F450169
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 469 | 344 | 938 | 146 |
Family's Representative Sequence
| Representative Sequence | 3300003791|Ga0055530_10000061|Ga0055530_1000006179 |
| Length | 159 |
| Sequence | MAMSVGEGGDEAPMSDINTTPLVDVMLVLLIIFLIAVPVVIQTIDLALPKVQFEVTQTKPENVALSVTGAGGQCQVYWGMTPVTHQELLDRGVEKLRKEIDRQGGPNAPGLELPEVHIRGDVNTPYRCIGGTIYTMQMAGFVKVGFISEPPAGSGTTRL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 2 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 3 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 4 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 5 | 3300001978 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 | Metagenome | Rhizosphere |
| 6 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 7 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 8 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 9 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 10 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 11 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 12 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 13 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 14 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 15 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 16 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 18 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 20 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 22 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 23 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 24 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 25 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 45 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 47 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 48 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 49 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 50 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 51 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 52 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 53 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 54 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 55 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 56 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 57 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 59 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 71 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 82 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 84 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 85 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 86 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 87 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 88 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 89 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 92 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 93 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 94 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 96 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 98 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 100 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 101 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 104 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 107 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 154 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 155 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 156 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 157 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 158 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 159 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 160 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 161 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 162 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 163 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 164 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 165 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 166 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 167 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 168 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 169 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 170 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 171 | 3300039145 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 | Metagenome | Unclassified |
| 172 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 173 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 174 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 175 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 176 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 177 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 178 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 179 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 180 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 181 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 182 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 183 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 184 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 185 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 186 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 187 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 188 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 189 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 190 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 191 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 192 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 193 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 194 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 195 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 228 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 229 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 230 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 231 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 232 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 233 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 234 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 235 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 236 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 237 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 238 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 239 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 240 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 241 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 242 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 243 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 244 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 245 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 246 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 247 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 248 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 249 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 250 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 251 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 252 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 253 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 254 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 255 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 256 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 257 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 258 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 259 | 3300049542 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 260 | 3300049553 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 261 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 265 | 3300049655 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought | Metagenome | Rhizosphere |
| 266 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 267 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 268 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 269 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 270 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 271 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 272 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 273 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 274 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 275 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 276 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 277 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 278 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 279 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 280 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 281 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 282 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 283 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 284 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 285 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 286 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 287 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 288 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 289 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 290 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 291 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 292 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 293 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 294 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 295 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 296 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 297 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 298 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 299 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 300 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 301 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 302 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 303 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 304 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 305 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 306 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 307 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 308 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 309 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 310 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 311 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 312 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 313 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 314 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 315 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 316 | 3300059514 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 317 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 318 | 3300059622 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 319 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 320 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 321 | 3300059626 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 322 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 323 | 3300059631 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 324 | 3300059639 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 325 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 326 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 327 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 328 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 329 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 330 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 331 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 332 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 333 | 3300059648 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 334 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 335 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 336 | 3300059654 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 337 | 3300059658 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 338 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 339 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 340 | 2582581305 | Rhizorhabdus wittichii YR128 | Isolate | Rhizosphere |
| 341 | 2643221605 | Sphingomonas sp. Root710 | Isolate | Unclassified |
| 342 | 2643221606 | Sphingomonas sp. Root720 | Isolate | Unclassified |
| 343 | 2643221622 | Sphingomonas sp. Root241 | Isolate | Unclassified |
| 344 | 2643221671 | Sphingomonas sp. Root1294 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 80.81 |
| Metatranscriptomes | 18.12 |
| Isolates | 1.07 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 18.55 |
| Nodule | 0 |
| Rhizoplane | 2.13 |
| Rhizosphere | 73.77 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0055530_10000061 | 3300003791 | Bacteria | 95363 |
| 2 | ARcpr5yngRDRAFT_c001154 | 3300000043 | Bacteria | 2973 |
| 3 | JGI24736J21556_1049509 | 3300001904 | Bacteria | 646 |
| 4 | JGI24741J21665_1000550 | 3300001915 | Bacteria | 11442 |
| 5 | JGI24747J21853_1025909 | 3300001978 | Bacteria | 656 |
| 6 | JGI24740J21852_10001315 | 3300001979 | Bacteria | 11295 |
| 7 | JGI24739J22299_10009493 | 3300001989 | Bacteria | 3625 |
| 8 | JGI24737J22298_10065040 | 3300001990 | Bacteria | 1093 |
| 9 | JGI24735J21928_10146408 | 3300002067 | Bacteria | 682 |
| 10 | JGI24738J21930_10049526 | 3300002075 | Bacteria | 856 |
| 11 | JGI24749J21850_1000218 | 3300002076 | Bacteria | 8932 |
| 12 | JGI24742J22300_10016651 | 3300002244 | Bacteria | 1241 |
| 13 | JGI24751J29686_10000355 | 3300002459 | Bacteria | 16147 |
| 14 | JGI25150J39212_1000213 | 3300002774 | Bacteria | 31530 |
| 15 | JGI25153J46596_10000036 | 3300003215 | Bacteria | 182205 |
| 16 | JGI25153J46596_10013309 | 3300003215 | Bacteria | 3484 |
| 17 | Ga0055525_1000035 | 3300003759 | Bacteria | 300887 |
| 18 | Ga0055542_1000060 | 3300003762 | Bacteria | 162275 |
| 19 | Ga0055529_1000043 | 3300003763 | Bacteria | 221704 |
| 20 | Ga0055526_1000948 | 3300003771 | Bacteria | 21478 |
| 21 | Ga0055524_1000180 | 3300003775 | Bacteria | 71495 |
| 22 | Ga0055536_1021897 | 3300003781 | Bacteria | 1923 |
| 23 | Ga0055530_10009391 | 3300003791 | Bacteria | 3765 |
| 24 | Ga0055530_10020085 | 3300003791 | Bacteria | 2006 |
| 25 | Ga0055540_1001505 | 3300003792 | Bacteria | 13844 |
| 26 | Ga0055531_10000035 | 3300003794 | Bacteria | 147414 |
| 27 | Ga0055531_10018371 | 3300003794 | Bacteria | 2890 |
| 28 | Ga0055531_10019062 | 3300003794 | Bacteria | 2799 |
| 29 | Ga0065165_1027465 | 3300005262 | Bacteria | 1855 |
| 30 | Ga0065165_1044085 | 3300005262 | Bacteria | 1306 |
| 31 | Ga0065165_1061701 | 3300005262 | Bacteria | 1025 |
| 32 | Ga0065707_10093614 | 3300005295 | Bacteria | 3603 |
| 33 | Ga0065707_10142143 | 3300005295 | Bacteria | 1758 |
| 34 | Ga0070658_10005034 | 3300005327 | Bacteria | 10754 |
| 35 | Ga0070658_10814024 | 3300005327 | Bacteria | 811 |
| 36 | Ga0070676_10045421 | 3300005328 | Bacteria | 2558 |
| 37 | Ga0070670_100000005 | 3300005331 | Bacteria | 351569 |
| 38 | Ga0070666_10128940 | 3300005335 | Bacteria | 1757 |
| 39 | Ga0070666_10629280 | 3300005335 | Bacteria | 784 |
| 40 | Ga0070682_101493108 | 3300005337 | Bacteria | 581 |
| 41 | Ga0070661_100016653 | 3300005344 | Bacteria | 5200 |
| 42 | Ga0070668_100446121 | 3300005347 | Bacteria | 1111 |
| 43 | Ga0070669_100000119 | 3300005353 | Bacteria | 73001 |
| 44 | Ga0070669_100071542 | 3300005353 | Bacteria | 2566 |
| 45 | Ga0070675_100190989 | 3300005354 | Bacteria | 1774 |
| 46 | Ga0070671_100199027 | 3300005355 | Bacteria | 1699 |
| 47 | Ga0070674_100171058 | 3300005356 | Bacteria | 1656 |
| 48 | Ga0070659_100668509 | 3300005366 | Bacteria | 896 |
| 49 | Ga0070667_100000302 | 3300005367 | Bacteria | 55150 |
| 50 | Ga0070667_100000407 | 3300005367 | Bacteria | 46001 |
| 51 | Ga0070667_100063320 | 3300005367 | Bacteria | 3134 |
| 52 | Ga0070663_100017496 | 3300005455 | Bacteria | 4680 |
| 53 | Ga0070662_100220336 | 3300005457 | Bacteria | 1513 |
| 54 | Ga0068867_100009668 | 3300005459 | Bacteria | 6798 |
| 55 | Ga0068853_100108553 | 3300005539 | Bacteria | 2462 |
| 56 | Ga0068853_100197717 | 3300005539 | Bacteria | 1829 |
| 57 | Ga0070665_100000186 | 3300005548 | Bacteria | 110750 |
| 58 | Ga0070665_100128007 | 3300005548 | Bacteria | 2542 |
| 59 | Ga0068855_100133578 | 3300005563 | Bacteria | 2832 |
| 60 | Ga0068855_100499520 | 3300005563 | Bacteria | 1322 |
| 61 | Ga0070664_100066966 | 3300005564 | Bacteria | 3068 |
| 62 | Ga0068857_100038434 | 3300005577 | Bacteria | 4239 |
| 63 | Ga0068857_100345353 | 3300005577 | Bacteria | 1377 |
| 64 | Ga0068854_100005131 | 3300005578 | Bacteria | 8254 |
| 65 | Ga0068854_100015788 | 3300005578 | Bacteria | 5015 |
| 66 | Ga0068856_100041069 | 3300005614 | Bacteria | 4545 |
| 67 | Ga0068852_100066428 | 3300005616 | Bacteria | 3149 |
| 68 | Ga0068852_102238016 | 3300005616 | Bacteria | 568 |
| 69 | Ga0068859_100029616 | 3300005617 | Bacteria | 5493 |
| 70 | Ga0068864_100005975 | 3300005618 | Bacteria | 9984 |
| 71 | Ga0068864_100224496 | 3300005618 | Bacteria | 1734 |
| 72 | Ga0068863_100003334 | 3300005841 | Bacteria | 15865 |
| 73 | Ga0068863_100003363 | 3300005841 | Bacteria | 15795 |
| 74 | Ga0068863_100047096 | 3300005841 | Bacteria | 4091 |
| 75 | Ga0068860_100000416 | 3300005843 | Bacteria | 55156 |
| 76 | Ga0068860_100991648 | 3300005843 | Bacteria | 858 |
| 77 | Ga0068862_100000011 | 3300005844 | Bacteria | 270105 |
| 78 | Ga0075364_10679039 | 3300006051 | Bacteria | 703 |
| 79 | Ga0075362_10211473 | 3300006177 | Bacteria | 946 |
| 80 | Ga0097621_100097792 | 3300006237 | Bacteria | 2465 |
| 81 | Ga0068871_100330633 | 3300006358 | Bacteria | 1344 |
| 82 | Ga0097620_100029618 | 3300006931 | Bacteria | 5493 |
| 83 | Ga0105240_10089799 | 3300009093 | Bacteria | 3757 |
| 84 | Ga0105247_10315171 | 3300009101 | Bacteria | 1090 |
| 85 | Ga0105243_10000122 | 3300009148 | Bacteria | 89527 |
| 86 | Ga0105241_10004088 | 3300009174 | Bacteria | 10782 |
| 87 | Ga0105248_10000921 | 3300009177 | Bacteria | 32763 |
| 88 | Ga0105237_10045883 | 3300009545 | Bacteria | 4397 |
| 89 | Ga0105238_10034108 | 3300009551 | Bacteria | 5179 |
| 90 | Ga0105238_10137947 | 3300009551 | Bacteria | 2417 |
| 91 | Ga0105249_10065162 | 3300009553 | Bacteria | 3351 |
| 92 | Ga0105239_10061378 | 3300010375 | Bacteria | 4125 |
| 93 | Ga0105246_10017446 | 3300011119 | Bacteria | 4562 |
| 94 | Ga0157326_1000156 | 3300012513 | Bacteria | 7474 |
| 95 | Ga0157373_10069160 | 3300013100 | Bacteria | 2496 |
| 96 | Ga0157373_10299837 | 3300013100 | Bacteria | 1141 |
| 97 | Ga0157371_10000030 | 3300013102 | Bacteria | 241585 |
| 98 | Ga0157370_10053275 | 3300013104 | Bacteria | 3859 |
| 99 | Ga0157369_10040121 | 3300013105 | Bacteria | 5112 |
| 100 | Ga0157374_10274042 | 3300013296 | Bacteria | 1664 |
| 101 | Ga0157374_10598079 | 3300013296 | Bacteria | 1113 |
| 102 | Ga0157378_10036642 | 3300013297 | Bacteria | 4341 |
| 103 | Ga0157378_10240643 | 3300013297 | Bacteria | 1728 |
| 104 | Ga0157372_10284634 | 3300013307 | Bacteria | 1922 |
| 105 | Ga0157372_10461882 | 3300013307 | Bacteria | 1480 |
| 106 | Ga0157375_10267416 | 3300013308 | Bacteria | 1872 |
| 107 | Ga0163163_10019186 | 3300014325 | Bacteria | 6417 |
| 108 | Ga0157380_10001430 | 3300014326 | Bacteria | 15629 |
| 109 | Ga0182008_10396499 | 3300014497 | Bacteria | 740 |
| 110 | Ga0163161_10038816 | 3300017792 | Bacteria | 3416 |
| 111 | Ga0197907_10167724 | 3300020069 | Bacteria | 925 |
| 112 | Ga0206356_10745082 | 3300020070 | Bacteria | 1178 |
| 113 | Ga0206349_1685457 | 3300020075 | Bacteria | 1804 |
| 114 | Ga0206355_1265416 | 3300020076 | Bacteria | 838 |
| 115 | Ga0206352_10765077 | 3300020078 | Bacteria | 2645 |
| 116 | Ga0206350_10568922 | 3300020080 | Bacteria | 1553 |
| 117 | Ga0209674_117634 | 3300025226 | Bacteria | 577 |
| 118 | Ga0209563_100047 | 3300025230 | Bacteria | 366620 |
| 119 | Ga0207425_1000037 | 3300025245 | Bacteria | 224645 |
| 120 | Ga0207425_1009226 | 3300025245 | Bacteria | 2467 |
| 121 | Ga0209646_1006345 | 3300025246 | Bacteria | 1991 |
| 122 | Ga0209677_105413 | 3300025253 | Bacteria | 3334 |
| 123 | Ga0209148_1000017 | 3300025254 | Bacteria | 787064 |
| 124 | Ga0209129_1000363 | 3300025258 | Bacteria | 37614 |
| 125 | Ga0209233_1029790 | 3300025261 | Bacteria | 1292 |
| 126 | Ga0209565_1000012 | 3300025263 | Bacteria | 606500 |
| 127 | Ga0209565_1000427 | 3300025263 | Bacteria | 34040 |
| 128 | Ga0209455_1000005 | 3300025272 | Bacteria | 1416756 |
| 129 | Ga0209673_1005653 | 3300025273 | Bacteria | 6241 |
| 130 | Ga0209673_1008360 | 3300025273 | Bacteria | 4615 |
| 131 | Ga0209675_1006520 | 3300025291 | Bacteria | 4660 |
| 132 | Ga0209676_1004865 | 3300025292 | Bacteria | 7270 |
| 133 | Ga0209025_1000117 | 3300025294 | Bacteria | 215073 |
| 134 | Ga0209564_1001191 | 3300025295 | Bacteria | 29869 |
| 135 | Ga0209564_1065550 | 3300025295 | Bacteria | 785 |
| 136 | Ga0209758_1000035 | 3300025297 | Bacteria | 448190 |
| 137 | Ga0209758_1000103 | 3300025297 | Bacteria | 223968 |
| 138 | Ga0209758_1002916 | 3300025297 | Bacteria | 16491 |
| 139 | Ga0209050_1000001 | 3300025298 | Bacteria | 3563507 |
| 140 | Ga0209050_1000014 | 3300025298 | Bacteria | 774327 |
| 141 | Ga0209050_1002236 | 3300025298 | Bacteria | 17279 |
| 142 | Ga0209256_1000012 | 3300025299 | Bacteria | 790371 |
| 143 | Ga0207426_1011098 | 3300025302 | Bacteria | 3455 |
| 144 | Ga0209051_1001637 | 3300025303 | Bacteria | 18170 |
| 145 | Ga0209257_1000019 | 3300025304 | Bacteria | 774261 |
| 146 | Ga0209257_1001431 | 3300025304 | Bacteria | 28304 |
| 147 | Ga0209257_1006564 | 3300025304 | Bacteria | 7420 |
| 148 | Ga0209257_1012112 | 3300025304 | Bacteria | 4043 |
| 149 | Ga0209257_1093054 | 3300025304 | Bacteria | 749 |
| 150 | Ga0207697_10108222 | 3300025315 | Bacteria | 1189 |
| 151 | Ga0207656_10004629 | 3300025321 | Bacteria | 4820 |
| 152 | Ga0207682_10087972 | 3300025893 | Bacteria | 1342 |
| 153 | Ga0207688_10116031 | 3300025901 | Bacteria | 1558 |
| 154 | Ga0207680_10035622 | 3300025903 | Bacteria | 2859 |
| 155 | Ga0207680_10240402 | 3300025903 | Bacteria | 1248 |
| 156 | Ga0207680_10483515 | 3300025903 | Bacteria | 881 |
| 157 | Ga0207647_10004031 | 3300025904 | Bacteria | 10951 |
| 158 | Ga0207645_10021418 | 3300025907 | Bacteria | 4215 |
| 159 | Ga0207705_10000163 | 3300025909 | Bacteria | 71674 |
| 160 | Ga0207654_10000307 | 3300025911 | Bacteria | 29685 |
| 161 | Ga0207695_10004528 | 3300025913 | Bacteria | 18917 |
| 162 | Ga0207671_10011997 | 3300025914 | Bacteria | 7003 |
| 163 | Ga0207657_10009441 | 3300025919 | Bacteria | 9801 |
| 164 | Ga0207649_10000199 | 3300025920 | Bacteria | 49941 |
| 165 | Ga0207681_10000001 | 3300025923 | Bacteria | 1105841 |
| 166 | Ga0207681_10341446 | 3300025923 | Bacteria | 1196 |
| 167 | Ga0207694_10004278 | 3300025924 | Bacteria | 11176 |
| 168 | Ga0207694_10381153 | 3300025924 | Bacteria | 1170 |
| 169 | Ga0207650_10000018 | 3300025925 | Bacteria | 352120 |
| 170 | Ga0207690_10003676 | 3300025932 | Bacteria | 9129 |
| 171 | Ga0207706_10104272 | 3300025933 | Bacteria | 2495 |
| 172 | Ga0207709_10000083 | 3300025935 | Bacteria | 163025 |
| 173 | Ga0207669_10017230 | 3300025937 | Bacteria | 3698 |
| 174 | Ga0207691_10999854 | 3300025940 | Bacteria | 698 |
| 175 | Ga0207711_10016962 | 3300025941 | Bacteria | 6049 |
| 176 | Ga0207661_10366009 | 3300025944 | Bacteria | 1303 |
| 177 | Ga0207679_10166251 | 3300025945 | Bacteria | 1811 |
| 178 | Ga0207667_10000004 | 3300025949 | Bacteria | 737718 |
| 179 | Ga0207651_10211195 | 3300025960 | Bacteria | 1562 |
| 180 | Ga0207712_10033557 | 3300025961 | Bacteria | 3471 |
| 181 | Ga0207668_11730599 | 3300025972 | Bacteria | 564 |
| 182 | Ga0207640_10012485 | 3300025981 | Bacteria | 4839 |
| 183 | Ga0207640_10023981 | 3300025981 | Bacteria | 3674 |
| 184 | Ga0207658_10000263 | 3300025986 | Bacteria | 55175 |
| 185 | Ga0207658_10001469 | 3300025986 | Bacteria | 18347 |
| 186 | Ga0207639_10007474 | 3300026041 | Bacteria | 7454 |
| 187 | Ga0207678_10002745 | 3300026067 | Bacteria | 15936 |
| 188 | Ga0207702_10002753 | 3300026078 | Bacteria | 16449 |
| 189 | Ga0207641_10000339 | 3300026088 | Bacteria | 56902 |
| 190 | Ga0207641_10010094 | 3300026088 | Bacteria | 7764 |
| 191 | Ga0207641_10103806 | 3300026088 | Bacteria | 2508 |
| 192 | Ga0207648_10040975 | 3300026089 | Bacteria | 4068 |
| 193 | Ga0207676_10000004 | 3300026095 | Bacteria | 725417 |
| 194 | Ga0207676_10004367 | 3300026095 | Bacteria | 10004 |
| 195 | Ga0207674_10006416 | 3300026116 | Bacteria | 13835 |
| 196 | Ga0207674_10051662 | 3300026116 | Bacteria | 4194 |
| 197 | Ga0207674_10301889 | 3300026116 | Bacteria | 1550 |
| 198 | Ga0207675_100001128 | 3300026118 | Bacteria | 26498 |
| 199 | Ga0207683_10005090 | 3300026121 | Bacteria | 11281 |
| 200 | Ga0207698_10003597 | 3300026142 | Bacteria | 9356 |
| 201 | Ga0207698_11439174 | 3300026142 | Bacteria | 704 |
| 202 | Ga0268266_10000002 | 3300028379 | Bacteria | 3059047 |
| 203 | Ga0268266_10110224 | 3300028379 | Bacteria | 2438 |
| 204 | Ga0268266_10435240 | 3300028379 | Bacteria | 1245 |
| 205 | Ga0268265_10000002 | 3300028380 | Bacteria | 1035381 |
| 206 | Ga0268264_10000184 | 3300028381 | Bacteria | 131402 |
| 207 | Ga0268264_11133789 | 3300028381 | Bacteria | 791 |
| 208 | Ga0307517_10156506 | 3300028786 | Bacteria | 1544 |
| 209 | Ga0314311_1249570 | 3300030733 | Bacteria | 2816 |
| 210 | Ga0307513_10005593 | 3300031456 | Bacteria | 16577 |
| 211 | Ga0307408_100380827 | 3300031548 | Bacteria | 1206 |
| 212 | Ga0307408_100597531 | 3300031548 | Bacteria | 980 |
| 213 | Ga0307405_10578634 | 3300031731 | Bacteria | 913 |
| 214 | Ga0307413_10003793 | 3300031824 | Bacteria | 6441 |
| 215 | Ga0307410_10082320 | 3300031852 | Bacteria | 2264 |
| 216 | Ga0307412_10006933 | 3300031911 | Bacteria | 6428 |
| 217 | Ga0307412_10018009 | 3300031911 | Bacteria | 4240 |
| 218 | Ga0307409_100009926 | 3300031995 | Bacteria | 5880 |
| 219 | Ga0307409_100432078 | 3300031995 | Bacteria | 1266 |
| 220 | Ga0307416_100096005 | 3300032002 | Bacteria | 2562 |
| 221 | Ga0307414_10046104 | 3300032004 | Bacteria | 2989 |
| 222 | Ga0307411_10107448 | 3300032005 | Bacteria | 1988 |
| 223 | Ga0307411_10741212 | 3300032005 | Bacteria | 860 |
| 224 | Ga0307510_10068030 | 3300033180 | Bacteria | 3579 |
| 225 | Ga0373927_0081358 | 3300035695 | Bacteria | 2099 |
| 226 | Ga0395899_0361068 | 3300037312 | Bacteria | 969 |
| 227 | Ga0395900_0502948 | 3300037418 | Bacteria | 1162 |
| 228 | Ga0395900_0878197 | 3300037418 | Bacteria | 821 |
| 229 | Ga0395901_0088914 | 3300038443 | Bacteria | 3232 |
| 230 | Ga0395901_0124250 | 3300038443 | Bacteria | 2712 |
| 231 | Ga0237819_00631 | 3300038705 | Bacteria | 11472 |
| 232 | Ga0237816_01412 | 3300039145 | Bacteria | 1949 |
| 233 | Ga0436365_1218500 | 3300039437 | Bacteria | 1490 |
| 234 | Ga0436365_1519106 | 3300039437 | Bacteria | 586 |
| 235 | Ga0439436_0019891 | 3300041404 | Bacteria | 2001 |
| 236 | Ga0439439_0105652 | 3300041406 | Bacteria | 777 |
| 237 | Ga0439461_0000061 | 3300041410 | Bacteria | 13673 |
| 238 | Ga0439461_0009141 | 3300041410 | Bacteria | 1792 |
| 239 | Ga0439466_0071613 | 3300041411 | Bacteria | 1103 |
| 240 | Ga0439465_0001448 | 3300041413 | Bacteria | 7689 |
| 241 | Ga0439465_0003318 | 3300041413 | Bacteria | 5257 |
| 242 | Ga0451787_460864 | 3300041441 | Bacteria | 528 |
| 243 | Ga0451802_1906611 | 3300041460 | Bacteria | 763 |
| 244 | Ga0451839_1000255 | 3300041496 | Bacteria | 666 |
| 245 | Ga0439431_0000299 | 3300041997 | Bacteria | 10198 |
| 246 | Ga0439431_0019915 | 3300041997 | Bacteria | 1598 |
| 247 | Ga0439445_0001302 | 3300042004 | Bacteria | 5395 |
| 248 | Ga0439432_000540 | 3300042006 | Bacteria | 14094 |
| 249 | Ga0439449_0232938 | 3300042007 | Bacteria | 691 |
| 250 | Ga0439452_023783 | 3300042010 | Bacteria | 1573 |
| 251 | Ga0439452_030982 | 3300042010 | Bacteria | 1315 |
| 252 | Ga0439457_005956 | 3300042014 | Bacteria | 3014 |
| 253 | Ga0439462_0001007 | 3300042015 | Bacteria | 6033 |
| 254 | Ga0439462_0001333 | 3300042015 | Bacteria | 5447 |
| 255 | Ga0450919_028886 | 3300042121 | Bacteria | 633 |
| 256 | Ga0450923_090818 | 3300042125 | Bacteria | 696 |
| 257 | Ga0450890_042389 | 3300042127 | Bacteria | 677 |
| 258 | Ga0450894_011934 | 3300042131 | Bacteria | 1133 |
| 259 | Ga0439446_0153879 | 3300042156 | Bacteria | 757 |
| 260 | Ga0439434_0002887 | 3300042435 | Bacteria | 5014 |
| 261 | Ga0466963_0642264 | 3300044694 | Bacteria | 749 |
| 262 | Ga0495629_1044979 | 3300046459 | Bacteria | 530 |
| 263 | Ga0495638_0154424 | 3300046460 | Bacteria | 1329 |
| 264 | Ga0495650_0000373 | 3300046471 | Bacteria | 78223 |
| 265 | Ga0495650_0044272 | 3300046471 | Bacteria | 1883 |
| 266 | Ga0495584_0050366 | 3300046491 | Bacteria | 2097 |
| 267 | Ga0495585_0066154 | 3300046492 | Bacteria | 1979 |
| 268 | Ga0495596_0006912 | 3300046500 | Bacteria | 5170 |
| 269 | Ga0495607_0055288 | 3300046501 | Bacteria | 2284 |
| 270 | Ga0495583_0000038 | 3300046506 | Bacteria | 243395 |
| 271 | Ga0495583_0002738 | 3300046506 | Bacteria | 14593 |
| 272 | Ga0495583_0026816 | 3300046506 | Bacteria | 2850 |
| 273 | Ga0495606_0000731 | 3300046507 | Bacteria | 50823 |
| 274 | Ga0495631_0041698 | 3300046518 | Bacteria | 2030 |
| 275 | Ga0495631_0088121 | 3300046518 | Bacteria | 1336 |
| 276 | Ga0495637_0129466 | 3300046520 | Bacteria | 965 |
| 277 | Ga0495643_0035928 | 3300046522 | Bacteria | 2725 |
| 278 | Ga0495643_0089797 | 3300046522 | Bacteria | 1586 |
| 279 | Ga0495643_0178811 | 3300046522 | Bacteria | 1032 |
| 280 | Ga0495648_0000115 | 3300046524 | Bacteria | 98656 |
| 281 | Ga0495648_0085264 | 3300046524 | Bacteria | 1785 |
| 282 | Ga0495663_0010880 | 3300046525 | Bacteria | 2531 |
| 283 | Ga0495663_0127921 | 3300046525 | Bacteria | 855 |
| 284 | Ga0495597_0150695 | 3300046542 | Bacteria | 954 |
| 285 | Ga0495622_0020692 | 3300046557 | Bacteria | 3063 |
| 286 | Ga0495633_0004785 | 3300046558 | Bacteria | 8487 |
| 287 | Ga0495633_0020508 | 3300046558 | Bacteria | 3323 |
| 288 | Ga0495668_0000007 | 3300046616 | Bacteria | 552902 |
| 289 | Ga0495668_0016805 | 3300046616 | Bacteria | 4251 |
| 290 | Ga0495668_0170806 | 3300046616 | Bacteria | 1191 |
| 291 | Ga0495668_0664223 | 3300046616 | Bacteria | 576 |
| 292 | Ga0495611_0038658 | 3300046648 | Bacteria | 2123 |
| 293 | Ga0495625_0000959 | 3300046660 | Bacteria | 38428 |
| 294 | Ga0495625_0072471 | 3300046660 | Bacteria | 2415 |
| 295 | Ga0495625_0177241 | 3300046660 | Bacteria | 1420 |
| 296 | Ga0495625_0444086 | 3300046660 | Bacteria | 802 |
| 297 | Ga0495661_0029182 | 3300046665 | Bacteria | 3524 |
| 298 | Ga0495669_0000268 | 3300046684 | Bacteria | 29882 |
| 299 | Ga0495670_0000066 | 3300046691 | Bacteria | 46500 |
| 300 | Ga0495670_0026006 | 3300046691 | Bacteria | 2897 |
| 301 | Ga0495670_0097425 | 3300046691 | Bacteria | 1511 |
| 302 | Ga0495649_0152324 | 3300046694 | Bacteria | 1214 |
| 303 | Ga0495649_0517941 | 3300046694 | Bacteria | 592 |
| 304 | Ga0495589_0315567 | 3300046794 | Bacteria | 723 |
| 305 | Ga0495600_0021313 | 3300046809 | Bacteria | 4148 |
| 306 | Ga0495660_0079263 | 3300046810 | Bacteria | 1725 |
| 307 | Ga0495660_0509617 | 3300046810 | Bacteria | 513 |
| 308 | Ga0495687_000055 | 3300047443 | Bacteria | 194477 |
| 309 | Ga0495687_005766 | 3300047443 | Bacteria | 7774 |
| 310 | Ga0495677_0030544 | 3300047445 | Bacteria | 1961 |
| 311 | Ga0495677_0141770 | 3300047445 | Bacteria | 923 |
| 312 | Ga0495673_0098815 | 3300047469 | Bacteria | 1183 |
| 313 | Ga0495681_0016889 | 3300047470 | Bacteria | 4071 |
| 314 | Ga0495681_0107982 | 3300047470 | Bacteria | 1208 |
| 315 | Ga0495686_0001594 | 3300047472 | Bacteria | 23956 |
| 316 | Ga0495686_0018056 | 3300047472 | Bacteria | 4741 |
| 317 | Ga0495686_0258893 | 3300047472 | Bacteria | 975 |
| 318 | Ga0496101_0265122 | 3300048904 | Bacteria | 1340 |
| 319 | Ga0496102_0002822 | 3300048905 | Bacteria | 14787 |
| 320 | Ga0496103_0000151 | 3300048906 | Bacteria | 72539 |
| 321 | Ga0496104_0076023 | 3300048907 | Bacteria | 3198 |
| 322 | Ga0496105_0000735 | 3300048908 | Bacteria | 22209 |
| 323 | Ga0496114_0005701 | 3300048917 | Bacteria | 9766 |
| 324 | Ga0496115_0000018 | 3300048918 | Bacteria | 182523 |
| 325 | Ga0496115_0004458 | 3300048918 | Bacteria | 10148 |
| 326 | Ga0496116_0003758 | 3300048919 | Bacteria | 14845 |
| 327 | Ga0496117_0000408 | 3300048920 | Bacteria | 72369 |
| 328 | Ga0496118_0000600 | 3300048921 | Bacteria | 59661 |
| 329 | Ga0496120_0080688 | 3300048923 | Bacteria | 1762 |
| 330 | Ga0496121_0012946 | 3300048924 | Bacteria | 9018 |
| 331 | Ga0496122_0021132 | 3300048925 | Bacteria | 5841 |
| 332 | Ga0496123_0009676 | 3300048926 | Bacteria | 8644 |
| 333 | Ga0496124_0000099 | 3300048927 | Bacteria | 182007 |
| 334 | Ga0496125_0005013 | 3300048928 | Bacteria | 14956 |
| 335 | Ga0496125_0048028 | 3300048928 | Bacteria | 3563 |
| 336 | Ga0496125_0109775 | 3300048928 | Bacteria | 2002 |
| 337 | Ga0496125_0301506 | 3300048928 | Bacteria | 981 |
| 338 | Ga0496126_0000507 | 3300048929 | Bacteria | 76510 |
| 339 | Ga0501306_000806 | 3300049127 | Bacteria | 2641 |
| 340 | Ga0501309_005223 | 3300049129 | Bacteria | 1540 |
| 341 | Ga0501305_005145 | 3300049161 | Bacteria | 1571 |
| 342 | Ga0501307_000547 | 3300049162 | Bacteria | 2645 |
| 343 | Ga0501290_071635 | 3300049513 | Bacteria | 576 |
| 344 | Ga0501311_015155 | 3300049527 | Bacteria | 992 |
| 345 | Ga0501312_005203 | 3300049528 | Bacteria | 1570 |
| 346 | Ga0501313_003798 | 3300049529 | Bacteria | 1523 |
| 347 | Ga0501314_002293 | 3300049530 | Bacteria | 1467 |
| 348 | Ga0501315_004245 | 3300049531 | Bacteria | 1488 |
| 349 | Ga0501320_000324 | 3300049536 | Bacteria | 2645 |
| 350 | Ga0501320_024753 | 3300049536 | Bacteria | 717 |
| 351 | Ga0501321_008250 | 3300049537 | Bacteria | 1101 |
| 352 | Ga0501322_000778 | 3300049538 | Bacteria | 1608 |
| 353 | Ga0501323_049428 | 3300049539 | Bacteria | 635 |
| 354 | Ga0501325_002853 | 3300049541 | Bacteria | 1218 |
| 355 | Ga0501326_05747 | 3300049542 | Bacteria | 681 |
| 356 | Ga0501337_010655 | 3300049553 | Bacteria | 672 |
| 357 | Ga0501033_0599907 | 3300049570 | Bacteria | 755 |
| 358 | Ga0501034_1276047 | 3300049571 | Bacteria | 612 |
| 359 | Ga0501036_0821632 | 3300049572 | Bacteria | 765 |
| 360 | Ga0501202_069852 | 3300049652 | Bacteria | 808 |
| 361 | Ga0501208_005097 | 3300049655 | Bacteria | 1594 |
| 362 | Ga0501223_037177 | 3300049663 | Bacteria | 946 |
| 363 | Ga0501224_023560 | 3300049664 | Bacteria | 919 |
| 364 | Ga0501249_002715 | 3300049679 | Bacteria | 3565 |
| 365 | Ga0501259_035837 | 3300049688 | Bacteria | 957 |
| 366 | Ga0501241_006223 | 3300049758 | Bacteria | 2201 |
| 367 | Ga0501241_024334 | 3300049758 | Bacteria | 1124 |
| 368 | Ga0501204_005385 | 3300049850 | Bacteria | 1401 |
| 369 | nmdc:mga03683_93826_c1 | 3300050489 | Bacteria | 1311 |
| 370 | nmdc:mga0k408_629678_c1 | 3300050493 | Bacteria | 632 |
| 371 | nmdc:mga07m45_466029_c1 | 3300050496 | Bacteria | 732 |
| 372 | Ga0500643_000937 | 3300053087 | Bacteria | 18234 |
| 373 | Ga0500643_002782 | 3300053087 | Bacteria | 8747 |
| 374 | Ga0500643_021751 | 3300053087 | Bacteria | 2075 |
| 375 | Ga0500643_026996 | 3300053087 | Bacteria | 1790 |
| 376 | Ga0500647_0138407 | 3300053091 | Bacteria | 1144 |
| 377 | Ga0500583_0358324 | 3300053092 | Bacteria | 706 |
| 378 | Ga0500651_0041230 | 3300053093 | Bacteria | 2910 |
| 379 | Ga0500566_0001914 | 3300053094 | Bacteria | 12257 |
| 380 | Ga0500566_0070078 | 3300053094 | Bacteria | 1969 |
| 381 | Ga0500641_0104009 | 3300053096 | Bacteria | 1219 |
| 382 | Ga0500555_014599 | 3300053103 | Bacteria | 2264 |
| 383 | Ga0500562_064187 | 3300053108 | Bacteria | 988 |
| 384 | Ga0500569_137670 | 3300053109 | Bacteria | 820 |
| 385 | Ga0500595_001198 | 3300053119 | Bacteria | 14324 |
| 386 | Ga0500618_014395 | 3300053125 | Bacteria | 2020 |
| 387 | Ga0500642_0000116 | 3300053130 | Bacteria | 37194 |
| 388 | Ga0500642_0061340 | 3300053130 | Bacteria | 1689 |
| 389 | Ga0500652_104707 | 3300053131 | Bacteria | 1183 |
| 390 | Ga0500655_000092 | 3300053133 | Bacteria | 23519 |
| 391 | Ga0500568_0005260 | 3300053139 | Bacteria | 6729 |
| 392 | Ga0500590_036304 | 3300053148 | Bacteria | 2547 |
| 393 | Ga0500604_0020927 | 3300053151 | Bacteria | 1846 |
| 394 | Ga0500619_002874 | 3300053154 | Bacteria | 3410 |
| 395 | Ga0500622_0088270 | 3300053156 | Bacteria | 1543 |
| 396 | Ga0500627_0146919 | 3300053158 | Bacteria | 1065 |
| 397 | Ga0500636_0062764 | 3300053177 | Bacteria | 2166 |
| 398 | Ga0500636_0139692 | 3300053177 | Bacteria | 1342 |
| 399 | Ga0500570_006787 | 3300053724 | Bacteria | 6234 |
| 400 | Ga0500645_000009 | 3300053730 | Bacteria | 206177 |
| 401 | Ga0500645_022066 | 3300053730 | Bacteria | 1962 |
| 402 | Ga0500596_004827 | 3300053735 | Bacteria | 2436 |
| 403 | Ga0587084_001094 | 3300059477 | Bacteria | 2462 |
| 404 | Ga0587084_002989 | 3300059477 | Bacteria | 1818 |
| 405 | Ga0587093_001326 | 3300059478 | Bacteria | 2059 |
| 406 | Ga0587066_001724 | 3300059490 | Bacteria | 2265 |
| 407 | Ga0587066_029494 | 3300059490 | Bacteria | 968 |
| 408 | Ga0587066_059023 | 3300059490 | Bacteria | 778 |
| 409 | Ga0587070_002153 | 3300059491 | Bacteria | 2184 |
| 410 | Ga0587073_0003635 | 3300059492 | Bacteria | 2135 |
| 411 | Ga0587073_0017525 | 3300059492 | Bacteria | 1324 |
| 412 | Ga0587077_002345 | 3300059493 | Bacteria | 2229 |
| 413 | Ga0587077_048166 | 3300059493 | Bacteria | 882 |
| 414 | Ga0587080_002193 | 3300059503 | Bacteria | 2263 |
| 415 | Ga0587082_002159 | 3300059504 | Bacteria | 2175 |
| 416 | Ga0587083_0002822 | 3300059505 | Bacteria | 2219 |
| 417 | Ga0587083_0024694 | 3300059505 | Bacteria | 1146 |
| 418 | Ga0587085_002116 | 3300059506 | Bacteria | 1985 |
| 419 | Ga0587086_001838 | 3300059507 | Bacteria | 1910 |
| 420 | Ga0587088_000818 | 3300059508 | Bacteria | 2900 |
| 421 | Ga0587088_043178 | 3300059508 | Bacteria | 857 |
| 422 | Ga0587088_058986 | 3300059508 | Bacteria | 773 |
| 423 | Ga0587089_001504 | 3300059509 | Bacteria | 2189 |
| 424 | Ga0587090_001838 | 3300059510 | Bacteria | 2223 |
| 425 | Ga0587090_002440 | 3300059510 | Bacteria | 2049 |
| 426 | Ga0587091_003541 | 3300059511 | Bacteria | 1975 |
| 427 | Ga0587091_009696 | 3300059511 | Bacteria | 1457 |
| 428 | Ga0587092_001822 | 3300059512 | Bacteria | 2169 |
| 429 | Ga0587094_010322 | 3300059513 | Bacteria | 1210 |
| 430 | Ga0587094_018163 | 3300059513 | Bacteria | 998 |
| 431 | Ga0587094_114253 | 3300059513 | Bacteria | 534 |
| 432 | Ga0587095_002741 | 3300059514 | Bacteria | 1203 |
| 433 | Ga0587106_001065 | 3300059605 | Bacteria | 2296 |
| 434 | Ga0587106_001991 | 3300059605 | Bacteria | 1933 |
| 435 | Ga0587099_001003 | 3300059622 | Bacteria | 1891 |
| 436 | Ga0587101_001092 | 3300059623 | Bacteria | 2218 |
| 437 | Ga0587109_022741 | 3300059624 | Bacteria | 1131 |
| 438 | Ga0587115_002052 | 3300059626 | Bacteria | 1948 |
| 439 | Ga0587128_001376 | 3300059630 | Bacteria | 2273 |
| 440 | Ga0587130_005080 | 3300059631 | Bacteria | 1168 |
| 441 | Ga0587062_001932 | 3300059639 | Bacteria | 1896 |
| 442 | Ga0587062_035199 | 3300059639 | Bacteria | 787 |
| 443 | Ga0587067_020822 | 3300059640 | Bacteria | 1125 |
| 444 | Ga0587067_049655 | 3300059640 | Bacteria | 844 |
| 445 | Ga0587068_002620 | 3300059641 | Bacteria | 2207 |
| 446 | Ga0587068_011559 | 3300059641 | Bacteria | 1335 |
| 447 | Ga0587069_001380 | 3300059642 | Bacteria | 2212 |
| 448 | Ga0587069_003533 | 3300059642 | Bacteria | 1695 |
| 449 | Ga0587072_003840 | 3300059643 | Bacteria | 2140 |
| 450 | Ga0587075_007355 | 3300059644 | Bacteria | 1380 |
| 451 | Ga0587076_011738 | 3300059645 | Bacteria | 1294 |
| 452 | Ga0587076_020750 | 3300059645 | Bacteria | 1081 |
| 453 | Ga0587078_001344 | 3300059646 | Bacteria | 2165 |
| 454 | Ga0587079_002709 | 3300059647 | Bacteria | 2214 |
| 455 | Ga0587079_013025 | 3300059647 | Bacteria | 1370 |
| 456 | Ga0587100_003121 | 3300059648 | Bacteria | 1115 |
| 457 | Ga0587102_000406 | 3300059649 | Bacteria | 2402 |
| 458 | Ga0587107_010570 | 3300059652 | Bacteria | 1114 |
| 459 | Ga0587110_005747 | 3300059654 | Bacteria | 1127 |
| 460 | Ga0587119_001885 | 3300059658 | Bacteria | 1809 |
| 461 | Ga0587119_007430 | 3300059658 | Bacteria | 1181 |
| 462 | Ga0587071_003565 | 3300060344 | Bacteria | 2245 |
| 463 | Ga0587111_0003541 | 3300060346 | Bacteria | 2233 |
| 464 | Ga0587111_0006016 | 3300060346 | Bacteria | 1903 |
| 465 | 2585260510 | 2582581305 | Bacteria | 4895574 |
| 466 | 2644037150 | 2643221605 | Bacteria | 4772303 |
| 467 | 2644043602 | 2643221606 | Bacteria | 5588032 |
| 468 | 2644126981 | 2643221622 | Bacteria | 4212502 |
| 469 | 2644393761 | 2643221671 | Bacteria | 5496681 |
| 470 | Ga0055530_10000061 | |||
| 471 | ARcpr5yngRDRAFT_c001154 | |||
| 472 | JGI24736J21556_1049509 | |||
| 473 | JGI24741J21665_1000550 | |||
| 474 | JGI24747J21853_1025909 | |||
| 475 | JGI24740J21852_10001315 | |||
| 476 | JGI24739J22299_10009493 | |||
| 477 | JGI24737J22298_10065040 | |||
| 478 | JGI24735J21928_10146408 | |||
| 479 | JGI24738J21930_10049526 | |||
| 480 | JGI24749J21850_1000218 | |||
| 481 | JGI24742J22300_10016651 | |||
| 482 | JGI24751J29686_10000355 | |||
| 483 | JGI25150J39212_1000213 | |||
| 484 | JGI25153J46596_10000036 | |||
| 485 | JGI25153J46596_10013309 | |||
| 486 | Ga0055525_1000035 | |||
| 487 | Ga0055542_1000060 | |||
| 488 | Ga0055529_1000043 | |||
| 489 | Ga0055526_1000948 | |||
| 490 | Ga0055524_1000180 | |||
| 491 | Ga0055536_1021897 | |||
| 492 | Ga0055530_10009391 | |||
| 493 | Ga0055530_10020085 | |||
| 494 | Ga0055540_1001505 | |||
| 495 | Ga0055531_10000035 | |||
| 496 | Ga0055531_10018371 | |||
| 497 | Ga0055531_10019062 | |||
| 498 | Ga0065165_1027465 | |||
| 499 | Ga0065165_1044085 | |||
| 500 | Ga0065165_1061701 | |||
| 501 | Ga0065707_10093614 | |||
| 502 | Ga0065707_10142143 | |||
| 503 | Ga0070658_10005034 | |||
| 504 | Ga0070658_10814024 | |||
| 505 | Ga0070676_10045421 | |||
| 506 | Ga0070670_100000005 | |||
| 507 | Ga0070666_10128940 | |||
| 508 | Ga0070666_10629280 | |||
| 509 | Ga0070682_101493108 | |||
| 510 | Ga0070661_100016653 | |||
| 511 | Ga0070668_100446121 | |||
| 512 | Ga0070669_100000119 | |||
| 513 | Ga0070669_100071542 | |||
| 514 | Ga0070675_100190989 | |||
| 515 | Ga0070671_100199027 | |||
| 516 | Ga0070674_100171058 | |||
| 517 | Ga0070659_100668509 | |||
| 518 | Ga0070667_100000302 | |||
| 519 | Ga0070667_100000407 | |||
| 520 | Ga0070667_100063320 | |||
| 521 | Ga0070663_100017496 | |||
| 522 | Ga0070662_100220336 | |||
| 523 | Ga0068867_100009668 | |||
| 524 | Ga0068853_100108553 | |||
| 525 | Ga0068853_100197717 | |||
| 526 | Ga0070665_100000186 | |||
| 527 | Ga0070665_100128007 | |||
| 528 | Ga0068855_100133578 | |||
| 529 | Ga0068855_100499520 | |||
| 530 | Ga0070664_100066966 | |||
| 531 | Ga0068857_100038434 | |||
| 532 | Ga0068857_100345353 | |||
| 533 | Ga0068854_100005131 | |||
| 534 | Ga0068854_100015788 | |||
| 535 | Ga0068856_100041069 | |||
| 536 | Ga0068852_100066428 | |||
| 537 | Ga0068852_102238016 | |||
| 538 | Ga0068859_100029616 | |||
| 539 | Ga0068864_100005975 | |||
| 540 | Ga0068864_100224496 | |||
| 541 | Ga0068863_100003334 | |||
| 542 | Ga0068863_100003363 | |||
| 543 | Ga0068863_100047096 | |||
| 544 | Ga0068860_100000416 | |||
| 545 | Ga0068860_100991648 | |||
| 546 | Ga0068862_100000011 | |||
| 547 | Ga0075364_10679039 | |||
| 548 | Ga0075362_10211473 | |||
| 549 | Ga0097621_100097792 | |||
| 550 | Ga0068871_100330633 | |||
| 551 | Ga0097620_100029618 | |||
| 552 | Ga0105240_10089799 | |||
| 553 | Ga0105247_10315171 | |||
| 554 | Ga0105243_10000122 | |||
| 555 | Ga0105241_10004088 | |||
| 556 | Ga0105248_10000921 | |||
| 557 | Ga0105237_10045883 | |||
| 558 | Ga0105238_10034108 | |||
| 559 | Ga0105238_10137947 | |||
| 560 | Ga0105249_10065162 | |||
| 561 | Ga0105239_10061378 | |||
| 562 | Ga0105246_10017446 | |||
| 563 | Ga0157326_1000156 | |||
| 564 | Ga0157373_10069160 | |||
| 565 | Ga0157373_10299837 | |||
| 566 | Ga0157371_10000030 | |||
| 567 | Ga0157370_10053275 | |||
| 568 | Ga0157369_10040121 | |||
| 569 | Ga0157374_10274042 | |||
| 570 | Ga0157374_10598079 | |||
| 571 | Ga0157378_10036642 | |||
| 572 | Ga0157378_10240643 | |||
| 573 | Ga0157372_10284634 | |||
| 574 | Ga0157372_10461882 | |||
| 575 | Ga0157375_10267416 | |||
| 576 | Ga0163163_10019186 | |||
| 577 | Ga0157380_10001430 | |||
| 578 | Ga0182008_10396499 | |||
| 579 | Ga0163161_10038816 | |||
| 580 | Ga0197907_10167724 | |||
| 581 | Ga0206356_10745082 | |||
| 582 | Ga0206349_1685457 | |||
| 583 | Ga0206355_1265416 | |||
| 584 | Ga0206352_10765077 | |||
| 585 | Ga0206350_10568922 | |||
| 586 | Ga0209674_117634 | |||
| 587 | Ga0209563_100047 | |||
| 588 | Ga0207425_1000037 | |||
| 589 | Ga0207425_1009226 | |||
| 590 | Ga0209646_1006345 | |||
| 591 | Ga0209677_105413 | |||
| 592 | Ga0209148_1000017 | |||
| 593 | Ga0209129_1000363 | |||
| 594 | Ga0209233_1029790 | |||
| 595 | Ga0209565_1000012 | |||
| 596 | Ga0209565_1000427 | |||
| 597 | Ga0209455_1000005 | |||
| 598 | Ga0209673_1005653 | |||
| 599 | Ga0209673_1008360 | |||
| 600 | Ga0209675_1006520 | |||
| 601 | Ga0209676_1004865 | |||
| 602 | Ga0209025_1000117 | |||
| 603 | Ga0209564_1001191 | |||
| 604 | Ga0209564_1065550 | |||
| 605 | Ga0209758_1000035 | |||
| 606 | Ga0209758_1000103 | |||
| 607 | Ga0209758_1002916 | |||
| 608 | Ga0209050_1000001 | |||
| 609 | Ga0209050_1000014 | |||
| 610 | Ga0209050_1002236 | |||
| 611 | Ga0209256_1000012 | |||
| 612 | Ga0207426_1011098 | |||
| 613 | Ga0209051_1001637 | |||
| 614 | Ga0209257_1000019 | |||
| 615 | Ga0209257_1001431 | |||
| 616 | Ga0209257_1006564 | |||
| 617 | Ga0209257_1012112 | |||
| 618 | Ga0209257_1093054 | |||
| 619 | Ga0207697_10108222 | |||
| 620 | Ga0207656_10004629 | |||
| 621 | Ga0207682_10087972 | |||
| 622 | Ga0207688_10116031 | |||
| 623 | Ga0207680_10035622 | |||
| 624 | Ga0207680_10240402 | |||
| 625 | Ga0207680_10483515 | |||
| 626 | Ga0207647_10004031 | |||
| 627 | Ga0207645_10021418 | |||
| 628 | Ga0207705_10000163 | |||
| 629 | Ga0207654_10000307 | |||
| 630 | Ga0207695_10004528 | |||
| 631 | Ga0207671_10011997 | |||
| 632 | Ga0207657_10009441 | |||
| 633 | Ga0207649_10000199 | |||
| 634 | Ga0207681_10000001 | |||
| 635 | Ga0207681_10341446 | |||
| 636 | Ga0207694_10004278 | |||
| 637 | Ga0207694_10381153 | |||
| 638 | Ga0207650_10000018 | |||
| 639 | Ga0207690_10003676 | |||
| 640 | Ga0207706_10104272 | |||
| 641 | Ga0207709_10000083 | |||
| 642 | Ga0207669_10017230 | |||
| 643 | Ga0207691_10999854 | |||
| 644 | Ga0207711_10016962 | |||
| 645 | Ga0207661_10366009 | |||
| 646 | Ga0207679_10166251 | |||
| 647 | Ga0207667_10000004 | |||
| 648 | Ga0207651_10211195 | |||
| 649 | Ga0207712_10033557 | |||
| 650 | Ga0207668_11730599 | |||
| 651 | Ga0207640_10012485 | |||
| 652 | Ga0207640_10023981 | |||
| 653 | Ga0207658_10000263 | |||
| 654 | Ga0207658_10001469 | |||
| 655 | Ga0207639_10007474 | |||
| 656 | Ga0207678_10002745 | |||
| 657 | Ga0207702_10002753 | |||
| 658 | Ga0207641_10000339 | |||
| 659 | Ga0207641_10010094 | |||
| 660 | Ga0207641_10103806 | |||
| 661 | Ga0207648_10040975 | |||
| 662 | Ga0207676_10000004 | |||
| 663 | Ga0207676_10004367 | |||
| 664 | Ga0207674_10006416 | |||
| 665 | Ga0207674_10051662 | |||
| 666 | Ga0207674_10301889 | |||
| 667 | Ga0207675_100001128 | |||
| 668 | Ga0207683_10005090 | |||
| 669 | Ga0207698_10003597 | |||
| 670 | Ga0207698_11439174 | |||
| 671 | Ga0268266_10000002 | |||
| 672 | Ga0268266_10110224 | |||
| 673 | Ga0268266_10435240 | |||
| 674 | Ga0268265_10000002 | |||
| 675 | Ga0268264_10000184 | |||
| 676 | Ga0268264_11133789 | |||
| 677 | Ga0307517_10156506 | |||
| 678 | Ga0314311_1249570 | |||
| 679 | Ga0307513_10005593 | |||
| 680 | Ga0307408_100380827 | |||
| 681 | Ga0307408_100597531 | |||
| 682 | Ga0307405_10578634 | |||
| 683 | Ga0307413_10003793 | |||
| 684 | Ga0307410_10082320 | |||
| 685 | Ga0307412_10006933 | |||
| 686 | Ga0307412_10018009 | |||
| 687 | Ga0307409_100009926 | |||
| 688 | Ga0307409_100432078 | |||
| 689 | Ga0307416_100096005 | |||
| 690 | Ga0307414_10046104 | |||
| 691 | Ga0307411_10107448 | |||
| 692 | Ga0307411_10741212 | |||
| 693 | Ga0307510_10068030 | |||
| 694 | Ga0373927_0081358 | |||
| 695 | Ga0395899_0361068 | |||
| 696 | Ga0395900_0502948 | |||
| 697 | Ga0395900_0878197 | |||
| 698 | Ga0395901_0088914 | |||
| 699 | Ga0395901_0124250 | |||
| 700 | Ga0237819_00631 | |||
| 701 | Ga0237816_01412 | |||
| 702 | Ga0436365_1218500 | |||
| 703 | Ga0436365_1519106 | |||
| 704 | Ga0439436_0019891 | |||
| 705 | Ga0439439_0105652 | |||
| 706 | Ga0439461_0000061 | |||
| 707 | Ga0439461_0009141 | |||
| 708 | Ga0439466_0071613 | |||
| 709 | Ga0439465_0001448 | |||
| 710 | Ga0439465_0003318 | |||
| 711 | Ga0451787_460864 | |||
| 712 | Ga0451802_1906611 | |||
| 713 | Ga0451839_1000255 | |||
| 714 | Ga0439431_0000299 | |||
| 715 | Ga0439431_0019915 | |||
| 716 | Ga0439445_0001302 | |||
| 717 | Ga0439432_000540 | |||
| 718 | Ga0439449_0232938 | |||
| 719 | Ga0439452_023783 | |||
| 720 | Ga0439452_030982 | |||
| 721 | Ga0439457_005956 | |||
| 722 | Ga0439462_0001007 | |||
| 723 | Ga0439462_0001333 | |||
| 724 | Ga0450919_028886 | |||
| 725 | Ga0450923_090818 | |||
| 726 | Ga0450890_042389 | |||
| 727 | Ga0450894_011934 | |||
| 728 | Ga0439446_0153879 | |||
| 729 | Ga0439434_0002887 | |||
| 730 | Ga0466963_0642264 | |||
| 731 | Ga0495629_1044979 | |||
| 732 | Ga0495638_0154424 | |||
| 733 | Ga0495650_0000373 | |||
| 734 | Ga0495650_0044272 | |||
| 735 | Ga0495584_0050366 | |||
| 736 | Ga0495585_0066154 | |||
| 737 | Ga0495596_0006912 | |||
| 738 | Ga0495607_0055288 | |||
| 739 | Ga0495583_0000038 | |||
| 740 | Ga0495583_0002738 | |||
| 741 | Ga0495583_0026816 | |||
| 742 | Ga0495606_0000731 | |||
| 743 | Ga0495631_0041698 | |||
| 744 | Ga0495631_0088121 | |||
| 745 | Ga0495637_0129466 | |||
| 746 | Ga0495643_0035928 | |||
| 747 | Ga0495643_0089797 | |||
| 748 | Ga0495643_0178811 | |||
| 749 | Ga0495648_0000115 | |||
| 750 | Ga0495648_0085264 | |||
| 751 | Ga0495663_0010880 | |||
| 752 | Ga0495663_0127921 | |||
| 753 | Ga0495597_0150695 | |||
| 754 | Ga0495622_0020692 | |||
| 755 | Ga0495633_0004785 | |||
| 756 | Ga0495633_0020508 | |||
| 757 | Ga0495668_0000007 | |||
| 758 | Ga0495668_0016805 | |||
| 759 | Ga0495668_0170806 | |||
| 760 | Ga0495668_0664223 | |||
| 761 | Ga0495611_0038658 | |||
| 762 | Ga0495625_0000959 | |||
| 763 | Ga0495625_0072471 | |||
| 764 | Ga0495625_0177241 | |||
| 765 | Ga0495625_0444086 | |||
| 766 | Ga0495661_0029182 | |||
| 767 | Ga0495669_0000268 | |||
| 768 | Ga0495670_0000066 | |||
| 769 | Ga0495670_0026006 | |||
| 770 | Ga0495670_0097425 | |||
| 771 | Ga0495649_0152324 | |||
| 772 | Ga0495649_0517941 | |||
| 773 | Ga0495589_0315567 | |||
| 774 | Ga0495600_0021313 | |||
| 775 | Ga0495660_0079263 | |||
| 776 | Ga0495660_0509617 | |||
| 777 | Ga0495687_000055 | |||
| 778 | Ga0495687_005766 | |||
| 779 | Ga0495677_0030544 | |||
| 780 | Ga0495677_0141770 | |||
| 781 | Ga0495673_0098815 | |||
| 782 | Ga0495681_0016889 | |||
| 783 | Ga0495681_0107982 | |||
| 784 | Ga0495686_0001594 | |||
| 785 | Ga0495686_0018056 | |||
| 786 | Ga0495686_0258893 | |||
| 787 | Ga0496101_0265122 | |||
| 788 | Ga0496102_0002822 | |||
| 789 | Ga0496103_0000151 | |||
| 790 | Ga0496104_0076023 | |||
| 791 | Ga0496105_0000735 | |||
| 792 | Ga0496114_0005701 | |||
| 793 | Ga0496115_0000018 | |||
| 794 | Ga0496115_0004458 | |||
| 795 | Ga0496116_0003758 | |||
| 796 | Ga0496117_0000408 | |||
| 797 | Ga0496118_0000600 | |||
| 798 | Ga0496120_0080688 | |||
| 799 | Ga0496121_0012946 | |||
| 800 | Ga0496122_0021132 | |||
| 801 | Ga0496123_0009676 | |||
| 802 | Ga0496124_0000099 | |||
| 803 | Ga0496125_0005013 | |||
| 804 | Ga0496125_0048028 | |||
| 805 | Ga0496125_0109775 | |||
| 806 | Ga0496125_0301506 | |||
| 807 | Ga0496126_0000507 | |||
| 808 | Ga0501306_000806 | |||
| 809 | Ga0501309_005223 | |||
| 810 | Ga0501305_005145 | |||
| 811 | Ga0501307_000547 | |||
| 812 | Ga0501290_071635 | |||
| 813 | Ga0501311_015155 | |||
| 814 | Ga0501312_005203 | |||
| 815 | Ga0501313_003798 | |||
| 816 | Ga0501314_002293 | |||
| 817 | Ga0501315_004245 | |||
| 818 | Ga0501320_000324 | |||
| 819 | Ga0501320_024753 | |||
| 820 | Ga0501321_008250 | |||
| 821 | Ga0501322_000778 | |||
| 822 | Ga0501323_049428 | |||
| 823 | Ga0501325_002853 | |||
| 824 | Ga0501326_05747 | |||
| 825 | Ga0501337_010655 | |||
| 826 | Ga0501033_0599907 | |||
| 827 | Ga0501034_1276047 | |||
| 828 | Ga0501036_0821632 | |||
| 829 | Ga0501202_069852 | |||
| 830 | Ga0501208_005097 | |||
| 831 | Ga0501223_037177 | |||
| 832 | Ga0501224_023560 | |||
| 833 | Ga0501249_002715 | |||
| 834 | Ga0501259_035837 | |||
| 835 | Ga0501241_006223 | |||
| 836 | Ga0501241_024334 | |||
| 837 | Ga0501204_005385 | |||
| 838 | nmdc:mga03683_93826_c1 | |||
| 839 | nmdc:mga0k408_629678_c1 | |||
| 840 | nmdc:mga07m45_466029_c1 | |||
| 841 | Ga0500643_000937 | |||
| 842 | Ga0500643_002782 | |||
| 843 | Ga0500643_021751 | |||
| 844 | Ga0500643_026996 | |||
| 845 | Ga0500647_0138407 | |||
| 846 | Ga0500583_0358324 | |||
| 847 | Ga0500651_0041230 | |||
| 848 | Ga0500566_0001914 | |||
| 849 | Ga0500566_0070078 | |||
| 850 | Ga0500641_0104009 | |||
| 851 | Ga0500555_014599 | |||
| 852 | Ga0500562_064187 | |||
| 853 | Ga0500569_137670 | |||
| 854 | Ga0500595_001198 | |||
| 855 | Ga0500618_014395 | |||
| 856 | Ga0500642_0000116 | |||
| 857 | Ga0500642_0061340 | |||
| 858 | Ga0500652_104707 | |||
| 859 | Ga0500655_000092 | |||
| 860 | Ga0500568_0005260 | |||
| 861 | Ga0500590_036304 | |||
| 862 | Ga0500604_0020927 | |||
| 863 | Ga0500619_002874 | |||
| 864 | Ga0500622_0088270 | |||
| 865 | Ga0500627_0146919 | |||
| 866 | Ga0500636_0062764 | |||
| 867 | Ga0500636_0139692 | |||
| 868 | Ga0500570_006787 | |||
| 869 | Ga0500645_000009 | |||
| 870 | Ga0500645_022066 | |||
| 871 | Ga0500596_004827 | |||
| 872 | Ga0587084_001094 | |||
| 873 | Ga0587084_002989 | |||
| 874 | Ga0587093_001326 | |||
| 875 | Ga0587066_001724 | |||
| 876 | Ga0587066_029494 | |||
| 877 | Ga0587066_059023 | |||
| 878 | Ga0587070_002153 | |||
| 879 | Ga0587073_0003635 | |||
| 880 | Ga0587073_0017525 | |||
| 881 | Ga0587077_002345 | |||
| 882 | Ga0587077_048166 | |||
| 883 | Ga0587080_002193 | |||
| 884 | Ga0587082_002159 | |||
| 885 | Ga0587083_0002822 | |||
| 886 | Ga0587083_0024694 | |||
| 887 | Ga0587085_002116 | |||
| 888 | Ga0587086_001838 | |||
| 889 | Ga0587088_000818 | |||
| 890 | Ga0587088_043178 | |||
| 891 | Ga0587088_058986 | |||
| 892 | Ga0587089_001504 | |||
| 893 | Ga0587090_001838 | |||
| 894 | Ga0587090_002440 | |||
| 895 | Ga0587091_003541 | |||
| 896 | Ga0587091_009696 | |||
| 897 | Ga0587092_001822 | |||
| 898 | Ga0587094_010322 | |||
| 899 | Ga0587094_018163 | |||
| 900 | Ga0587094_114253 | |||
| 901 | Ga0587095_002741 | |||
| 902 | Ga0587106_001065 | |||
| 903 | Ga0587106_001991 | |||
| 904 | Ga0587099_001003 | |||
| 905 | Ga0587101_001092 | |||
| 906 | Ga0587109_022741 | |||
| 907 | Ga0587115_002052 | |||
| 908 | Ga0587128_001376 | |||
| 909 | Ga0587130_005080 | |||
| 910 | Ga0587062_001932 | |||
| 911 | Ga0587062_035199 | |||
| 912 | Ga0587067_020822 | |||
| 913 | Ga0587067_049655 | |||
| 914 | Ga0587068_002620 | |||
| 915 | Ga0587068_011559 | |||
| 916 | Ga0587069_001380 | |||
| 917 | Ga0587069_003533 | |||
| 918 | Ga0587072_003840 | |||
| 919 | Ga0587075_007355 | |||
| 920 | Ga0587076_011738 | |||
| 921 | Ga0587076_020750 | |||
| 922 | Ga0587078_001344 | |||
| 923 | Ga0587079_002709 | |||
| 924 | Ga0587079_013025 | |||
| 925 | Ga0587100_003121 | |||
| 926 | Ga0587102_000406 | |||
| 927 | Ga0587107_010570 | |||
| 928 | Ga0587110_005747 | |||
| 929 | Ga0587119_001885 | |||
| 930 | Ga0587119_007430 | |||
| 931 | Ga0587071_003565 | |||
| 932 | Ga0587111_0003541 | |||
| 933 | Ga0587111_0006016 | |||
| 934 | 2585260510 | |||
| 935 | 2644037150 | |||
| 936 | 2644043602 | |||
| 937 | 2644126981 | |||
| 938 | 2644393761 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1vdm-assembly1.cif.gz_I | crystal structure of purine phosphoribosyltransferase from pyrococcus horikoshii ot3 | 0.8203 | 110 | 141 |
| 8p9r-assembly1.cif.gz_B | structure of the periplasmic domain of exbd from e. coli in complex with tonb | 0.7934 | 57 | 143 |
| 8pek-assembly1.cif.gz_B | structure of the dimeric, periplasmic domain of exbd | 0.7922 | 44 | 142 |
| 6dg3-assembly1.cif.gz_E | lare, a sulfur transferase involved in synthesis of the cofactor for lactate racemase, in complex with caesium | 0.7851 | 108 | 142 |
| 8p9r-assembly1.cif.gz_B | structure of the periplasmic domain of exbd from e. coli in complex with tonb | 0.7744 | 57 | 143 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G056_117_224_3.40.50.2020 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.8144 | 110 | 142 | 3.40.50.2020 |
| af_A0A1D6M3A4_241_482_3.40.50.360 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain | 0.7543 | 110 | 146 | 3.40.50.360 |
| af_P46846_104_226_3.40.50.2020 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.7046 | 102 | 142 | 3.40.50.2020 |
| af_A0A1D8PDD4_238_365_3.50.30.30 | Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1; | 0.7033 | 107 | 144 | 3.50.30.30 |
| af_B9G7E3_163_290_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.6755 | 109 | 146 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A661WY42-F1-model_v4 | Biopolymer transporter ExbD | 0.9019 | 54 | 145 |
GO:0005886
GO:0015031 GO:0022857 |
| AF-A0A2E3WUS4-F1-model_v4 | Biopolymer transporter ExbD | 0.9012 | 57 | 142 |
GO:0005886
GO:0015031 GO:0022857 |
| AF-A0A2A4P3E7-F1-model_v4 | deleted | 0.8992 | 54 | 145 |
|
| AF-A0A7C4N1B6-F1-model_v4 | Biopolymer transporter ExbD | 0.8983 | 56 | 147 |
GO:0005886
GO:0015031 GO:0022857 |
| AF-A0A496S5C8-F1-model_v4 | Biopolymer transporter ExbD | 0.8932 | 52 | 145 |
GO:0005886
GO:0015031 GO:0022857 |