F449570

General Info

Members Datasets Scaffolds Average Seq Length
465 231 930 178

Family's Representative Sequence

Representative Sequence 3300050507|nmdc:mga05p37_38464_c1|nmdc:mga05p37_38464_c1_1504_2133
Length 209
Sequence MESSTGGEENEFWSKLSVNERRDQMNLQDKTMAILVAEGVEDLEYYVPLMRLQEEGAHVFTAGLDLKPLHGKNGLSITPDVTIEALKAEELDALIIPGGWAPDKLRRYDVVKNLVREMDSANKVVGIICHAGLVAISAGIIKPGQQTTGSLGIKDDLINAGGVWTDEAAFRERNQVWGRVVADIPDFCRELVSALTEMTAAEGVKNDRK

Samples

Sample ID Description Type Environment
1 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
43 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
67 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
68 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
77 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
105 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
107 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
108 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
109 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
110 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
111 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
112 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
113 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
114 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
115 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
116 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
117 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
118 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
119 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
120 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
121 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
122 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
123 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
124 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
125 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
126 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
127 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
128 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
129 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
130 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
131 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
132 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
133 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
134 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
135 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
136 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
137 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
138 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
139 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
140 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
141 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
142 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
143 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
144 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
145 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
146 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
147 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
148 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
149 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
150 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
151 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
152 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
153 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
154 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
155 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
156 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
157 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
158 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
159 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
160 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
161 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
162 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
163 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
164 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
165 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
166 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
182 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
183 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
184 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
185 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
186 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
187 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
188 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
189 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
190 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
191 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
192 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
193 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
194 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
195 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
196 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
197 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
198 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
199 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
200 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
201 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
202 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
203 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
204 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
205 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
206 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
207 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
208 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
209 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
210 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
211 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
212 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
213 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
214 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
215 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
216 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
220 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
221 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
222 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
223 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
224 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
225 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
226 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
227 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
228 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
229 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
230 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
231 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.2
Metatranscriptomes 2.8
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.43
Rhizosphere 98.49
Stem 0
Stem Tuber 0
Unclassified 18.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga05p37_38464_c1 3300050507 Bacteria 5868
2 MBSR1b_contig_1113708 2162886012 Unclassified 1461
3 MBSR1b_contig_774658 2162886012 Bacteria 1636
4 JGI25407J50210_10006077 3300003373 Bacteria 2993
5 JGI25407J50210_10042009 3300003373 Bacteria 1170
6 Ga0058862_11296933 3300004803 Bacteria 945
7 Ga0065704_10393269 3300005289 Bacteria 760
8 Ga0065715_10096988 3300005293 Unclassified 3782
9 Ga0065707_10083408 3300005295 Archaea 9292
10 Ga0070690_100086465 3300005330 Bacteria 2058
11 Ga0070690_100789225 3300005330 Bacteria 736
12 Ga0070670_100628397 3300005331 Bacteria 962
13 Ga0070680_100284867 3300005336 Bacteria 1400
14 Ga0070682_100916283 3300005337 Bacteria 721
15 Ga0068868_100624661 3300005338 Unclassified 957
16 Ga0070689_100607275 3300005340 Unclassified 948
17 Ga0070691_10001892 3300005341 Bacteria 9169
18 Ga0070692_10276182 3300005345 Bacteria 1016
19 Ga0070669_100665169 3300005353 Unclassified 877
20 Ga0070675_101033981 3300005354 Unclassified 755
21 Ga0070673_100172572 3300005364 Unclassified 1846
22 Ga0070667_100188622 3300005367 Bacteria 1826
23 Ga0070703_10218559 3300005406 Unclassified 757
24 Ga0070714_100169197 3300005435 Bacteria 1982
25 Ga0070694_100334605 3300005444 Bacteria 1169
26 Ga0070708_100171581 3300005445 Unclassified 2025
27 Ga0070708_100374882 3300005445 Unclassified 1342
28 Ga0070706_100094355 3300005467 Bacteria 2776
29 Ga0070706_100308517 3300005467 Unclassified 1476
30 Ga0070707_100003530 3300005468 Bacteria 14758
31 Ga0070707_100132195 3300005468 Unclassified 2427
32 Ga0070707_100143420 3300005468 Bacteria 2324
33 Ga0070707_100327986 3300005468 Bacteria 1487
34 Ga0070707_101429011 3300005468 Unclassified 658
35 Ga0070698_100008618 3300005471 Bacteria 10990
36 Ga0070698_100657994 3300005471 Bacteria 989
37 Ga0070698_101109063 3300005471 Bacteria 740
38 Ga0070699_100007525 3300005518 Bacteria 9473
39 Ga0070699_100036903 3300005518 Bacteria 4228
40 Ga0070699_100037925 3300005518 Bacteria 4172
41 Ga0070699_100154092 3300005518 Unclassified 2033
42 Ga0070679_100002676 3300005530 Bacteria 16223
43 Ga0070697_100031444 3300005536 Bacteria 4270
44 Ga0070672_100518502 3300005543 Unclassified 1032
45 Ga0070686_100674914 3300005544 Bacteria 822
46 Ga0070695_101167452 3300005545 Bacteria 632
47 Ga0070696_100145927 3300005546 Bacteria 1733
48 Ga0070696_100256956 3300005546 Bacteria 1323
49 Ga0068855_101335161 3300005563 Bacteria 741
50 Ga0068857_100018449 3300005577 Bacteria 6120
51 Ga0070702_100619139 3300005615 Bacteria 814
52 Ga0068858_100642412 3300005842 Bacteria 1031
53 Ga0068860_100016808 3300005843 Bacteria 7133
54 Ga0081455_10019693 3300005937 Bacteria 6374
55 Ga0081455_10067597 3300005937 Bacteria 2977
56 Ga0081538_10002724 3300005981 Bacteria 16981
57 Ga0081538_10003807 3300005981 Bacteria 14108
58 Ga0081538_10024496 3300005981 Bacteria 4297
59 Ga0081538_10024519 3300005981 Bacteria 4295
60 Ga0081538_10070607 3300005981 Bacteria 1927
61 Ga0081538_10103636 3300005981 Bacteria 1423
62 Ga0081538_10152232 3300005981 Bacteria 1045
63 Ga0081539_10003059 3300005985 Bacteria 21594
64 Ga0081539_10020973 3300005985 Bacteria 4387
65 Ga0070717_10317581 3300006028 Unclassified 1387
66 Ga0075432_10069529 3300006058 Bacteria 1263
67 Ga0075428_100021992 3300006844 Bacteria 7061
68 Ga0075428_100066301 3300006844 Bacteria 3952
69 Ga0075428_101663851 3300006844 Bacteria 666
70 Ga0075430_100160692 3300006846 Bacteria 1870
71 Ga0075430_100396285 3300006846 Bacteria 1139
72 Ga0075431_100273472 3300006847 Bacteria 1711
73 Ga0075431_100518692 3300006847 Unclassified 1181
74 Ga0075433_10151268 3300006852 Bacteria 2065
75 Ga0075433_10346706 3300006852 Bacteria 1312
76 Ga0075434_100022509 3300006871 Bacteria 6137
77 Ga0075434_100104466 3300006871 Bacteria 2842
78 Ga0075429_100127852 3300006880 Bacteria 2222
79 Ga0075429_100626107 3300006880 Bacteria 943
80 Ga0068865_100066774 3300006881 Bacteria 2538
81 Ga0068865_100089214 3300006881 Bacteria 2233
82 Ga0075435_100411714 3300007076 Bacteria 1164
83 Ga0105240_10258507 3300009093 Bacteria 2010
84 Ga0111539_10030205 3300009094 Bacteria 6590
85 Ga0111539_10280054 3300009094 Bacteria 1940
86 Ga0111539_10281421 3300009094 Unclassified 1935
87 Ga0105247_10328249 3300009101 Bacteria 1070
88 Ga0114129_10006268 3300009147 Bacteria 16857
89 Ga0114129_10009226 3300009147 Bacteria 14070
90 Ga0114129_10023891 3300009147 Bacteria 8663
91 Ga0114129_10086342 3300009147 Bacteria 4352
92 Ga0105242_10342900 3300009176 Bacteria 1377
93 Ga0105248_10253277 3300009177 Bacteria 1981
94 Ga0105246_10053999 3300011119 Bacteria 2767
95 Ga0105246_10302761 3300011119 Unclassified 1291
96 Ga0157373_10099657 3300013100 Unclassified 2045
97 Ga0157374_10026889 3300013296 Bacteria 5182
98 Ga0157374_10535040 3300013296 Unclassified 1179
99 Ga0157378_11063292 3300013297 Bacteria 845
100 Ga0157378_11262261 3300013297 Bacteria 779
101 Ga0163162_11137182 3300013306 Unclassified 885
102 Ga0157372_10053152 3300013307 Bacteria 4513
103 Ga0157375_10072745 3300013308 Bacteria 3455
104 Ga0157375_10151865 3300013308 Bacteria 2452
105 Ga0163163_10270860 3300014325 Bacteria 1749
106 Ga0157380_10094608 3300014326 Bacteria 2473
107 Ga0182008_10508181 3300014497 Bacteria 664
108 Ga0197907_10835833 3300020069 Bacteria 1174
109 Ga0206356_11642851 3300020070 Unclassified 1515
110 Ga0206349_1087214 3300020075 Bacteria 8052
111 Ga0206351_10404409 3300020077 Bacteria 1542
112 Ga0206352_10563827 3300020078 Unclassified 1294
113 Ga0206350_10639138 3300020080 Bacteria 952
114 Ga0206354_11250799 3300020081 Bacteria 1321
115 Ga0206353_11472736 3300020082 Bacteria 900
116 Ga0154015_1088504 3300020610 Bacteria 844
117 Ga0224712_10004526 3300022467 Bacteria 3760
118 Ga0224712_10042821 3300022467 Bacteria 1718
119 Ga0207653_10196944 3300025885 Unclassified 758
120 Ga0207680_10319102 3300025903 Unclassified 1086
121 Ga0207684_10006540 3300025910 Bacteria 10615
122 Ga0207684_10151929 3300025910 Bacteria 1992
123 Ga0207684_10364793 3300025910 Bacteria 1243
124 Ga0207695_10825466 3300025913 Bacteria 807
125 Ga0207693_10323421 3300025915 Unclassified 1207
126 Ga0207660_11198534 3300025917 Unclassified 618
127 Ga0207652_10001623 3300025921 Bacteria 19771
128 Ga0207646_10011650 3300025922 Bacteria 8502
129 Ga0207646_10122540 3300025922 Bacteria 2336
130 Ga0207646_10290948 3300025922 Bacteria 1476
131 Ga0207646_11221993 3300025922 Unclassified 658
132 Ga0207659_10924955 3300025926 Unclassified 750
133 Ga0207686_10838809 3300025934 Bacteria 739
134 Ga0207670_10559669 3300025936 Unclassified 935
135 Ga0207704_10073714 3300025938 Bacteria 2175
136 Ga0207704_10114576 3300025938 Bacteria 1830
137 Ga0207691_10089391 3300025940 Bacteria 2762
138 Ga0207711_10808052 3300025941 Unclassified 873
139 Ga0207679_10358578 3300025945 Unclassified 1273
140 Ga0207678_10937501 3300026067 Unclassified 766
141 Ga0207708_10331514 3300026075 Bacteria 1244
142 Ga0207648_10041900 3300026089 Bacteria 4020
143 Ga0207648_10809375 3300026089 Bacteria 872
144 Ga0207674_10022796 3300026116 Bacteria 6719
145 Ga0207675_100982863 3300026118 Bacteria 862
146 Ga0209969_1012816 3300027360 Bacteria 1211
147 Ga0209968_1003448 3300027526 Unclassified 2376
148 Ga0209999_1006757 3300027543 Unclassified 2065
149 Ga0209983_1102181 3300027665 Unclassified 649
150 Ga0209998_10055132 3300027717 Unclassified 927
151 Ga0209974_10012361 3300027876 Unclassified 2855
152 Ga0207428_10077084 3300027907 Bacteria 2610
153 Ga0268264_10054195 3300028381 Bacteria 3348
154 Ga0265337_1116713 3300028556 Unclassified 724
155 Ga0265322_10012095 3300028654 Bacteria 2497
156 Ga0307408_100068068 3300031548 Bacteria 2621
157 Ga0307408_101165737 3300031548 Bacteria 717
158 Ga0307408_101581023 3300031548 Bacteria 622
159 Ga0316575_10095444 3300031665 Bacteria 1207
160 Ga0316579_10133547 3300031691 Bacteria 1196
161 Ga0316576_10550874 3300031727 Bacteria 845
162 Ga0316578_10534131 3300031728 Unclassified 690
163 Ga0307405_10009310 3300031731 Bacteria 5029
164 Ga0307405_10075780 3300031731 Bacteria 2180
165 Ga0307405_10122018 3300031731 Bacteria 1785
166 Ga0307405_10335392 3300031731 Unclassified 1160
167 Ga0307405_10401660 3300031731 Bacteria 1073
168 Ga0307405_10523837 3300031731 Unclassified 954
169 Ga0316577_10023951 3300031733 Bacteria 3391
170 Ga0316577_10059422 3300031733 Bacteria 2134
171 Ga0316577_10066568 3300031733 Unclassified 2011
172 Ga0307413_10052423 3300031824 Bacteria 2464
173 Ga0307413_10223025 3300031824 Unclassified 1378
174 Ga0307413_10296410 3300031824 Bacteria 1224
175 Ga0307413_10951522 3300031824 Unclassified 733
176 Ga0307410_10012259 3300031852 Bacteria 4948
177 Ga0307410_10101885 3300031852 Bacteria 2059
178 Ga0307410_10119002 3300031852 Bacteria 1923
179 Ga0307410_10137038 3300031852 Bacteria 1805
180 Ga0307410_10305633 3300031852 Bacteria 1256
181 Ga0307410_10364302 3300031852 Unclassified 1158
182 Ga0307410_10407657 3300031852 Bacteria 1100
183 Ga0307410_10469017 3300031852 Bacteria 1030
184 Ga0307406_10092923 3300031901 Bacteria 2035
185 Ga0307406_10160432 3300031901 Bacteria 1616
186 Ga0307406_10636081 3300031901 Bacteria 884
187 Ga0307406_10804630 3300031901 Bacteria 793
188 Ga0307406_10901799 3300031901 Bacteria 753
189 Ga0307407_10002358 3300031903 Bacteria 7362
190 Ga0307407_10065918 3300031903 Bacteria 2134
191 Ga0307407_10125624 3300031903 Bacteria 1633
192 Ga0307407_10172691 3300031903 Bacteria 1425
193 Ga0307407_10175460 3300031903 Unclassified 1416
194 Ga0307407_10503708 3300031903 Bacteria 888
195 Ga0307412_10030108 3300031911 Bacteria 3413
196 Ga0307412_10216594 3300031911 Bacteria 1465
197 Ga0307412_10261096 3300031911 Unclassified 1350
198 Ga0307412_10457744 3300031911 Bacteria 1053
199 Ga0307412_10541178 3300031911 Unclassified 976
200 Ga0307412_11165945 3300031911 Unclassified 688
201 Ga0307409_100008767 3300031995 Bacteria 6166
202 Ga0307409_100062100 3300031995 Bacteria 2923
203 Ga0307409_100531997 3300031995 Unclassified 1150
204 Ga0307409_100847723 3300031995 Unclassified 924
205 Ga0307409_100850843 3300031995 Unclassified 923
206 Ga0307409_101734333 3300031995 Unclassified 653
207 Ga0307416_100008811 3300032002 Bacteria 6543
208 Ga0307416_100062088 3300032002 Bacteria 3053
209 Ga0307416_100144157 3300032002 Unclassified 2171
210 Ga0307416_100412226 3300032002 Bacteria 1392
211 Ga0307416_100657320 3300032002 Bacteria 1133
212 Ga0307416_100795083 3300032002 Bacteria 1041
213 Ga0307416_100874649 3300032002 Bacteria 998
214 Ga0307416_100983728 3300032002 Bacteria 946
215 Ga0307416_101065462 3300032002 Bacteria 912
216 Ga0307416_101117391 3300032002 Unclassified 893
217 Ga0307416_101347099 3300032002 Bacteria 819
218 Ga0307416_101652825 3300032002 Bacteria 745
219 Ga0307416_101741857 3300032002 Bacteria 727
220 Ga0307414_10122363 3300032004 Bacteria 2003
221 Ga0307414_10156085 3300032004 Bacteria 1807
222 Ga0307414_10331475 3300032004 Unclassified 1299
223 Ga0307414_10651880 3300032004 Bacteria 949
224 Ga0307411_10034935 3300032005 Bacteria 3133
225 Ga0307411_10123107 3300032005 Bacteria 1881
226 Ga0307411_10195795 3300032005 Bacteria 1547
227 Ga0307411_10251093 3300032005 Bacteria 1391
228 Ga0307411_10466162 3300032005 Bacteria 1060
229 Ga0307415_100003325 3300032126 Bacteria 8161
230 Ga0307415_100005701 3300032126 Bacteria 6637
231 Ga0307415_100016794 3300032126 Bacteria 4374
232 Ga0307415_100101615 3300032126 Bacteria 2110
233 Ga0307415_100140376 3300032126 Bacteria 1844
234 Ga0307415_100192292 3300032126 Bacteria 1611
235 Ga0307415_100404709 3300032126 Bacteria 1166
236 Ga0307415_102056141 3300032126 Bacteria 557
237 Ga0316593_10313968 3300032168 Unclassified 595
238 Ga0373954_0003108 3300035118 Bacteria 7010
239 Ga0373956_0000069 3300035119 Bacteria 34644
240 Ga0316574_0027642 3300035398 Bacteria 3418
241 Ga0373927_0000027 3300035695 Bacteria 110859
242 Ga0373933_0010049 3300035724 Bacteria 5181
243 Ga0373933_0040567 3300035724 Bacteria 2743
244 Ga0373933_0283467 3300035724 Bacteria 1071
245 Ga0316582_0027885 3300036647 Bacteria 3417
246 Ga0316582_0093589 3300036647 Unclassified 1982
247 Ga0316584_0145916 3300036712 Unclassified 1763
248 Ga0316584_0177497 3300036712 Bacteria 1578
249 Ga0316584_0277039 3300036712 Bacteria 1220
250 Ga0316584_0377357 3300036712 Bacteria 1014
251 Ga0316584_0523433 3300036712 Bacteria 831
252 Ga0316584_0568808 3300036712 Bacteria 789
253 Ga0316584_0585737 3300036712 Bacteria 775
254 Ga0395899_0036974 3300037312 Bacteria 3661
255 Ga0395899_0258400 3300037312 Bacteria 1192
256 Ga0395900_0012356 3300037418 Bacteria 8737
257 Ga0395900_0037369 3300037418 Bacteria 5007
258 Ga0395900_0562336 3300037418 Bacteria 1084
259 Ga0395900_1029785 3300037418 Bacteria 742
260 Ga0395898_0175594 3300037466 Bacteria 2047
261 Ga0395898_0212282 3300037466 Bacteria 1846
262 Ga0395898_0290298 3300037466 Unclassified 1560
263 Ga0395905_0011185 3300037471 Bacteria 8677
264 Ga0395905_0077106 3300037471 Bacteria 3123
265 Ga0395905_0242061 3300037471 Bacteria 1686
266 Ga0395905_1075173 3300037471 Bacteria 708
267 Ga0395901_0001606 3300038443 Bacteria 23410
268 Ga0395901_0030473 3300038443 Bacteria 5557
269 Ga0395901_0172195 3300038443 Bacteria 2271
270 Ga0395901_0340700 3300038443 Bacteria 1549
271 Ga0395901_0723319 3300038443 Bacteria 991
272 Ga0395901_0952574 3300038443 Bacteria 837
273 Ga0400484_26240 3300038725 Bacteria 2013
274 Ga0400490_10366 3300038726 Bacteria 1553
275 Ga0400490_24447 3300038726 Bacteria 2064
276 Ga0400490_41630 3300038726 Bacteria 5029
277 Ga0400488_00677 3300038741 Bacteria 1661
278 Ga0439448_0075074 3300042005 Bacteria 1130
279 Ga0439450_000956 3300042008 Bacteria 4030
280 Ga0439450_034005 3300042008 Bacteria 1158
281 Ga0439463_008722 3300042016 Bacteria 2496
282 Ga0439463_048210 3300042016 Bacteria 1085
283 Ga0439463_079917 3300042016 Bacteria 840
284 Ga0439463_145818 3300042016 Bacteria 613
285 Ga0450922_005245 3300042124 Bacteria 1199
286 Ga0439434_0104518 3300042435 Bacteria 914
287 Ga0439464_0083545 3300042439 Bacteria 956
288 Ga0439464_0232239 3300042439 Bacteria 593
289 Ga0439460_0067126 3300042461 Bacteria 1104
290 Ga0439440_0039575 3300042993 Bacteria 1145
291 Ga0439440_0112738 3300042993 Unclassified 750
292 Ga0466972_0019654 3300044658 Bacteria 3377
293 Ga0453683_0110326 3300044673 Bacteria 1730
294 Ga0466966_0062641 3300044684 Bacteria 2345
295 Ga0466961_0015330 3300044693 Bacteria 4923
296 Ga0453684_0034494 3300044712 Bacteria 7023
297 Ga0453684_0067991 3300044712 Bacteria 4527
298 Ga0453684_0148855 3300044712 Bacteria 2785
299 Ga0453684_0229384 3300044712 Bacteria 2145
300 Ga0453684_0246866 3300044712 Bacteria 2052
301 Ga0453684_0409607 3300044712 Bacteria 1517
302 Ga0453684_0872739 3300044712 Unclassified 965
303 Ga0453684_1022538 3300044712 Bacteria 877
304 Ga0466970_0082129 3300044765 Bacteria 1743
305 Ga0466957_0504789 3300044842 Bacteria 839
306 Ga0466959_0049279 3300045049 Unclassified 3094
307 Ga0466959_0163064 3300045049 Bacteria 1566
308 Ga0451576_0000258 3300045051 Bacteria 129651
309 Ga0451576_0587327 3300045051 Bacteria 1171
310 Ga0495603_0050134 3300046455 Bacteria 2483
311 Ga0495641_0023653 3300046461 Bacteria 3047
312 Ga0495594_0021244 3300046499 Bacteria 3464
313 Ga0495656_0135740 3300046615 Bacteria 1175
314 Ga0495676_0203143 3300047321 Bacteria 1376
315 Ga0496112_0220685 3300048915 Unclassified 1852
316 Ga0496115_0772454 3300048918 Bacteria 750
317 Ga0501291_097353 3300049514 Bacteria 609
318 Ga0501031_0260713 3300049568 Bacteria 1126
319 Ga0501031_0309466 3300049568 Bacteria 1024
320 Ga0501032_0019883 3300049569 Bacteria 4688
321 Ga0501033_0009574 3300049570 Bacteria 7455
322 Ga0501033_0157760 3300049570 Unclassified 1634
323 Ga0501033_0182891 3300049570 Bacteria 1502
324 Ga0501033_0545456 3300049570 Bacteria 799
325 Ga0501034_0175356 3300049571 Unclassified 2110
326 Ga0501036_0138665 3300049572 Bacteria 2052
327 Ga0501036_0474288 3300049572 Bacteria 1042
328 Ga0501036_1014999 3300049572 Unclassified 679
329 Ga0501037_0016937 3300049573 Bacteria 5363
330 Ga0501037_0044082 3300049573 Bacteria 3277
331 Ga0501038_0005577 3300049574 Bacteria 11683
332 Ga0501038_0023219 3300049574 Bacteria 5549
333 Ga0501038_0034883 3300049574 Bacteria 4421
334 Ga0501038_0050708 3300049574 Bacteria 3585
335 Ga0501039_0021197 3300049575 Bacteria 4985
336 Ga0501039_0034860 3300049575 Bacteria 3883
337 Ga0501039_0049047 3300049575 Bacteria 3263
338 Ga0501039_0102939 3300049575 Bacteria 2229
339 Ga0501040_0015369 3300049576 Bacteria 5061
340 Ga0501040_0027836 3300049576 Bacteria 3807
341 Ga0501040_0115777 3300049576 Unclassified 1877
342 Ga0501041_0075589 3300049577 Bacteria 2071
343 Ga0501041_0125383 3300049577 Bacteria 1598
344 Ga0501041_0454152 3300049577 Bacteria 813
345 Ga0501042_0185951 3300049578 Bacteria 1498
346 Ga0501042_0633279 3300049578 Bacteria 777
347 Ga0501043_0024806 3300049579 Bacteria 4704
348 Ga0501043_0445351 3300049579 Unclassified 974
349 Ga0501043_0757572 3300049579 Bacteria 705
350 Ga0501046_0004512 3300049580 Bacteria 12615
351 Ga0501046_0025083 3300049580 Bacteria 4883
352 Ga0501046_0174911 3300049580 Bacteria 1608
353 Ga0501046_0273720 3300049580 Bacteria 1238
354 Ga0501047_0152529 3300049581 Bacteria 2186
355 Ga0501048_0009525 3300049582 Bacteria 7290
356 Ga0501048_0061599 3300049582 Bacteria 2656
357 Ga0501048_0357650 3300049582 Bacteria 1041
358 Ga0501067_0357688 3300049583 Unclassified 814
359 Ga0501068_0062074 3300049584 Unclassified 2271
360 Ga0501068_0077436 3300049584 Bacteria 2036
361 Ga0501069_0010200 3300049585 Bacteria 4969
362 Ga0501069_0188650 3300049585 Bacteria 1192
363 Ga0501069_0556109 3300049585 Unclassified 687
364 Ga0501070_0127319 3300049586 Bacteria 2104
365 Ga0501071_0073965 3300049587 Bacteria 2486
366 Ga0501071_0075716 3300049587 Bacteria 2457
367 Ga0501071_0620466 3300049587 Bacteria 831
368 Ga0501072_0002662 3300049588 Bacteria 13389
369 Ga0501072_0094568 3300049588 Bacteria 2374
370 Ga0501072_0173376 3300049588 Bacteria 1721
371 Ga0501072_0174939 3300049588 Bacteria 1712
372 Ga0501072_0360104 3300049588 Bacteria 1155
373 Ga0501073_0151382 3300049589 Bacteria 1608
374 Ga0501074_0020223 3300049590 Bacteria 4837
375 Ga0501074_0052937 3300049590 Bacteria 2929
376 Ga0501075_0026981 3300049591 Bacteria 4231
377 Ga0501075_0034031 3300049591 Bacteria 3792
378 Ga0501075_0063564 3300049591 Bacteria 2783
379 Ga0501075_0168972 3300049591 Bacteria 1668
380 Ga0501076_0009360 3300049592 Bacteria 7232
381 Ga0501076_0031836 3300049592 Bacteria 4115
382 Ga0501076_0137522 3300049592 Bacteria 1984
383 Ga0501076_0759459 3300049592 Bacteria 800
384 Ga0501077_0017665 3300049593 Bacteria 4505
385 Ga0501077_0056262 3300049593 Unclassified 2496
386 Ga0501201_005626 3300049651 Bacteria 1176
387 Ga0501208_079305 3300049655 Bacteria 673
388 Ga0501217_014198 3300049661 Bacteria 1795
389 Ga0501224_008453 3300049664 Bacteria 1501
390 Ga0501227_025958 3300049665 Bacteria 1378
391 Ga0501233_014037 3300049668 Bacteria 1632
392 Ga0501235_000143 3300049669 Bacteria 12007
393 Ga0501243_018364 3300049675 Bacteria 1139
394 Ga0501243_021053 3300049675 Unclassified 1075
395 Ga0501249_024638 3300049679 Bacteria 1326
396 Ga0501250_021340 3300049680 Unclassified 840
397 Ga0501257_002818 3300049686 Bacteria 3680
398 Ga0501260_006837 3300049689 Bacteria 1104
399 Ga0501261_040440 3300049690 Bacteria 734
400 Ga0501225_0005288 3300049705 Bacteria 3795
401 Ga0501234_004012 3300049707 Bacteria 2311
402 Ga0501079_0011926 3300049741 Bacteria 6632
403 Ga0501079_0073284 3300049741 Bacteria 2646
404 Ga0501079_0332074 3300049741 Unclassified 1191
405 Ga0501079_0572374 3300049741 Bacteria 888
406 Ga0501079_0573554 3300049741 Bacteria 887
407 Ga0501080_0132006 3300049742 Bacteria 2312
408 Ga0501080_0219254 3300049742 Unclassified 1741
409 Ga0501080_0545699 3300049742 Bacteria 1033
410 Ga0501081_0066628 3300049743 Bacteria 2504
411 Ga0501081_0207160 3300049743 Bacteria 1423
412 Ga0501081_0212097 3300049743 Bacteria 1406
413 Ga0501083_0019087 3300049744 Bacteria 4774
414 Ga0501083_0199813 3300049744 Bacteria 1304
415 Ga0501083_1030429 3300049744 Unclassified 536
416 Ga0501264_017569 3300049761 Unclassified 736
417 Ga0501266_003581 3300049763 Bacteria 1930
418 Ga0501268_012909 3300049765 Bacteria 1342
419 Ga0501268_046215 3300049765 Bacteria 832
420 Ga0501273_014934 3300049770 Bacteria 1004
421 Ga0501279_007018 3300049775 Bacteria 1493
422 Ga0501035_0061217 3300049822 Bacteria 3350
423 Ga0501035_0079433 3300049822 Unclassified 2898
424 Ga0501044_0666315 3300049823 Bacteria 928
425 Ga0501044_0878099 3300049823 Bacteria 772
426 Ga0501045_0022183 3300049824 Bacteria 4543
427 Ga0501045_0048000 3300049824 Bacteria 3111
428 Ga0501045_0074178 3300049824 Bacteria 2505
429 Ga0501045_0992837 3300049824 Unclassified 616
430 Ga0501204_022179 3300049850 Bacteria 836
431 nmdc:mga05p37_121660_c1 3300050507 Bacteria 3206
432 nmdc:mga05p37_199030_c1 3300050507 Bacteria 2428
433 nmdc:mga05p37_256582_c1 3300050507 Bacteria 2095
434 nmdc:mga05p37_88778_c1 3300050507 Bacteria 3810
435 nmdc:mga09592_195142_c1 3300050508 Bacteria 1753
436 nmdc:mga09592_216246_c1 3300050508 Bacteria 1661
437 nmdc:mga09592_93045_c1 3300050508 Bacteria 2577
438 nmdc:mga0qj67_1081452_c1 3300050509 Bacteria 627
439 nmdc:mga0qj67_5730_c1 3300050509 Bacteria 9089
440 nmdc:mga06r32_236257_c1 3300050510 Bacteria 1815
441 nmdc:mga06r32_413343_c1 3300050510 Bacteria 1331
442 nmdc:mga06r32_501748_c1 3300050510 Unclassified 1190
443 nmdc:mga08y16_154468_c1 3300050511 Bacteria 2385
444 nmdc:mga08y16_247980_c1 3300050511 Bacteria 1840
445 nmdc:mga08y16_32826_c1 3300050511 Bacteria 5458
446 nmdc:mga0n895_176080_c1 3300050512 Bacteria 2170
447 nmdc:mga0n895_33382_c1 3300050512 Bacteria 4946
448 nmdc:mga0rr50_210809_c1 3300050513 Bacteria 1600
449 nmdc:mga0a205_140449_c1 3300050515 Bacteria 2316
450 nmdc:mga0a205_7922_c1 3300050515 Bacteria 9648
451 nmdc:mga0a205_981_c1 3300050515 Bacteria 23586
452 Ga0495612_0145940 3300053078 Bacteria 1028
453 Ga0501084_0027117 3300054114 Bacteria 4786
454 Ga0501084_0042684 3300054114 Bacteria 3793
455 Ga0501084_0787066 3300054114 Bacteria 801
456 Ga0590075_002254 3300059424 Bacteria 4635
457 Ga0590075_106264 3300059424 Bacteria 732
458 Ga0501082_0023113 3300060353 Bacteria 5361
459 Ga0501082_0044851 3300060353 Bacteria 3813
460 Ga0501082_0061110 3300060353 Bacteria 3243
461 Ga0501082_0112410 3300060353 Bacteria 2358
462 Ga0501082_0515947 3300060353 Bacteria 1045
463 Ga0501082_0839760 3300060353 Bacteria 803
464 Ga0530510_0014740 3300061734 Bacteria 5519
465 Ga0530510_0140282 3300061734 Bacteria 1781
466 nmdc:mga05p37_38464_c1
467 MBSR1b_contig_1113708
468 MBSR1b_contig_774658
469 JGI25407J50210_10006077
470 JGI25407J50210_10042009
471 Ga0058862_11296933
472 Ga0065704_10393269
473 Ga0065715_10096988
474 Ga0065707_10083408
475 Ga0070690_100086465
476 Ga0070690_100789225
477 Ga0070670_100628397
478 Ga0070680_100284867
479 Ga0070682_100916283
480 Ga0068868_100624661
481 Ga0070689_100607275
482 Ga0070691_10001892
483 Ga0070692_10276182
484 Ga0070669_100665169
485 Ga0070675_101033981
486 Ga0070673_100172572
487 Ga0070667_100188622
488 Ga0070703_10218559
489 Ga0070714_100169197
490 Ga0070694_100334605
491 Ga0070708_100171581
492 Ga0070708_100374882
493 Ga0070706_100094355
494 Ga0070706_100308517
495 Ga0070707_100003530
496 Ga0070707_100132195
497 Ga0070707_100143420
498 Ga0070707_100327986
499 Ga0070707_101429011
500 Ga0070698_100008618
501 Ga0070698_100657994
502 Ga0070698_101109063
503 Ga0070699_100007525
504 Ga0070699_100036903
505 Ga0070699_100037925
506 Ga0070699_100154092
507 Ga0070679_100002676
508 Ga0070697_100031444
509 Ga0070672_100518502
510 Ga0070686_100674914
511 Ga0070695_101167452
512 Ga0070696_100145927
513 Ga0070696_100256956
514 Ga0068855_101335161
515 Ga0068857_100018449
516 Ga0070702_100619139
517 Ga0068858_100642412
518 Ga0068860_100016808
519 Ga0081455_10019693
520 Ga0081455_10067597
521 Ga0081538_10002724
522 Ga0081538_10003807
523 Ga0081538_10024496
524 Ga0081538_10024519
525 Ga0081538_10070607
526 Ga0081538_10103636
527 Ga0081538_10152232
528 Ga0081539_10003059
529 Ga0081539_10020973
530 Ga0070717_10317581
531 Ga0075432_10069529
532 Ga0075428_100021992
533 Ga0075428_100066301
534 Ga0075428_101663851
535 Ga0075430_100160692
536 Ga0075430_100396285
537 Ga0075431_100273472
538 Ga0075431_100518692
539 Ga0075433_10151268
540 Ga0075433_10346706
541 Ga0075434_100022509
542 Ga0075434_100104466
543 Ga0075429_100127852
544 Ga0075429_100626107
545 Ga0068865_100066774
546 Ga0068865_100089214
547 Ga0075435_100411714
548 Ga0105240_10258507
549 Ga0111539_10030205
550 Ga0111539_10280054
551 Ga0111539_10281421
552 Ga0105247_10328249
553 Ga0114129_10006268
554 Ga0114129_10009226
555 Ga0114129_10023891
556 Ga0114129_10086342
557 Ga0105242_10342900
558 Ga0105248_10253277
559 Ga0105246_10053999
560 Ga0105246_10302761
561 Ga0157373_10099657
562 Ga0157374_10026889
563 Ga0157374_10535040
564 Ga0157378_11063292
565 Ga0157378_11262261
566 Ga0163162_11137182
567 Ga0157372_10053152
568 Ga0157375_10072745
569 Ga0157375_10151865
570 Ga0163163_10270860
571 Ga0157380_10094608
572 Ga0182008_10508181
573 Ga0197907_10835833
574 Ga0206356_11642851
575 Ga0206349_1087214
576 Ga0206351_10404409
577 Ga0206352_10563827
578 Ga0206350_10639138
579 Ga0206354_11250799
580 Ga0206353_11472736
581 Ga0154015_1088504
582 Ga0224712_10004526
583 Ga0224712_10042821
584 Ga0207653_10196944
585 Ga0207680_10319102
586 Ga0207684_10006540
587 Ga0207684_10151929
588 Ga0207684_10364793
589 Ga0207695_10825466
590 Ga0207693_10323421
591 Ga0207660_11198534
592 Ga0207652_10001623
593 Ga0207646_10011650
594 Ga0207646_10122540
595 Ga0207646_10290948
596 Ga0207646_11221993
597 Ga0207659_10924955
598 Ga0207686_10838809
599 Ga0207670_10559669
600 Ga0207704_10073714
601 Ga0207704_10114576
602 Ga0207691_10089391
603 Ga0207711_10808052
604 Ga0207679_10358578
605 Ga0207678_10937501
606 Ga0207708_10331514
607 Ga0207648_10041900
608 Ga0207648_10809375
609 Ga0207674_10022796
610 Ga0207675_100982863
611 Ga0209969_1012816
612 Ga0209968_1003448
613 Ga0209999_1006757
614 Ga0209983_1102181
615 Ga0209998_10055132
616 Ga0209974_10012361
617 Ga0207428_10077084
618 Ga0268264_10054195
619 Ga0265337_1116713
620 Ga0265322_10012095
621 Ga0307408_100068068
622 Ga0307408_101165737
623 Ga0307408_101581023
624 Ga0316575_10095444
625 Ga0316579_10133547
626 Ga0316576_10550874
627 Ga0316578_10534131
628 Ga0307405_10009310
629 Ga0307405_10075780
630 Ga0307405_10122018
631 Ga0307405_10335392
632 Ga0307405_10401660
633 Ga0307405_10523837
634 Ga0316577_10023951
635 Ga0316577_10059422
636 Ga0316577_10066568
637 Ga0307413_10052423
638 Ga0307413_10223025
639 Ga0307413_10296410
640 Ga0307413_10951522
641 Ga0307410_10012259
642 Ga0307410_10101885
643 Ga0307410_10119002
644 Ga0307410_10137038
645 Ga0307410_10305633
646 Ga0307410_10364302
647 Ga0307410_10407657
648 Ga0307410_10469017
649 Ga0307406_10092923
650 Ga0307406_10160432
651 Ga0307406_10636081
652 Ga0307406_10804630
653 Ga0307406_10901799
654 Ga0307407_10002358
655 Ga0307407_10065918
656 Ga0307407_10125624
657 Ga0307407_10172691
658 Ga0307407_10175460
659 Ga0307407_10503708
660 Ga0307412_10030108
661 Ga0307412_10216594
662 Ga0307412_10261096
663 Ga0307412_10457744
664 Ga0307412_10541178
665 Ga0307412_11165945
666 Ga0307409_100008767
667 Ga0307409_100062100
668 Ga0307409_100531997
669 Ga0307409_100847723
670 Ga0307409_100850843
671 Ga0307409_101734333
672 Ga0307416_100008811
673 Ga0307416_100062088
674 Ga0307416_100144157
675 Ga0307416_100412226
676 Ga0307416_100657320
677 Ga0307416_100795083
678 Ga0307416_100874649
679 Ga0307416_100983728
680 Ga0307416_101065462
681 Ga0307416_101117391
682 Ga0307416_101347099
683 Ga0307416_101652825
684 Ga0307416_101741857
685 Ga0307414_10122363
686 Ga0307414_10156085
687 Ga0307414_10331475
688 Ga0307414_10651880
689 Ga0307411_10034935
690 Ga0307411_10123107
691 Ga0307411_10195795
692 Ga0307411_10251093
693 Ga0307411_10466162
694 Ga0307415_100003325
695 Ga0307415_100005701
696 Ga0307415_100016794
697 Ga0307415_100101615
698 Ga0307415_100140376
699 Ga0307415_100192292
700 Ga0307415_100404709
701 Ga0307415_102056141
702 Ga0316593_10313968
703 Ga0373954_0003108
704 Ga0373956_0000069
705 Ga0316574_0027642
706 Ga0373927_0000027
707 Ga0373933_0010049
708 Ga0373933_0040567
709 Ga0373933_0283467
710 Ga0316582_0027885
711 Ga0316582_0093589
712 Ga0316584_0145916
713 Ga0316584_0177497
714 Ga0316584_0277039
715 Ga0316584_0377357
716 Ga0316584_0523433
717 Ga0316584_0568808
718 Ga0316584_0585737
719 Ga0395899_0036974
720 Ga0395899_0258400
721 Ga0395900_0012356
722 Ga0395900_0037369
723 Ga0395900_0562336
724 Ga0395900_1029785
725 Ga0395898_0175594
726 Ga0395898_0212282
727 Ga0395898_0290298
728 Ga0395905_0011185
729 Ga0395905_0077106
730 Ga0395905_0242061
731 Ga0395905_1075173
732 Ga0395901_0001606
733 Ga0395901_0030473
734 Ga0395901_0172195
735 Ga0395901_0340700
736 Ga0395901_0723319
737 Ga0395901_0952574
738 Ga0400484_26240
739 Ga0400490_10366
740 Ga0400490_24447
741 Ga0400490_41630
742 Ga0400488_00677
743 Ga0439448_0075074
744 Ga0439450_000956
745 Ga0439450_034005
746 Ga0439463_008722
747 Ga0439463_048210
748 Ga0439463_079917
749 Ga0439463_145818
750 Ga0450922_005245
751 Ga0439434_0104518
752 Ga0439464_0083545
753 Ga0439464_0232239
754 Ga0439460_0067126
755 Ga0439440_0039575
756 Ga0439440_0112738
757 Ga0466972_0019654
758 Ga0453683_0110326
759 Ga0466966_0062641
760 Ga0466961_0015330
761 Ga0453684_0034494
762 Ga0453684_0067991
763 Ga0453684_0148855
764 Ga0453684_0229384
765 Ga0453684_0246866
766 Ga0453684_0409607
767 Ga0453684_0872739
768 Ga0453684_1022538
769 Ga0466970_0082129
770 Ga0466957_0504789
771 Ga0466959_0049279
772 Ga0466959_0163064
773 Ga0451576_0000258
774 Ga0451576_0587327
775 Ga0495603_0050134
776 Ga0495641_0023653
777 Ga0495594_0021244
778 Ga0495656_0135740
779 Ga0495676_0203143
780 Ga0496112_0220685
781 Ga0496115_0772454
782 Ga0501291_097353
783 Ga0501031_0260713
784 Ga0501031_0309466
785 Ga0501032_0019883
786 Ga0501033_0009574
787 Ga0501033_0157760
788 Ga0501033_0182891
789 Ga0501033_0545456
790 Ga0501034_0175356
791 Ga0501036_0138665
792 Ga0501036_0474288
793 Ga0501036_1014999
794 Ga0501037_0016937
795 Ga0501037_0044082
796 Ga0501038_0005577
797 Ga0501038_0023219
798 Ga0501038_0034883
799 Ga0501038_0050708
800 Ga0501039_0021197
801 Ga0501039_0034860
802 Ga0501039_0049047
803 Ga0501039_0102939
804 Ga0501040_0015369
805 Ga0501040_0027836
806 Ga0501040_0115777
807 Ga0501041_0075589
808 Ga0501041_0125383
809 Ga0501041_0454152
810 Ga0501042_0185951
811 Ga0501042_0633279
812 Ga0501043_0024806
813 Ga0501043_0445351
814 Ga0501043_0757572
815 Ga0501046_0004512
816 Ga0501046_0025083
817 Ga0501046_0174911
818 Ga0501046_0273720
819 Ga0501047_0152529
820 Ga0501048_0009525
821 Ga0501048_0061599
822 Ga0501048_0357650
823 Ga0501067_0357688
824 Ga0501068_0062074
825 Ga0501068_0077436
826 Ga0501069_0010200
827 Ga0501069_0188650
828 Ga0501069_0556109
829 Ga0501070_0127319
830 Ga0501071_0073965
831 Ga0501071_0075716
832 Ga0501071_0620466
833 Ga0501072_0002662
834 Ga0501072_0094568
835 Ga0501072_0173376
836 Ga0501072_0174939
837 Ga0501072_0360104
838 Ga0501073_0151382
839 Ga0501074_0020223
840 Ga0501074_0052937
841 Ga0501075_0026981
842 Ga0501075_0034031
843 Ga0501075_0063564
844 Ga0501075_0168972
845 Ga0501076_0009360
846 Ga0501076_0031836
847 Ga0501076_0137522
848 Ga0501076_0759459
849 Ga0501077_0017665
850 Ga0501077_0056262
851 Ga0501201_005626
852 Ga0501208_079305
853 Ga0501217_014198
854 Ga0501224_008453
855 Ga0501227_025958
856 Ga0501233_014037
857 Ga0501235_000143
858 Ga0501243_018364
859 Ga0501243_021053
860 Ga0501249_024638
861 Ga0501250_021340
862 Ga0501257_002818
863 Ga0501260_006837
864 Ga0501261_040440
865 Ga0501225_0005288
866 Ga0501234_004012
867 Ga0501079_0011926
868 Ga0501079_0073284
869 Ga0501079_0332074
870 Ga0501079_0572374
871 Ga0501079_0573554
872 Ga0501080_0132006
873 Ga0501080_0219254
874 Ga0501080_0545699
875 Ga0501081_0066628
876 Ga0501081_0207160
877 Ga0501081_0212097
878 Ga0501083_0019087
879 Ga0501083_0199813
880 Ga0501083_1030429
881 Ga0501264_017569
882 Ga0501266_003581
883 Ga0501268_012909
884 Ga0501268_046215
885 Ga0501273_014934
886 Ga0501279_007018
887 Ga0501035_0061217
888 Ga0501035_0079433
889 Ga0501044_0666315
890 Ga0501044_0878099
891 Ga0501045_0022183
892 Ga0501045_0048000
893 Ga0501045_0074178
894 Ga0501045_0992837
895 Ga0501204_022179
896 nmdc:mga05p37_121660_c1
897 nmdc:mga05p37_199030_c1
898 nmdc:mga05p37_256582_c1
899 nmdc:mga05p37_88778_c1
900 nmdc:mga09592_195142_c1
901 nmdc:mga09592_216246_c1
902 nmdc:mga09592_93045_c1
903 nmdc:mga0qj67_1081452_c1
904 nmdc:mga0qj67_5730_c1
905 nmdc:mga06r32_236257_c1
906 nmdc:mga06r32_413343_c1
907 nmdc:mga06r32_501748_c1
908 nmdc:mga08y16_154468_c1
909 nmdc:mga08y16_247980_c1
910 nmdc:mga08y16_32826_c1
911 nmdc:mga0n895_176080_c1
912 nmdc:mga0n895_33382_c1
913 nmdc:mga0rr50_210809_c1
914 nmdc:mga0a205_140449_c1
915 nmdc:mga0a205_7922_c1
916 nmdc:mga0a205_981_c1
917 Ga0495612_0145940
918 Ga0501084_0027117
919 Ga0501084_0042684
920 Ga0501084_0787066
921 Ga0590075_002254
922 Ga0590075_106264
923 Ga0501082_0023113
924 Ga0501082_0044851
925 Ga0501082_0061110
926 Ga0501082_0112410
927 Ga0501082_0515947
928 Ga0501082_0839760
929 Ga0530510_0014740
930 Ga0530510_0140282

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01965

DJ-1_PfpI

DJ-1/PfpI family

30

194

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3fse-assembly1.cif.gz_A crystal structure of a two-domain protein containing dj-1/thij/pfpi-like and ferritin-like domains (ava_4496) from anabaena variabilis atcc 29413 at 1.90 a resolution 0.9843 6 170
3fse-assembly1.cif.gz_B crystal structure of a two-domain protein containing dj-1/thij/pfpi-like and ferritin-like domains (ava_4496) from anabaena variabilis atcc 29413 at 1.90 a resolution 0.9838 6 170
6f2f-assembly1.cif.gz_A crystal structure of protease 1 from pyrococcus horikoshii co-cystallized in presence of 10 mm tb-xo4 and ammonium sulfate. 0.9826 7 170
7r66-assembly1.cif.gz_A structure of pfp1 protease from thermococcus thioreducens: large unit cell at 1.44 a resolution 0.9825 7 170
6q3t-assembly1.cif.gz_A structure of protease1 from pyrococcus horikoshii at room temperature in chipx microfluidic device 0.9814 7 170
ID Description Score Start End Superfamily
6f2fA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9826 7 170 3.40.50.880
3fseB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9717 6 170 3.40.50.880
1oi4B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9676 3 170 3.40.50.880
4y1eA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9662 6 171 3.40.50.880
6f2fA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9652 7 170 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A2N2MA78-F1-model_v4 Type 1 glutamine amidotransferase 1.002 1 171 GO:0016740
AF-A0A3N5STW2-F1-model_v4 Type 1 glutamine amidotransferase 0.9985 1 144 GO:0016740
AF-A0A3A4QM18-F1-model_v4 Type 1 glutamine amidotransferase 0.9978 1 172 GO:0016740
AF-A0A2T2UUX4-F1-model_v4 Type 1 glutamine amidotransferase 0.9954 1 175 GO:0016740
AF-A0A537ECD7-F1-model_v4 Type 1 glutamine amidotransferase 0.9933 11 172 GO:0016740

Map