F450602

General Info

Members Datasets Scaffolds Average Seq Length
471 341 418 140

Family's Representative Sequence

Representative Sequence 3300021361|Ga0213872_10102023|Ga0213872_101020233
Length 167
Sequence MILLDTNVVSEAMKPEPNAAVLNWLDEQAAETLYLSSVTIAELLFGIGALPAGRRKGNLTAALDGLLALFDGRVLSFDTSAARRYADLAVKARSAGRGFPTPDGYIAAIAASHGFAVATRDTSAFDAAGLAVIDPWQAGLTTERPAPLHKAARSLRRAGRRRASAPY

Samples

Sample ID Description Type Environment
1 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
2 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
3 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
4 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
5 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
6 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
7 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
8 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
9 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
10 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
11 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
12 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
13 2791355266 Rhizobium sp. L43 Isolate Nodule
14 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
15 2818991467 Bosea vestrisii 3192 Isolate Unclassified
16 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
17 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
18 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
19 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
20 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
21 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
22 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
23 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
24 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
25 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
26 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
27 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
28 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
29 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
30 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
31 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
32 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
33 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
34 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
35 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
36 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
37 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
38 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
39 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
40 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
41 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
42 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
43 2989392574 Methylomonas rhizoryzae GJ1 Isolate Unclassified
44 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
45 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
46 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
47 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
48 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
49 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
50 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
51 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
52 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
53 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
54 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
55 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
56 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
57 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
58 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
59 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
60 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
61 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
62 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
63 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
64 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
65 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
66 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
67 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
68 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
69 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
70 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
71 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
72 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
73 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
74 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
75 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
76 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
77 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
78 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
79 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
80 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
81 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
82 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
83 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
84 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
85 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
86 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
87 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
88 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
89 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
90 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
91 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
92 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
93 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
94 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
95 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
96 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
97 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
98 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
99 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
100 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
101 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
102 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
103 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
104 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
105 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
106 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
107 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
108 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
109 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
110 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
111 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
112 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
113 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
114 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
115 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
116 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
117 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
118 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
119 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
120 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
121 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
122 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
123 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
124 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
125 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
126 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
131 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
133 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
134 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
137 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
178 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
179 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
180 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
181 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
182 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
183 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
184 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
185 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
186 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
187 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
188 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
189 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
190 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
191 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
192 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
193 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
194 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
195 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
196 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
197 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
198 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
199 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
200 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
201 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
202 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
203 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
204 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
206 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
207 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
208 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
209 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
210 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
211 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
212 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
213 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
214 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
215 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
216 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
217 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
218 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
219 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
220 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
221 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
222 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
223 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
224 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
225 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
226 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
227 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
228 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
229 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
230 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
231 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
232 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
233 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
234 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
235 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
236 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
237 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
238 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
239 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
240 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
241 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
242 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
243 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
244 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
245 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
246 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
247 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
248 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
249 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
250 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
251 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
252 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
253 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
254 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
255 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
256 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
257 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
258 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
259 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
260 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
261 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
262 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
263 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
264 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
265 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
266 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
267 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
268 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
269 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
270 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
271 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
272 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
273 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
274 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
275 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
276 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
277 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
278 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
279 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
280 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
281 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
282 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
283 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
284 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
285 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
287 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
293 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
295 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
296 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
297 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
298 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
299 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
300 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
301 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
302 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
303 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
304 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
305 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
306 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
307 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
308 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
309 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
310 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
311 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
312 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
313 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
314 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
315 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
316 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
317 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
318 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
319 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
320 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
321 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
323 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
324 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
325 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
326 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
327 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
328 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
329 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
330 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
331 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
332 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
333 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
334 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
335 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
336 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
337 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
338 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
339 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
340 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
341 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.6
Metatranscriptomes 0.21
Isolates 10.19

Biome Distribution

Category Percentage (%)
Aerial Root 0.85
Bulb 0
Endosphere 11.89
Nodule 5.52
Rhizoplane 2.34
Rhizosphere 67.94
Stem 0
Stem Tuber 0
Unclassified 11.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24750J21931_1001274 3300002070 Bacteria 3173
2 JGI24749J21850_1036740 3300002076 Bacteria 712
3 JGI24744J21845_10029251 3300002077 Bacteria 1059
4 JGI24034J26672_10089036 3300002239 Bacteria 571
5 JGI24751J29686_10001486 3300002459 Bacteria 4880
6 JGI25159J45721_1002221 3300002987 Bacteria 7515
7 JGI25159J45721_1017591 3300002987 Bacteria 1471
8 rootL2_10134349 3300003322 Bacteria 3415
9 rootL2_10158925 3300003322 Bacteria 1717
10 rootH1_10268397 3300003323 Bacteria 1747
11 JGI25160J50197_1026801 3300003354 Bacteria 1581
12 JGI25161J50226_1000115 3300003374 Bacteria 62500
13 JGI25161J50226_1004572 3300003374 Bacteria 2866
14 Ga0055532_1000084 3300003758 Bacteria 114507
15 Ga0055527_1000057 3300003760 Bacteria 97738
16 Ga0055542_1000424 3300003762 Bacteria 40881
17 Ga0055529_1000577 3300003763 Bacteria 29709
18 Ga0055526_1043950 3300003771 Bacteria 1083
19 Ga0055537_1023446 3300003773 Bacteria 883
20 Ga0055524_1005415 3300003775 Bacteria 5703
21 Ga0055534_1019034 3300003784 Bacteria 1185
22 Ga0055543_1000094 3300004625 Bacteria 78040
23 Ga0055543_1014848 3300004625 Bacteria 1509
24 Ga0065165_1000434 3300005262 Bacteria 65848
25 Ga0065165_1036161 3300005262 Bacteria 1509
26 Ga0065707_10121912 3300005295 Bacteria 2099
27 Ga0070670_100001126 3300005331 Bacteria 21230
28 Ga0070670_100387564 3300005331 Bacteria 1232
29 Ga0068869_101250896 3300005334 Bacteria 654
30 Ga0070666_10271771 3300005335 Bacteria 1203
31 Ga0070682_100511948 3300005337 Bacteria 932
32 Ga0070682_102034073 3300005337 Bacteria 506
33 Ga0068868_100272733 3300005338 Bacteria 1430
34 Ga0070668_100004878 3300005347 Bacteria 9938
35 Ga0070668_100026274 3300005347 Bacteria 4417
36 Ga0070668_100155497 3300005347 Bacteria 1852
37 Ga0070669_100000004 3300005353 Bacteria 314707
38 Ga0070671_100000029 3300005355 Bacteria 112712
39 Ga0070671_100719228 3300005355 Bacteria 867
40 Ga0070659_100006787 3300005366 Bacteria 8285
41 Ga0070667_100010156 3300005367 Bacteria 7784
42 Ga0070709_10000440 3300005434 Bacteria 25182
43 Ga0070713_100024350 3300005436 Bacteria 4713
44 Ga0070713_100786313 3300005436 Bacteria 912
45 Ga0070705_100002697 3300005440 Bacteria 8870
46 Ga0070705_100005106 3300005440 Bacteria 6383
47 Ga0070708_100017520 3300005445 Bacteria 5980
48 Ga0070678_100333010 3300005456 Bacteria 1300
49 Ga0070706_101046843 3300005467 Bacteria 752
50 Ga0070706_101222954 3300005467 Bacteria 690
51 Ga0070698_100507725 3300005471 Bacteria 1144
52 Ga0070672_100109917 3300005543 Bacteria 2246
53 Ga0070665_100236721 3300005548 Bacteria 1826
54 Ga0070665_100242905 3300005548 Bacteria 1801
55 Ga0070665_100406594 3300005548 Bacteria 1369
56 Ga0068855_100000046 3300005563 Bacteria 147225
57 Ga0068855_100490237 3300005563 Bacteria 1337
58 Ga0068854_100384679 3300005578 Bacteria 1157
59 Ga0070702_100173034 3300005615 Bacteria 1406
60 Ga0068852_100739405 3300005616 Bacteria 995
61 Ga0068859_100002440 3300005617 Bacteria 18923
62 Ga0068859_100242809 3300005617 Bacteria 1890
63 Ga0068864_100250731 3300005618 Bacteria 1643
64 Ga0068861_100009134 3300005719 Bacteria 6836
65 Ga0068861_100400394 3300005719 Bacteria 1218
66 Ga0068851_10585843 3300005834 Bacteria 677
67 Ga0068863_100001855 3300005841 Bacteria 21000
68 Ga0068858_100002250 3300005842 Bacteria 19508
69 Ga0068858_100090193 3300005842 Bacteria 2852
70 Ga0068860_100003538 3300005843 Bacteria 16074
71 Ga0068860_101148697 3300005843 Bacteria 796
72 Ga0068862_100010074 3300005844 Bacteria 7803
73 Ga0068862_100059009 3300005844 Bacteria 3293
74 Ga0075365_10158258 3300006038 Bacteria 1577
75 Ga0075365_10291007 3300006038 Bacteria 1149
76 Ga0075363_100445632 3300006048 Bacteria 764
77 Ga0075364_10833115 3300006051 Bacteria 629
78 Ga0070712_100773152 3300006175 Bacteria 823
79 Ga0070712_100849017 3300006175 Bacteria 785
80 Ga0075362_10379552 3300006177 Bacteria 711
81 Ga0075369_10002823 3300006186 Bacteria 6249
82 Ga0075429_100036065 3300006880 Bacteria 4301
83 Ga0068865_100530274 3300006881 Bacteria 986
84 Ga0097620_100002440 3300006931 Bacteria 18923
85 Ga0097620_100242813 3300006931 Bacteria 1890
86 Ga0105244_10043792 3300009036 Bacteria 2307
87 Ga0105250_10167696 3300009092 Bacteria 918
88 Ga0105240_10049445 3300009093 Bacteria 5306
89 Ga0105247_10001335 3300009101 Bacteria 18004
90 Ga0105247_10251790 3300009101 Bacteria 1207
91 Ga0114129_11239062 3300009147 Bacteria 927
92 Ga0105243_10196634 3300009148 Bacteria 1765
93 Ga0105248_10407030 3300009177 Bacteria 1532
94 Ga0105237_10154466 3300009545 Bacteria 2292
95 Ga0105249_10006295 3300009553 Bacteria 10313
96 Ga0105239_10783121 3300010375 Bacteria 1092
97 Ga0105246_10585011 3300011119 Bacteria 962
98 Ga0157374_10199185 3300013296 Bacteria 1960
99 Ga0163162_10008056 3300013306 Bacteria 10279
100 Ga0157375_10463840 3300013308 Bacteria 1432
101 Ga0163163_12529813 3300014325 Bacteria 571
102 Ga0157380_10005732 3300014326 Bacteria 8693
103 Ga0157379_10009705 3300014968 Bacteria 8383
104 Ga0157379_10232844 3300014968 Bacteria 1670
105 Ga0157376_10262840 3300014969 Bacteria 1618
106 Ga0213872_10102023 3300021361 Bacteria 1279
107 Ga0213872_10217289 3300021361 Bacteria 815
108 Ga0209436_100042 3300025208 Bacteria 73600
109 Ga0209436_112824 3300025208 Bacteria 1404
110 Ga0209672_100245 3300025228 Bacteria 40928
111 Ga0209147_100299 3300025229 Bacteria 40928
112 Ga0209258_100487 3300025242 Bacteria 40928
113 Ga0209148_1000489 3300025254 Bacteria 40928
114 Ga0209565_1024231 3300025263 Bacteria 1237
115 Ga0209455_1000374 3300025272 Bacteria 40928
116 Ga0209130_1000227 3300025284 Bacteria 73760
117 Ga0209130_1002419 3300025284 Bacteria 9400
118 Ga0209130_1015164 3300025284 Bacteria 1908
119 Ga0209675_1015239 3300025291 Bacteria 2295
120 Ga0209564_1041341 3300025295 Bacteria 1237
121 Ga0209256_1000638 3300025299 Bacteria 47804
122 Ga0209256_1000757 3300025299 Bacteria 42054
123 Ga0207426_1000506 3300025302 Bacteria 57538
124 Ga0209051_1087613 3300025303 Bacteria 877
125 Ga0207697_10000013 3300025315 Bacteria 61852
126 Ga0207655_1037001 3300025728 Bacteria 2155
127 Ga0207692_10487453 3300025898 Bacteria 781
128 Ga0207710_10008210 3300025900 Bacteria 4409
129 Ga0207710_10149695 3300025900 Bacteria 1131
130 Ga0207680_10462331 3300025903 Bacteria 901
131 Ga0207699_10000034 3300025906 Bacteria 134405
132 Ga0207684_10735995 3300025910 Bacteria 836
133 Ga0207695_10000797 3300025913 Bacteria 59086
134 Ga0207671_10003165 3300025914 Bacteria 16628
135 Ga0207662_10499122 3300025918 Bacteria 838
136 Ga0207681_10000010 3300025923 Bacteria 403379
137 Ga0207650_10000482 3300025925 Bacteria 33245
138 Ga0207659_10861258 3300025926 Bacteria 779
139 Ga0207687_10838717 3300025927 Bacteria 785
140 Ga0207700_10009703 3300025928 Bacteria 6030
141 Ga0207700_10842061 3300025928 Bacteria 821
142 Ga0207664_10028968 3300025929 Bacteria 4215
143 Ga0207644_10000007 3300025931 Bacteria 381778
144 Ga0207690_10003861 3300025932 Bacteria 8858
145 Ga0207709_10969641 3300025935 Bacteria 694
146 Ga0207670_10643480 3300025936 Bacteria 874
147 Ga0207691_10501151 3300025940 Bacteria 1031
148 Ga0207689_10090473 3300025942 Bacteria 2515
149 Ga0207689_10891856 3300025942 Bacteria 750
150 Ga0207667_10000036 3300025949 Bacteria 297966
151 Ga0207667_10739297 3300025949 Bacteria 984
152 Ga0207712_10020555 3300025961 Bacteria 4325
153 Ga0207712_10172638 3300025961 Bacteria 1691
154 Ga0207668_10001767 3300025972 Bacteria 12621
155 Ga0207668_10054336 3300025972 Bacteria 2780
156 Ga0207668_10557640 3300025972 Bacteria 993
157 Ga0207658_10005143 3300025986 Bacteria 9009
158 Ga0207703_10001843 3300026035 Bacteria 18892
159 Ga0207703_10088318 3300026035 Bacteria 2601
160 Ga0207703_10349013 3300026035 Bacteria 1362
161 Ga0207678_10062555 3300026067 Bacteria 3199
162 Ga0207708_10402696 3300026075 Bacteria 1132
163 Ga0207702_10670537 3300026078 Bacteria 1021
164 Ga0207641_10002095 3300026088 Bacteria 18874
165 Ga0207641_10705372 3300026088 Bacteria 994
166 Ga0207641_11559634 3300026088 Bacteria 662
167 Ga0207676_10001590 3300026095 Bacteria 16719
168 Ga0207676_10129561 3300026095 Bacteria 2143
169 Ga0207675_100002086 3300026118 Bacteria 19851
170 Ga0207683_10222259 3300026121 Bacteria 1721
171 Ga0207698_10537495 3300026142 Bacteria 1143
172 Ga0209371_1001619 3300027312 Bacteria 14596
173 Ga0268266_10220437 3300028379 Bacteria 1743
174 Ga0268266_10257448 3300028379 Bacteria 1616
175 Ga0268266_10298391 3300028379 Bacteria 1502
176 Ga0268265_10000468 3300028380 Bacteria 42801
177 Ga0268265_10001167 3300028380 Bacteria 23017
178 Ga0268265_10650300 3300028380 Bacteria 1013
179 Ga0268264_10000218 3300028381 Bacteria 113449
180 Ga0268264_10173364 3300028381 Bacteria 1953
181 Ga0307517_10167061 3300028786 Bacteria 1458
182 Ga0307515_10025549 3300028794 Bacteria 10212
183 Ga0307515_10043433 3300028794 Bacteria 6987
184 Ga0307515_10064202 3300028794 Bacteria 5136
185 Ga0307515_10175891 3300028794 Bacteria 2111
186 Ga0265324_10011806 3300029957 Bacteria 3317
187 Ga0268256_1001406 3300030500 Bacteria 14595
188 Ga0265328_10003566 3300031239 Bacteria 6859
189 Ga0265328_10092361 3300031239 Bacteria 1118
190 Ga0265325_10301757 3300031241 Unclassified 715
191 Ga0265329_10025912 3300031242 Bacteria 1936
192 Ga0265331_10006285 3300031250 Bacteria 7041
193 Ga0265331_10006923 3300031250 Bacteria 6620
194 Ga0265327_10014228 3300031251 Bacteria 5216
195 Ga0265327_10018161 3300031251 Bacteria 4372
196 Ga0265327_10024863 3300031251 Bacteria 3506
197 Ga0265327_10208555 3300031251 Bacteria 883
198 Ga0265327_10215376 3300031251 Bacteria 865
199 Ga0265316_10007308 3300031344 Bacteria 10420
200 Ga0265316_10036543 3300031344 Bacteria 3971
201 Ga0265316_10167848 3300031344 Bacteria 1638
202 Ga0307513_10044320 3300031456 Bacteria 4874
203 Ga0307513_10209589 3300031456 Bacteria 1781
204 Ga0307513_10354877 3300031456 Unclassified 1213
205 Ga0307513_10877060 3300031456 Unclassified 604
206 Ga0307509_10075917 3300031507 Bacteria 3489
207 Ga0307408_100104046 3300031548 Bacteria 2168
208 Ga0307408_101522935 3300031548 Bacteria 633
209 Ga0307508_10100740 3300031616 Bacteria 2484
210 Ga0316579_10010356 3300031691 Bacteria 3941
211 Ga0316579_10029931 3300031691 Bacteria 2486
212 Ga0265314_10459746 3300031711 Bacteria 676
213 Ga0307516_10096084 3300031730 Bacteria 2784
214 Ga0307516_10220165 3300031730 Bacteria 1608
215 Ga0307405_10432377 3300031731 Bacteria 1039
216 Ga0307413_11170796 3300031824 Bacteria 667
217 Ga0307410_11520217 3300031852 Bacteria 590
218 Ga0307406_10045765 3300031901 Bacteria 2749
219 Ga0307412_10234679 3300031911 Bacteria 1415
220 Ga0307412_10525399 3300031911 Bacteria 989
221 Ga0307409_101914515 3300031995 Bacteria 622
222 Ga0307409_102666623 3300031995 Bacteria 528
223 Ga0307416_100486420 3300032002 Bacteria 1295
224 Ga0307416_100810584 3300032002 Bacteria 1032
225 Ga0307414_10087875 3300032004 Bacteria 2299
226 Ga0307414_10118974 3300032004 Bacteria 2027
227 Ga0307411_12336141 3300032005 Bacteria 503
228 Ga0307415_100184766 3300032126 Bacteria 1639
229 Ga0307415_100926785 3300032126 Bacteria 805
230 Ga0316593_10005215 3300032168 Bacteria 3408
231 Ga0373944_0126385 3300035089 Bacteria 885
232 Ga0373943_0073739 3300035170 Bacteria 1734
233 Ga0373946_0151138 3300035171 Bacteria 1083
234 Ga0373935_0301615 3300035692 Bacteria 1132
235 Ga0373935_0329513 3300035692 Bacteria 1085
236 Ga0373927_0000343 3300035695 Bacteria 36640
237 Ga0373947_0075577 3300035725 Bacteria 2075
238 Ga0373937_0122465 3300036401 Bacteria 2425
239 Ga0373925_0006509 3300037068 Bacteria 8589
240 Ga0395905_0712680 3300037471 Bacteria 906
241 Ga0395901_0000062 3300038443 Bacteria 150171
242 Ga0400490_23922 3300038726 Bacteria 4045
243 Ga0400491_20839 3300038727 Bacteria 1833
244 Ga0400485_18289 3300038735 Bacteria 1155
245 Ga0400486_22975 3300038742 Bacteria 1183
246 Ga0400483_112712 3300039062 Bacteria 3139
247 Ga0400487_05514 3300039110 Bacteria 5186
248 Ga0436361_0008661 3300039447 Bacteria 11017
249 Ga0436361_0962141 3300039447 Bacteria 4144
250 Ga0436363_0629244 3300039450 Bacteria 694
251 Ga0439436_0072227 3300041404 Bacteria 961
252 Ga0439439_0001838 3300041406 Bacteria 4359
253 Ga0439466_0044780 3300041411 Bacteria 1465
254 Ga0451791_0885110 3300041451 Bacteria 724
255 Ga0451793_0747869 3300041452 Bacteria 1037
256 Ga0451797_0914973 3300041453 Unclassified 904
257 Ga0451798_0580064 3300041458 Bacteria 1016
258 Ga0451833_0613690 3300041491 Bacteria 596
259 Ga0451853_0902899 3300041512 Bacteria 653
260 Ga0439442_072412 3300042002 Bacteria 734
261 Ga0439432_102040 3300042006 Bacteria 857
262 Ga0439449_0032651 3300042007 Bacteria 1940
263 Ga0439452_002877 3300042010 Bacteria 6183
264 Ga0439457_083328 3300042014 Bacteria 736
265 Ga0439462_0012339 3300042015 Bacteria 2181
266 Ga0439446_0012172 3300042156 Bacteria 2347
267 Ga0451577_0002536 3300042876 Bacteria 21608
268 Ga0451577_0074075 3300042876 Bacteria 3037
269 Ga0466969_0035685 3300044656 Bacteria 2514
270 Ga0466969_0053602 3300044656 Bacteria 1977
271 Ga0453683_0021108 3300044673 Bacteria 4159
272 Ga0466965_0009539 3300044683 Bacteria 4510
273 Ga0466965_0110294 3300044683 Bacteria 1413
274 Ga0466966_0104309 3300044684 Bacteria 1751
275 Ga0466966_0106728 3300044684 Bacteria 1728
276 Ga0466961_0001063 3300044693 Bacteria 16912
277 Ga0466961_0007379 3300044693 Bacteria 6996
278 Ga0466961_0130324 3300044693 Bacteria 1576
279 Ga0466961_0351445 3300044693 Bacteria 897
280 Ga0466963_0047549 3300044694 Bacteria 2832
281 Ga0453684_0049573 3300044712 Bacteria 5535
282 Ga0453684_0066497 3300044712 Bacteria 4589
283 Ga0466971_0009307 3300044719 Bacteria 4292
284 Ga0466970_0020129 3300044765 Bacteria 3463
285 Ga0466957_0859047 3300044842 Bacteria 647
286 Ga0466959_0000763 3300045049 Bacteria 18831
287 Ga0466959_0059962 3300045049 Bacteria 2769
288 Ga0466959_0139321 3300045049 Bacteria 1715
289 Ga0466959_0151512 3300045049 Bacteria 1634
290 Ga0466959_0592688 3300045049 Bacteria 746
291 Ga0451576_0034880 3300045051 Bacteria 5341
292 Ga0466958_0004154 3300045836 Bacteria 7604
293 Ga0466958_0012983 3300045836 Bacteria 4733
294 Ga0495582_0190127 3300046473 Bacteria 1171
295 Ga0495605_0016393 3300046474 Bacteria 4010
296 Ga0495664_0675793 3300046477 Unclassified 611
297 Ga0495607_0000386 3300046501 Bacteria 45031
298 Ga0495606_0044304 3300046507 Bacteria 2960
299 Ga0495628_0012002 3300046516 Bacteria 7307
300 Ga0495663_0003121 3300046525 Bacteria 4839
301 Ga0495645_0765924 3300046543 Unclassified 581
302 Ga0495633_0001009 3300046558 Bacteria 23026
303 Ga0495633_0358490 3300046558 Bacteria 660
304 Ga0495668_0061277 3300046616 Bacteria 2075
305 Ga0495613_0760716 3300046689 Bacteria 634
306 Ga0495624_0487505 3300046690 Bacteria 738
307 Ga0495649_0000288 3300046694 Bacteria 44617
308 Ga0495600_0137083 3300046809 Bacteria 1589
309 Ga0495636_0007910 3300047318 Bacteria 4186
310 Ga0495686_0085034 3300047472 Bacteria 1927
311 Ga0495686_0225630 3300047472 Bacteria 1063
312 Ga0495626_0320832 3300048091 Unclassified 609
313 Ga0496103_0176711 3300048906 Bacteria 1372
314 Ga0496106_0300271 3300048909 Bacteria 1288
315 Ga0496108_0026927 3300048911 Bacteria 4745
316 Ga0496109_0261088 3300048912 Bacteria 1631
317 Ga0496109_1055837 3300048912 Bacteria 750
318 Ga0496110_0151184 3300048913 Bacteria 2102
319 Ga0496113_0378536 3300048916 Bacteria 1136
320 Ga0496116_0031350 3300048919 Bacteria 3808
321 Ga0496117_0025805 3300048920 Bacteria 4609
322 Ga0496118_0259894 3300048921 Bacteria 981
323 Ga0496121_0086961 3300048924 Bacteria 2455
324 Ga0496122_0003182 3300048925 Bacteria 21893
325 Ga0496122_0003590 3300048925 Bacteria 20223
326 Ga0496122_0021289 3300048925 Bacteria 5810
327 Ga0496123_0002846 3300048926 Bacteria 20442
328 Ga0496123_0016154 3300048926 Bacteria 6078
329 Ga0496123_0022086 3300048926 Bacteria 4917
330 Ga0496124_0139448 3300048927 Bacteria 1915
331 Ga0496124_0607308 3300048927 Bacteria 710
332 Ga0496125_0136153 3300048928 Bacteria 1718
333 Ga0496125_0158494 3300048928 Bacteria 1542
334 Ga0496126_0178137 3300048929 Bacteria 1807
335 Ga0501031_0268185 3300049568 Bacteria 1109
336 Ga0501031_0632970 3300049568 Bacteria 688
337 Ga0501032_0054389 3300049569 Bacteria 2694
338 Ga0501033_0026320 3300049570 Bacteria 4379
339 Ga0501033_0365024 3300049570 Bacteria 1010
340 Ga0501034_0007653 3300049571 Bacteria 11494
341 Ga0501037_0010483 3300049573 Bacteria 6807
342 Ga0501037_0749842 3300049573 Unclassified 647
343 Ga0501038_0011245 3300049574 Bacteria 8172
344 Ga0501038_0162006 3300049574 Bacteria 1817
345 Ga0501039_0335198 3300049575 Bacteria 1189
346 Ga0501039_0632926 3300049575 Bacteria 838
347 Ga0501043_0074371 3300049579 Bacteria 2669
348 Ga0501043_0578022 3300049579 Bacteria 832
349 Ga0501047_0004093 3300049581 Bacteria 13721
350 Ga0501047_0005368 3300049581 Bacteria 12042
351 Ga0501047_0662814 3300049581 Bacteria 862
352 Ga0501047_0865206 3300049581 Bacteria 718
353 Ga0501067_0001493 3300049583 Bacteria 12731
354 Ga0501068_0050502 3300049584 Bacteria 2514
355 Ga0501068_0164991 3300049584 Bacteria 1397
356 Ga0501069_0006459 3300049585 Bacteria 6131
357 Ga0501069_0007320 3300049585 Bacteria 5792
358 Ga0501069_0013393 3300049585 Bacteria 4374
359 Ga0501070_0004757 3300049586 Bacteria 11618
360 Ga0501070_0018257 3300049586 Bacteria 5885
361 Ga0501070_0438752 3300049586 Bacteria 1053
362 Ga0501070_0499776 3300049586 Unclassified 977
363 Ga0501072_0111919 3300049588 Bacteria 2173
364 Ga0501072_0160565 3300049588 Bacteria 1793
365 Ga0501073_0006210 3300049589 Bacteria 8914
366 Ga0501073_0557678 3300049589 Bacteria 791
367 Ga0501074_0166337 3300049590 Bacteria 1574
368 Ga0501074_0188450 3300049590 Bacteria 1471
369 Ga0501076_1650495 3300049592 Bacteria 526
370 Ga0501207_015649 3300049654 Bacteria 1169
371 Ga0501235_138549 3300049669 Bacteria 621
372 Ga0501242_077697 3300049674 Bacteria 529
373 Ga0501253_038505 3300049683 Bacteria 951
374 Ga0501255_016433 3300049684 Bacteria 915
375 Ga0501225_0013244 3300049705 Bacteria 2311
376 Ga0501229_000504 3300049706 Bacteria 4415
377 Ga0501229_028021 3300049706 Bacteria 764
378 Ga0501079_0032173 3300049741 Bacteria 4032
379 Ga0501080_0155897 3300049742 Bacteria 2109
380 Ga0501080_0304622 3300049742 Bacteria 1444
381 Ga0501083_0001350 3300049744 Bacteria 16654
382 Ga0501083_0254173 3300049744 Bacteria 1144
383 Ga0501262_004381 3300049759 Bacteria 1637
384 Ga0501264_009101 3300049761 Bacteria 943
385 Ga0501265_006676 3300049762 Bacteria 1346
386 Ga0501266_015742 3300049763 Bacteria 1001
387 Ga0501268_056257 3300049765 Bacteria 771
388 Ga0501269_005148 3300049766 Bacteria 1573
389 Ga0501270_047567 3300049767 Bacteria 767
390 Ga0501272_003346 3300049769 Bacteria 1627
391 Ga0501280_028164 3300049776 Bacteria 867
392 Ga0501035_0001896 3300049822 Bacteria 21033
393 Ga0501035_0058001 3300049822 Bacteria 3451
394 Ga0501035_0807638 3300049822 Bacteria 749
395 Ga0501044_0023069 3300049823 Bacteria 6624
396 Ga0501044_0202187 3300049823 Bacteria 1944
397 Ga0501044_0401420 3300049823 Bacteria 1283
398 Ga0501044_0528886 3300049823 Bacteria 1078
399 Ga0501044_0986190 3300049823 Bacteria 715
400 Ga0501044_1559619 3300049823 Bacteria 525
401 nmdc:mga03n38_390902_c1 3300050490 Bacteria 764
402 nmdc:mga0yw44_146276_c1 3300050492 Bacteria 1539
403 nmdc:mga0yw44_73515_c1 3300050492 Bacteria 2127
404 nmdc:mga09592_76460_c1 3300050508 Unclassified 2847
405 Ga0495601_0621722 3300053077 Bacteria 692
406 Ga0500578_0019417 3300053086 Bacteria 4364
407 Ga0500651_0073710 3300053093 Bacteria 2122
408 Ga0500641_0002260 3300053096 Bacteria 6823
409 Ga0500554_054642 3300053102 Bacteria 1266
410 Ga0500559_0223245 3300053136 Bacteria 888
411 Ga0500590_009468 3300053148 Bacteria 4899
412 Ga0500590_044627 3300053148 Bacteria 2270
413 Ga0500616_0000907 3300053153 Bacteria 32494
414 Ga0500627_0271009 3300053158 Bacteria 747
415 Ga0501084_0054988 3300054114 Bacteria 3330
416 Ga0501084_0749133 3300054114 Bacteria 823
417 Ga0501082_0612580 3300060353 Bacteria 953
418 Ga0466962_0028301 3300061719 Bacteria 2685

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048912 Ga0496109_1055837 Ga0496109_1055837_363_737 123
2 3300039447 Ga0436361_0962141 Ga0436361_0962141_2088_2591 125
3 3300046501 Ga0495607_0000386 Ga0495607_0000386_28343_28771 134
4 iso_pu_bacteria 2521172590 2521558513 134
5 iso_pu_bacteria 2551306416 2553003310 134
6 iso_pu_bacteria 2841911363 2841915792 134
7 iso_pu_bacteria 2841917233 2841921827 134
8 iso_pu_bacteria 2906602504 2906605727 134
9 iso_pu_bacteria 2928130867 2928131361 134
10 iso_pu_bacteria 2989392574 2989395217 134
11 3300026088 Ga0207641_11559634 Ga0207641_115596342 135
12 3300046616 Ga0495668_0061277 Ga0495668_0061277_841_1251 135
13 3300047318 Ga0495636_0007910 Ga0495636_0007910_2556_2966 135
14 3300049570 Ga0501033_0365024 Ga0501033_0365024_345_767 135
15 iso_pu_bacteria 2574179768 2574431797 135
16 iso_pu_bacteria 2818991439 2819562116 135
17 iso_pu_bacteria 2904541872 2904542527 135
18 iso_pu_bacteria 2929160207 2929167774 135
19 iso_pu_bacteria 2984509177 2984514109 135
20 iso_pu_bacteria 2984518228 2984523139 135
21 iso_pu_bacteria 2984537506 2984542324 135
22 iso_pu_bacteria 2984601300 2984606361 135
23 3300031242 Ga0265329_10025912 Ga0265329_100259123 136
24 iso_pu_bacteria 2510065019 2510136364 136
25 iso_pu_bacteria 2513237087 2513593943 136
26 iso_pu_bacteria 2513237103 2513711231 136
27 iso_pu_bacteria 2513237137 2513863295 136
28 iso_pu_bacteria 2515154123 2515686945 136
29 iso_pu_bacteria 2517287029 2517409750 136
30 iso_pu_bacteria 2517572143 2517890414 136
31 iso_pu_bacteria 2524023209 2524458952 136
32 iso_pu_bacteria 2643221579 2643905809 136
33 iso_pu_bacteria 2791355266 2793363695 136
34 iso_pu_bacteria 2818991467 2819719024 136
35 iso_pu_bacteria 2838680041 2838684539 136
36 iso_pu_bacteria 2838694306 2838698700 136
37 iso_pu_bacteria 2838707686 2838712419 136
38 iso_pu_bacteria 2842118031 2842122818 136
39 iso_pu_bacteria 2842217011 2842219925 136
40 iso_pu_bacteria 2842237096 2842241831 136
41 iso_pu_bacteria 2842291075 2842295658 136
42 iso_pu_bacteria 2842298080 2842298304 136
43 iso_pu_bacteria 2842357229 2842360096 136
44 iso_pu_bacteria 2842370503 2842374460 136
45 iso_pu_bacteria 2842377471 2842382062 136
46 iso_pu_bacteria 2842384541 2842389366 136
47 iso_pu_bacteria 2844315083 2844320644 136
48 iso_pu_bacteria 2885312484 2885313247 136
49 iso_pu_bacteria 2903768456 2903772467 136
50 iso_pu_bacteria 2919450847 2919456262 136
51 iso_pu_bacteria 2935894831 2935898618 136
52 iso_pu_bacteria 3004334049 3004337342 136
53 iso_pu_bacteria 639633055 639644848 136
54 iso_pu_bacteria 8001845381 8001847274 136
55 iso_pu_bacteria 8018163183 8018163469 136
56 3300003322 rootL2_10134349 rootL2_101343492 137
57 3300005337 Ga0070682_102034073 Ga0070682_1020340731 137
58 3300029957 Ga0265324_10011806 Ga0265324_100118063 137
59 3300031241 Ga0265325_10301757 Ga0265325_103017572 137
60 3300003322 rootL2_10158925 rootL2_101589252 138
61 3300005366 Ga0070659_100006787 Ga0070659_10000678713 138
62 3300005563 Ga0068855_100000046 Ga0068855_1000000469 138
63 3300005834 Ga0068851_10585843 Ga0068851_105858432 138
64 3300006048 Ga0075363_100445632 Ga0075363_1004456322 138
65 3300009036 Ga0105244_10043792 Ga0105244_100437923 138
66 3300009148 Ga0105243_10196634 Ga0105243_101966342 138
67 3300025728 Ga0207655_1037001 Ga0207655_10370013 138
68 3300025932 Ga0207690_10003861 Ga0207690_100038616 138
69 3300025949 Ga0207667_10000036 Ga0207667_1000003695 138
70 3300028786 Ga0307517_10167061 Ga0307517_101670613 138
71 3300028794 Ga0307515_10025549 Ga0307515_100255495 138
72 3300031251 Ga0265327_10208555 Ga0265327_102085551 138
73 3300031251 Ga0265327_10215376 Ga0265327_102153761 138
74 3300031507 Ga0307509_10075917 Ga0307509_100759173 138
75 3300031548 Ga0307408_101522935 Ga0307408_1015229351 138
76 3300031691 Ga0316579_10010356 Ga0316579_100103562 138
77 3300031691 Ga0316579_10029931 Ga0316579_100299315 138
78 3300031911 Ga0307412_10234679 Ga0307412_102346792 138
79 3300032004 Ga0307414_10087875 Ga0307414_100878753 138
80 3300032168 Ga0316593_10005215 Ga0316593_100052152 138
81 3300035692 Ga0373935_0329513 Ga0373935_0329513_353_769 138
82 3300035725 Ga0373947_0075577 Ga0373947_0075577_282_698 138
83 3300037471 Ga0395905_0712680 Ga0395905_0712680_476_892 138
84 3300038726 Ga0400490_23922 Ga0400490_23922_400_816 138
85 3300038727 Ga0400491_20839 Ga0400491_20839_637_1053 138
86 3300038735 Ga0400485_18289 Ga0400485_18289_642_1058 138
87 3300038742 Ga0400486_22975 Ga0400486_22975_92_508 138
88 3300039062 Ga0400483_112712 Ga0400483_112712_768_1184 138
89 3300039110 Ga0400487_05514 Ga0400487_05514_420_836 138
90 3300039450 Ga0436363_0629244 Ga0436363_0629244_241_657 138
91 3300041452 Ga0451793_0747869 Ga0451793_0747869_92_508 138
92 3300041453 Ga0451797_0914973 Ga0451797_0914973_365_781 138
93 3300041458 Ga0451798_0580064 Ga0451798_0580064_588_1004 138
94 3300042876 Ga0451577_0002536 Ga0451577_0002536_17698_18114 138
95 3300042876 Ga0451577_0074075 Ga0451577_0074075_295_711 138
96 3300044673 Ga0453683_0021108 Ga0453683_0021108_82_498 138
97 3300044683 Ga0466965_0110294 Ga0466965_0110294_563_979 138
98 3300044693 Ga0466961_0130324 Ga0466961_0130324_485_901 138
99 3300044693 Ga0466961_0351445 Ga0466961_0351445_120_536 138
100 3300044712 Ga0453684_0049573 Ga0453684_0049573_821_1237 138
101 3300044712 Ga0453684_0066497 Ga0453684_0066497_661_1077 138
102 3300045049 Ga0466959_0151512 Ga0466959_0151512_726_1142 138
103 3300045051 Ga0451576_0034880 Ga0451576_0034880_689_1105 138
104 3300046473 Ga0495582_0190127 Ga0495582_0190127_558_974 138
105 3300046525 Ga0495663_0003121 Ga0495663_0003121_3523_3939 138
106 3300046558 Ga0495633_0001009 Ga0495633_0001009_706_1122 138
107 3300046558 Ga0495633_0358490 Ga0495633_0358490_103_519 138
108 3300046690 Ga0495624_0487505 Ga0495624_0487505_113_529 138
109 3300049581 Ga0501047_0662814 Ga0501047_0662814_423_839 138
110 3300049585 Ga0501069_0006459 Ga0501069_0006459_2882_3298 138
111 3300049586 Ga0501070_0018257 Ga0501070_0018257_5238_5654 138
112 3300049586 Ga0501070_0499776 Ga0501070_0499776_183_599 138
113 3300050490 nmdc:mga03n38_390902_c1 nmdc:mga03n38_390902_c1_111_527 138
114 3300053077 Ga0495601_0621722 Ga0495601_0621722_12_428 138
115 3300053102 Ga0500554_054642 Ga0500554_054642_821_1237 138
116 3300053136 Ga0500559_0223245 Ga0500559_0223245_131_547 138
117 3300053148 Ga0500590_044627 Ga0500590_044627_1435_1851 138
118 3300053158 Ga0500627_0271009 Ga0500627_0271009_153_572 138
119 3300006880 Ga0075429_100036065 Ga0075429_1000360656 139
120 3300027312 Ga0209371_1001619 Ga0209371_100161914 139
121 3300030500 Ga0268256_1001406 Ga0268256_100140614 139
122 3300031251 Ga0265327_10018161 Ga0265327_100181612 139
123 3300031344 Ga0265316_10036543 Ga0265316_100365433 139
124 3300031456 Ga0307513_10877060 Ga0307513_108770601 139
125 3300031548 Ga0307408_100104046 Ga0307408_1001040463 139
126 3300031711 Ga0265314_10459746 Ga0265314_104597462 139
127 3300031824 Ga0307413_11170796 Ga0307413_111707961 139
128 3300031911 Ga0307412_10525399 Ga0307412_105253992 139
129 3300032004 Ga0307414_10118974 Ga0307414_101189741 139
130 3300032005 Ga0307411_12336141 Ga0307411_123361411 139
131 3300036401 Ga0373937_0122465 Ga0373937_0122465_1447_1869 139
132 3300041404 Ga0439436_0072227 Ga0439436_0072227_121_540 139
133 3300041406 Ga0439439_0001838 Ga0439439_0001838_418_837 139
134 3300041411 Ga0439466_0044780 Ga0439466_0044780_435_854 139
135 3300042002 Ga0439442_072412 Ga0439442_072412_13_432 139
136 3300042006 Ga0439432_102040 Ga0439432_102040_307_726 139
137 3300042007 Ga0439449_0032651 Ga0439449_0032651_1373_1792 139
138 3300042010 Ga0439452_002877 Ga0439452_002877_1578_1997 139
139 3300042014 Ga0439457_083328 Ga0439457_083328_121_540 139
140 3300042015 Ga0439462_0012339 Ga0439462_0012339_610_1029 139
141 3300042156 Ga0439446_0012172 Ga0439446_0012172_1594_2013 139
142 3300046477 Ga0495664_0675793 Ga0495664_0675793_155_577 139
143 3300046501 Ga0495607_0000386 Ga0495607_0000386_1480_1899 139
144 3300046516 Ga0495628_0012002 Ga0495628_0012002_2164_2586 139
145 3300046543 Ga0495645_0765924 Ga0495645_0765924_39_461 139
146 3300046809 Ga0495600_0137083 Ga0495600_0137083_846_1268 139
147 3300048091 Ga0495626_0320832 Ga0495626_0320832_77_496 139
148 3300048928 Ga0496125_0136153 Ga0496125_0136153_1070_1489 139
149 3300049573 Ga0501037_0749842 Ga0501037_0749842_161_580 139
150 3300049579 Ga0501043_0074371 Ga0501043_0074371_199_624 139
151 3300049822 Ga0501035_0807638 Ga0501035_0807638_47_472 139
152 3300049823 Ga0501044_0401420 Ga0501044_0401420_199_624 139
153 3300050508 nmdc:mga09592_76460_c1 nmdc:mga09592_76460_c1_888_1310 139
154 3300053086 Ga0500578_0019417 Ga0500578_0019417_1594_2019 139
155 3300053093 Ga0500651_0073710 Ga0500651_0073710_267_692 139
156 3300053153 Ga0500616_0000907 Ga0500616_0000907_29749_30174 139
157 3300002070 JGI24750J21931_1001274 JGI24750J21931_10012744 140
158 3300002076 JGI24749J21850_1036740 JGI24749J21850_10367401 140
159 3300002077 JGI24744J21845_10029251 JGI24744J21845_100292512 140
160 3300002239 JGI24034J26672_10089036 JGI24034J26672_100890361 140
161 3300002459 JGI24751J29686_10001486 JGI24751J29686_100014865 140
162 3300002987 JGI25159J45721_1002221 JGI25159J45721_10022217 140
163 3300002987 JGI25159J45721_1017591 JGI25159J45721_10175913 140
164 3300003323 rootH1_10268397 rootH1_102683974 140
165 3300003354 JGI25160J50197_1026801 JGI25160J50197_10268013 140
166 3300003374 JGI25161J50226_1000115 JGI25161J50226_100011548 140
167 3300003374 JGI25161J50226_1004572 JGI25161J50226_10045723 140
168 3300003758 Ga0055532_1000084 Ga0055532_1000084149 140
169 3300003758 Ga0055532_1000084 Ga0055532_100008433 140
170 3300003758 Ga0055532_1000084 Ga0055532_100008491 140
171 3300003760 Ga0055527_1000057 Ga0055527_1000057125 140
172 3300003760 Ga0055527_1000057 Ga0055527_100005767 140
173 3300003760 Ga0055527_1000057 Ga0055527_10000579 140
174 3300003762 Ga0055542_1000424 Ga0055542_100042420 140
175 3300003763 Ga0055529_1000577 Ga0055529_100057737 140
176 3300003771 Ga0055526_1043950 Ga0055526_10439502 140
177 3300003773 Ga0055537_1023446 Ga0055537_10234462 140
178 3300003775 Ga0055524_1005415 Ga0055524_10054152 140
179 3300003784 Ga0055534_1019034 Ga0055534_10190342 140
180 3300004625 Ga0055543_1000094 Ga0055543_100009442 140
181 3300004625 Ga0055543_1014848 Ga0055543_10148482 140
182 3300005262 Ga0065165_1000434 Ga0065165_10004342 140
183 3300005262 Ga0065165_1036161 Ga0065165_10361613 140
184 3300005295 Ga0065707_10121912 Ga0065707_101219123 140
185 3300005331 Ga0070670_100001126 Ga0070670_10000112612 140
186 3300005331 Ga0070670_100387564 Ga0070670_1003875642 140
187 3300005334 Ga0068869_101250896 Ga0068869_1012508961 140
188 3300005335 Ga0070666_10271771 Ga0070666_102717712 140
189 3300005337 Ga0070682_100511948 Ga0070682_1005119482 140
190 3300005338 Ga0068868_100272733 Ga0068868_1002727332 140
191 3300005347 Ga0070668_100004878 Ga0070668_1000048787 140
192 3300005347 Ga0070668_100026274 Ga0070668_1000262743 140
193 3300005347 Ga0070668_100155497 Ga0070668_1001554972 140
194 3300005353 Ga0070669_100000004 Ga0070669_10000000419 140
195 3300005355 Ga0070671_100000029 Ga0070671_10000002913 140
196 3300005355 Ga0070671_100719228 Ga0070671_1007192282 140
197 3300005367 Ga0070667_100010156 Ga0070667_1000101567 140
198 3300005434 Ga0070709_10000440 Ga0070709_100004402 140
199 3300005436 Ga0070713_100024350 Ga0070713_1000243502 140
200 3300005436 Ga0070713_100786313 Ga0070713_1007863131 140
201 3300005440 Ga0070705_100002697 Ga0070705_1000026975 140
202 3300005440 Ga0070705_100005106 Ga0070705_1000051065 140
203 3300005445 Ga0070708_100017520 Ga0070708_1000175206 140
204 3300005456 Ga0070678_100333010 Ga0070678_1003330102 140
205 3300005467 Ga0070706_101046843 Ga0070706_1010468432 140
206 3300005467 Ga0070706_101222954 Ga0070706_1012229541 140
207 3300005471 Ga0070698_100507725 Ga0070698_1005077252 140
208 3300005543 Ga0070672_100109917 Ga0070672_1001099172 140
209 3300005548 Ga0070665_100236721 Ga0070665_1002367213 140
210 3300005548 Ga0070665_100242905 Ga0070665_1002429054 140
211 3300005548 Ga0070665_100406594 Ga0070665_1004065942 140
212 3300005563 Ga0068855_100490237 Ga0068855_1004902373 140
213 3300005578 Ga0068854_100384679 Ga0068854_1003846792 140
214 3300005615 Ga0070702_100173034 Ga0070702_1001730342 140
215 3300005616 Ga0068852_100739405 Ga0068852_1007394053 140
216 3300005617 Ga0068859_100002440 Ga0068859_10000244019 140
217 3300005617 Ga0068859_100242809 Ga0068859_1002428093 140
218 3300005618 Ga0068864_100250731 Ga0068864_1002507313 140
219 3300005719 Ga0068861_100009134 Ga0068861_1000091343 140
220 3300005719 Ga0068861_100400394 Ga0068861_1004003942 140
221 3300005841 Ga0068863_100001855 Ga0068863_10000185513 140
222 3300005842 Ga0068858_100002250 Ga0068858_10000225016 140
223 3300005842 Ga0068858_100090193 Ga0068858_1000901932 140
224 3300005843 Ga0068860_100003538 Ga0068860_10000353815 140
225 3300005843 Ga0068860_101148697 Ga0068860_1011486972 140
226 3300005844 Ga0068862_100010074 Ga0068862_1000100746 140
227 3300005844 Ga0068862_100059009 Ga0068862_1000590094 140
228 3300006038 Ga0075365_10158258 Ga0075365_101582583 140
229 3300006038 Ga0075365_10291007 Ga0075365_102910072 140
230 3300006051 Ga0075364_10833115 Ga0075364_108331152 140
231 3300006175 Ga0070712_100773152 Ga0070712_1007731522 140
232 3300006175 Ga0070712_100849017 Ga0070712_1008490172 140
233 3300006177 Ga0075362_10379552 Ga0075362_103795522 140
234 3300006186 Ga0075369_10002823 Ga0075369_100028239 140
235 3300006881 Ga0068865_100530274 Ga0068865_1005302741 140
236 3300006931 Ga0097620_100002440 Ga0097620_1000024406 140
237 3300006931 Ga0097620_100242813 Ga0097620_1002428132 140
238 3300009092 Ga0105250_10167696 Ga0105250_101676962 140
239 3300009093 Ga0105240_10049445 Ga0105240_100494453 140
240 3300009101 Ga0105247_10001335 Ga0105247_1000133517 140
241 3300009101 Ga0105247_10251790 Ga0105247_102517903 140
242 3300009147 Ga0114129_11239062 Ga0114129_112390622 140
243 3300009177 Ga0105248_10407030 Ga0105248_104070303 140
244 3300009545 Ga0105237_10154466 Ga0105237_101544665 140
245 3300009553 Ga0105249_10006295 Ga0105249_100062956 140
246 3300010375 Ga0105239_10783121 Ga0105239_107831211 140
247 3300011119 Ga0105246_10585011 Ga0105246_105850112 140
248 3300013296 Ga0157374_10199185 Ga0157374_101991852 140
249 3300013306 Ga0163162_10008056 Ga0163162_100080568 140
250 3300013308 Ga0157375_10463840 Ga0157375_104638401 140
251 3300014325 Ga0163163_12529813 Ga0163163_125298131 140
252 3300014326 Ga0157380_10005732 Ga0157380_100057328 140
253 3300014968 Ga0157379_10009705 Ga0157379_100097054 140
254 3300014968 Ga0157379_10232844 Ga0157379_102328443 140
255 3300014969 Ga0157376_10262840 Ga0157376_102628403 140
256 3300021361 Ga0213872_10102023 Ga0213872_101020233 140
257 3300021361 Ga0213872_10217289 Ga0213872_102172891 140
258 3300025208 Ga0209436_100042 Ga0209436_1000426 140
259 3300025208 Ga0209436_112824 Ga0209436_1128243 140
260 3300025228 Ga0209672_100245 Ga0209672_1002452 140
261 3300025229 Ga0209147_100299 Ga0209147_1002992 140
262 3300025242 Ga0209258_100487 Ga0209258_1004872 140
263 3300025254 Ga0209148_1000489 Ga0209148_100048938 140
264 3300025263 Ga0209565_1024231 Ga0209565_10242312 140
265 3300025272 Ga0209455_1000374 Ga0209455_100037422 140
266 3300025284 Ga0209130_1000227 Ga0209130_10002272 140
267 3300025284 Ga0209130_1002419 Ga0209130_10024194 140
268 3300025284 Ga0209130_1015164 Ga0209130_10151643 140
269 3300025291 Ga0209675_1015239 Ga0209675_10152392 140
270 3300025295 Ga0209564_1041341 Ga0209564_10413412 140
271 3300025299 Ga0209256_1000638 Ga0209256_10006384 140
272 3300025299 Ga0209256_1000757 Ga0209256_100075742 140
273 3300025302 Ga0207426_1000506 Ga0207426_100050644 140
274 3300025303 Ga0209051_1087613 Ga0209051_10876132 140
275 3300025315 Ga0207697_10000013 Ga0207697_1000001344 140
276 3300025898 Ga0207692_10487453 Ga0207692_104874531 140
277 3300025900 Ga0207710_10008210 Ga0207710_100082105 140
278 3300025900 Ga0207710_10149695 Ga0207710_101496953 140
279 3300025903 Ga0207680_10462331 Ga0207680_104623311 140
280 3300025906 Ga0207699_10000034 Ga0207699_1000003463 140
281 3300025910 Ga0207684_10735995 Ga0207684_107359951 140
282 3300025913 Ga0207695_10000797 Ga0207695_1000079756 140
283 3300025914 Ga0207671_10003165 Ga0207671_100031654 140
284 3300025918 Ga0207662_10499122 Ga0207662_104991222 140
285 3300025923 Ga0207681_10000010 Ga0207681_10000010389 140
286 3300025925 Ga0207650_10000482 Ga0207650_100004825 140
287 3300025926 Ga0207659_10861258 Ga0207659_108612581 140
288 3300025927 Ga0207687_10838717 Ga0207687_108387171 140
289 3300025928 Ga0207700_10009703 Ga0207700_100097036 140
290 3300025928 Ga0207700_10842061 Ga0207700_108420611 140
291 3300025929 Ga0207664_10028968 Ga0207664_100289684 140
292 3300025931 Ga0207644_10000007 Ga0207644_10000007374 140
293 3300025935 Ga0207709_10969641 Ga0207709_109696411 140
294 3300025936 Ga0207670_10643480 Ga0207670_106434802 140
295 3300025940 Ga0207691_10501151 Ga0207691_105011511 140
296 3300025942 Ga0207689_10090473 Ga0207689_100904731 140
297 3300025942 Ga0207689_10891856 Ga0207689_108918562 140
298 3300025949 Ga0207667_10739297 Ga0207667_107392971 140
299 3300025961 Ga0207712_10020555 Ga0207712_100205555 140
300 3300025961 Ga0207712_10172638 Ga0207712_101726382 140
301 3300025972 Ga0207668_10001767 Ga0207668_1000176710 140
302 3300025972 Ga0207668_10054336 Ga0207668_100543362 140
303 3300025972 Ga0207668_10557640 Ga0207668_105576402 140
304 3300025986 Ga0207658_10005143 Ga0207658_100051437 140
305 3300026035 Ga0207703_10001843 Ga0207703_1000184317 140
306 3300026035 Ga0207703_10088318 Ga0207703_100883183 140
307 3300026035 Ga0207703_10349013 Ga0207703_103490131 140
308 3300026067 Ga0207678_10062555 Ga0207678_100625555 140
309 3300026075 Ga0207708_10402696 Ga0207708_104026962 140
310 3300026078 Ga0207702_10670537 Ga0207702_106705372 140
311 3300026088 Ga0207641_10002095 Ga0207641_1000209513 140
312 3300026088 Ga0207641_10705372 Ga0207641_107053722 140
313 3300026095 Ga0207676_10001590 Ga0207676_100015908 140
314 3300026095 Ga0207676_10129561 Ga0207676_101295612 140
315 3300026118 Ga0207675_100002086 Ga0207675_10000208613 140
316 3300026121 Ga0207683_10222259 Ga0207683_102222592 140
317 3300026142 Ga0207698_10537495 Ga0207698_105374951 140
318 3300028379 Ga0268266_10220437 Ga0268266_102204373 140
319 3300028379 Ga0268266_10257448 Ga0268266_102574481 140
320 3300028379 Ga0268266_10298391 Ga0268266_102983911 140
321 3300028380 Ga0268265_10000468 Ga0268265_1000046820 140
322 3300028380 Ga0268265_10001167 Ga0268265_1000116718 140
323 3300028380 Ga0268265_10650300 Ga0268265_106503001 140
324 3300028381 Ga0268264_10000218 Ga0268264_1000021826 140
325 3300028381 Ga0268264_10173364 Ga0268264_101733643 140
326 3300028794 Ga0307515_10043433 Ga0307515_100434336 140
327 3300028794 Ga0307515_10064202 Ga0307515_100642025 140
328 3300028794 Ga0307515_10175891 Ga0307515_101758913 140
329 3300031239 Ga0265328_10003566 Ga0265328_1000356610 140
330 3300031239 Ga0265328_10092361 Ga0265328_100923612 140
331 3300031250 Ga0265331_10006285 Ga0265331_100062853 140
332 3300031250 Ga0265331_10006923 Ga0265331_100069234 140
333 3300031251 Ga0265327_10014228 Ga0265327_100142283 140
334 3300031251 Ga0265327_10024863 Ga0265327_100248633 140
335 3300031344 Ga0265316_10007308 Ga0265316_100073088 140
336 3300031344 Ga0265316_10167848 Ga0265316_101678483 140
337 3300031456 Ga0307513_10044320 Ga0307513_100443203 140
338 3300031456 Ga0307513_10209589 Ga0307513_102095892 140
339 3300031456 Ga0307513_10354877 Ga0307513_103548773 140
340 3300031616 Ga0307508_10100740 Ga0307508_101007402 140
341 3300031730 Ga0307516_10096084 Ga0307516_100960842 140
342 3300031730 Ga0307516_10220165 Ga0307516_102201652 140
343 3300031731 Ga0307405_10432377 Ga0307405_104323772 140
344 3300031852 Ga0307410_11520217 Ga0307410_115202171 140
345 3300031901 Ga0307406_10045765 Ga0307406_100457653 140
346 3300031995 Ga0307409_101914515 Ga0307409_1019145151 140
347 3300031995 Ga0307409_102666623 Ga0307409_1026666231 140
348 3300032002 Ga0307416_100486420 Ga0307416_1004864202 140
349 3300032002 Ga0307416_100810584 Ga0307416_1008105842 140
350 3300032126 Ga0307415_100184766 Ga0307415_1001847662 140
351 3300032126 Ga0307415_100926785 Ga0307415_1009267851 140
352 3300035089 Ga0373944_0126385 Ga0373944_0126385_280_702 140
353 3300035170 Ga0373943_0073739 Ga0373943_0073739_967_1389 140
354 3300035171 Ga0373946_0151138 Ga0373946_0151138_198_620 140
355 3300035692 Ga0373935_0301615 Ga0373935_0301615_297_719 140
356 3300035695 Ga0373927_0000343 Ga0373927_0000343_24184_24606 140
357 3300037068 Ga0373925_0006509 Ga0373925_0006509_538_960 140
358 3300038443 Ga0395901_0000062 Ga0395901_0000062_120397_120819 140
359 3300039447 Ga0436361_0008661 Ga0436361_0008661_9448_9879 140
360 3300041451 Ga0451791_0885110 Ga0451791_0885110_55_477 140
361 3300041491 Ga0451833_0613690 Ga0451833_0613690_70_492 140
362 3300041512 Ga0451853_0902899 Ga0451853_0902899_12_434 140
363 3300044656 Ga0466969_0035685 Ga0466969_0035685_185_607 140
364 3300044656 Ga0466969_0053602 Ga0466969_0053602_1176_1598 140
365 3300044683 Ga0466965_0009539 Ga0466965_0009539_1295_1717 140
366 3300044684 Ga0466966_0104309 Ga0466966_0104309_290_712 140
367 3300044684 Ga0466966_0106728 Ga0466966_0106728_206_628 140
368 3300044693 Ga0466961_0001063 Ga0466961_0001063_398_841 140
369 3300044693 Ga0466961_0007379 Ga0466961_0007379_1142_1564 140
370 3300044694 Ga0466963_0047549 Ga0466963_0047549_205_630 140
371 3300044719 Ga0466971_0009307 Ga0466971_0009307_2440_2883 140
372 3300044765 Ga0466970_0020129 Ga0466970_0020129_363_785 140
373 3300044842 Ga0466957_0859047 Ga0466957_0859047_206_628 140
374 3300045049 Ga0466959_0000763 Ga0466959_0000763_11825_12247 140
375 3300045049 Ga0466959_0059962 Ga0466959_0059962_2012_2434 140
376 3300045049 Ga0466959_0139321 Ga0466959_0139321_1207_1650 140
377 3300045049 Ga0466959_0592688 Ga0466959_0592688_192_614 140
378 3300045836 Ga0466958_0004154 Ga0466958_0004154_5707_6129 140
379 3300045836 Ga0466958_0012983 Ga0466958_0012983_4267_4689 140
380 3300046474 Ga0495605_0016393 Ga0495605_0016393_1828_2253 140
381 3300046507 Ga0495606_0044304 Ga0495606_0044304_1735_2160 140
382 3300046689 Ga0495613_0760716 Ga0495613_0760716_37_468 140
383 3300046694 Ga0495649_0000288 Ga0495649_0000288_11766_12188 140
384 3300047472 Ga0495686_0085034 Ga0495686_0085034_1316_1738 140
385 3300047472 Ga0495686_0225630 Ga0495686_0225630_539_961 140
386 3300048906 Ga0496103_0176711 Ga0496103_0176711_481_903 140
387 3300048909 Ga0496106_0300271 Ga0496106_0300271_780_1202 140
388 3300048911 Ga0496108_0026927 Ga0496108_0026927_4257_4679 140
389 3300048912 Ga0496109_0261088 Ga0496109_0261088_289_711 140
390 3300048913 Ga0496110_0151184 Ga0496110_0151184_1224_1646 140
391 3300048916 Ga0496113_0378536 Ga0496113_0378536_362_787 140
392 3300048919 Ga0496116_0031350 Ga0496116_0031350_2848_3270 140
393 3300048920 Ga0496117_0025805 Ga0496117_0025805_286_708 140
394 3300048921 Ga0496118_0259894 Ga0496118_0259894_508_930 140
395 3300048924 Ga0496121_0086961 Ga0496121_0086961_1106_1528 140
396 3300048925 Ga0496122_0003182 Ga0496122_0003182_20074_20508 140
397 3300048925 Ga0496122_0003590 Ga0496122_0003590_19523_19945 140
398 3300048925 Ga0496122_0021289 Ga0496122_0021289_4087_4509 140
399 3300048926 Ga0496123_0002846 Ga0496123_0002846_19752_20174 140
400 3300048926 Ga0496123_0016154 Ga0496123_0016154_3897_4331 140
401 3300048926 Ga0496123_0022086 Ga0496123_0022086_4100_4522 140
402 3300048927 Ga0496124_0139448 Ga0496124_0139448_160_582 140
403 3300048927 Ga0496124_0607308 Ga0496124_0607308_273_695 140
404 3300048928 Ga0496125_0158494 Ga0496125_0158494_683_1117 140
405 3300048929 Ga0496126_0178137 Ga0496126_0178137_258_680 140
406 3300049568 Ga0501031_0268185 Ga0501031_0268185_108_530 140
407 3300049568 Ga0501031_0632970 Ga0501031_0632970_220_654 140
408 3300049569 Ga0501032_0054389 Ga0501032_0054389_925_1347 140
409 3300049570 Ga0501033_0026320 Ga0501033_0026320_2151_2582 140
410 3300049571 Ga0501034_0007653 Ga0501034_0007653_8549_8971 140
411 3300049573 Ga0501037_0010483 Ga0501037_0010483_4364_4795 140
412 3300049574 Ga0501038_0011245 Ga0501038_0011245_7030_7452 140
413 3300049574 Ga0501038_0162006 Ga0501038_0162006_1035_1466 140
414 3300049575 Ga0501039_0335198 Ga0501039_0335198_668_1090 140
415 3300049575 Ga0501039_0632926 Ga0501039_0632926_25_447 140
416 3300049579 Ga0501043_0578022 Ga0501043_0578022_127_549 140
417 3300049581 Ga0501047_0004093 Ga0501047_0004093_11352_11774 140
418 3300049581 Ga0501047_0005368 Ga0501047_0005368_7101_7562 140
419 3300049581 Ga0501047_0865206 Ga0501047_0865206_162_584 140
420 3300049583 Ga0501067_0001493 Ga0501067_0001493_1625_2047 140
421 3300049584 Ga0501068_0050502 Ga0501068_0050502_1243_1665 140
422 3300049584 Ga0501068_0164991 Ga0501068_0164991_679_1101 140
423 3300049585 Ga0501069_0007320 Ga0501069_0007320_5038_5460 140
424 3300049585 Ga0501069_0013393 Ga0501069_0013393_3469_3891 140
425 3300049586 Ga0501070_0004757 Ga0501070_0004757_411_833 140
426 3300049586 Ga0501070_0438752 Ga0501070_0438752_15_437 140
427 3300049588 Ga0501072_0111919 Ga0501072_0111919_1408_1830 140
428 3300049588 Ga0501072_0160565 Ga0501072_0160565_199_621 140
429 3300049589 Ga0501073_0006210 Ga0501073_0006210_2011_2433 140
430 3300049589 Ga0501073_0557678 Ga0501073_0557678_268_690 140
431 3300049590 Ga0501074_0166337 Ga0501074_0166337_922_1344 140
432 3300049590 Ga0501074_0188450 Ga0501074_0188450_203_664 140
433 3300049592 Ga0501076_1650495 Ga0501076_1650495_52_480 140
434 3300049654 Ga0501207_015649 Ga0501207_015649_401_823 140
435 3300049669 Ga0501235_138549 Ga0501235_138549_113_535 140
436 3300049674 Ga0501242_077697 Ga0501242_077697_13_435 140
437 3300049683 Ga0501253_038505 Ga0501253_038505_252_674 140
438 3300049684 Ga0501255_016433 Ga0501255_016433_434_856 140
439 3300049705 Ga0501225_0013244 Ga0501225_0013244_1433_1855 140
440 3300049706 Ga0501229_000504 Ga0501229_000504_1656_2078 140
441 3300049706 Ga0501229_028021 Ga0501229_028021_66_494 140
442 3300049741 Ga0501079_0032173 Ga0501079_0032173_1123_1545 140
443 3300049742 Ga0501080_0155897 Ga0501080_0155897_1276_1698 140
444 3300049742 Ga0501080_0304622 Ga0501080_0304622_433_855 140
445 3300049744 Ga0501083_0001350 Ga0501083_0001350_1606_2028 140
446 3300049744 Ga0501083_0254173 Ga0501083_0254173_176_598 140
447 3300049759 Ga0501262_004381 Ga0501262_004381_384_806 140
448 3300049761 Ga0501264_009101 Ga0501264_009101_76_498 140
449 3300049762 Ga0501265_006676 Ga0501265_006676_226_648 140
450 3300049763 Ga0501266_015742 Ga0501266_015742_99_521 140
451 3300049765 Ga0501268_056257 Ga0501268_056257_59_481 140
452 3300049766 Ga0501269_005148 Ga0501269_005148_903_1325 140
453 3300049767 Ga0501270_047567 Ga0501270_047567_247_669 140
454 3300049769 Ga0501272_003346 Ga0501272_003346_431_853 140
455 3300049776 Ga0501280_028164 Ga0501280_028164_94_516 140
456 3300049822 Ga0501035_0001896 Ga0501035_0001896_14316_14738 140
457 3300049822 Ga0501035_0058001 Ga0501035_0058001_1031_1462 140
458 3300049823 Ga0501044_0023069 Ga0501044_0023069_4738_5199 140
459 3300049823 Ga0501044_0202187 Ga0501044_0202187_1319_1741 140
460 3300049823 Ga0501044_0528886 Ga0501044_0528886_525_947 140
461 3300049823 Ga0501044_0986190 Ga0501044_0986190_259_681 140
462 3300049823 Ga0501044_1559619 Ga0501044_1559619_53_484 140
463 3300050492 nmdc:mga0yw44_146276_c1 nmdc:mga0yw44_146276_c1_783_1205 140
464 3300050492 nmdc:mga0yw44_73515_c1 nmdc:mga0yw44_73515_c1_746_1168 140
465 3300053096 Ga0500641_0002260 Ga0500641_0002260_5838_6260 140
466 3300053148 Ga0500590_009468 Ga0500590_009468_1604_2035 140
467 3300054114 Ga0501084_0054988 Ga0501084_0054988_2679_3101 140
468 3300054114 Ga0501084_0749133 Ga0501084_0749133_64_486 140
469 3300060353 Ga0501082_0612580 Ga0501082_0612580_240_662 140
470 3300061719 Ga0466962_0028301 Ga0466962_0028301_809_1252 140
471 iso_pu_bacteria 8057101203 8057101803 140

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01850

PIN

PIN domain

2

130

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2h1o-assembly1.cif.gz_A structure of fitab bound to ir36 dna fragment 0.9436 1 140
2h1c-assembly1.cif.gz_A crystal structure of fitacb from neisseria gonorrhoeae 0.9423 1 138
2h1o-assembly1.cif.gz_A structure of fitab bound to ir36 dna fragment 0.9372 1 140
2h1c-assembly1.cif.gz_A crystal structure of fitacb from neisseria gonorrhoeae 0.9294 1 138
3tnd-assembly1.cif.gz_G crystal structure of shigella flexneri vapbc toxin-antitoxin complex 0.8877 2 135
ID Description Score Start End Superfamily
2bsqA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9436 1 140 3.40.50.1010
af_P9WF99_2_82_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9409 3 70 3.40.50.1010
2bsqA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9372 1 140 3.40.50.1010
af_P48775_217_267_1.10.287.3810 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.9123 40 72 1.10.287.3810
5ecwB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8641 2 134 3.40.50.1010
ID Description Score Start End GO Terms
AF-A0A147GS92-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.995 1 138 GO:0000287
GO:0004540
GO:0090729
AF-A0A5C8C6X4-F1-model_v4 deleted 0.9922 1 138
AF-I3CVU8-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.9912 1 138 GO:0000287
GO:0004540
GO:0090729
AF-A0A3D3SNS7-F1-model_v4 deleted 0.9912 1 78
AF-A0A2K3A2Z7-F1-model_v4 deleted 0.9909 1 65

Feature Viewer

pLDDT pTM Quality
95.21 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map