17 3300005719 Ga0068861_100977076 Ga0068861_1009770762 106
18 3300006353 Ga0075370_10183863 Ga0075370_101838632 106
19 3300009094 Ga0111539_12721879 Ga0111539_127218792 106
20 3300009148 Ga0105243_10764574 Ga0105243_107645742 106
21 3300025899 Ga0207642_11155190 Ga0207642_111551902 106
22 3300025901 Ga0207688_10484093 Ga0207688_104840932 106
23 3300025907 Ga0207645_10047498 Ga0207645_100474982 106
24 3300025923 Ga0207681_10662281 Ga0207681_106622812 106
25 3300025926 Ga0207659_10640509 Ga0207659_106405092 106
26 3300025931 Ga0207644_11261711 Ga0207644_112617111 106
27 3300025933 Ga0207706_10590149 Ga0207706_105901492 106
28 3300025986 Ga0207658_10082837 Ga0207658_100828372 106
29 3300026089 Ga0207648_11408762 Ga0207648_114087622 106
30 3300026116 Ga0207674_10457542 Ga0207674_104575422 106
31 3300026118 Ga0207675_100673585 Ga0207675_1006735852 106
32 3300028379 Ga0268266_10088839 Ga0268266_100888392 106
33 3300028381 Ga0268264_10129614 Ga0268264_101296142 106
34 3300031548 Ga0307408_100396530 Ga0307408_1003965302 106
35 3300042005 Ga0439448_0187424 Ga0439448_0187424_25_396 106
36 3300042012 Ga0439455_0003121 Ga0439455_0003121_318_689 106
37 3300021388 Ga0213875_10176050 Ga0213875_101760502 107
38 3300037853 Ga0436364_0179263 Ga0436364_0179263_182_559 107
39 3300048905 Ga0496102_0056767 Ga0496102_0056767_1288_1659 107
40 3300044673 Ga0453683_0400019 Ga0453683_0400019_17_376 114
41 3300044712 Ga0453684_0120695 Ga0453684_0120695_2790_3149 114
42 3300005295 Ga0065707_10499855 Ga0065707_104998552 115
43 3300005340 Ga0070689_100516306 Ga0070689_1005163061 115
44 3300005444 Ga0070694_101123493 Ga0070694_1011234931 115
45 3300005518 Ga0070699_100002280 Ga0070699_1000022803 115
46 3300005546 Ga0070696_101218710 Ga0070696_1012187101 115
47 3300005617 Ga0068859_100172431 Ga0068859_1001724312 115
48 3300005719 Ga0068861_100663012 Ga0068861_1006630122 115
49 3300005844 Ga0068862_100125161 Ga0068862_1001251613 115
50 3300006844 Ga0075428_100285798 Ga0075428_1002857984 115
51 3300006846 Ga0075430_100874367 Ga0075430_1008743671 115
52 3300006852 Ga0075433_11547976 Ga0075433_115479761 115
53 3300006931 Ga0097620_100172443 Ga0097620_1001724432 115
54 3300026118 Ga0207675_100479889 Ga0207675_1004798892 115
55 3300028380 Ga0268265_10118081 Ga0268265_101180812 115
56 3300028577 Ga0265318_10103068 Ga0265318_101030682 115
57 3300041459 Ga0451800_0092686 Ga0451800_0092686_82_459 115
58 3300041486 Ga0451807_0176066 Ga0451807_0176066_305_682 115
59 3300042876 Ga0451577_0048440 Ga0451577_0048440_3402_3779 115
60 3300042876 Ga0451577_0335819 Ga0451577_0335819_139_516 115
61 3300044712 Ga0453684_0080678 Ga0453684_0080678_3405_3782 115
62 3300044712 Ga0453684_1085513 Ga0453684_1085513_365_742 115
63 3300045051 Ga0451576_0039487 Ga0451576_0039487_1982_2359 115
64 3300045051 Ga0451576_0189678 Ga0451576_0189678_233_610 115
65 3300048904 Ga0496101_0104368 Ga0496101_0104368_1145_1507 115
66 3300048907 Ga0496104_0199005 Ga0496104_0199005_59_421 115
67 3300048908 Ga0496105_0010856 Ga0496105_0010856_4729_5091 115
68 3300048910 Ga0496107_0199195 Ga0496107_0199195_584_946 115
69 3300048911 Ga0496108_0020691 Ga0496108_0020691_1975_2337 115
70 3300048915 Ga0496112_0168426 Ga0496112_0168426_141_503 115
71 3300050508 nmdc:mga09592_142436_c1 nmdc:mga09592_142436_c1_1631_2008 115
72 3300050509 nmdc:mga0qj67_1383460_c1 nmdc:mga0qj67_1383460_c1_15_392 115
73 3300050515 nmdc:mga0a205_275638_c1 nmdc:mga0a205_275638_c1_512_889 115
74 iso_pu_bacteria 2510917022 2511135032 116
75 iso_pu_bacteria 2524023209 2524460358 116
76 iso_pu_bacteria 2582581307 2585270771 116
77 iso_pu_bacteria 2582581308 2585277125 116
78 iso_pu_bacteria 2582581315 2585323867 116
79 iso_pu_bacteria 2582581316 2585331845 116
80 iso_pu_bacteria 2585427527 2585534139 116
81 iso_pu_bacteria 2585427530 2585552009 116
82 iso_pu_bacteria 2585427531 2585558494 116
83 iso_pu_bacteria 2585427608 2585897863 116
84 iso_pu_bacteria 2585427609 2585904536 116
85 iso_pu_bacteria 2585428125 2587980348 116
86 iso_pu_bacteria 2615840626 2616308502 116
87 iso_pu_bacteria 2615840698 2616557197 116
88 iso_pu_bacteria 2617270742 2617385682 116
89 iso_pu_bacteria 2667528174 2671111794 116
90 iso_pu_bacteria 2775507049 2776913607 116
91 iso_pu_bacteria 2775507266 2778173938 116
92 iso_pu_bacteria 2818991448 2819612906 116
93 iso_pu_bacteria 2818991453 2819637987 116
94 iso_pu_bacteria 2837651117 2837651963 116
95 iso_pu_bacteria 2838029111 2838030173 116
96 iso_pu_bacteria 2842298080 2842302124 116
97 iso_pu_bacteria 2842357229 2842357409 116
98 iso_pu_bacteria 2842475841 2842476542 116
99 iso_pu_bacteria 2842482326 2842484916 116
100 iso_pu_bacteria 2842502639 2842503701 116
101 iso_pu_bacteria 2842509118 2842515210 116
102 iso_pu_bacteria 2852387548 2852389815 116
103 iso_pu_bacteria 2919408235 2919411767 116
104 iso_pu_bacteria 3005416602 3005420183 116
105 iso_pu_bacteria 8002060224 8002061210 116
106 iso_pu_bacteria 8005314921 8005317134 116
107 iso_pu_bacteria 8005484373 8005485068 116
108 iso_pu_bacteria 8005645114 8005648802 116
109 iso_pu_bacteria 8005682033 8005683269 116
110 iso_pu_bacteria 8046767195 8046773872 116
111 iso_pu_bacteria 8057575449 8057576752 116
112 iso_pu_bacteria 2738543031 2739350087 117
113 3300031727 Ga0316576_10170246 Ga0316576_101702461 118
114 3300031728 Ga0316578_10171381 Ga0316578_101713812 118
115 3300036712 Ga0316584_0100969 Ga0316584_0100969_519_893 118
116 3300045051 Ga0451576_0030825 Ga0451576_0030825_588_956 118
117 3300045051 Ga0451576_0063884 Ga0451576_0063884_2394_2759 118
118 iso_pu_bacteria 2842333319 2842335608 118
119 iso_pu_bacteria 2891088606 2891090093 118
120 3300005334 Ga0068869_101482007 Ga0068869_1014820071 119
121 3300005440 Ga0070705_101338340 Ga0070705_1013383402 119
122 3300005456 Ga0070678_100801747 Ga0070678_1008017472 119
123 3300005459 Ga0068867_101124150 Ga0068867_1011241502 119
124 3300005546 Ga0070696_101706483 Ga0070696_1017064831 119
125 3300006237 Ga0097621_100688634 Ga0097621_1006886342 119
126 3300013296 Ga0157374_10161925 Ga0157374_101619252 119
127 3300025934 Ga0207686_11447375 Ga0207686_114473751 119
128 3300026089 Ga0207648_10776405 Ga0207648_107764052 119
129 3300030732 Ga0316176_1010088 Ga0316176_10100882 119
130 3300030733 Ga0314311_1239489 Ga0314311_12394892 119
131 3300031240 Ga0265320_10128905 Ga0265320_101289052 119
132 3300031241 Ga0265325_10018843 Ga0265325_100188432 119
133 3300031247 Ga0265340_10011313 Ga0265340_100113132 119
134 3300031250 Ga0265331_10149197 Ga0265331_101491972 119
135 3300031251 Ga0265327_10229938 Ga0265327_102299382 119
136 3300031595 Ga0265313_10008025 Ga0265313_100080253 119
137 3300031711 Ga0265314_10038937 Ga0265314_100389371 119
138 3300031911 Ga0307412_12022277 Ga0307412_120222771 119
139 3300032005 Ga0307411_11450148 Ga0307411_114501481 119
140 3300041494 Ga0451837_1857841 Ga0451837_1857841_112_483 119
141 3300045836 Ga0466958_1031968 Ga0466958_1031968_32_406 119
142 3300046516 Ga0495628_0774549 Ga0495628_0774549_134_499 119
143 3300046642 Ga0495634_0533166 Ga0495634_0533166_43_408 119
144 3300049569 Ga0501032_0186723 Ga0501032_0186723_97_468 119
145 3300049569 Ga0501032_0352143 Ga0501032_0352143_516_890 119
146 3300049570 Ga0501033_0258522 Ga0501033_0258522_455_829 119
147 3300049570 Ga0501033_0686645 Ga0501033_0686645_312_686 119
148 3300049571 Ga0501034_0025068 Ga0501034_0025068_3546_3917 119
149 3300049571 Ga0501034_0440653 Ga0501034_0440653_245_616 119
150 3300049571 Ga0501034_0452261 Ga0501034_0452261_379_750 119
151 3300049571 Ga0501034_0634382 Ga0501034_0634382_414_785 119
152 3300049572 Ga0501036_0234433 Ga0501036_0234433_1071_1436 119
153 3300049572 Ga0501036_0449870 Ga0501036_0449870_363_734 119
154 3300049574 Ga0501038_0147897 Ga0501038_0147897_624_995 119
155 3300049574 Ga0501038_0500873 Ga0501038_0500873_324_689 119
156 3300049579 Ga0501043_0082162 Ga0501043_0082162_1695_2060 119
157 3300049581 Ga0501047_0162551 Ga0501047_0162551_287_652 119
158 3300049581 Ga0501047_0267404 Ga0501047_0267404_760_1131 119
159 3300049582 Ga0501048_0474952 Ga0501048_0474952_175_549 119
160 3300049583 Ga0501067_0398445 Ga0501067_0398445_60_431 119
161 3300049585 Ga0501069_0412664 Ga0501069_0412664_183_551 119
162 3300049586 Ga0501070_0048830 Ga0501070_0048830_1129_1497 119
163 3300049586 Ga0501070_0156652 Ga0501070_0156652_974_1345 119
164 3300049586 Ga0501070_0228458 Ga0501070_0228458_158_532 119
165 3300049586 Ga0501070_0338983 Ga0501070_0338983_222_593 119
166 3300049589 Ga0501073_0063487 Ga0501073_0063487_1274_1645 119
167 3300049589 Ga0501073_0647205 Ga0501073_0647205_145_513 119
168 3300049591 Ga0501075_1244935 Ga0501075_1244935_26_391 119
169 3300049742 Ga0501080_0154453 Ga0501080_0154453_544_915 119
170 3300049742 Ga0501080_0553053 Ga0501080_0553053_354_722 119
171 3300049742 Ga0501080_0904527 Ga0501080_0904527_155_520 119
172 3300049822 Ga0501035_0082371 Ga0501035_0082371_1798_2163 119
173 3300049822 Ga0501035_0247919 Ga0501035_0247919_19_393 119
174 3300049822 Ga0501035_0531725 Ga0501035_0531725_276_650 119
175 3300049823 Ga0501044_0046132 Ga0501044_0046132_14_379 119
176 3300049823 Ga0501044_0196016 Ga0501044_0196016_1206_1580 119
177 3300049823 Ga0501044_0409179 Ga0501044_0409179_76_450 119
178 3300053098 Ga0500650_0225000 Ga0500650_0225000_400_777 119
179 2162886006 SwRhRL3b_contig_1929186 SwRhRL3b_0869.00001330 120
180 3300001979 JGI24740J21852_10000493 JGI24740J21852_1000049312 120
181 3300002704 JGI25155J39150_1000215 JGI25155J39150_100021514 120
182 3300002705 JGI25156J39149_1000491 JGI25156J39149_100049114 120
183 3300002737 JGI25162J39368_1002390 JGI25162J39368_10023907 120
184 3300002737 JGI25162J39368_1002612 JGI25162J39368_10026122 120
185 3300002738 JGI25154J39366_1000407 JGI25154J39366_100040714 120
186 3300002741 JGI25157J39369_1000515 JGI25157J39369_100051514 120
187 3300002987 JGI25159J45721_1000220 JGI25159J45721_100022011 120
188 3300003214 JGI25165J46597_1002236 JGI25165J46597_10022366 120
189 3300003214 JGI25165J46597_1002365 JGI25165J46597_10023652 120
190 3300003214 JGI25165J46597_1005170 JGI25165J46597_10051702 120
191 3300003214 JGI25165J46597_1011613 JGI25165J46597_10116132 120
192 3300003316 rootH1_10094521 rootH1_100945212 120
193 3300003322 rootL2_10057180 rootL2_100571801 120
194 3300003323 rootH1_10125481 rootH1_101254812 120
195 3300003354 JGI25160J50197_1000010 JGI25160J50197_1000010180 120
196 3300003374 JGI25161J50226_1000006 JGI25161J50226_1000006180 120
197 3300003752 Ga0055539_1039994 Ga0055539_10399941 120
198 3300004625 Ga0055543_1000014 Ga0055543_100001486 120
199 3300005262 Ga0065165_1000262 Ga0065165_100026291 120
200 3300005295 Ga0065707_10106159 Ga0065707_101061592 120
201 3300005331 Ga0070670_102039229 Ga0070670_1020392291 120
202 3300005336 Ga0070680_100004467 Ga0070680_1000044677 120
203 3300005354 Ga0070675_100302501 Ga0070675_1003025011 120
204 3300005435 Ga0070714_100000322 Ga0070714_10000032218 120
205 3300005436 Ga0070713_100298912 Ga0070713_1002989122 120
206 3300005436 Ga0070713_101455234 Ga0070713_1014552341 120
207 3300005437 Ga0070710_10072856 Ga0070710_100728562 120
208 3300005439 Ga0070711_100914459 Ga0070711_1009144591 120
209 3300005458 Ga0070681_10005353 Ga0070681_1000535312 120
210 3300005530 Ga0070679_100015110 Ga0070679_1000151102 120
211 3300005535 Ga0070684_100118245 Ga0070684_1001182452 120
212 3300005535 Ga0070684_100581834 Ga0070684_1005818342 120
213 3300005539 Ga0068853_101034159 Ga0068853_1010341592 120
214 3300005545 Ga0070695_101345403 Ga0070695_1013454031 120
215 3300005548 Ga0070665_100251843 Ga0070665_1002518432 120
216 3300005563 Ga0068855_100628731 Ga0068855_1006287312 120
217 3300005578 Ga0068854_100034168 Ga0068854_1000341683 120
218 3300005578 Ga0068854_100125624 Ga0068854_1001256242 120
219 3300005614 Ga0068856_100127073 Ga0068856_1001270732 120
220 3300005614 Ga0068856_100220330 Ga0068856_1002203302 120
221 3300005614 Ga0068856_100334493 Ga0068856_1003344932 120
222 3300005937 Ga0081455_10295005 Ga0081455_102950052 120
223 3300005981 Ga0081538_10001121 Ga0081538_1000112116 120
224 3300006028 Ga0070717_10104379 Ga0070717_101043793 120
225 3300006028 Ga0070717_10601819 Ga0070717_106018192 120
226 3300006163 Ga0070715_10122700 Ga0070715_101227002 120
227 3300006844 Ga0075428_100001793 Ga0075428_1000017936 120
228 3300006846 Ga0075430_100126572 Ga0075430_1001265723 120
229 3300006846 Ga0075430_100174911 Ga0075430_1001749113 120
230 3300006847 Ga0075431_100000136 Ga0075431_10000013624 120
231 3300006880 Ga0075429_100003755 Ga0075429_1000037554 120
232 3300007076 Ga0075435_100476175 Ga0075435_1004761752 120
233 3300009011 Ga0105251_10312460 Ga0105251_103124601 120
234 3300009093 Ga0105240_10000005 Ga0105240_10000005517 120
235 3300009093 Ga0105240_10022753 Ga0105240_100227533 120
236 3300009093 Ga0105240_10522214 Ga0105240_105222142 120
237 3300009094 Ga0111539_10000405 Ga0111539_1000040542 120
238 3300009094 Ga0111539_10129178 Ga0111539_101291782 120
239 3300009147 Ga0114129_10002465 Ga0114129_1000246525 120
240 3300009177 Ga0105248_10651662 Ga0105248_106516622 120
241 3300009545 Ga0105237_10001882 Ga0105237_100018828 120
242 3300010375 Ga0105239_10002014 Ga0105239_100020148 120
243 3300013100 Ga0157373_11118647 Ga0157373_111186472 120
244 3300013104 Ga0157370_10000274 Ga0157370_1000027438 120
245 3300013104 Ga0157370_10007782 Ga0157370_100077827 120
246 3300013306 Ga0163162_11516473 Ga0163162_115164732 120
247 3300013307 Ga0157372_10745210 Ga0157372_107452102 120
248 3300013308 Ga0157375_13369553 Ga0157375_133695531 120
249 3300014325 Ga0163163_10047922 Ga0163163_100479225 120
250 3300014325 Ga0163163_10452744 Ga0163163_104527442 120
251 3300014325 Ga0163163_11221870 Ga0163163_112218702 120
252 3300014497 Ga0182008_10106857 Ga0182008_101068572 120
253 3300014968 Ga0157379_10416956 Ga0157379_104169562 120
254 3300015262 Ga0182007_10000711 Ga0182007_1000071111 120
255 3300021361 Ga0213872_10041927 Ga0213872_100419272 120
256 3300025206 Ga0209435_100045 Ga0209435_10004514 120
257 3300025208 Ga0209436_119376 Ga0209436_1193762 120
258 3300025228 Ga0209672_106967 Ga0209672_1069672 120
259 3300025231 Ga0207427_105796 Ga0207427_1057962 120
260 3300025231 Ga0207427_106984 Ga0207427_1069842 120
261 3300025233 Ga0209437_100047 Ga0209437_100047304 120
262 3300025233 Ga0209437_100683 Ga0209437_1006838 120
263 3300025246 Ga0209646_1000154 Ga0209646_100015414 120
264 3300025246 Ga0209646_1007550 Ga0209646_10075501 120
265 3300025250 Ga0209026_1000177 Ga0209026_100017714 120
266 3300025253 Ga0209677_100435 Ga0209677_1004352 120
267 3300025254 Ga0209148_1015098 Ga0209148_10150982 120
268 3300025256 Ga0209759_1000795 Ga0209759_100079514 120
269 3300025256 Ga0209759_1023408 Ga0209759_10234082 120
270 3300025261 Ga0209233_1000048 Ga0209233_100004898 120
271 3300025261 Ga0209233_1000069 Ga0209233_1000069340 120
272 3300025261 Ga0209233_1000221 Ga0209233_100022143 120
273 3300025261 Ga0209233_1000538 Ga0209233_100053812 120
274 3300025261 Ga0209233_1025360 Ga0209233_10253602 120
275 3300025272 Ga0209455_1019419 Ga0209455_10194192 120
276 3300025284 Ga0209130_1000021 Ga0209130_100002188 120
277 3300025302 Ga0207426_1000010 Ga0207426_1000010270 120
278 3300025905 Ga0207685_10068580 Ga0207685_100685803 120
279 3300025906 Ga0207699_11163496 Ga0207699_111634962 120
280 3300025912 Ga0207707_10003185 Ga0207707_100031858 120
281 3300025913 Ga0207695_10000011 Ga0207695_10000011401 120
282 3300025913 Ga0207695_10210683 Ga0207695_102106832 120
283 3300025913 Ga0207695_10301706 Ga0207695_103017062 120
284 3300025914 Ga0207671_10000314 Ga0207671_1000031446 120
285 3300025921 Ga0207652_10025552 Ga0207652_100255522 120
286 3300025929 Ga0207664_10605423 Ga0207664_106054232 120
287 3300025939 Ga0207665_10103211 Ga0207665_101032112 120
288 3300025939 Ga0207665_10634332 Ga0207665_106343321 120
289 3300025941 Ga0207711_10265395 Ga0207711_102653952 120
290 3300025944 Ga0207661_11417978 Ga0207661_114179782 120
291 3300025949 Ga0207667_10036003 Ga0207667_100360034 120
292 3300025949 Ga0207667_12222600 Ga0207667_122226001 120
293 3300025981 Ga0207640_10139796 Ga0207640_101397962 120
294 3300025981 Ga0207640_11033876 Ga0207640_110338762 120
295 3300026078 Ga0207702_10094154 Ga0207702_100941543 120
296 3300026078 Ga0207702_10584365 Ga0207702_105843652 120
297 3300026095 Ga0207676_10807849 Ga0207676_108078492 120
298 3300027312 Ga0209371_1008268 Ga0209371_10082682 120
299 3300027312 Ga0209371_1073192 Ga0209371_10731922 120
300 3300027907 Ga0207428_10000994 Ga0207428_100009946 120
301 3300028379 Ga0268266_10903027 Ga0268266_109030272 120
302 3300030500 Ga0268256_1005022 Ga0268256_10050224 120
303 3300030500 Ga0268256_1081277 Ga0268256_10812772 120
304 3300031240 Ga0265320_10005956 Ga0265320_100059562 120
305 3300031507 Ga0307509_10340691 Ga0307509_103406912 120
306 3300031548 Ga0307408_100805747 Ga0307408_1008057472 120
307 3300031548 Ga0307408_101545493 Ga0307408_1015454932 120
308 3300031616 Ga0307508_10023185 Ga0307508_100231852 120
309 3300031616 Ga0307508_10813788 Ga0307508_108137881 120
310 3300031711 Ga0265314_10009562 Ga0265314_100095622 120
311 3300031711 Ga0265314_10104175 Ga0265314_101041753 120
312 3300031712 Ga0265342_10046457 Ga0265342_100464573 120
313 3300031824 Ga0307413_10734516 Ga0307413_107345162 120
314 3300031901 Ga0307406_10642276 Ga0307406_106422761 120
315 3300031911 Ga0307412_11085211 Ga0307412_110852112 120
316 3300031995 Ga0307409_100138932 Ga0307409_1001389322 120
317 3300031995 Ga0307409_101028651 Ga0307409_1010286512 120
318 3300032002 Ga0307416_100403081 Ga0307416_1004030812 120
319 3300032004 Ga0307414_10407181 Ga0307414_104071812 120
320 3300032005 Ga0307411_11601132 Ga0307411_116011322 120
321 3300032126 Ga0307415_101428852 Ga0307415_1014288522 120
322 3300035090 Ga0373949_0095895 Ga0373949_0095895_361_723 120
323 3300035091 Ga0373951_0149095 Ga0373951_0149095_51_413 120
324 3300035692 Ga0373935_0041040 Ga0373935_0041040_1694_2056 120
325 3300035695 Ga0373927_0000343 Ga0373927_0000343_28026_28388 120
326 3300035725 Ga0373947_0390934 Ga0373947_0390934_238_600 120
327 3300037068 Ga0373925_0006509 Ga0373925_0006509_4380_4742 120
328 3300037068 Ga0373925_1264798 Ga0373925_1264798_162_539 120
329 3300037312 Ga0395899_0038881 Ga0395899_0038881_2426_2803 120
330 3300037418 Ga0395900_0934227 Ga0395900_0934227_357_734 120
331 3300037853 Ga0436364_0619236 Ga0436364_0619236_6526_6903 120
332 3300038443 Ga0395901_0032619 Ga0395901_0032619_3631_4008 120
333 3300039437 Ga0436365_0615018 Ga0436365_0615018_331_708 120
334 3300039437 Ga0436365_0620338 Ga0436365_0620338_119_496 120
335 3300039437 Ga0436365_1010111 Ga0436365_1010111_481_858 120
336 3300039437 Ga0436365_1171900 Ga0436365_1171900_3258_3635 120
337 3300039438 Ga0436360_1293286 Ga0436360_1293286_326_703 120
338 3300039447 Ga0436361_0761415 Ga0436361_0761415_6496_6873 120
339 3300039450 Ga0436363_0646758 Ga0436363_0646758_764_1138 120
340 3300039450 Ga0436363_1460995 Ga0436363_1460995_22_399 120
341 3300042004 Ga0439445_0109064 Ga0439445_0109064_53_415 120
342 3300042125 Ga0450923_041826 Ga0450923_041826_132_509 120
343 3300042145 Ga0450906_067842 Ga0450906_067842_120_497 120
344 3300042461 Ga0439460_0061457 Ga0439460_0061457_191_568 120
345 3300044673 Ga0453683_0068649 Ga0453683_0068649_902_1279 120
346 3300044706 Ga0466964_0543623 Ga0466964_0543623_103_489 120
347 3300044712 Ga0453684_0048098 Ga0453684_0048098_2839_3216 120
348 3300045051 Ga0451576_0000301 Ga0451576_0000301_31464_31841 120
349 3300045051 Ga0451576_0176824 Ga0451576_0176824_761_1138 120
350 3300046454 Ga0495592_0185565 Ga0495592_0185565_456_818 120
351 3300046459 Ga0495629_0032776 Ga0495629_0032776_1473_1835 120
352 3300046475 Ga0495639_0352064 Ga0495639_0352064_101_478 120
353 3300046507 Ga0495606_0049506 Ga0495606_0049506_2380_2742 120
354 3300046507 Ga0495606_0288339 Ga0495606_0288339_503_865 120
355 3300046514 Ga0495618_0417424 Ga0495618_0417424_293_670 120
356 3300046522 Ga0495643_0109188 Ga0495643_0109188_843_1205 120
357 3300046533 Ga0495640_0436119 Ga0495640_0436119_303_665 120
358 3300046557 Ga0495622_0024538 Ga0495622_0024538_890_1252 120
359 3300046642 Ga0495634_0089555 Ga0495634_0089555_93_458 120
360 3300046663 Ga0495635_0186022 Ga0495635_0186022_447_809 120
361 3300046674 Ga0495588_0085293 Ga0495588_0085293_254_616 120
362 3300046675 Ga0495657_0018964 Ga0495657_0018964_1408_1770 120
363 3300046683 Ga0495658_0085790 Ga0495658_0085790_1091_1456 120
364 3300046690 Ga0495624_0039465 Ga0495624_0039465_1726_2088 120
365 3300046691 Ga0495670_0232613 Ga0495670_0232613_335_697 120
366 3300046809 Ga0495600_0072162 Ga0495600_0072162_1087_1452 120
367 3300046809 Ga0495600_0893438 Ga0495600_0893438_92_469 120
368 3300047315 Ga0495581_0078819 Ga0495581_0078819_887_1264 120
369 3300047317 Ga0495604_0077315 Ga0495604_0077315_357_719 120
370 3300047673 Ga0495593_0100348 Ga0495593_0100348_827_1189 120
371 3300048903 Ga0496100_0028499 Ga0496100_0028499_257_619 120
372 3300048903 Ga0496100_0173746 Ga0496100_0173746_118_495 120
373 3300048903 Ga0496100_0532169 Ga0496100_0532169_188_565 120
374 3300048903 Ga0496100_0797121 Ga0496100_0797121_261_623 120
375 3300048904 Ga0496101_0024916 Ga0496101_0024916_2773_3150 120
376 3300048904 Ga0496101_0292011 Ga0496101_0292011_726_1103 120
377 3300048905 Ga0496102_0051810 Ga0496102_0051810_415_777 120
378 3300048905 Ga0496102_0616606 Ga0496102_0616606_578_955 120
379 3300048906 Ga0496103_0024597 Ga0496103_0024597_2806_3168 120
380 3300048906 Ga0496103_0138319 Ga0496103_0138319_204_581 120
381 3300048907 Ga0496104_0000042 Ga0496104_0000042_24103_24480 120
382 3300048907 Ga0496104_0036532 Ga0496104_0036532_1852_2229 120
383 3300048907 Ga0496104_0435970 Ga0496104_0435970_611_973 120
384 3300048907 Ga0496104_0583201 Ga0496104_0583201_582_959 120
385 3300048907 Ga0496104_1594838 Ga0496104_1594838_152_529 120
386 3300048908 Ga0496105_0000046 Ga0496105_0000046_56199_56576 120
387 3300048908 Ga0496105_0004982 Ga0496105_0004982_5004_5381 120
388 3300048908 Ga0496105_0067827 Ga0496105_0067827_582_959 120
389 3300048908 Ga0496105_0068832 Ga0496105_0068832_754_1131 120
390 3300048908 Ga0496105_0074279 Ga0496105_0074279_1725_2102 120
391 3300048908 Ga0496105_0708083 Ga0496105_0708083_46_423 120
392 3300048909 Ga0496106_0087927 Ga0496106_0087927_1494_1871 120
393 3300048911 Ga0496108_0001365 Ga0496108_0001365_3082_3459 120
394 3300048913 Ga0496110_0044229 Ga0496110_0044229_2087_2464 120
395 3300048913 Ga0496110_0090787 Ga0496110_0090787_1247_1624 120
396 3300048913 Ga0496110_0601452 Ga0496110_0601452_276_653 120
397 3300048914 Ga0496111_0000226 Ga0496111_0000226_23479_23856 120
398 3300048915 Ga0496112_0007460 Ga0496112_0007460_9173_9550 120
399 3300048915 Ga0496112_0101461 Ga0496112_0101461_215_592 120
400 3300048915 Ga0496112_0240216 Ga0496112_0240216_1203_1580 120
401 3300048916 Ga0496113_0004784 Ga0496113_0004784_1155_1532 120
402 3300048916 Ga0496113_0077691 Ga0496113_0077691_1818_2195 120
403 3300048916 Ga0496113_0142658 Ga0496113_0142658_1307_1684 120
404 3300048917 Ga0496114_0129872 Ga0496114_0129872_1466_1828 120
405 3300048918 Ga0496115_0006892 Ga0496115_0006892_5207_5584 120
406 3300048918 Ga0496115_1155935 Ga0496115_1155935_96_458 120
407 3300048919 Ga0496116_0031573 Ga0496116_0031573_1682_2044 120
408 3300048920 Ga0496117_0000641 Ga0496117_0000641_6082_6444 120
409 3300048921 Ga0496118_0002328 Ga0496118_0002328_18119_18481 120
410 3300048922 Ga0496119_0000343 Ga0496119_0000343_38688_39065 120
411 3300048922 Ga0496119_0007704 Ga0496119_0007704_5605_5967 120
412 3300048922 Ga0496119_0044327 Ga0496119_0044327_1800_2162 120
413 3300048923 Ga0496120_0013368 Ga0496120_0013368_1902_2264 120
414 3300048924 Ga0496121_0004370 Ga0496121_0004370_2359_2721 120
415 3300048925 Ga0496122_0023168 Ga0496122_0023168_3191_3553 120
416 3300048925 Ga0496122_0073872 Ga0496122_0073872_1719_2081 120
417 3300048926 Ga0496123_0024172 Ga0496123_0024172_1416_1778 120
418 3300048926 Ga0496123_0048441 Ga0496123_0048441_594_956 120
419 3300048927 Ga0496124_0010738 Ga0496124_0010738_3051_3413 120
420 3300048928 Ga0496125_0046959 Ga0496125_0046959_398_760 120
421 3300048928 Ga0496125_0079656 Ga0496125_0079656_1671_2048 120
422 3300048928 Ga0496125_0317572 Ga0496125_0317572_15_377 120
423 3300048929 Ga0496126_0033052 Ga0496126_0033052_1742_2104 120
424 3300048929 Ga0496126_0376922 Ga0496126_0376922_41_412 120
425 3300048929 Ga0496126_0445890 Ga0496126_0445890_446_808 120
426 3300048929 Ga0496126_0641260 Ga0496126_0641260_149_526 120
427 3300048929 Ga0496126_0771912 Ga0496126_0771912_237_599 120
428 3300049534 Ga0501318_077973 Ga0501318_077973_142_519 120
429 3300049571 Ga0501034_0131294 Ga0501034_0131294_1175_1552 120
430 3300049572 Ga0501036_0107400 Ga0501036_0107400_504_881 120
431 3300049574 Ga0501038_0151685 Ga0501038_0151685_963_1340 120
432 3300049574 Ga0501038_0773757 Ga0501038_0773757_25_402 120
433 3300049575 Ga0501039_0353444 Ga0501039_0353444_421_798 120
434 3300049576 Ga0501040_0668066 Ga0501040_0668066_315_692 120
435 3300049578 Ga0501042_0386036 Ga0501042_0386036_397_774 120
436 3300049579 Ga0501043_0134382 Ga0501043_0134382_897_1274 120
437 3300049580 Ga0501046_1059690 Ga0501046_1059690_154_531 120
438 3300049587 Ga0501071_0018571 Ga0501071_0018571_619_996 120
439 3300049587 Ga0501071_0506632 Ga0501071_0506632_483_860 120
440 3300049588 Ga0501072_0089064 Ga0501072_0089064_1210_1587 120
441 3300049589 Ga0501073_0117728 Ga0501073_0117728_407_784 120
442 3300049591 Ga0501075_0041783 Ga0501075_0041783_967_1344 120
443 3300049592 Ga0501076_0011306 Ga0501076_0011306_2361_2738 120
444 3300049593 Ga0501077_0091604 Ga0501077_0091604_19_396 120
445 3300049742 Ga0501080_0087351 Ga0501080_0087351_750_1127 120
446 3300049743 Ga0501081_0037297 Ga0501081_0037297_1106_1483 120
447 3300049824 Ga0501045_0092474 Ga0501045_0092474_849_1226 120
448 3300049824 Ga0501045_1345385 Ga0501045_1345385_81_464 120
449 3300050507 nmdc:mga05p37_2000190_c1 nmdc:mga05p37_2000190_c1_91_453 120
450 3300050507 nmdc:mga05p37_74_c1 nmdc:mga05p37_74_c1_34327_34704 120
451 3300050508 nmdc:mga09592_3887_c1 nmdc:mga09592_3887_c1_9950_10327 120
452 3300050509 nmdc:mga0qj67_29405_c1 nmdc:mga0qj67_29405_c1_1781_2158 120
453 3300050509 nmdc:mga0qj67_677782_c1 nmdc:mga0qj67_677782_c1_77_454 120
454 3300050510 nmdc:mga06r32_2556_c1 nmdc:mga06r32_2556_c1_10410_10787 120
455 3300050511 nmdc:mga08y16_373_c1 nmdc:mga08y16_373_c1_5119_5496 120
456 3300050513 nmdc:mga0rr50_156504_c1 nmdc:mga0rr50_156504_c1_1309_1671 120
457 3300053088 Ga0500644_0090260 Ga0500644_0090260_571_933 120
458 3300053122 Ga0500608_004923 Ga0500608_004923_2832_3194 120
459 3300053156 Ga0500622_0000830 Ga0500622_0000830_9846_10208 120
460 3300053158 Ga0500627_0258898 Ga0500627_0258898_383_745 120
461 3300054114 Ga0501084_0336302 Ga0501084_0336302_411_788 120
462 3300059491 Ga0587070_033407 Ga0587070_033407_158_520 120
463 3300059504 Ga0587082_112808 Ga0587082_112808_222_584 120
464 3300059505 Ga0587083_0098640 Ga0587083_0098640_159_521 120
465 3300059508 Ga0587088_059501 Ga0587088_059501_243_605 120
466 3300059510 Ga0587090_013757 Ga0587090_013757_203_565 120
467 3300059511 Ga0587091_022963 Ga0587091_022963_542_904 120
468 3300059512 Ga0587092_107772 Ga0587092_107772_29_391 120
469 3300059605 Ga0587106_017787 Ga0587106_017787_442_804 120
470 3300059641 Ga0587068_098900 Ga0587068_098900_138_500 120
471 3300059642 Ga0587069_019447 Ga0587069_019447_465_827 120
472 3300059643 Ga0587072_015969 Ga0587072_015969_594_956 120
473 3300059644 Ga0587075_011359 Ga0587075_011359_211_573 120
474 3300059645 Ga0587076_003992 Ga0587076_003992_162_524 120
475 3300059647 Ga0587079_020181 Ga0587079_020181_575_937 120
476 3300059652 Ga0587107_042627 Ga0587107_042627_205_567 120
477 3300059659 Ga0587120_013485 Ga0587120_013485_69_431 120
478 3300060247 Ga0587096_04485 Ga0587096_04485_203_565 120
479 3300060344 Ga0587071_018194 Ga0587071_018194_548_910 120
480 3300060346 Ga0587111_0144204 Ga0587111_0144204_211_573 120
481 3300061719 Ga0466962_0043823 Ga0466962_0043823_638_1000 120
482 3300061719 Ga0466962_0221092 Ga0466962_0221092_363_740 120
483 3300061734 Ga0530510_0053458 Ga0530510_0053458_530_907 120
484 3300061734 Ga0530510_0506140 Ga0530510_0506140_344_721 120

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01597

GCV_H

Glycine cleavage H-protein

12

132

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1onl-assembly3.cif.gz_C crystal structure of thermus thermophilus hb8 h-protein of the glycine cleavage system 0.9863 2 119
1zko-assembly1.cif.gz_A crystal structure of glycine cleavage system h protein (tm0212) from thermotoga maritima at 1.65 a resolution 0.9813 1 118
3wdn-assembly1.cif.gz_A high-resolution x-ray crystal structure of bovine h-protein using a high-pressure cryocooling method 0.977 1 119
1htp-assembly1.cif.gz_A refined structures at 2 angstroms and 2.2 angstroms of the two forms of the h-protein, a lipoamide-containing protein of the glycine decarboxylase complex 0.9762 2 117
3a7a-assembly1.cif.gz_B crystal structure of e. coli lipoate-protein ligase a in complex with octyl-amp and apoh-protein 0.9637 2 119
ID Description Score Start End Superfamily
af_Q5AKX1_36_173_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9819 1 119 2.40.50.100
af_Q20634_6_139_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9788 2 118 2.40.50.100
3wdnA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9763 1 119 2.40.50.100
af_Q9U616_24_160_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.974 2 120 2.40.50.100
af_Q54JV8_6_144_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9736 2 120 2.40.50.100
ID Description Score Start End GO Terms
AF-A0A7S3GD37-F1-model_v4 Glycine cleavage system H protein 0.9942 1 102 GO:0005739
GO:0005960
GO:0019464
AF-A0A356TLI4-F1-model_v4 Glycine cleavage system H protein 0.9911 2 119 GO:0005829
GO:0005960
GO:0019464
AF-A0A2U2DT81-F1-model_v4 Glycine cleavage system H protein 0.9908 1 120 GO:0005737
GO:0005960
GO:0019464
AF-A0A077X1S6-F1-model_v4 Glycine cleavage system H protein 0.9908 1 118 GO:0005739
GO:0005960
GO:0019464
AF-A0A3B8UCB1-F1-model_v4 Glycine cleavage system H protein 0.9906 3 101 GO:0005737
GO:0005960
GO:0019464

Feature Viewer

pLDDT pTM Quality
96.08 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map