F450169

General Info

Members Datasets Scaffolds Average Seq Length
469 344 938 146

Family's Representative Sequence

Representative Sequence 3300003791|Ga0055530_10000061|Ga0055530_1000006179
Length 159
Sequence MAMSVGEGGDEAPMSDINTTPLVDVMLVLLIIFLIAVPVVIQTIDLALPKVQFEVTQTKPENVALSVTGAGGQCQVYWGMTPVTHQELLDRGVEKLRKEIDRQGGPNAPGLELPEVHIRGDVNTPYRCIGGTIYTMQMAGFVKVGFISEPPAGSGTTRL

Samples

Sample ID Description Type Environment
1 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
2 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
5 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
6 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
7 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
8 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
9 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
10 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
11 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
12 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
13 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
14 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
15 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
16 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
17 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
18 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
19 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
20 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
21 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
22 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
23 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
24 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
25 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
28 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
29 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
30 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
71 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
87 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
92 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
93 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
96 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
97 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
103 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
105 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
108 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
154 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
155 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
156 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
157 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
158 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
159 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
160 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
161 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
162 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
163 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
164 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
165 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
166 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
167 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
168 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
169 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
170 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
171 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
172 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
173 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
174 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
175 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
176 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
177 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
178 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
179 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
180 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
181 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
182 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
183 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
184 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
185 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
186 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
187 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
188 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
189 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
190 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
191 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
192 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
193 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
194 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
195 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
196 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
197 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
198 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
199 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
200 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
201 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
202 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
203 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
204 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
205 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
206 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
207 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
208 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
209 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
210 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
211 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
212 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
213 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
214 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
215 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
216 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
217 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
218 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
219 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
220 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
221 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
222 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
223 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
224 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
225 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
226 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
227 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
228 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
229 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
230 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
231 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
232 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
233 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
234 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
235 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
236 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
237 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
238 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
239 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
240 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
241 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
242 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
243 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
244 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
245 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
246 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
247 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
248 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
249 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
251 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
252 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
253 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
254 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
255 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
256 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
258 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
259 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
260 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
265 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
266 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
267 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
268 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
269 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
270 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
271 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
272 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
273 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
274 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
275 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
276 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
277 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
278 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
279 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
280 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
281 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
282 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
283 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
284 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
285 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
286 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
287 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
288 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
289 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
290 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
291 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
292 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
293 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
294 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
295 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
296 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
297 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
298 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
299 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
300 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
301 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
302 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
303 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
304 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
305 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
306 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
307 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
308 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
309 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
310 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
311 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
312 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
313 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
314 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
315 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
316 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
317 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
318 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
319 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
320 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
321 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
322 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
323 3300059631 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
324 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
325 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
326 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
327 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
328 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
329 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
330 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
331 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
332 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
333 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
334 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
335 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
336 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
337 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
338 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
339 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
340 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
341 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
342 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
343 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
344 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 80.81
Metatranscriptomes 18.12
Isolates 1.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.55
Nodule 0
Rhizoplane 2.13
Rhizosphere 73.77
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055530_10000061 3300003791 Bacteria 95363
2 ARcpr5yngRDRAFT_c001154 3300000043 Bacteria 2973
3 JGI24736J21556_1049509 3300001904 Bacteria 646
4 JGI24741J21665_1000550 3300001915 Bacteria 11442
5 JGI24747J21853_1025909 3300001978 Bacteria 656
6 JGI24740J21852_10001315 3300001979 Bacteria 11295
7 JGI24739J22299_10009493 3300001989 Bacteria 3625
8 JGI24737J22298_10065040 3300001990 Bacteria 1093
9 JGI24735J21928_10146408 3300002067 Bacteria 682
10 JGI24738J21930_10049526 3300002075 Bacteria 856
11 JGI24749J21850_1000218 3300002076 Bacteria 8932
12 JGI24742J22300_10016651 3300002244 Bacteria 1241
13 JGI24751J29686_10000355 3300002459 Bacteria 16147
14 JGI25150J39212_1000213 3300002774 Bacteria 31530
15 JGI25153J46596_10000036 3300003215 Bacteria 182205
16 JGI25153J46596_10013309 3300003215 Bacteria 3484
17 Ga0055525_1000035 3300003759 Bacteria 300887
18 Ga0055542_1000060 3300003762 Bacteria 162275
19 Ga0055529_1000043 3300003763 Bacteria 221704
20 Ga0055526_1000948 3300003771 Bacteria 21478
21 Ga0055524_1000180 3300003775 Bacteria 71495
22 Ga0055536_1021897 3300003781 Bacteria 1923
23 Ga0055530_10009391 3300003791 Bacteria 3765
24 Ga0055530_10020085 3300003791 Bacteria 2006
25 Ga0055540_1001505 3300003792 Bacteria 13844
26 Ga0055531_10000035 3300003794 Bacteria 147414
27 Ga0055531_10018371 3300003794 Bacteria 2890
28 Ga0055531_10019062 3300003794 Bacteria 2799
29 Ga0065165_1027465 3300005262 Bacteria 1855
30 Ga0065165_1044085 3300005262 Bacteria 1306
31 Ga0065165_1061701 3300005262 Bacteria 1025
32 Ga0065707_10093614 3300005295 Bacteria 3603
33 Ga0065707_10142143 3300005295 Bacteria 1758
34 Ga0070658_10005034 3300005327 Bacteria 10754
35 Ga0070658_10814024 3300005327 Bacteria 811
36 Ga0070676_10045421 3300005328 Bacteria 2558
37 Ga0070670_100000005 3300005331 Bacteria 351569
38 Ga0070666_10128940 3300005335 Bacteria 1757
39 Ga0070666_10629280 3300005335 Bacteria 784
40 Ga0070682_101493108 3300005337 Bacteria 581
41 Ga0070661_100016653 3300005344 Bacteria 5200
42 Ga0070668_100446121 3300005347 Bacteria 1111
43 Ga0070669_100000119 3300005353 Bacteria 73001
44 Ga0070669_100071542 3300005353 Bacteria 2566
45 Ga0070675_100190989 3300005354 Bacteria 1774
46 Ga0070671_100199027 3300005355 Bacteria 1699
47 Ga0070674_100171058 3300005356 Bacteria 1656
48 Ga0070659_100668509 3300005366 Bacteria 896
49 Ga0070667_100000302 3300005367 Bacteria 55150
50 Ga0070667_100000407 3300005367 Bacteria 46001
51 Ga0070667_100063320 3300005367 Bacteria 3134
52 Ga0070663_100017496 3300005455 Bacteria 4680
53 Ga0070662_100220336 3300005457 Bacteria 1513
54 Ga0068867_100009668 3300005459 Bacteria 6798
55 Ga0068853_100108553 3300005539 Bacteria 2462
56 Ga0068853_100197717 3300005539 Bacteria 1829
57 Ga0070665_100000186 3300005548 Bacteria 110750
58 Ga0070665_100128007 3300005548 Bacteria 2542
59 Ga0068855_100133578 3300005563 Bacteria 2832
60 Ga0068855_100499520 3300005563 Bacteria 1322
61 Ga0070664_100066966 3300005564 Bacteria 3068
62 Ga0068857_100038434 3300005577 Bacteria 4239
63 Ga0068857_100345353 3300005577 Bacteria 1377
64 Ga0068854_100005131 3300005578 Bacteria 8254
65 Ga0068854_100015788 3300005578 Bacteria 5015
66 Ga0068856_100041069 3300005614 Bacteria 4545
67 Ga0068852_100066428 3300005616 Bacteria 3149
68 Ga0068852_102238016 3300005616 Bacteria 568
69 Ga0068859_100029616 3300005617 Bacteria 5493
70 Ga0068864_100005975 3300005618 Bacteria 9984
71 Ga0068864_100224496 3300005618 Bacteria 1734
72 Ga0068863_100003334 3300005841 Bacteria 15865
73 Ga0068863_100003363 3300005841 Bacteria 15795
74 Ga0068863_100047096 3300005841 Bacteria 4091
75 Ga0068860_100000416 3300005843 Bacteria 55156
76 Ga0068860_100991648 3300005843 Bacteria 858
77 Ga0068862_100000011 3300005844 Bacteria 270105
78 Ga0075364_10679039 3300006051 Bacteria 703
79 Ga0075362_10211473 3300006177 Bacteria 946
80 Ga0097621_100097792 3300006237 Bacteria 2465
81 Ga0068871_100330633 3300006358 Bacteria 1344
82 Ga0097620_100029618 3300006931 Bacteria 5493
83 Ga0105240_10089799 3300009093 Bacteria 3757
84 Ga0105247_10315171 3300009101 Bacteria 1090
85 Ga0105243_10000122 3300009148 Bacteria 89527
86 Ga0105241_10004088 3300009174 Bacteria 10782
87 Ga0105248_10000921 3300009177 Bacteria 32763
88 Ga0105237_10045883 3300009545 Bacteria 4397
89 Ga0105238_10034108 3300009551 Bacteria 5179
90 Ga0105238_10137947 3300009551 Bacteria 2417
91 Ga0105249_10065162 3300009553 Bacteria 3351
92 Ga0105239_10061378 3300010375 Bacteria 4125
93 Ga0105246_10017446 3300011119 Bacteria 4562
94 Ga0157326_1000156 3300012513 Bacteria 7474
95 Ga0157373_10069160 3300013100 Bacteria 2496
96 Ga0157373_10299837 3300013100 Bacteria 1141
97 Ga0157371_10000030 3300013102 Bacteria 241585
98 Ga0157370_10053275 3300013104 Bacteria 3859
99 Ga0157369_10040121 3300013105 Bacteria 5112
100 Ga0157374_10274042 3300013296 Bacteria 1664
101 Ga0157374_10598079 3300013296 Bacteria 1113
102 Ga0157378_10036642 3300013297 Bacteria 4341
103 Ga0157378_10240643 3300013297 Bacteria 1728
104 Ga0157372_10284634 3300013307 Bacteria 1922
105 Ga0157372_10461882 3300013307 Bacteria 1480
106 Ga0157375_10267416 3300013308 Bacteria 1872
107 Ga0163163_10019186 3300014325 Bacteria 6417
108 Ga0157380_10001430 3300014326 Bacteria 15629
109 Ga0182008_10396499 3300014497 Bacteria 740
110 Ga0163161_10038816 3300017792 Bacteria 3416
111 Ga0197907_10167724 3300020069 Bacteria 925
112 Ga0206356_10745082 3300020070 Bacteria 1178
113 Ga0206349_1685457 3300020075 Bacteria 1804
114 Ga0206355_1265416 3300020076 Bacteria 838
115 Ga0206352_10765077 3300020078 Bacteria 2645
116 Ga0206350_10568922 3300020080 Bacteria 1553
117 Ga0209674_117634 3300025226 Bacteria 577
118 Ga0209563_100047 3300025230 Bacteria 366620
119 Ga0207425_1000037 3300025245 Bacteria 224645
120 Ga0207425_1009226 3300025245 Bacteria 2467
121 Ga0209646_1006345 3300025246 Bacteria 1991
122 Ga0209677_105413 3300025253 Bacteria 3334
123 Ga0209148_1000017 3300025254 Bacteria 787064
124 Ga0209129_1000363 3300025258 Bacteria 37614
125 Ga0209233_1029790 3300025261 Bacteria 1292
126 Ga0209565_1000012 3300025263 Bacteria 606500
127 Ga0209565_1000427 3300025263 Bacteria 34040
128 Ga0209455_1000005 3300025272 Bacteria 1416756
129 Ga0209673_1005653 3300025273 Bacteria 6241
130 Ga0209673_1008360 3300025273 Bacteria 4615
131 Ga0209675_1006520 3300025291 Bacteria 4660
132 Ga0209676_1004865 3300025292 Bacteria 7270
133 Ga0209025_1000117 3300025294 Bacteria 215073
134 Ga0209564_1001191 3300025295 Bacteria 29869
135 Ga0209564_1065550 3300025295 Bacteria 785
136 Ga0209758_1000035 3300025297 Bacteria 448190
137 Ga0209758_1000103 3300025297 Bacteria 223968
138 Ga0209758_1002916 3300025297 Bacteria 16491
139 Ga0209050_1000001 3300025298 Bacteria 3563507
140 Ga0209050_1000014 3300025298 Bacteria 774327
141 Ga0209050_1002236 3300025298 Bacteria 17279
142 Ga0209256_1000012 3300025299 Bacteria 790371
143 Ga0207426_1011098 3300025302 Bacteria 3455
144 Ga0209051_1001637 3300025303 Bacteria 18170
145 Ga0209257_1000019 3300025304 Bacteria 774261
146 Ga0209257_1001431 3300025304 Bacteria 28304
147 Ga0209257_1006564 3300025304 Bacteria 7420
148 Ga0209257_1012112 3300025304 Bacteria 4043
149 Ga0209257_1093054 3300025304 Bacteria 749
150 Ga0207697_10108222 3300025315 Bacteria 1189
151 Ga0207656_10004629 3300025321 Bacteria 4820
152 Ga0207682_10087972 3300025893 Bacteria 1342
153 Ga0207688_10116031 3300025901 Bacteria 1558
154 Ga0207680_10035622 3300025903 Bacteria 2859
155 Ga0207680_10240402 3300025903 Bacteria 1248
156 Ga0207680_10483515 3300025903 Bacteria 881
157 Ga0207647_10004031 3300025904 Bacteria 10951
158 Ga0207645_10021418 3300025907 Bacteria 4215
159 Ga0207705_10000163 3300025909 Bacteria 71674
160 Ga0207654_10000307 3300025911 Bacteria 29685
161 Ga0207695_10004528 3300025913 Bacteria 18917
162 Ga0207671_10011997 3300025914 Bacteria 7003
163 Ga0207657_10009441 3300025919 Bacteria 9801
164 Ga0207649_10000199 3300025920 Bacteria 49941
165 Ga0207681_10000001 3300025923 Bacteria 1105841
166 Ga0207681_10341446 3300025923 Bacteria 1196
167 Ga0207694_10004278 3300025924 Bacteria 11176
168 Ga0207694_10381153 3300025924 Bacteria 1170
169 Ga0207650_10000018 3300025925 Bacteria 352120
170 Ga0207690_10003676 3300025932 Bacteria 9129
171 Ga0207706_10104272 3300025933 Bacteria 2495
172 Ga0207709_10000083 3300025935 Bacteria 163025
173 Ga0207669_10017230 3300025937 Bacteria 3698
174 Ga0207691_10999854 3300025940 Bacteria 698
175 Ga0207711_10016962 3300025941 Bacteria 6049
176 Ga0207661_10366009 3300025944 Bacteria 1303
177 Ga0207679_10166251 3300025945 Bacteria 1811
178 Ga0207667_10000004 3300025949 Bacteria 737718
179 Ga0207651_10211195 3300025960 Bacteria 1562
180 Ga0207712_10033557 3300025961 Bacteria 3471
181 Ga0207668_11730599 3300025972 Bacteria 564
182 Ga0207640_10012485 3300025981 Bacteria 4839
183 Ga0207640_10023981 3300025981 Bacteria 3674
184 Ga0207658_10000263 3300025986 Bacteria 55175
185 Ga0207658_10001469 3300025986 Bacteria 18347
186 Ga0207639_10007474 3300026041 Bacteria 7454
187 Ga0207678_10002745 3300026067 Bacteria 15936
188 Ga0207702_10002753 3300026078 Bacteria 16449
189 Ga0207641_10000339 3300026088 Bacteria 56902
190 Ga0207641_10010094 3300026088 Bacteria 7764
191 Ga0207641_10103806 3300026088 Bacteria 2508
192 Ga0207648_10040975 3300026089 Bacteria 4068
193 Ga0207676_10000004 3300026095 Bacteria 725417
194 Ga0207676_10004367 3300026095 Bacteria 10004
195 Ga0207674_10006416 3300026116 Bacteria 13835
196 Ga0207674_10051662 3300026116 Bacteria 4194
197 Ga0207674_10301889 3300026116 Bacteria 1550
198 Ga0207675_100001128 3300026118 Bacteria 26498
199 Ga0207683_10005090 3300026121 Bacteria 11281
200 Ga0207698_10003597 3300026142 Bacteria 9356
201 Ga0207698_11439174 3300026142 Bacteria 704
202 Ga0268266_10000002 3300028379 Bacteria 3059047
203 Ga0268266_10110224 3300028379 Bacteria 2438
204 Ga0268266_10435240 3300028379 Bacteria 1245
205 Ga0268265_10000002 3300028380 Bacteria 1035381
206 Ga0268264_10000184 3300028381 Bacteria 131402
207 Ga0268264_11133789 3300028381 Bacteria 791
208 Ga0307517_10156506 3300028786 Bacteria 1544
209 Ga0314311_1249570 3300030733 Bacteria 2816
210 Ga0307513_10005593 3300031456 Bacteria 16577
211 Ga0307408_100380827 3300031548 Bacteria 1206
212 Ga0307408_100597531 3300031548 Bacteria 980
213 Ga0307405_10578634 3300031731 Bacteria 913
214 Ga0307413_10003793 3300031824 Bacteria 6441
215 Ga0307410_10082320 3300031852 Bacteria 2264
216 Ga0307412_10006933 3300031911 Bacteria 6428
217 Ga0307412_10018009 3300031911 Bacteria 4240
218 Ga0307409_100009926 3300031995 Bacteria 5880
219 Ga0307409_100432078 3300031995 Bacteria 1266
220 Ga0307416_100096005 3300032002 Bacteria 2562
221 Ga0307414_10046104 3300032004 Bacteria 2989
222 Ga0307411_10107448 3300032005 Bacteria 1988
223 Ga0307411_10741212 3300032005 Bacteria 860
224 Ga0307510_10068030 3300033180 Bacteria 3579
225 Ga0373927_0081358 3300035695 Bacteria 2099
226 Ga0395899_0361068 3300037312 Bacteria 969
227 Ga0395900_0502948 3300037418 Bacteria 1162
228 Ga0395900_0878197 3300037418 Bacteria 821
229 Ga0395901_0088914 3300038443 Bacteria 3232
230 Ga0395901_0124250 3300038443 Bacteria 2712
231 Ga0237819_00631 3300038705 Bacteria 11472
232 Ga0237816_01412 3300039145 Bacteria 1949
233 Ga0436365_1218500 3300039437 Bacteria 1490
234 Ga0436365_1519106 3300039437 Bacteria 586
235 Ga0439436_0019891 3300041404 Bacteria 2001
236 Ga0439439_0105652 3300041406 Bacteria 777
237 Ga0439461_0000061 3300041410 Bacteria 13673
238 Ga0439461_0009141 3300041410 Bacteria 1792
239 Ga0439466_0071613 3300041411 Bacteria 1103
240 Ga0439465_0001448 3300041413 Bacteria 7689
241 Ga0439465_0003318 3300041413 Bacteria 5257
242 Ga0451787_460864 3300041441 Bacteria 528
243 Ga0451802_1906611 3300041460 Bacteria 763
244 Ga0451839_1000255 3300041496 Bacteria 666
245 Ga0439431_0000299 3300041997 Bacteria 10198
246 Ga0439431_0019915 3300041997 Bacteria 1598
247 Ga0439445_0001302 3300042004 Bacteria 5395
248 Ga0439432_000540 3300042006 Bacteria 14094
249 Ga0439449_0232938 3300042007 Bacteria 691
250 Ga0439452_023783 3300042010 Bacteria 1573
251 Ga0439452_030982 3300042010 Bacteria 1315
252 Ga0439457_005956 3300042014 Bacteria 3014
253 Ga0439462_0001007 3300042015 Bacteria 6033
254 Ga0439462_0001333 3300042015 Bacteria 5447
255 Ga0450919_028886 3300042121 Bacteria 633
256 Ga0450923_090818 3300042125 Bacteria 696
257 Ga0450890_042389 3300042127 Bacteria 677
258 Ga0450894_011934 3300042131 Bacteria 1133
259 Ga0439446_0153879 3300042156 Bacteria 757
260 Ga0439434_0002887 3300042435 Bacteria 5014
261 Ga0466963_0642264 3300044694 Bacteria 749
262 Ga0495629_1044979 3300046459 Bacteria 530
263 Ga0495638_0154424 3300046460 Bacteria 1329
264 Ga0495650_0000373 3300046471 Bacteria 78223
265 Ga0495650_0044272 3300046471 Bacteria 1883
266 Ga0495584_0050366 3300046491 Bacteria 2097
267 Ga0495585_0066154 3300046492 Bacteria 1979
268 Ga0495596_0006912 3300046500 Bacteria 5170
269 Ga0495607_0055288 3300046501 Bacteria 2284
270 Ga0495583_0000038 3300046506 Bacteria 243395
271 Ga0495583_0002738 3300046506 Bacteria 14593
272 Ga0495583_0026816 3300046506 Bacteria 2850
273 Ga0495606_0000731 3300046507 Bacteria 50823
274 Ga0495631_0041698 3300046518 Bacteria 2030
275 Ga0495631_0088121 3300046518 Bacteria 1336
276 Ga0495637_0129466 3300046520 Bacteria 965
277 Ga0495643_0035928 3300046522 Bacteria 2725
278 Ga0495643_0089797 3300046522 Bacteria 1586
279 Ga0495643_0178811 3300046522 Bacteria 1032
280 Ga0495648_0000115 3300046524 Bacteria 98656
281 Ga0495648_0085264 3300046524 Bacteria 1785
282 Ga0495663_0010880 3300046525 Bacteria 2531
283 Ga0495663_0127921 3300046525 Bacteria 855
284 Ga0495597_0150695 3300046542 Bacteria 954
285 Ga0495622_0020692 3300046557 Bacteria 3063
286 Ga0495633_0004785 3300046558 Bacteria 8487
287 Ga0495633_0020508 3300046558 Bacteria 3323
288 Ga0495668_0000007 3300046616 Bacteria 552902
289 Ga0495668_0016805 3300046616 Bacteria 4251
290 Ga0495668_0170806 3300046616 Bacteria 1191
291 Ga0495668_0664223 3300046616 Bacteria 576
292 Ga0495611_0038658 3300046648 Bacteria 2123
293 Ga0495625_0000959 3300046660 Bacteria 38428
294 Ga0495625_0072471 3300046660 Bacteria 2415
295 Ga0495625_0177241 3300046660 Bacteria 1420
296 Ga0495625_0444086 3300046660 Bacteria 802
297 Ga0495661_0029182 3300046665 Bacteria 3524
298 Ga0495669_0000268 3300046684 Bacteria 29882
299 Ga0495670_0000066 3300046691 Bacteria 46500
300 Ga0495670_0026006 3300046691 Bacteria 2897
301 Ga0495670_0097425 3300046691 Bacteria 1511
302 Ga0495649_0152324 3300046694 Bacteria 1214
303 Ga0495649_0517941 3300046694 Bacteria 592
304 Ga0495589_0315567 3300046794 Bacteria 723
305 Ga0495600_0021313 3300046809 Bacteria 4148
306 Ga0495660_0079263 3300046810 Bacteria 1725
307 Ga0495660_0509617 3300046810 Bacteria 513
308 Ga0495687_000055 3300047443 Bacteria 194477
309 Ga0495687_005766 3300047443 Bacteria 7774
310 Ga0495677_0030544 3300047445 Bacteria 1961
311 Ga0495677_0141770 3300047445 Bacteria 923
312 Ga0495673_0098815 3300047469 Bacteria 1183
313 Ga0495681_0016889 3300047470 Bacteria 4071
314 Ga0495681_0107982 3300047470 Bacteria 1208
315 Ga0495686_0001594 3300047472 Bacteria 23956
316 Ga0495686_0018056 3300047472 Bacteria 4741
317 Ga0495686_0258893 3300047472 Bacteria 975
318 Ga0496101_0265122 3300048904 Bacteria 1340
319 Ga0496102_0002822 3300048905 Bacteria 14787
320 Ga0496103_0000151 3300048906 Bacteria 72539
321 Ga0496104_0076023 3300048907 Bacteria 3198
322 Ga0496105_0000735 3300048908 Bacteria 22209
323 Ga0496114_0005701 3300048917 Bacteria 9766
324 Ga0496115_0000018 3300048918 Bacteria 182523
325 Ga0496115_0004458 3300048918 Bacteria 10148
326 Ga0496116_0003758 3300048919 Bacteria 14845
327 Ga0496117_0000408 3300048920 Bacteria 72369
328 Ga0496118_0000600 3300048921 Bacteria 59661
329 Ga0496120_0080688 3300048923 Bacteria 1762
330 Ga0496121_0012946 3300048924 Bacteria 9018
331 Ga0496122_0021132 3300048925 Bacteria 5841
332 Ga0496123_0009676 3300048926 Bacteria 8644
333 Ga0496124_0000099 3300048927 Bacteria 182007
334 Ga0496125_0005013 3300048928 Bacteria 14956
335 Ga0496125_0048028 3300048928 Bacteria 3563
336 Ga0496125_0109775 3300048928 Bacteria 2002
337 Ga0496125_0301506 3300048928 Bacteria 981
338 Ga0496126_0000507 3300048929 Bacteria 76510
339 Ga0501306_000806 3300049127 Bacteria 2641
340 Ga0501309_005223 3300049129 Bacteria 1540
341 Ga0501305_005145 3300049161 Bacteria 1571
342 Ga0501307_000547 3300049162 Bacteria 2645
343 Ga0501290_071635 3300049513 Bacteria 576
344 Ga0501311_015155 3300049527 Bacteria 992
345 Ga0501312_005203 3300049528 Bacteria 1570
346 Ga0501313_003798 3300049529 Bacteria 1523
347 Ga0501314_002293 3300049530 Bacteria 1467
348 Ga0501315_004245 3300049531 Bacteria 1488
349 Ga0501320_000324 3300049536 Bacteria 2645
350 Ga0501320_024753 3300049536 Bacteria 717
351 Ga0501321_008250 3300049537 Bacteria 1101
352 Ga0501322_000778 3300049538 Bacteria 1608
353 Ga0501323_049428 3300049539 Bacteria 635
354 Ga0501325_002853 3300049541 Bacteria 1218
355 Ga0501326_05747 3300049542 Bacteria 681
356 Ga0501337_010655 3300049553 Bacteria 672
357 Ga0501033_0599907 3300049570 Bacteria 755
358 Ga0501034_1276047 3300049571 Bacteria 612
359 Ga0501036_0821632 3300049572 Bacteria 765
360 Ga0501202_069852 3300049652 Bacteria 808
361 Ga0501208_005097 3300049655 Bacteria 1594
362 Ga0501223_037177 3300049663 Bacteria 946
363 Ga0501224_023560 3300049664 Bacteria 919
364 Ga0501249_002715 3300049679 Bacteria 3565
365 Ga0501259_035837 3300049688 Bacteria 957
366 Ga0501241_006223 3300049758 Bacteria 2201
367 Ga0501241_024334 3300049758 Bacteria 1124
368 Ga0501204_005385 3300049850 Bacteria 1401
369 nmdc:mga03683_93826_c1 3300050489 Bacteria 1311
370 nmdc:mga0k408_629678_c1 3300050493 Bacteria 632
371 nmdc:mga07m45_466029_c1 3300050496 Bacteria 732
372 Ga0500643_000937 3300053087 Bacteria 18234
373 Ga0500643_002782 3300053087 Bacteria 8747
374 Ga0500643_021751 3300053087 Bacteria 2075
375 Ga0500643_026996 3300053087 Bacteria 1790
376 Ga0500647_0138407 3300053091 Bacteria 1144
377 Ga0500583_0358324 3300053092 Bacteria 706
378 Ga0500651_0041230 3300053093 Bacteria 2910
379 Ga0500566_0001914 3300053094 Bacteria 12257
380 Ga0500566_0070078 3300053094 Bacteria 1969
381 Ga0500641_0104009 3300053096 Bacteria 1219
382 Ga0500555_014599 3300053103 Bacteria 2264
383 Ga0500562_064187 3300053108 Bacteria 988
384 Ga0500569_137670 3300053109 Bacteria 820
385 Ga0500595_001198 3300053119 Bacteria 14324
386 Ga0500618_014395 3300053125 Bacteria 2020
387 Ga0500642_0000116 3300053130 Bacteria 37194
388 Ga0500642_0061340 3300053130 Bacteria 1689
389 Ga0500652_104707 3300053131 Bacteria 1183
390 Ga0500655_000092 3300053133 Bacteria 23519
391 Ga0500568_0005260 3300053139 Bacteria 6729
392 Ga0500590_036304 3300053148 Bacteria 2547
393 Ga0500604_0020927 3300053151 Bacteria 1846
394 Ga0500619_002874 3300053154 Bacteria 3410
395 Ga0500622_0088270 3300053156 Bacteria 1543
396 Ga0500627_0146919 3300053158 Bacteria 1065
397 Ga0500636_0062764 3300053177 Bacteria 2166
398 Ga0500636_0139692 3300053177 Bacteria 1342
399 Ga0500570_006787 3300053724 Bacteria 6234
400 Ga0500645_000009 3300053730 Bacteria 206177
401 Ga0500645_022066 3300053730 Bacteria 1962
402 Ga0500596_004827 3300053735 Bacteria 2436
403 Ga0587084_001094 3300059477 Bacteria 2462
404 Ga0587084_002989 3300059477 Bacteria 1818
405 Ga0587093_001326 3300059478 Bacteria 2059
406 Ga0587066_001724 3300059490 Bacteria 2265
407 Ga0587066_029494 3300059490 Bacteria 968
408 Ga0587066_059023 3300059490 Bacteria 778
409 Ga0587070_002153 3300059491 Bacteria 2184
410 Ga0587073_0003635 3300059492 Bacteria 2135
411 Ga0587073_0017525 3300059492 Bacteria 1324
412 Ga0587077_002345 3300059493 Bacteria 2229
413 Ga0587077_048166 3300059493 Bacteria 882
414 Ga0587080_002193 3300059503 Bacteria 2263
415 Ga0587082_002159 3300059504 Bacteria 2175
416 Ga0587083_0002822 3300059505 Bacteria 2219
417 Ga0587083_0024694 3300059505 Bacteria 1146
418 Ga0587085_002116 3300059506 Bacteria 1985
419 Ga0587086_001838 3300059507 Bacteria 1910
420 Ga0587088_000818 3300059508 Bacteria 2900
421 Ga0587088_043178 3300059508 Bacteria 857
422 Ga0587088_058986 3300059508 Bacteria 773
423 Ga0587089_001504 3300059509 Bacteria 2189
424 Ga0587090_001838 3300059510 Bacteria 2223
425 Ga0587090_002440 3300059510 Bacteria 2049
426 Ga0587091_003541 3300059511 Bacteria 1975
427 Ga0587091_009696 3300059511 Bacteria 1457
428 Ga0587092_001822 3300059512 Bacteria 2169
429 Ga0587094_010322 3300059513 Bacteria 1210
430 Ga0587094_018163 3300059513 Bacteria 998
431 Ga0587094_114253 3300059513 Bacteria 534
432 Ga0587095_002741 3300059514 Bacteria 1203
433 Ga0587106_001065 3300059605 Bacteria 2296
434 Ga0587106_001991 3300059605 Bacteria 1933
435 Ga0587099_001003 3300059622 Bacteria 1891
436 Ga0587101_001092 3300059623 Bacteria 2218
437 Ga0587109_022741 3300059624 Bacteria 1131
438 Ga0587115_002052 3300059626 Bacteria 1948
439 Ga0587128_001376 3300059630 Bacteria 2273
440 Ga0587130_005080 3300059631 Bacteria 1168
441 Ga0587062_001932 3300059639 Bacteria 1896
442 Ga0587062_035199 3300059639 Bacteria 787
443 Ga0587067_020822 3300059640 Bacteria 1125
444 Ga0587067_049655 3300059640 Bacteria 844
445 Ga0587068_002620 3300059641 Bacteria 2207
446 Ga0587068_011559 3300059641 Bacteria 1335
447 Ga0587069_001380 3300059642 Bacteria 2212
448 Ga0587069_003533 3300059642 Bacteria 1695
449 Ga0587072_003840 3300059643 Bacteria 2140
450 Ga0587075_007355 3300059644 Bacteria 1380
451 Ga0587076_011738 3300059645 Bacteria 1294
452 Ga0587076_020750 3300059645 Bacteria 1081
453 Ga0587078_001344 3300059646 Bacteria 2165
454 Ga0587079_002709 3300059647 Bacteria 2214
455 Ga0587079_013025 3300059647 Bacteria 1370
456 Ga0587100_003121 3300059648 Bacteria 1115
457 Ga0587102_000406 3300059649 Bacteria 2402
458 Ga0587107_010570 3300059652 Bacteria 1114
459 Ga0587110_005747 3300059654 Bacteria 1127
460 Ga0587119_001885 3300059658 Bacteria 1809
461 Ga0587119_007430 3300059658 Bacteria 1181
462 Ga0587071_003565 3300060344 Bacteria 2245
463 Ga0587111_0003541 3300060346 Bacteria 2233
464 Ga0587111_0006016 3300060346 Bacteria 1903
465 2585260510 2582581305 Bacteria 4895574
466 2644037150 2643221605 Bacteria 4772303
467 2644043602 2643221606 Bacteria 5588032
468 2644126981 2643221622 Bacteria 4212502
469 2644393761 2643221671 Bacteria 5496681
470 Ga0055530_10000061
471 ARcpr5yngRDRAFT_c001154
472 JGI24736J21556_1049509
473 JGI24741J21665_1000550
474 JGI24747J21853_1025909
475 JGI24740J21852_10001315
476 JGI24739J22299_10009493
477 JGI24737J22298_10065040
478 JGI24735J21928_10146408
479 JGI24738J21930_10049526
480 JGI24749J21850_1000218
481 JGI24742J22300_10016651
482 JGI24751J29686_10000355
483 JGI25150J39212_1000213
484 JGI25153J46596_10000036
485 JGI25153J46596_10013309
486 Ga0055525_1000035
487 Ga0055542_1000060
488 Ga0055529_1000043
489 Ga0055526_1000948
490 Ga0055524_1000180
491 Ga0055536_1021897
492 Ga0055530_10009391
493 Ga0055530_10020085
494 Ga0055540_1001505
495 Ga0055531_10000035
496 Ga0055531_10018371
497 Ga0055531_10019062
498 Ga0065165_1027465
499 Ga0065165_1044085
500 Ga0065165_1061701
501 Ga0065707_10093614
502 Ga0065707_10142143
503 Ga0070658_10005034
504 Ga0070658_10814024
505 Ga0070676_10045421
506 Ga0070670_100000005
507 Ga0070666_10128940
508 Ga0070666_10629280
509 Ga0070682_101493108
510 Ga0070661_100016653
511 Ga0070668_100446121
512 Ga0070669_100000119
513 Ga0070669_100071542
514 Ga0070675_100190989
515 Ga0070671_100199027
516 Ga0070674_100171058
517 Ga0070659_100668509
518 Ga0070667_100000302
519 Ga0070667_100000407
520 Ga0070667_100063320
521 Ga0070663_100017496
522 Ga0070662_100220336
523 Ga0068867_100009668
524 Ga0068853_100108553
525 Ga0068853_100197717
526 Ga0070665_100000186
527 Ga0070665_100128007
528 Ga0068855_100133578
529 Ga0068855_100499520
530 Ga0070664_100066966
531 Ga0068857_100038434
532 Ga0068857_100345353
533 Ga0068854_100005131
534 Ga0068854_100015788
535 Ga0068856_100041069
536 Ga0068852_100066428
537 Ga0068852_102238016
538 Ga0068859_100029616
539 Ga0068864_100005975
540 Ga0068864_100224496
541 Ga0068863_100003334
542 Ga0068863_100003363
543 Ga0068863_100047096
544 Ga0068860_100000416
545 Ga0068860_100991648
546 Ga0068862_100000011
547 Ga0075364_10679039
548 Ga0075362_10211473
549 Ga0097621_100097792
550 Ga0068871_100330633
551 Ga0097620_100029618
552 Ga0105240_10089799
553 Ga0105247_10315171
554 Ga0105243_10000122
555 Ga0105241_10004088
556 Ga0105248_10000921
557 Ga0105237_10045883
558 Ga0105238_10034108
559 Ga0105238_10137947
560 Ga0105249_10065162
561 Ga0105239_10061378
562 Ga0105246_10017446
563 Ga0157326_1000156
564 Ga0157373_10069160
565 Ga0157373_10299837
566 Ga0157371_10000030
567 Ga0157370_10053275
568 Ga0157369_10040121
569 Ga0157374_10274042
570 Ga0157374_10598079
571 Ga0157378_10036642
572 Ga0157378_10240643
573 Ga0157372_10284634
574 Ga0157372_10461882
575 Ga0157375_10267416
576 Ga0163163_10019186
577 Ga0157380_10001430
578 Ga0182008_10396499
579 Ga0163161_10038816
580 Ga0197907_10167724
581 Ga0206356_10745082
582 Ga0206349_1685457
583 Ga0206355_1265416
584 Ga0206352_10765077
585 Ga0206350_10568922
586 Ga0209674_117634
587 Ga0209563_100047
588 Ga0207425_1000037
589 Ga0207425_1009226
590 Ga0209646_1006345
591 Ga0209677_105413
592 Ga0209148_1000017
593 Ga0209129_1000363
594 Ga0209233_1029790
595 Ga0209565_1000012
596 Ga0209565_1000427
597 Ga0209455_1000005
598 Ga0209673_1005653
599 Ga0209673_1008360
600 Ga0209675_1006520
601 Ga0209676_1004865
602 Ga0209025_1000117
603 Ga0209564_1001191
604 Ga0209564_1065550
605 Ga0209758_1000035
606 Ga0209758_1000103
607 Ga0209758_1002916
608 Ga0209050_1000001
609 Ga0209050_1000014
610 Ga0209050_1002236
611 Ga0209256_1000012
612 Ga0207426_1011098
613 Ga0209051_1001637
614 Ga0209257_1000019
615 Ga0209257_1001431
616 Ga0209257_1006564
617 Ga0209257_1012112
618 Ga0209257_1093054
619 Ga0207697_10108222
620 Ga0207656_10004629
621 Ga0207682_10087972
622 Ga0207688_10116031
623 Ga0207680_10035622
624 Ga0207680_10240402
625 Ga0207680_10483515
626 Ga0207647_10004031
627 Ga0207645_10021418
628 Ga0207705_10000163
629 Ga0207654_10000307
630 Ga0207695_10004528
631 Ga0207671_10011997
632 Ga0207657_10009441
633 Ga0207649_10000199
634 Ga0207681_10000001
635 Ga0207681_10341446
636 Ga0207694_10004278
637 Ga0207694_10381153
638 Ga0207650_10000018
639 Ga0207690_10003676
640 Ga0207706_10104272
641 Ga0207709_10000083
642 Ga0207669_10017230
643 Ga0207691_10999854
644 Ga0207711_10016962
645 Ga0207661_10366009
646 Ga0207679_10166251
647 Ga0207667_10000004
648 Ga0207651_10211195
649 Ga0207712_10033557
650 Ga0207668_11730599
651 Ga0207640_10012485
652 Ga0207640_10023981
653 Ga0207658_10000263
654 Ga0207658_10001469
655 Ga0207639_10007474
656 Ga0207678_10002745
657 Ga0207702_10002753
658 Ga0207641_10000339
659 Ga0207641_10010094
660 Ga0207641_10103806
661 Ga0207648_10040975
662 Ga0207676_10000004
663 Ga0207676_10004367
664 Ga0207674_10006416
665 Ga0207674_10051662
666 Ga0207674_10301889
667 Ga0207675_100001128
668 Ga0207683_10005090
669 Ga0207698_10003597
670 Ga0207698_11439174
671 Ga0268266_10000002
672 Ga0268266_10110224
673 Ga0268266_10435240
674 Ga0268265_10000002
675 Ga0268264_10000184
676 Ga0268264_11133789
677 Ga0307517_10156506
678 Ga0314311_1249570
679 Ga0307513_10005593
680 Ga0307408_100380827
681 Ga0307408_100597531
682 Ga0307405_10578634
683 Ga0307413_10003793
684 Ga0307410_10082320
685 Ga0307412_10006933
686 Ga0307412_10018009
687 Ga0307409_100009926
688 Ga0307409_100432078
689 Ga0307416_100096005
690 Ga0307414_10046104
691 Ga0307411_10107448
692 Ga0307411_10741212
693 Ga0307510_10068030
694 Ga0373927_0081358
695 Ga0395899_0361068
696 Ga0395900_0502948
697 Ga0395900_0878197
698 Ga0395901_0088914
699 Ga0395901_0124250
700 Ga0237819_00631
701 Ga0237816_01412
702 Ga0436365_1218500
703 Ga0436365_1519106
704 Ga0439436_0019891
705 Ga0439439_0105652
706 Ga0439461_0000061
707 Ga0439461_0009141
708 Ga0439466_0071613
709 Ga0439465_0001448
710 Ga0439465_0003318
711 Ga0451787_460864
712 Ga0451802_1906611
713 Ga0451839_1000255
714 Ga0439431_0000299
715 Ga0439431_0019915
716 Ga0439445_0001302
717 Ga0439432_000540
718 Ga0439449_0232938
719 Ga0439452_023783
720 Ga0439452_030982
721 Ga0439457_005956
722 Ga0439462_0001007
723 Ga0439462_0001333
724 Ga0450919_028886
725 Ga0450923_090818
726 Ga0450890_042389
727 Ga0450894_011934
728 Ga0439446_0153879
729 Ga0439434_0002887
730 Ga0466963_0642264
731 Ga0495629_1044979
732 Ga0495638_0154424
733 Ga0495650_0000373
734 Ga0495650_0044272
735 Ga0495584_0050366
736 Ga0495585_0066154
737 Ga0495596_0006912
738 Ga0495607_0055288
739 Ga0495583_0000038
740 Ga0495583_0002738
741 Ga0495583_0026816
742 Ga0495606_0000731
743 Ga0495631_0041698
744 Ga0495631_0088121
745 Ga0495637_0129466
746 Ga0495643_0035928
747 Ga0495643_0089797
748 Ga0495643_0178811
749 Ga0495648_0000115
750 Ga0495648_0085264
751 Ga0495663_0010880
752 Ga0495663_0127921
753 Ga0495597_0150695
754 Ga0495622_0020692
755 Ga0495633_0004785
756 Ga0495633_0020508
757 Ga0495668_0000007
758 Ga0495668_0016805
759 Ga0495668_0170806
760 Ga0495668_0664223
761 Ga0495611_0038658
762 Ga0495625_0000959
763 Ga0495625_0072471
764 Ga0495625_0177241
765 Ga0495625_0444086
766 Ga0495661_0029182
767 Ga0495669_0000268
768 Ga0495670_0000066
769 Ga0495670_0026006
770 Ga0495670_0097425
771 Ga0495649_0152324
772 Ga0495649_0517941
773 Ga0495589_0315567
774 Ga0495600_0021313
775 Ga0495660_0079263
776 Ga0495660_0509617
777 Ga0495687_000055
778 Ga0495687_005766
779 Ga0495677_0030544
780 Ga0495677_0141770
781 Ga0495673_0098815
782 Ga0495681_0016889
783 Ga0495681_0107982
784 Ga0495686_0001594
785 Ga0495686_0018056
786 Ga0495686_0258893
787 Ga0496101_0265122
788 Ga0496102_0002822
789 Ga0496103_0000151
790 Ga0496104_0076023
791 Ga0496105_0000735
792 Ga0496114_0005701
793 Ga0496115_0000018
794 Ga0496115_0004458
795 Ga0496116_0003758
796 Ga0496117_0000408
797 Ga0496118_0000600
798 Ga0496120_0080688
799 Ga0496121_0012946
800 Ga0496122_0021132
801 Ga0496123_0009676
802 Ga0496124_0000099
803 Ga0496125_0005013
804 Ga0496125_0048028
805 Ga0496125_0109775
806 Ga0496125_0301506
807 Ga0496126_0000507
808 Ga0501306_000806
809 Ga0501309_005223
810 Ga0501305_005145
811 Ga0501307_000547
812 Ga0501290_071635
813 Ga0501311_015155
814 Ga0501312_005203
815 Ga0501313_003798
816 Ga0501314_002293
817 Ga0501315_004245
818 Ga0501320_000324
819 Ga0501320_024753
820 Ga0501321_008250
821 Ga0501322_000778
822 Ga0501323_049428
823 Ga0501325_002853
824 Ga0501326_05747
825 Ga0501337_010655
826 Ga0501033_0599907
827 Ga0501034_1276047
828 Ga0501036_0821632
829 Ga0501202_069852
830 Ga0501208_005097
831 Ga0501223_037177
832 Ga0501224_023560
833 Ga0501249_002715
834 Ga0501259_035837
835 Ga0501241_006223
836 Ga0501241_024334
837 Ga0501204_005385
838 nmdc:mga03683_93826_c1
839 nmdc:mga0k408_629678_c1
840 nmdc:mga07m45_466029_c1
841 Ga0500643_000937
842 Ga0500643_002782
843 Ga0500643_021751
844 Ga0500643_026996
845 Ga0500647_0138407
846 Ga0500583_0358324
847 Ga0500651_0041230
848 Ga0500566_0001914
849 Ga0500566_0070078
850 Ga0500641_0104009
851 Ga0500555_014599
852 Ga0500562_064187
853 Ga0500569_137670
854 Ga0500595_001198
855 Ga0500618_014395
856 Ga0500642_0000116
857 Ga0500642_0061340
858 Ga0500652_104707
859 Ga0500655_000092
860 Ga0500568_0005260
861 Ga0500590_036304
862 Ga0500604_0020927
863 Ga0500619_002874
864 Ga0500622_0088270
865 Ga0500627_0146919
866 Ga0500636_0062764
867 Ga0500636_0139692
868 Ga0500570_006787
869 Ga0500645_000009
870 Ga0500645_022066
871 Ga0500596_004827
872 Ga0587084_001094
873 Ga0587084_002989
874 Ga0587093_001326
875 Ga0587066_001724
876 Ga0587066_029494
877 Ga0587066_059023
878 Ga0587070_002153
879 Ga0587073_0003635
880 Ga0587073_0017525
881 Ga0587077_002345
882 Ga0587077_048166
883 Ga0587080_002193
884 Ga0587082_002159
885 Ga0587083_0002822
886 Ga0587083_0024694
887 Ga0587085_002116
888 Ga0587086_001838
889 Ga0587088_000818
890 Ga0587088_043178
891 Ga0587088_058986
892 Ga0587089_001504
893 Ga0587090_001838
894 Ga0587090_002440
895 Ga0587091_003541
896 Ga0587091_009696
897 Ga0587092_001822
898 Ga0587094_010322
899 Ga0587094_018163
900 Ga0587094_114253
901 Ga0587095_002741
902 Ga0587106_001065
903 Ga0587106_001991
904 Ga0587099_001003
905 Ga0587101_001092
906 Ga0587109_022741
907 Ga0587115_002052
908 Ga0587128_001376
909 Ga0587130_005080
910 Ga0587062_001932
911 Ga0587062_035199
912 Ga0587067_020822
913 Ga0587067_049655
914 Ga0587068_002620
915 Ga0587068_011559
916 Ga0587069_001380
917 Ga0587069_003533
918 Ga0587072_003840
919 Ga0587075_007355
920 Ga0587076_011738
921 Ga0587076_020750
922 Ga0587078_001344
923 Ga0587079_002709
924 Ga0587079_013025
925 Ga0587100_003121
926 Ga0587102_000406
927 Ga0587107_010570
928 Ga0587110_005747
929 Ga0587119_001885
930 Ga0587119_007430
931 Ga0587071_003565
932 Ga0587111_0003541
933 Ga0587111_0006016
934 2585260510
935 2644037150
936 2644043602
937 2644126981
938 2644393761

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02472

ExbD

Biopolymer transport protein ExbD/TolR

10

150

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vdm-assembly1.cif.gz_I crystal structure of purine phosphoribosyltransferase from pyrococcus horikoshii ot3 0.8203 110 141
8p9r-assembly1.cif.gz_B structure of the periplasmic domain of exbd from e. coli in complex with tonb 0.7934 57 143
8pek-assembly1.cif.gz_B structure of the dimeric, periplasmic domain of exbd 0.7922 44 142
6dg3-assembly1.cif.gz_E lare, a sulfur transferase involved in synthesis of the cofactor for lactate racemase, in complex with caesium 0.7851 108 142
8p9r-assembly1.cif.gz_B structure of the periplasmic domain of exbd from e. coli in complex with tonb 0.7744 57 143
ID Description Score Start End Superfamily
af_Q2G056_117_224_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8144 110 142 3.40.50.2020
af_A0A1D6M3A4_241_482_3.40.50.360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavodoxin domain 0.7543 110 146 3.40.50.360
af_P46846_104_226_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7046 102 142 3.40.50.2020
af_A0A1D8PDD4_238_365_3.50.30.30 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1; 0.7033 107 144 3.50.30.30
af_B9G7E3_163_290_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.6755 109 146 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A661WY42-F1-model_v4 Biopolymer transporter ExbD 0.9019 54 145 GO:0005886
GO:0015031
GO:0022857
AF-A0A2E3WUS4-F1-model_v4 Biopolymer transporter ExbD 0.9012 57 142 GO:0005886
GO:0015031
GO:0022857
AF-A0A2A4P3E7-F1-model_v4 deleted 0.8992 54 145
AF-A0A7C4N1B6-F1-model_v4 Biopolymer transporter ExbD 0.8983 56 147 GO:0005886
GO:0015031
GO:0022857
AF-A0A496S5C8-F1-model_v4 Biopolymer transporter ExbD 0.8932 52 145 GO:0005886
GO:0015031
GO:0022857

Map