F448474

General Info

Members Datasets Scaffolds Average Seq Length
460 280 920 260

Family's Representative Sequence

Representative Sequence 3300001977|JGI24746J21847_1004480|JGI24746J21847_10044802
Length 299
Sequence MTKPVATTADSTVSHGVSTPHGTPSRRHYVQARGSAVMAAENPDSRAPYADQRKNYILDQLLTHGRVDAVEIAEALGVTGETIRKDLIALERQGLLRRVHGGAVPVQSLAFEPAVETRTQFASEKTRIAQAALNHLPAQGSVLIDAGSTTGKLVELFPGDRDLTVYTNTVPLALSLLTRPRLTVFTFGGRLRNKTFAEVGDWAARALAEINVDVAFLGTNGISMSRGLTTPDPDEAAVKRLMLACADKRVLLADHSKFGVVKGTKHGDLDDIDVLISDKGLTDDQCAQLRTAGIDVERT

Samples

Sample ID Description Type Environment
1 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
6 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
9 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
73 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
74 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
75 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
76 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
77 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
80 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
86 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
87 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
171 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
175 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
176 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
177 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
178 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
179 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
180 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
181 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
182 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
183 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
184 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
185 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
186 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
187 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
188 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
189 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
190 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
191 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
192 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
193 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
194 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
195 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
196 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
197 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
198 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
199 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
200 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
201 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
202 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
203 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
204 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
205 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
206 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
207 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
208 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
209 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
210 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
211 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
212 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
213 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
214 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
215 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
216 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
217 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
218 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
219 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
220 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
221 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
222 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
223 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
224 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
225 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
226 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
227 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
228 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
229 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
230 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
231 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
232 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
233 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
234 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
236 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
237 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
238 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
239 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
240 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
242 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
243 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
244 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
245 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
253 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
254 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
255 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
256 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
257 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
258 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
259 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
261 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
262 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
263 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
264 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
265 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
266 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
267 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
268 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
269 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
270 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
271 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
272 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
273 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
274 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
275 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
276 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
277 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
278 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
279 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
280 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95
Metatranscriptomes 3.7
Isolates 1.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.48
Nodule 0
Rhizoplane 8.04
Rhizosphere 84.35
Stem 0
Stem Tuber 0
Unclassified 7.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1004480 3300001977 Unclassified 2201
2 JGI24739J22299_10041077 3300001989 Bacteria 1541
3 JGI24737J22298_10049938 3300001990 Unclassified 1272
4 JGI24743J22301_10003770 3300001991 Bacteria 2421
5 JGI24745J21846_1003983 3300002073 Unclassified 1565
6 JGI24748J21848_1000621 3300002074 Bacteria 3802
7 JGI24744J21845_10000370 3300002077 Bacteria 7655
8 JGI24742J22300_10011428 3300002244 Bacteria 1474
9 Ga0058859_11469375 3300004798 Bacteria 1243
10 Ga0065715_10037798 3300005293 Bacteria 2045
11 Ga0065715_10091941 3300005293 Bacteria 5445
12 Ga0065707_10111714 3300005295 Bacteria 2386
13 Ga0070676_10007146 3300005328 Bacteria 5980
14 Ga0070676_10106407 3300005328 Bacteria 1740
15 Ga0070683_100180735 3300005329 Bacteria 2002
16 Ga0070683_100211457 3300005329 Bacteria 1842
17 Ga0070690_100011670 3300005330 Bacteria 5145
18 Ga0068869_100006928 3300005334 Bacteria 7216
19 Ga0068869_100041575 3300005334 Bacteria 3293
20 Ga0070666_10002743 3300005335 Bacteria 10634
21 Ga0070680_100164002 3300005336 Bacteria 1868
22 Ga0070682_100010562 3300005337 Bacteria 5241
23 Ga0070682_100090852 3300005337 Bacteria 1998
24 Ga0070682_100214161 3300005337 Bacteria 1367
25 Ga0068868_100011012 3300005338 Bacteria 6572
26 Ga0068868_100019415 3300005338 Bacteria 5093
27 Ga0068868_100480344 3300005338 Unclassified 1085
28 Ga0070660_100157646 3300005339 Bacteria 1828
29 Ga0070660_100181067 3300005339 Unclassified 1705
30 Ga0070691_10006808 3300005341 Bacteria 5224
31 Ga0070691_10015007 3300005341 Bacteria 3557
32 Ga0070691_10089477 3300005341 Bacteria 1516
33 Ga0070687_100055774 3300005343 Bacteria 2065
34 Ga0070661_100040309 3300005344 Bacteria 3407
35 Ga0070692_10020321 3300005345 Bacteria 3219
36 Ga0070668_100007915 3300005347 Bacteria 7891
37 Ga0070668_100183538 3300005347 Unclassified 1710
38 Ga0070668_100198049 3300005347 Unclassified 1648
39 Ga0070669_100013326 3300005353 Bacteria 5845
40 Ga0070669_100013834 3300005353 Bacteria 5736
41 Ga0070675_100001942 3300005354 Bacteria 15299
42 Ga0070671_100026129 3300005355 Bacteria 4796
43 Ga0070671_100088903 3300005355 Bacteria 2586
44 Ga0070674_100036453 3300005356 Bacteria 3302
45 Ga0070674_100736019 3300005356 Bacteria 846
46 Ga0070673_100089871 3300005364 Bacteria 2508
47 Ga0070688_100094260 3300005365 Bacteria 1962
48 Ga0070659_100015186 3300005366 Bacteria 5762
49 Ga0070659_100035086 3300005366 Bacteria 3904
50 Ga0070659_100076279 3300005366 Bacteria 2673
51 Ga0070667_100002383 3300005367 Bacteria 16463
52 Ga0070667_100048829 3300005367 Bacteria 3563
53 Ga0070709_10044220 3300005434 Bacteria 2757
54 Ga0070709_10265285 3300005434 Bacteria 1242
55 Ga0070710_10002800 3300005437 Bacteria 8312
56 Ga0070701_10010625 3300005438 Bacteria 4079
57 Ga0070711_100004586 3300005439 Bacteria 8177
58 Ga0070711_100088061 3300005439 Bacteria 2230
59 Ga0070705_100030878 3300005440 Bacteria 2961
60 Ga0070700_100003800 3300005441 Bacteria 7822
61 Ga0070700_100005298 3300005441 Bacteria 6819
62 Ga0070700_100145888 3300005441 Bacteria 1613
63 Ga0070694_100009310 3300005444 Bacteria 6030
64 Ga0070694_100177770 3300005444 Bacteria 1572
65 Ga0070663_100014456 3300005455 Bacteria 5066
66 Ga0070663_100042139 3300005455 Bacteria 3207
67 Ga0070663_100345073 3300005455 Bacteria 1204
68 Ga0070678_100003307 3300005456 Bacteria 8964
69 Ga0070678_100065900 3300005456 Bacteria 2691
70 Ga0070662_100002512 3300005457 Bacteria 11310
71 Ga0070662_100015780 3300005457 Bacteria 5065
72 Ga0068867_100003162 3300005459 Bacteria 11612
73 Ga0068867_100147336 3300005459 Unclassified 1846
74 Ga0068867_100226093 3300005459 Bacteria 1510
75 Ga0070685_10018061 3300005466 Bacteria 3789
76 Ga0070698_100443091 3300005471 Bacteria 1234
77 Ga0070699_100125603 3300005518 Bacteria 2258
78 Ga0070684_100062401 3300005535 Bacteria 3264
79 Ga0068853_100026966 3300005539 Bacteria 4828
80 Ga0068853_100048298 3300005539 Bacteria 3655
81 Ga0070672_100434719 3300005543 Bacteria 1129
82 Ga0070686_100093645 3300005544 Bacteria 2015
83 Ga0070686_100282288 3300005544 Bacteria 1225
84 Ga0070686_100391593 3300005544 Bacteria 1054
85 Ga0070695_100003228 3300005545 Bacteria 9518
86 Ga0070695_100078692 3300005545 Unclassified 2174
87 Ga0070696_100009865 3300005546 Bacteria 6386
88 Ga0070696_100036603 3300005546 Bacteria 3384
89 Ga0070665_100046986 3300005548 Bacteria 4333
90 Ga0070704_100007110 3300005549 Bacteria 6646
91 Ga0070664_100002003 3300005564 Bacteria 16337
92 Ga0070664_100127198 3300005564 Bacteria 2236
93 Ga0068857_100007657 3300005577 Bacteria 9303
94 Ga0068857_100204297 3300005577 Bacteria 1801
95 Ga0068854_100002144 3300005578 Bacteria 12124
96 Ga0068854_100195959 3300005578 Bacteria 1585
97 Ga0068856_100047003 3300005614 Bacteria 4251
98 Ga0068856_100096062 3300005614 Bacteria 2952
99 Ga0070702_100001606 3300005615 Bacteria 9344
100 Ga0070702_100080468 3300005615 Unclassified 1950
101 Ga0070702_100178062 3300005615 Bacteria 1389
102 Ga0068852_100226867 3300005616 Unclassified 1779
103 Ga0068852_100318983 3300005616 Bacteria 1509
104 Ga0068852_100340932 3300005616 Bacteria 1461
105 Ga0068859_100007489 3300005617 Bacteria 11086
106 Ga0068859_100044266 3300005617 Bacteria 4473
107 Ga0068859_100169667 3300005617 Bacteria 2263
108 Ga0068859_100170064 3300005617 Bacteria 2260
109 Ga0068859_100332570 3300005617 Unclassified 1613
110 Ga0068859_100507522 3300005617 Unclassified 1301
111 Ga0068864_100019238 3300005618 Bacteria 5708
112 Ga0068864_100209341 3300005618 Bacteria 1795
113 Ga0068866_10001052 3300005718 Bacteria 12164
114 Ga0068866_10151143 3300005718 Unclassified 1345
115 Ga0068861_100005819 3300005719 Bacteria 8370
116 Ga0068861_100085202 3300005719 Bacteria 2482
117 Ga0068861_100464128 3300005719 Bacteria 1137
118 Ga0068851_10059051 3300005834 Bacteria 1962
119 Ga0068870_10163003 3300005840 Bacteria 1324
120 Ga0068870_10377037 3300005840 Unclassified 917
121 Ga0068863_100108860 3300005841 Bacteria 2637
122 Ga0068863_100152436 3300005841 Bacteria 2212
123 Ga0068858_100041162 3300005842 Bacteria 4285
124 Ga0068858_100910328 3300005842 Bacteria 860
125 Ga0068860_100008544 3300005843 Bacteria 10204
126 Ga0068860_100077424 3300005843 Bacteria 3162
127 Ga0068860_100187499 3300005843 Unclassified 2001
128 Ga0068860_100244181 3300005843 Unclassified 1747
129 Ga0068860_100463487 3300005843 Bacteria 1261
130 Ga0068862_100006530 3300005844 Bacteria 9679
131 Ga0068862_100033910 3300005844 Bacteria 4318
132 Ga0068862_100068658 3300005844 Bacteria 3058
133 Ga0068862_100500670 3300005844 Bacteria 1153
134 Ga0081455_10030487 3300005937 Bacteria 4897
135 Ga0081539_10008310 3300005985 Bacteria 9082
136 Ga0075365_10003183 3300006038 Bacteria 8381
137 Ga0075363_100001699 3300006048 Bacteria 8544
138 Ga0075363_100002169 3300006048 Bacteria 7899
139 Ga0075363_100025032 3300006048 Bacteria 3040
140 Ga0075364_10005595 3300006051 Bacteria 7323
141 Ga0070715_10015883 3300006163 Bacteria 2817
142 Ga0070712_100007831 3300006175 Bacteria 6690
143 Ga0075362_10145912 3300006177 Bacteria 1133
144 Ga0075367_10008914 3300006178 Bacteria 5220
145 Ga0097621_100004229 3300006237 Bacteria 9971
146 Ga0097621_100031428 3300006237 Bacteria 4214
147 Ga0097621_100451419 3300006237 Bacteria 1158
148 Ga0075370_10031589 3300006353 Bacteria 2957
149 Ga0068871_100008400 3300006358 Bacteria 7425
150 Ga0068871_100025254 3300006358 Bacteria 4620
151 Ga0068871_100471200 3300006358 Bacteria 1128
152 Ga0075428_100359603 3300006844 Bacteria 1562
153 Ga0075428_101055576 3300006844 Bacteria 859
154 Ga0075430_100005697 3300006846 Bacteria 10512
155 Ga0075431_100035172 3300006847 Bacteria 5158
156 Ga0075429_100015596 3300006880 Bacteria 6585
157 Ga0068865_100052557 3300006881 Bacteria 2824
158 Ga0068865_100355956 3300006881 Bacteria 1187
159 Ga0097620_100007489 3300006931 Bacteria 11086
160 Ga0097620_100044267 3300006931 Bacteria 4473
161 Ga0097620_100169667 3300006931 Bacteria 2263
162 Ga0097620_100170068 3300006931 Bacteria 2260
163 Ga0097620_100332577 3300006931 Unclassified 1613
164 Ga0097620_100507524 3300006931 Unclassified 1301
165 Ga0099795_10001329 3300007788 Bacteria 5282
166 Ga0111539_10029460 3300009094 Bacteria 6685
167 Ga0111539_10058007 3300009094 Bacteria 4595
168 Ga0105245_10007898 3300009098 Bacteria 9305
169 Ga0105245_10009208 3300009098 Bacteria 8609
170 Ga0105245_10049477 3300009098 Bacteria 3764
171 Ga0105247_10000810 3300009101 Bacteria 23853
172 Ga0105247_10127044 3300009101 Bacteria 1658
173 Ga0114129_10008637 3300009147 Bacteria 14524
174 Ga0114129_10869912 3300009147 Bacteria 1144
175 Ga0105243_10001844 3300009148 Bacteria 18127
176 Ga0105243_10518511 3300009148 Unclassified 1133
177 Ga0105241_10029462 3300009174 Bacteria 4096
178 Ga0105241_10174488 3300009174 Bacteria 1778
179 Ga0105241_10380166 3300009174 Bacteria 1234
180 Ga0105242_10002336 3300009176 Bacteria 14965
181 Ga0105242_10580574 3300009176 Unclassified 1079
182 Ga0105248_10004796 3300009177 Bacteria 14969
183 Ga0105248_10005731 3300009177 Bacteria 13637
184 Ga0105248_10251340 3300009177 Bacteria 1990
185 Ga0105237_10022291 3300009545 Bacteria 6498
186 Ga0105238_10055448 3300009551 Bacteria 3978
187 Ga0105238_10107177 3300009551 Bacteria 2775
188 Ga0105249_10002828 3300009553 Bacteria 14969
189 Ga0105249_10182574 3300009553 Bacteria 2042
190 Ga0099796_10000539 3300010159 Bacteria 6471
191 Ga0105239_10010801 3300010375 Bacteria 10201
192 Ga0105239_10017556 3300010375 Bacteria 7914
193 Ga0105239_10120823 3300010375 Bacteria 2909
194 Ga0105239_10184217 3300010375 Bacteria 2336
195 Ga0105239_10211815 3300010375 Bacteria 2172
196 Ga0105239_10274855 3300010375 Bacteria 1895
197 Ga0105239_10864131 3300010375 Unclassified 1038
198 Ga0105246_10387640 3300011119 Bacteria 1156
199 Ga0157374_10011234 3300013296 Bacteria 7746
200 Ga0157378_10022335 3300013297 Bacteria 5569
201 Ga0163162_10007343 3300013306 Bacteria 10712
202 Ga0163162_10015887 3300013306 Bacteria 7357
203 Ga0157372_10038397 3300013307 Bacteria 5284
204 Ga0157375_10005756 3300013308 Bacteria 10782
205 Ga0157375_10020820 3300013308 Bacteria 6003
206 Ga0157375_10092696 3300013308 Bacteria 3085
207 Ga0163163_10005930 3300014325 Bacteria 10631
208 Ga0163163_10257950 3300014325 Bacteria 1794
209 Ga0157380_10002508 3300014326 Bacteria 12371
210 Ga0157380_10323214 3300014326 Unclassified 1431
211 Ga0157377_10006958 3300014745 Bacteria 5431
212 Ga0157377_10031159 3300014745 Bacteria 2896
213 Ga0157379_10436015 3300014968 Bacteria 1208
214 Ga0163161_10001383 3300017792 Bacteria 17947
215 Ga0163161_10255329 3300017792 Bacteria 1367
216 Ga0209051_1000014 3300025303 Bacteria 552732
217 Ga0207656_10082544 3300025321 Bacteria 1447
218 Ga0207692_10039696 3300025898 Bacteria 2318
219 Ga0207642_10033330 3300025899 Bacteria 2179
220 Ga0207642_10061943 3300025899 Bacteria 1742
221 Ga0207710_10006063 3300025900 Bacteria 5181
222 Ga0207688_10000359 3300025901 Bacteria 21269
223 Ga0207688_10002756 3300025901 Bacteria 9523
224 Ga0207688_10008944 3300025901 Bacteria 5449
225 Ga0207680_10029417 3300025903 Bacteria 3086
226 Ga0207647_10002723 3300025904 Bacteria 13338
227 Ga0207647_10059610 3300025904 Unclassified 2335
228 Ga0207647_10068846 3300025904 Bacteria 2141
229 Ga0207685_10038675 3300025905 Bacteria 1765
230 Ga0207645_10009881 3300025907 Bacteria 6575
231 Ga0207645_10092079 3300025907 Bacteria 1950
232 Ga0207643_10137906 3300025908 Bacteria 1455
233 Ga0207654_10173663 3300025911 Bacteria 1401
234 Ga0207671_10046633 3300025914 Bacteria 3207
235 Ga0207671_10281313 3300025914 Bacteria 1312
236 Ga0207693_10011125 3300025915 Bacteria 7289
237 Ga0207663_10100341 3300025916 Bacteria 1942
238 Ga0207660_10197999 3300025917 Bacteria 1568
239 Ga0207662_10087084 3300025918 Bacteria 1915
240 Ga0207657_10062185 3300025919 Bacteria 3198
241 Ga0207657_10149695 3300025919 Bacteria 1902
242 Ga0207649_10688090 3300025920 Bacteria 792
243 Ga0207681_10351342 3300025923 Bacteria 1180
244 Ga0207694_10032243 3300025924 Bacteria 4009
245 Ga0207650_10134256 3300025925 Bacteria 1940
246 Ga0207650_10313420 3300025925 Bacteria 1284
247 Ga0207659_10010723 3300025926 Bacteria 5763
248 Ga0207687_10006680 3300025927 Bacteria 7606
249 Ga0207687_10029275 3300025927 Bacteria 3704
250 Ga0207644_10298252 3300025931 Unclassified 1298
251 Ga0207690_10032321 3300025932 Bacteria 3357
252 Ga0207690_10130353 3300025932 Bacteria 1839
253 Ga0207706_10005061 3300025933 Bacteria 12311
254 Ga0207706_10075281 3300025933 Bacteria 2968
255 Ga0207686_10156163 3300025934 Bacteria 1594
256 Ga0207709_10034121 3300025935 Bacteria 2996
257 Ga0207670_10200672 3300025936 Bacteria 1515
258 Ga0207669_10002213 3300025937 Bacteria 8262
259 Ga0207669_10135547 3300025937 Bacteria 1700
260 Ga0207704_10000596 3300025938 Bacteria 15969
261 Ga0207704_10377967 3300025938 Bacteria 1111
262 Ga0207665_10002231 3300025939 Bacteria 13069
263 Ga0207691_10078430 3300025940 Bacteria 2974
264 Ga0207691_10087795 3300025940 Bacteria 2789
265 Ga0207691_10440810 3300025940 Unclassified 1109
266 Ga0207711_10102418 3300025941 Bacteria 2535
267 Ga0207711_10246830 3300025941 Bacteria 1638
268 Ga0207689_10014112 3300025942 Bacteria 6799
269 Ga0207689_10053449 3300025942 Bacteria 3328
270 Ga0207689_10121041 3300025942 Bacteria 2153
271 Ga0207689_10152642 3300025942 Unclassified 1904
272 Ga0207661_10006625 3300025944 Bacteria 8184
273 Ga0207679_10303704 3300025945 Bacteria 1377
274 Ga0207651_10279898 3300025960 Bacteria 1378
275 Ga0207668_10027304 3300025972 Bacteria 3717
276 Ga0207640_10032609 3300025981 Bacteria 3231
277 Ga0207640_10144518 3300025981 Bacteria 1739
278 Ga0207658_10002141 3300025986 Bacteria 14670
279 Ga0207658_10124375 3300025986 Bacteria 2061
280 Ga0207677_10001139 3300026023 Bacteria 14487
281 Ga0207677_10013968 3300026023 Bacteria 4671
282 Ga0207703_10172757 3300026035 Bacteria 1902
283 Ga0207703_10531182 3300026035 Unclassified 1107
284 Ga0207639_10595334 3300026041 Unclassified 1019
285 Ga0207678_10011284 3300026067 Bacteria 7844
286 Ga0207678_10013729 3300026067 Bacteria 7113
287 Ga0207678_10015195 3300026067 Bacteria 6772
288 Ga0207678_10073407 3300026067 Bacteria 2932
289 Ga0207678_10270918 3300026067 Bacteria 1456
290 Ga0207708_10003300 3300026075 Bacteria 11874
291 Ga0207708_10008248 3300026075 Bacteria 7715
292 Ga0207708_10045936 3300026075 Unclassified 3327
293 Ga0207708_10411412 3300026075 Bacteria 1120
294 Ga0207641_10087979 3300026088 Bacteria 2711
295 Ga0207641_10152489 3300026088 Bacteria 2094
296 Ga0207648_10009748 3300026089 Bacteria 9180
297 Ga0207648_10157547 3300026089 Unclassified 2005
298 Ga0207648_10232502 3300026089 Bacteria 1640
299 Ga0207648_10300566 3300026089 Bacteria 1439
300 Ga0207676_10008280 3300026095 Bacteria 7393
301 Ga0207676_10463497 3300026095 Bacteria 1197
302 Ga0207675_100001290 3300026118 Bacteria 25101
303 Ga0207675_100040786 3300026118 Unclassified 4335
304 Ga0207675_100040837 3300026118 Bacteria 4333
305 Ga0207675_100373746 3300026118 Bacteria 1400
306 Ga0207683_10000669 3300026121 Bacteria 31502
307 Ga0207683_10051295 3300026121 Bacteria 3614
308 Ga0207698_10593309 3300026142 Unclassified 1091
309 Ga0209179_1000453 3300027512 Bacteria 4148
310 Ga0209974_10019391 3300027876 Bacteria 2255
311 Ga0207428_10060059 3300027907 Bacteria 3012
312 Ga0268266_10029270 3300028379 Bacteria 4683
313 Ga0268266_10615995 3300028379 Bacteria 1043
314 Ga0268265_10010042 3300028380 Bacteria 6392
315 Ga0268265_10070635 3300028380 Bacteria 2716
316 Ga0268265_10115942 3300028380 Bacteria 2197
317 Ga0268264_10558000 3300028381 Bacteria 1124
318 Ga0307515_10006238 3300028794 Bacteria 23937
319 Ga0307515_10174583 3300028794 Bacteria 2125
320 Ga0265327_10001755 3300031251 Bacteria 25641
321 Ga0307513_10118950 3300031456 Bacteria 2615
322 Ga0307508_10326621 3300031616 Bacteria 1126
323 Ga0316576_10000265 3300031727 Bacteria 22779
324 Ga0307406_10051389 3300031901 Bacteria 2617
325 Ga0307406_10285830 3300031901 Bacteria 1260
326 Ga0307407_10112242 3300031903 Bacteria 1713
327 Ga0307416_100767189 3300032002 Bacteria 1058
328 Ga0307414_10142046 3300032004 Bacteria 1881
329 Ga0307411_10047173 3300032005 Bacteria 2784
330 Ga0307415_100010197 3300032126 Bacteria 5309
331 Ga0307415_100070350 3300032126 Bacteria 2457
332 Ga0307415_100176283 3300032126 Bacteria 1673
333 Ga0307415_100397077 3300032126 Bacteria 1176
334 Ga0373931_0020107 3300035691 Bacteria 3338
335 Ga0395900_0080742 3300037418 Bacteria 3342
336 Ga0395900_0462598 3300037418 Bacteria 1223
337 Ga0395898_0044269 3300037466 Bacteria 4383
338 Ga0395905_0209134 3300037471 Bacteria 1828
339 Ga0395901_0756120 3300038443 Bacteria 965
340 Ga0451793_0108552 3300041452 Bacteria 994
341 Ga0439450_018662 3300042008 Bacteria 1460
342 Ga0466972_0117460 3300044658 Bacteria 1255
343 Ga0466965_0014428 3300044683 Bacteria 3739
344 Ga0466960_0001444 3300044901 Bacteria 8672
345 Ga0495629_0016221 3300046459 Bacteria 5348
346 Ga0495641_0024039 3300046461 Bacteria 3014
347 Ga0495582_0104358 3300046473 Bacteria 1589
348 Ga0495597_0126619 3300046542 Bacteria 1062
349 Ga0495646_0071443 3300046680 Bacteria 2042
350 Ga0495624_0105595 3300046690 Bacteria 1733
351 Ga0495581_0075960 3300047315 Bacteria 1944
352 Ga0495604_0258205 3300047317 Bacteria 1185
353 Ga0495676_0051501 3300047321 Bacteria 3293
354 Ga0495593_0043567 3300047673 Bacteria 2404
355 Ga0496100_0000043 3300048903 Bacteria 89692
356 Ga0496100_0031191 3300048903 Bacteria 3311
357 Ga0496101_0000149 3300048904 Bacteria 60550
358 Ga0496101_0000477 3300048904 Bacteria 25255
359 Ga0496102_0015005 3300048905 Bacteria 6742
360 Ga0496102_0048439 3300048905 Bacteria 3864
361 Ga0496102_0049019 3300048905 Bacteria 3841
362 Ga0496103_0000152 3300048906 Bacteria 72428
363 Ga0496103_0008632 3300048906 Bacteria 6053
364 Ga0496103_0185544 3300048906 Bacteria 1337
365 Ga0496104_0052258 3300048907 Bacteria 3859
366 Ga0496104_0088159 3300048907 Unclassified 2964
367 Ga0496104_0096464 3300048907 Bacteria 2829
368 Ga0496104_0205822 3300048907 Bacteria 1879
369 Ga0496105_0061862 3300048908 Bacteria 3089
370 Ga0496105_0132769 3300048908 Bacteria 2052
371 Ga0496106_0000341 3300048909 Bacteria 32846
372 Ga0496106_0000382 3300048909 Bacteria 31520
373 Ga0496107_0005114 3300048910 Bacteria 8947
374 Ga0496107_0030782 3300048910 Bacteria 3826
375 Ga0496108_0008462 3300048911 Bacteria 8346
376 Ga0496108_0015700 3300048911 Bacteria 6177
377 Ga0496108_0021532 3300048911 Bacteria 5297
378 Ga0496108_0142459 3300048911 Bacteria 2065
379 Ga0496109_0000194 3300048912 Bacteria 60448
380 Ga0496109_0014698 3300048912 Bacteria 6813
381 Ga0496110_0005202 3300048913 Bacteria 10180
382 Ga0496110_0013300 3300048913 Bacteria 6798
383 Ga0496111_0011823 3300048914 Bacteria 5893
384 Ga0496112_0002793 3300048915 Bacteria 14163
385 Ga0496112_0051723 3300048915 Bacteria 4030
386 Ga0496112_0253132 3300048915 Bacteria 1712
387 Ga0496113_0026101 3300048916 Bacteria 4173
388 Ga0496114_0000548 3300048917 Bacteria 27791
389 Ga0496114_0013916 3300048917 Bacteria 6450
390 Ga0496115_0042855 3300048918 Bacteria 3607
391 Ga0496116_0002353 3300048919 Bacteria 19979
392 Ga0496117_0009215 3300048920 Bacteria 9232
393 Ga0496118_0018054 3300048921 Bacteria 6386
394 Ga0496119_0001288 3300048922 Bacteria 31010
395 Ga0496121_0000048 3300048924 Bacteria 330242
396 Ga0496122_0000301 3300048925 Bacteria 109636
397 Ga0496124_0000044 3300048927 Bacteria 289064
398 Ga0496125_0000037 3300048928 Bacteria 330242
399 Ga0496126_0000046 3300048929 Bacteria 330242
400 Ga0496126_0563089 3300048929 Bacteria 903
401 Ga0501306_000840 3300049127 Bacteria 2618
402 Ga0501308_014567 3300049128 Bacteria 922
403 Ga0501309_000614 3300049129 Bacteria 3019
404 Ga0501310_000284 3300049130 Bacteria 4670
405 Ga0501310_000781 3300049130 Bacteria 2825
406 Ga0501304_011091 3300049160 Bacteria 797
407 Ga0501305_000865 3300049161 Bacteria 2721
408 Ga0501307_016416 3300049162 Bacteria 923
409 Ga0501311_021739 3300049527 Bacteria 877
410 Ga0501312_001019 3300049528 Bacteria 2597
411 Ga0501313_012439 3300049529 Bacteria 991
412 Ga0501316_020892 3300049532 Bacteria 825
413 Ga0501320_000261 3300049536 Bacteria 2831
414 Ga0501322_002696 3300049538 Bacteria 1106
415 Ga0501323_010369 3300049539 Bacteria 1110
416 Ga0501324_009591 3300049540 Bacteria 870
417 Ga0501032_0023222 3300049569 Bacteria 4291
418 Ga0501036_0162121 3300049572 Bacteria 1885
419 Ga0501037_0000068 3300049573 Bacteria 96244
420 Ga0501037_0001241 3300049573 Bacteria 18799
421 Ga0501038_0130594 3300049574 Bacteria 2063
422 Ga0501039_0080905 3300049575 Bacteria 2528
423 Ga0501043_0000200 3300049579 Bacteria 54757
424 Ga0501043_0003961 3300049579 Bacteria 12141
425 Ga0501047_0302809 3300049581 Bacteria 1441
426 Ga0501068_0408161 3300049584 Unclassified 876
427 Ga0501069_0000001 3300049585 Bacteria 289100
428 Ga0501070_0000307 3300049586 Bacteria 44919
429 Ga0501070_0015075 3300049586 Bacteria 6505
430 Ga0501071_0027940 3300049587 Bacteria 3971
431 Ga0501074_0001131 3300049590 Bacteria 17464
432 Ga0501080_0011927 3300049742 Bacteria 7958
433 Ga0501083_0000068 3300049744 Bacteria 69153
434 Ga0501035_0000111 3300049822 Bacteria 99357
435 Ga0501044_0000621 3300049823 Bacteria 42802
436 Ga0501044_0031840 3300049823 Bacteria 5547
437 nmdc:mga03n38_3948_c1 3300050490 Bacteria 4840
438 nmdc:mga06z11_12214_c1 3300050494 Bacteria 3729
439 nmdc:mga07m45_15628_c1 3300050496 Bacteria 2652
440 nmdc:mga05p37_11304_c1 3300050507 Bacteria 10620
441 nmdc:mga05p37_58518_c1 3300050507 Bacteria 4746
442 nmdc:mga09592_11944_c1 3300050508 Bacteria 7066
443 nmdc:mga09592_71163_c1 3300050508 Bacteria 2952
444 nmdc:mga06r32_491622_c1 3300050510 Bacteria 1205
445 nmdc:mga08y16_30839_c1 3300050511 Bacteria 5638
446 nmdc:mga08y16_52908_c1 3300050511 Bacteria 4246
447 Ga0495655_0041603 3300053083 Bacteria 1176
448 Ga0495595_0343294 3300053084 Bacteria 753
449 Ga0495619_0012611 3300053085 Bacteria 5320
450 Ga0495619_0068680 3300053085 Bacteria 2368
451 Ga0500583_0001444 3300053092 Bacteria 6813
452 Ga0500641_0024380 3300053096 Bacteria 2332
453 Ga0500591_063986 3300053115 Bacteria 1687
454 Ga0500637_0121827 3300053178 Bacteria 1513
455 2676485156 2675903059 Bacteria 8644972
456 2738663855 2738541264 Bacteria 5935393
457 2739142990 2738541356 Bacteria 5935017
458 2816508639 2816332139 Bacteria 9138787
459 2861526998 2861520306 Bacteria 8348283
460 8003834777 8003830390 Bacteria 6541657
461 JGI24746J21847_1004480
462 JGI24739J22299_10041077
463 JGI24737J22298_10049938
464 JGI24743J22301_10003770
465 JGI24745J21846_1003983
466 JGI24748J21848_1000621
467 JGI24744J21845_10000370
468 JGI24742J22300_10011428
469 Ga0058859_11469375
470 Ga0065715_10037798
471 Ga0065715_10091941
472 Ga0065707_10111714
473 Ga0070676_10007146
474 Ga0070676_10106407
475 Ga0070683_100180735
476 Ga0070683_100211457
477 Ga0070690_100011670
478 Ga0068869_100006928
479 Ga0068869_100041575
480 Ga0070666_10002743
481 Ga0070680_100164002
482 Ga0070682_100010562
483 Ga0070682_100090852
484 Ga0070682_100214161
485 Ga0068868_100011012
486 Ga0068868_100019415
487 Ga0068868_100480344
488 Ga0070660_100157646
489 Ga0070660_100181067
490 Ga0070691_10006808
491 Ga0070691_10015007
492 Ga0070691_10089477
493 Ga0070687_100055774
494 Ga0070661_100040309
495 Ga0070692_10020321
496 Ga0070668_100007915
497 Ga0070668_100183538
498 Ga0070668_100198049
499 Ga0070669_100013326
500 Ga0070669_100013834
501 Ga0070675_100001942
502 Ga0070671_100026129
503 Ga0070671_100088903
504 Ga0070674_100036453
505 Ga0070674_100736019
506 Ga0070673_100089871
507 Ga0070688_100094260
508 Ga0070659_100015186
509 Ga0070659_100035086
510 Ga0070659_100076279
511 Ga0070667_100002383
512 Ga0070667_100048829
513 Ga0070709_10044220
514 Ga0070709_10265285
515 Ga0070710_10002800
516 Ga0070701_10010625
517 Ga0070711_100004586
518 Ga0070711_100088061
519 Ga0070705_100030878
520 Ga0070700_100003800
521 Ga0070700_100005298
522 Ga0070700_100145888
523 Ga0070694_100009310
524 Ga0070694_100177770
525 Ga0070663_100014456
526 Ga0070663_100042139
527 Ga0070663_100345073
528 Ga0070678_100003307
529 Ga0070678_100065900
530 Ga0070662_100002512
531 Ga0070662_100015780
532 Ga0068867_100003162
533 Ga0068867_100147336
534 Ga0068867_100226093
535 Ga0070685_10018061
536 Ga0070698_100443091
537 Ga0070699_100125603
538 Ga0070684_100062401
539 Ga0068853_100026966
540 Ga0068853_100048298
541 Ga0070672_100434719
542 Ga0070686_100093645
543 Ga0070686_100282288
544 Ga0070686_100391593
545 Ga0070695_100003228
546 Ga0070695_100078692
547 Ga0070696_100009865
548 Ga0070696_100036603
549 Ga0070665_100046986
550 Ga0070704_100007110
551 Ga0070664_100002003
552 Ga0070664_100127198
553 Ga0068857_100007657
554 Ga0068857_100204297
555 Ga0068854_100002144
556 Ga0068854_100195959
557 Ga0068856_100047003
558 Ga0068856_100096062
559 Ga0070702_100001606
560 Ga0070702_100080468
561 Ga0070702_100178062
562 Ga0068852_100226867
563 Ga0068852_100318983
564 Ga0068852_100340932
565 Ga0068859_100007489
566 Ga0068859_100044266
567 Ga0068859_100169667
568 Ga0068859_100170064
569 Ga0068859_100332570
570 Ga0068859_100507522
571 Ga0068864_100019238
572 Ga0068864_100209341
573 Ga0068866_10001052
574 Ga0068866_10151143
575 Ga0068861_100005819
576 Ga0068861_100085202
577 Ga0068861_100464128
578 Ga0068851_10059051
579 Ga0068870_10163003
580 Ga0068870_10377037
581 Ga0068863_100108860
582 Ga0068863_100152436
583 Ga0068858_100041162
584 Ga0068858_100910328
585 Ga0068860_100008544
586 Ga0068860_100077424
587 Ga0068860_100187499
588 Ga0068860_100244181
589 Ga0068860_100463487
590 Ga0068862_100006530
591 Ga0068862_100033910
592 Ga0068862_100068658
593 Ga0068862_100500670
594 Ga0081455_10030487
595 Ga0081539_10008310
596 Ga0075365_10003183
597 Ga0075363_100001699
598 Ga0075363_100002169
599 Ga0075363_100025032
600 Ga0075364_10005595
601 Ga0070715_10015883
602 Ga0070712_100007831
603 Ga0075362_10145912
604 Ga0075367_10008914
605 Ga0097621_100004229
606 Ga0097621_100031428
607 Ga0097621_100451419
608 Ga0075370_10031589
609 Ga0068871_100008400
610 Ga0068871_100025254
611 Ga0068871_100471200
612 Ga0075428_100359603
613 Ga0075428_101055576
614 Ga0075430_100005697
615 Ga0075431_100035172
616 Ga0075429_100015596
617 Ga0068865_100052557
618 Ga0068865_100355956
619 Ga0097620_100007489
620 Ga0097620_100044267
621 Ga0097620_100169667
622 Ga0097620_100170068
623 Ga0097620_100332577
624 Ga0097620_100507524
625 Ga0099795_10001329
626 Ga0111539_10029460
627 Ga0111539_10058007
628 Ga0105245_10007898
629 Ga0105245_10009208
630 Ga0105245_10049477
631 Ga0105247_10000810
632 Ga0105247_10127044
633 Ga0114129_10008637
634 Ga0114129_10869912
635 Ga0105243_10001844
636 Ga0105243_10518511
637 Ga0105241_10029462
638 Ga0105241_10174488
639 Ga0105241_10380166
640 Ga0105242_10002336
641 Ga0105242_10580574
642 Ga0105248_10004796
643 Ga0105248_10005731
644 Ga0105248_10251340
645 Ga0105237_10022291
646 Ga0105238_10055448
647 Ga0105238_10107177
648 Ga0105249_10002828
649 Ga0105249_10182574
650 Ga0099796_10000539
651 Ga0105239_10010801
652 Ga0105239_10017556
653 Ga0105239_10120823
654 Ga0105239_10184217
655 Ga0105239_10211815
656 Ga0105239_10274855
657 Ga0105239_10864131
658 Ga0105246_10387640
659 Ga0157374_10011234
660 Ga0157378_10022335
661 Ga0163162_10007343
662 Ga0163162_10015887
663 Ga0157372_10038397
664 Ga0157375_10005756
665 Ga0157375_10020820
666 Ga0157375_10092696
667 Ga0163163_10005930
668 Ga0163163_10257950
669 Ga0157380_10002508
670 Ga0157380_10323214
671 Ga0157377_10006958
672 Ga0157377_10031159
673 Ga0157379_10436015
674 Ga0163161_10001383
675 Ga0163161_10255329
676 Ga0209051_1000014
677 Ga0207656_10082544
678 Ga0207692_10039696
679 Ga0207642_10033330
680 Ga0207642_10061943
681 Ga0207710_10006063
682 Ga0207688_10000359
683 Ga0207688_10002756
684 Ga0207688_10008944
685 Ga0207680_10029417
686 Ga0207647_10002723
687 Ga0207647_10059610
688 Ga0207647_10068846
689 Ga0207685_10038675
690 Ga0207645_10009881
691 Ga0207645_10092079
692 Ga0207643_10137906
693 Ga0207654_10173663
694 Ga0207671_10046633
695 Ga0207671_10281313
696 Ga0207693_10011125
697 Ga0207663_10100341
698 Ga0207660_10197999
699 Ga0207662_10087084
700 Ga0207657_10062185
701 Ga0207657_10149695
702 Ga0207649_10688090
703 Ga0207681_10351342
704 Ga0207694_10032243
705 Ga0207650_10134256
706 Ga0207650_10313420
707 Ga0207659_10010723
708 Ga0207687_10006680
709 Ga0207687_10029275
710 Ga0207644_10298252
711 Ga0207690_10032321
712 Ga0207690_10130353
713 Ga0207706_10005061
714 Ga0207706_10075281
715 Ga0207686_10156163
716 Ga0207709_10034121
717 Ga0207670_10200672
718 Ga0207669_10002213
719 Ga0207669_10135547
720 Ga0207704_10000596
721 Ga0207704_10377967
722 Ga0207665_10002231
723 Ga0207691_10078430
724 Ga0207691_10087795
725 Ga0207691_10440810
726 Ga0207711_10102418
727 Ga0207711_10246830
728 Ga0207689_10014112
729 Ga0207689_10053449
730 Ga0207689_10121041
731 Ga0207689_10152642
732 Ga0207661_10006625
733 Ga0207679_10303704
734 Ga0207651_10279898
735 Ga0207668_10027304
736 Ga0207640_10032609
737 Ga0207640_10144518
738 Ga0207658_10002141
739 Ga0207658_10124375
740 Ga0207677_10001139
741 Ga0207677_10013968
742 Ga0207703_10172757
743 Ga0207703_10531182
744 Ga0207639_10595334
745 Ga0207678_10011284
746 Ga0207678_10013729
747 Ga0207678_10015195
748 Ga0207678_10073407
749 Ga0207678_10270918
750 Ga0207708_10003300
751 Ga0207708_10008248
752 Ga0207708_10045936
753 Ga0207708_10411412
754 Ga0207641_10087979
755 Ga0207641_10152489
756 Ga0207648_10009748
757 Ga0207648_10157547
758 Ga0207648_10232502
759 Ga0207648_10300566
760 Ga0207676_10008280
761 Ga0207676_10463497
762 Ga0207675_100001290
763 Ga0207675_100040786
764 Ga0207675_100040837
765 Ga0207675_100373746
766 Ga0207683_10000669
767 Ga0207683_10051295
768 Ga0207698_10593309
769 Ga0209179_1000453
770 Ga0209974_10019391
771 Ga0207428_10060059
772 Ga0268266_10029270
773 Ga0268266_10615995
774 Ga0268265_10010042
775 Ga0268265_10070635
776 Ga0268265_10115942
777 Ga0268264_10558000
778 Ga0307515_10006238
779 Ga0307515_10174583
780 Ga0265327_10001755
781 Ga0307513_10118950
782 Ga0307508_10326621
783 Ga0316576_10000265
784 Ga0307406_10051389
785 Ga0307406_10285830
786 Ga0307407_10112242
787 Ga0307416_100767189
788 Ga0307414_10142046
789 Ga0307411_10047173
790 Ga0307415_100010197
791 Ga0307415_100070350
792 Ga0307415_100176283
793 Ga0307415_100397077
794 Ga0373931_0020107
795 Ga0395900_0080742
796 Ga0395900_0462598
797 Ga0395898_0044269
798 Ga0395905_0209134
799 Ga0395901_0756120
800 Ga0451793_0108552
801 Ga0439450_018662
802 Ga0466972_0117460
803 Ga0466965_0014428
804 Ga0466960_0001444
805 Ga0495629_0016221
806 Ga0495641_0024039
807 Ga0495582_0104358
808 Ga0495597_0126619
809 Ga0495646_0071443
810 Ga0495624_0105595
811 Ga0495581_0075960
812 Ga0495604_0258205
813 Ga0495676_0051501
814 Ga0495593_0043567
815 Ga0496100_0000043
816 Ga0496100_0031191
817 Ga0496101_0000149
818 Ga0496101_0000477
819 Ga0496102_0015005
820 Ga0496102_0048439
821 Ga0496102_0049019
822 Ga0496103_0000152
823 Ga0496103_0008632
824 Ga0496103_0185544
825 Ga0496104_0052258
826 Ga0496104_0088159
827 Ga0496104_0096464
828 Ga0496104_0205822
829 Ga0496105_0061862
830 Ga0496105_0132769
831 Ga0496106_0000341
832 Ga0496106_0000382
833 Ga0496107_0005114
834 Ga0496107_0030782
835 Ga0496108_0008462
836 Ga0496108_0015700
837 Ga0496108_0021532
838 Ga0496108_0142459
839 Ga0496109_0000194
840 Ga0496109_0014698
841 Ga0496110_0005202
842 Ga0496110_0013300
843 Ga0496111_0011823
844 Ga0496112_0002793
845 Ga0496112_0051723
846 Ga0496112_0253132
847 Ga0496113_0026101
848 Ga0496114_0000548
849 Ga0496114_0013916
850 Ga0496115_0042855
851 Ga0496116_0002353
852 Ga0496117_0009215
853 Ga0496118_0018054
854 Ga0496119_0001288
855 Ga0496121_0000048
856 Ga0496122_0000301
857 Ga0496124_0000044
858 Ga0496125_0000037
859 Ga0496126_0000046
860 Ga0496126_0563089
861 Ga0501306_000840
862 Ga0501308_014567
863 Ga0501309_000614
864 Ga0501310_000284
865 Ga0501310_000781
866 Ga0501304_011091
867 Ga0501305_000865
868 Ga0501307_016416
869 Ga0501311_021739
870 Ga0501312_001019
871 Ga0501313_012439
872 Ga0501316_020892
873 Ga0501320_000261
874 Ga0501322_002696
875 Ga0501323_010369
876 Ga0501324_009591
877 Ga0501032_0023222
878 Ga0501036_0162121
879 Ga0501037_0000068
880 Ga0501037_0001241
881 Ga0501038_0130594
882 Ga0501039_0080905
883 Ga0501043_0000200
884 Ga0501043_0003961
885 Ga0501047_0302809
886 Ga0501068_0408161
887 Ga0501069_0000001
888 Ga0501070_0000307
889 Ga0501070_0015075
890 Ga0501071_0027940
891 Ga0501074_0001131
892 Ga0501080_0011927
893 Ga0501083_0000068
894 Ga0501035_0000111
895 Ga0501044_0000621
896 Ga0501044_0031840
897 nmdc:mga03n38_3948_c1
898 nmdc:mga06z11_12214_c1
899 nmdc:mga07m45_15628_c1
900 nmdc:mga05p37_11304_c1
901 nmdc:mga05p37_58518_c1
902 nmdc:mga09592_11944_c1
903 nmdc:mga09592_71163_c1
904 nmdc:mga06r32_491622_c1
905 nmdc:mga08y16_30839_c1
906 nmdc:mga08y16_52908_c1
907 Ga0495655_0041603
908 Ga0495595_0343294
909 Ga0495619_0012611
910 Ga0495619_0068680
911 Ga0500583_0001444
912 Ga0500641_0024380
913 Ga0500591_063986
914 Ga0500637_0121827
915 2676485156
916 2738663855
917 2739142990
918 2816508639
919 2861526998
920 8003834777

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00455

DeoRC

DeoR C terminal sensor domain

120

279

0.99

PF08220

HTH_DeoR

DeoR-like helix-turn-helix domain

53

108

0.95

PF08279

HTH_11

HTH domain

53

110

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
7l6l-assembly1.cif.gz_E crystal structure of the dna-binding transcriptional repressor deor from escherichia coli str. k-12 0.9291 122 297
7l6l-assembly1.cif.gz_E crystal structure of the dna-binding transcriptional repressor deor from escherichia coli str. k-12 0.9143 122 297
4a12-assembly1.cif.gz_B structure of the global transcription regulator fapr from staphylococcus aureus in complex with dna operator 0.8701 51 91
4awx-assembly1.cif.gz_B moonlighting functions of feoc in the regulation of ferrous iron transport in feo 0.8628 54 105
2qlz-assembly2.cif.gz_C crystal structure of transcription factor pf0095 from pyrococcus furiosus 0.8621 54 109
ID Description Score Start End Superfamily
af_P36930_3_62_1.20.58.390 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Neurotransmitter-gated ion-channel transmembrane domain 0.9915 48 105 1.20.58.390
af_P77721_6_62_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9831 54 105 1.10.10.10
af_P0ACL0_1_57_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9689 48 104 1.10.10.10
af_P0A9W0_3_58_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9667 51 104 1.10.10.10
af_P39361_78_236_3.40.50.1360 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9629 121 277 3.40.50.1360
ID Description Score Start End GO Terms
AF-A0A175QQN0-F1-model_v4 DeoR faimly transcriptional regulator 0.997 45 105 GO:0003677
GO:0003700
AF-X1IZN9-F1-model_v4 DeoR-like transcriptional repressor C-terminal sensor domain-containing protein 0.9908 216 299
AF-A0A6V8KKT7-F1-model_v4 DeoR-like transcriptional repressor C-terminal sensor domain-containing protein 0.9886 207 299
AF-X1IZN9-F1-model_v4 DeoR-like transcriptional repressor C-terminal sensor domain-containing protein 0.9793 216 299
AF-A0A645FCE5-F1-model_v4 HTH-type transcriptional repressor GlcR 0.9758 210 299

Map