F437580

General Info

Members Datasets Scaffolds Average Seq Length
411 255 380 173

Family's Representative Sequence

Representative Sequence 3300041404|Ga0439436_0004836|Ga0439436_0004836_2653_3258
Length 201
Sequence LRWHEAAANGADLLFFSPQPRLRHMTAERDFIPLRLCVLTVSDSRTLAEDSSGDYLVQSLSEAGHRLAERRLLPDDRYRLRAAVSQWIADPEIDGVLVTGGTGFTGRDSTPEALLPLLDKEMPGFGELFRSLSFEEIGTSTLQSRAFAGLANATFVFCLPGSTSACRTAWEKIIRAQLDARTRPCNLATLRPRLLEPTHKE

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2524614729 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
3 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
4 2627854209 Arenimonas oryziterrae YC6267, DSM 21050 Isolate Rhizosphere
5 2643221559 Lysobacter sp. Root559 Isolate Unclassified
6 2643221573 Lysobacter sp. Root604 Isolate Unclassified
7 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
8 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
9 2643221586 Lysobacter sp. Root667 Isolate Unclassified
10 2643221593 Lysobacter sp. Root690 Isolate Unclassified
11 2643221612 Lysobacter sp. Root76 Isolate Unclassified
12 2643221720 Lysobacter sp. Root916 Isolate Unclassified
13 2643221727 Lysobacter sp. Root96 Isolate Unclassified
14 2643221728 Lysobacter sp. Root983 Isolate Unclassified
15 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
16 2818991457 Xanthomonas translucens 569 Isolate Unclassified
17 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
18 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
19 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
20 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
21 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
22 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
23 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
24 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
25 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
26 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
27 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
28 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
29 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
30 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
31 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
32 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
33 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
34 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
35 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
36 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
37 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
38 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
39 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
40 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
41 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
42 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
43 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
44 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
45 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
46 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
47 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
48 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
49 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
50 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
51 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
69 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
72 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013874 Rhizosphere microbial communities from switchgrass harvested rhizosphere in Austin, TX, USA - RS_213 Metagenome Rhizosphere
76 3300013875 Rhizosphere microbial communities from switchgrass unharvested rhizosphere in Austin, TX, USA - RS_233 Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
82 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
83 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
84 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
85 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
88 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
91 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
93 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
125 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
126 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
127 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
128 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
129 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
130 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
131 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
132 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
133 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
134 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
135 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
136 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
137 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
138 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
139 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
140 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
141 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
142 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
143 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
144 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
145 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
146 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
147 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
148 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
149 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
150 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
151 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
152 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
153 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
154 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
155 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
156 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
157 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
158 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
159 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
160 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
161 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
162 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
163 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
164 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
165 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
166 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
167 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
168 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
169 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
170 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
171 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
172 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
173 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
174 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
175 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
176 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
177 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
178 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
179 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
180 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
181 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
182 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
183 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
184 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
185 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
186 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
187 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
188 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
189 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
190 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
191 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
192 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
193 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
194 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
195 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
196 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
197 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
198 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
199 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
200 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
201 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
202 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
203 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
204 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
205 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
206 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
207 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
208 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
209 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
210 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
211 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
212 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
213 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
214 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
215 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
216 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
229 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
230 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
231 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
232 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
233 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
234 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
235 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
236 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
237 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
238 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
239 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
240 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
241 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
242 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
243 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
246 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
247 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
248 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
249 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
250 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
251 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
252 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
253 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
254 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
255 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.46
Metatranscriptomes 0
Isolates 7.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.65
Nodule 0
Rhizoplane 6.33
Rhizosphere 60.83
Stem 0
Stem Tuber 0
Unclassified 11.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3845428 2162886007 Bacteria 2488
2 SwRhRL2b_contig_440373 2162886007 Bacteria 2225
3 JGI25152J39213_1000480 3300002773 Bacteria 22834
4 JGI25150J39212_1000356 3300002774 Bacteria 22473
5 JGI25150J39212_1029777 3300002774 Bacteria 763
6 JGI25151J46595_10000676 3300003187 Bacteria 28829
7 JGI25151J46595_10000924 3300003187 Bacteria 22834
8 JGI25151J46595_10015338 3300003187 Bacteria 3380
9 JGI25151J46595_10029237 3300003187 Bacteria 2184
10 JGI25153J46596_10000050 3300003215 Bacteria 140710
11 Ga0055526_1000124 3300003771 Bacteria 68139
12 Ga0055526_1056417 3300003771 Bacteria 860
13 Ga0055526_1071251 3300003771 Bacteria 704
14 Ga0055537_1000351 3300003773 Bacteria 31332
15 Ga0055524_1000188 3300003775 Bacteria 68244
16 Ga0055524_1003485 3300003775 Bacteria 7626
17 Ga0055524_1010063 3300003775 Bacteria 3792
18 Ga0055524_1057554 3300003775 Bacteria 829
19 Ga0055536_1002108 3300003781 Bacteria 11321
20 Ga0055536_1003924 3300003781 Bacteria 7799
21 Ga0055536_1011849 3300003781 Bacteria 3293
22 Ga0055536_1022616 3300003781 Bacteria 1871
23 Ga0055534_1000108 3300003784 Bacteria 61496
24 Ga0055534_1041576 3300003784 Bacteria 675
25 Ga0055528_1000102 3300003790 Bacteria 68139
26 Ga0055530_10014200 3300003791 Bacteria 2666
27 Ga0055531_10002096 3300003794 Bacteria 13693
28 Ga0055531_10002569 3300003794 Bacteria 12052
29 Ga0055531_10011069 3300003794 Bacteria 4402
30 Ga0055531_10013553 3300003794 Bacteria 3749
31 Ga0055531_10027918 3300003794 Bacteria 1962
32 Ga0055531_10054827 3300003794 Bacteria 1019
33 Ga0058692_1000032 3300003856 Bacteria 179581
34 Ga0065714_10115774 3300005288 Bacteria 1411
35 Ga0065704_10071251 3300005289 Bacteria 12240
36 Ga0065704_10078342 3300005289 Bacteria 4460
37 Ga0070676_10221254 3300005328 Bacteria 1250
38 Ga0070670_100005259 3300005331 Bacteria 10902
39 Ga0068868_100106169 3300005338 Bacteria 2278
40 Ga0070669_100052094 3300005353 Bacteria 2993
41 Ga0070671_100028673 3300005355 Bacteria 4586
42 Ga0070671_100080063 3300005355 Bacteria 2731
43 Ga0070674_100016109 3300005356 Bacteria 4683
44 Ga0070673_100135673 3300005364 Bacteria 2071
45 Ga0070673_100238013 3300005364 Bacteria 1582
46 Ga0070667_100277547 3300005367 Bacteria 1504
47 Ga0070667_100923225 3300005367 Bacteria 813
48 Ga0068867_100096762 3300005459 Bacteria 2248
49 Ga0068853_100156106 3300005539 Bacteria 2056
50 Ga0070672_100000577 3300005543 Bacteria 21558
51 Ga0070672_100146893 3300005543 Bacteria 1948
52 Ga0070665_101168218 3300005548 Bacteria 781
53 Ga0068855_101071856 3300005563 Bacteria 844
54 Ga0068864_100864186 3300005618 Bacteria 892
55 Ga0068862_100071796 3300005844 Bacteria 2989
56 Ga0075365_10514028 3300006038 Bacteria 847
57 Ga0075364_10000625 3300006051 Bacteria 18201
58 Ga0075364_10134033 3300006051 Bacteria 1664
59 Ga0075362_10288022 3300006177 Bacteria 813
60 Ga0075366_10446475 3300006195 Bacteria 798
61 Ga0105251_10002229 3300009011 Bacteria 15465
62 Ga0105240_10029288 3300009093 Bacteria 7177
63 Ga0105243_10023660 3300009148 Bacteria 4681
64 Ga0105243_10505914 3300009148 Bacteria 1146
65 Ga0105248_10910761 3300009177 Bacteria 993
66 Ga0105237_10340468 3300009545 Bacteria 1504
67 Ga0105030_107673 3300009987 Bacteria 916
68 Ga0105035_120238 3300009988 Bacteria 631
69 Ga0105246_10086626 3300011119 Bacteria 2246
70 Ga0157318_1000915 3300012482 Bacteria 1386
71 Ga0157345_1017862 3300012498 Bacteria 695
72 Ga0157371_10920085 3300013102 Bacteria 664
73 Ga0157374_10258525 3300013296 Bacteria 1715
74 Ga0157514_112427 3300013874 Bacteria 916
75 Ga0157515_133431 3300013875 Bacteria 631
76 Ga0163163_10933929 3300014325 Bacteria 931
77 Ga0157380_10186658 3300014326 Bacteria 1827
78 Ga0182008_10103090 3300014497 Bacteria 1411
79 Ga0157376_11671538 3300014969 Bacteria 672
80 Ga0182005_1008030 3300015265 Bacteria 3131
81 Ga0183360_10001 3300015689 Bacteria 3943671
82 Ga0207425_1000117 3300025245 Bacteria 74911
83 Ga0207425_1006385 3300025245 Bacteria 3230
84 Ga0209129_1000011 3300025258 Bacteria 568657
85 Ga0209565_1000001 3300025263 Bacteria 2950419
86 Ga0209673_1000001 3300025273 Bacteria 3176258
87 Ga0209673_1005553 3300025273 Bacteria 6309
88 Ga0209673_1060509 3300025273 Bacteria 949
89 Ga0209673_1063010 3300025273 Bacteria 916
90 Ga0209130_1006144 3300025284 Bacteria 3963
91 Ga0209675_1000001 3300025291 Bacteria 2950293
92 Ga0209675_1010658 3300025291 Bacteria 3116
93 Ga0209675_1016501 3300025291 Bacteria 2147
94 Ga0209676_1000436 3300025292 Bacteria 72143
95 Ga0209676_1001557 3300025292 Bacteria 20542
96 Ga0209676_1001981 3300025292 Bacteria 16305
97 Ga0209676_1002305 3300025292 Bacteria 13899
98 Ga0209676_1002769 3300025292 Bacteria 11711
99 Ga0209676_1004360 3300025292 Bacteria 7921
100 Ga0209676_1005388 3300025292 Bacteria 6712
101 Ga0209676_1006571 3300025292 Bacteria 5699
102 Ga0209025_1000002 3300025294 Bacteria 1393142
103 Ga0209025_1000006 3300025294 Bacteria 1153444
104 Ga0209025_1000564 3300025294 Bacteria 67936
105 Ga0209025_1019266 3300025294 Bacteria 3802
106 Ga0209025_1137077 3300025294 Bacteria 700
107 Ga0209564_1000001 3300025295 Bacteria 3176258
108 Ga0209564_1047968 3300025295 Bacteria 1071
109 Ga0209564_1047969 3300025295 Bacteria 1071
110 Ga0209758_1000003 3300025297 Bacteria 1398533
111 Ga0209758_1040999 3300025297 Bacteria 1738
112 Ga0209758_1062907 3300025297 Bacteria 1212
113 Ga0209050_1005567 3300025298 Bacteria 7836
114 Ga0209050_1007405 3300025298 Bacteria 6165
115 Ga0209050_1057507 3300025298 Bacteria 940
116 Ga0209256_1000006 3300025299 Bacteria 1250310
117 Ga0209256_1002374 3300025299 Bacteria 15525
118 Ga0209256_1002733 3300025299 Bacteria 13643
119 Ga0209256_1025187 3300025299 Bacteria 1738
120 Ga0209051_1020202 3300025303 Bacteria 2877
121 Ga0209257_1000343 3300025304 Bacteria 96876
122 Ga0209257_1000567 3300025304 Bacteria 62634
123 Ga0209257_1000738 3300025304 Bacteria 49567
124 Ga0209257_1000788 3300025304 Bacteria 46352
125 Ga0209257_1002327 3300025304 Bacteria 19162
126 Ga0209257_1004934 3300025304 Bacteria 9799
127 Ga0209257_1006402 3300025304 Bacteria 7604
128 Ga0207713_1000294 3300025735 Bacteria 57476
129 Ga0207680_10394770 3300025903 Bacteria 977
130 Ga0207645_10184833 3300025907 Bacteria 1368
131 Ga0207695_10010702 3300025913 Bacteria 11200
132 Ga0207650_10013553 3300025925 Bacteria 5648
133 Ga0207650_10072802 3300025925 Bacteria 2587
134 Ga0207650_10613707 3300025925 Bacteria 915
135 Ga0207650_10646909 3300025925 Bacteria 891
136 Ga0207644_10133320 3300025931 Bacteria 1904
137 Ga0207644_10261962 3300025931 Bacteria 1383
138 Ga0207644_10378913 3300025931 Bacteria 1153
139 Ga0207709_10394515 3300025935 Bacteria 1056
140 Ga0207670_10226561 3300025936 Bacteria 1434
141 Ga0207691_10008799 3300025940 Bacteria 9681
142 Ga0207661_10118219 3300025944 Bacteria 2253
143 Ga0207668_10037422 3300025972 Bacteria 3247
144 Ga0207677_10132843 3300026023 Bacteria 1893
145 Ga0207708_10968656 3300026075 Bacteria 738
146 Ga0207676_10609300 3300026095 Bacteria 1050
147 Ga0207683_10093680 3300026121 Bacteria 2677
148 Ga0209371_1000055 3300027312 Bacteria 257599
149 Ga0209967_1032709 3300027364 Bacteria 780
150 Ga0209984_1029591 3300027424 Bacteria 772
151 Ga0209995_1016608 3300027471 Bacteria 1210
152 Ga0209999_1022095 3300027543 Bacteria 1170
153 Ga0209982_1008033 3300027552 Bacteria 1544
154 Ga0209970_1001244 3300027614 Bacteria 4502
155 Ga0210002_1052901 3300027617 Bacteria 701
156 Ga0209983_1005407 3300027665 Bacteria 2647
157 Ga0209971_1005688 3300027682 Bacteria 2956
158 Ga0268266_10837479 3300028379 Bacteria 889
159 Ga0268266_10929040 3300028379 Bacteria 842
160 Ga0268265_10044957 3300028380 Bacteria 3292
161 Ga0268256_1000054 3300030500 Bacteria 257599
162 Ga0316177_1019888 3300030731 Bacteria 3467
163 Ga0314311_1002365 3300030733 Bacteria 2551
164 Ga0316182_1085314 3300030745 Bacteria 3184
165 Ga0307513_10003461 3300031456 Bacteria 21352
166 Ga0307513_10138265 3300031456 Bacteria 2367
167 Ga0307408_100043501 3300031548 Bacteria 3196
168 Ga0307408_100097636 3300031548 Bacteria 2232
169 Ga0307408_100561274 3300031548 Bacteria 1009
170 Ga0307516_10093454 3300031730 Bacteria 2833
171 Ga0307516_10315010 3300031730 Bacteria 1237
172 Ga0307405_10296419 3300031731 Bacteria 1224
173 Ga0307413_10006589 3300031824 Bacteria 5319
174 Ga0307413_10043280 3300031824 Bacteria 2653
175 Ga0307413_10155336 3300031824 Bacteria 1600
176 Ga0307413_10447161 3300031824 Bacteria 1025
177 Ga0307410_10112774 3300031852 Bacteria 1970
178 Ga0307410_10455284 3300031852 Bacteria 1045
179 Ga0307406_10011312 3300031901 Bacteria 5062
180 Ga0307406_10013777 3300031901 Bacteria 4638
181 Ga0307406_10200612 3300031901 Bacteria 1468
182 Ga0307407_10080993 3300031903 Bacteria 1963
183 Ga0307407_10441542 3300031903 Bacteria 942
184 Ga0307412_10034205 3300031911 Bacteria 3238
185 Ga0307412_10161731 3300031911 Bacteria 1664
186 Ga0307412_10690818 3300031911 Bacteria 875
187 Ga0307412_10806268 3300031911 Bacteria 815
188 Ga0307412_11051951 3300031911 Bacteria 722
189 Ga0307409_100030243 3300031995 Bacteria 3888
190 Ga0307409_100385983 3300031995 Bacteria 1333
191 Ga0307409_100690608 3300031995 Bacteria 1019
192 Ga0307416_100055265 3300032002 Bacteria 3196
193 Ga0307416_100090621 3300032002 Bacteria 2623
194 Ga0307414_10002922 3300032004 Bacteria 9035
195 Ga0307414_10090827 3300032004 Bacteria 2268
196 Ga0307414_10136927 3300032004 Bacteria 1911
197 Ga0307414_10272551 3300032004 Bacteria 1418
198 Ga0307414_10747110 3300032004 Bacteria 889
199 Ga0307414_10776771 3300032004 Bacteria 872
200 Ga0307414_10887301 3300032004 Bacteria 817
201 Ga0307414_11071096 3300032004 Bacteria 744
202 Ga0307411_10095683 3300032005 Bacteria 2086
203 Ga0307411_10168536 3300032005 Bacteria 1649
204 Ga0307411_10614693 3300032005 Bacteria 936
205 Ga0307415_100490020 3300032126 Bacteria 1072
206 Ga0307415_100534800 3300032126 Bacteria 1031
207 Ga0307415_100548011 3300032126 Bacteria 1020
208 Ga0307415_101156192 3300032126 Bacteria 727
209 Ga0395899_0022853 3300037312 Bacteria 4738
210 Ga0395900_0028616 3300037418 Bacteria 5711
211 Ga0395898_0058673 3300037466 Bacteria 3746
212 Ga0395905_0002340 3300037471 Bacteria 21136
213 Ga0395905_0075886 3300037471 Bacteria 3150
214 Ga0395905_0118577 3300037471 Bacteria 2487
215 Ga0395901_0002043 3300038443 Bacteria 20724
216 Ga0237819_00412 3300038705 Bacteria 14816
217 Ga0237819_04909 3300038705 Bacteria 2145
218 Ga0237816_00086 3300039145 Bacteria 6647
219 Ga0439436_0004836 3300041404 Bacteria 4133
220 Ga0439436_0046305 3300041404 Bacteria 1236
221 Ga0439436_0091977 3300041404 Bacteria 845
222 Ga0439439_0007005 3300041406 Bacteria 2625
223 Ga0439439_0024518 3300041406 Bacteria 1515
224 Ga0439439_0103971 3300041406 Bacteria 783
225 Ga0439447_002198 3300041407 Bacteria 7152
226 Ga0439461_0079168 3300041410 Bacteria 773
227 Ga0439465_0000362 3300041413 Bacteria 12994
228 Ga0439465_0005244 3300041413 Bacteria 4149
229 Ga0439465_0016272 3300041413 Bacteria 2320
230 Ga0439465_0030025 3300041413 Bacteria 1728
231 Ga0439465_0061335 3300041413 Bacteria 1246
232 Ga0439465_0143996 3300041413 Bacteria 848
233 Ga0451789_0689845 3300041443 Bacteria 1782
234 Ga0451791_0228750 3300041451 Bacteria 1935
235 Ga0451791_1101586 3300041451 Bacteria 1012
236 Ga0451797_0493669 3300041453 Bacteria 2424
237 Ga0451797_0598154 3300041453 Bacteria 1538
238 Ga0451797_0943323 3300041453 Bacteria 676
239 Ga0451797_1231087 3300041453 Bacteria 874
240 Ga0451797_1398069 3300041453 Bacteria 747
241 Ga0451797_1413463 3300041453 Bacteria 1408
242 Ga0451795_0735229 3300041456 Bacteria 1280
243 Ga0451798_0478081 3300041458 Bacteria 961
244 Ga0451800_0514176 3300041459 Bacteria 6401
245 Ga0451802_0869472 3300041460 Bacteria 2384
246 Ga0451806_112225 3300041462 Bacteria 6097
247 Ga0451804_0844979 3300041463 Bacteria 3836
248 Ga0451807_0495113 3300041486 Bacteria 1126
249 Ga0451807_1026549 3300041486 Bacteria 3848
250 Ga0451837_0624323 3300041494 Bacteria 1690
251 Ga0451837_1025625 3300041494 Bacteria 2970
252 Ga0451837_1747075 3300041494 Bacteria 2756
253 Ga0451851_0044262 3300041507 Bacteria 1196
254 Ga0451843_0988962 3300041509 Bacteria 1130
255 Ga0451843_1204059 3300041509 Bacteria 1487
256 Ga0439431_0031747 3300041997 Bacteria 1314
257 Ga0439433_0051554 3300041999 Bacteria 971
258 Ga0439445_0004816 3300042004 Bacteria 3063
259 Ga0439445_0018213 3300042004 Bacteria 1741
260 Ga0439432_005990 3300042006 Bacteria 4362
261 Ga0439432_015006 3300042006 Bacteria 2618
262 Ga0439449_0004898 3300042007 Bacteria 5156
263 Ga0439449_0007530 3300042007 Bacteria 4136
264 Ga0439449_0009677 3300042007 Bacteria 3648
265 Ga0439449_0023440 3300042007 Bacteria 2308
266 Ga0439462_0004797 3300042015 Bacteria 3316
267 Ga0439446_0049440 3300042156 Bacteria 1254
268 Ga0453684_0001075 3300044712 Bacteria 86968
269 Ga0453684_0732213 3300044712 Bacteria 1072
270 Ga0451576_0000025 3300045051 Bacteria 427980
271 Ga0495638_0036836 3300046460 Bacteria 3114
272 Ga0495650_0119572 3300046471 Bacteria 971
273 Ga0495607_0076045 3300046501 Bacteria 1858
274 Ga0495606_0360582 3300046507 Bacteria 768
275 Ga0495616_0049989 3300046513 Bacteria 2093
276 Ga0495632_0125788 3300046519 Bacteria 1195
277 Ga0495643_0153107 3300046522 Bacteria 1140
278 Ga0495663_0009500 3300046525 Bacteria 2700
279 Ga0495663_0039477 3300046525 Bacteria 1430
280 Ga0495663_0056335 3300046525 Bacteria 1227
281 Ga0495663_0097889 3300046525 Bacteria 963
282 Ga0495663_0319576 3300046525 Bacteria 561
283 Ga0495598_0086316 3300046537 Bacteria 1015
284 Ga0495621_0018448 3300046539 Bacteria 2265
285 Ga0495633_0109232 3300046558 Bacteria 1282
286 Ga0495656_0001213 3300046615 Bacteria 8395
287 Ga0495656_0011020 3300046615 Bacteria 3306
288 Ga0495656_0020511 3300046615 Bacteria 2564
289 Ga0495668_0006902 3300046616 Bacteria 7354
290 Ga0495661_0242240 3300046665 Bacteria 925
291 Ga0495670_0276885 3300046691 Bacteria 897
292 Ga0495671_0030282 3300046692 Bacteria 2772
293 Ga0495636_0001221 3300047318 Bacteria 9710
294 Ga0495636_0131705 3300047318 Bacteria 1112
295 Ga0495636_0197763 3300047318 Bacteria 917
296 Ga0495681_0028334 3300047470 Bacteria 2883
297 Ga0495686_0068036 3300047472 Bacteria 2197
298 Ga0495615_0127172 3300048090 Bacteria 742
299 Ga0496100_0029977 3300048903 Bacteria 3370
300 Ga0496100_0594769 3300048903 Bacteria 859
301 Ga0496101_0113131 3300048904 Bacteria 2045
302 Ga0496102_0678895 3300048905 Bacteria 953
303 Ga0496109_0043544 3300048912 Bacteria 4069
304 Ga0496109_0609314 3300048912 Bacteria 1028
305 Ga0496110_0613098 3300048913 Bacteria 987
306 Ga0496114_0007208 3300048917 Bacteria 8778
307 Ga0496115_0695418 3300048918 Bacteria 800
308 Ga0496116_0130572 3300048919 Bacteria 1433
309 Ga0496117_0003368 3300048920 Bacteria 18629
310 Ga0496117_0192345 3300048920 Bacteria 1161
311 Ga0496118_0013515 3300048921 Bacteria 7712
312 Ga0496118_0100692 3300048921 Bacteria 1953
313 Ga0496119_0002089 3300048922 Bacteria 22562
314 Ga0496120_0000537 3300048923 Bacteria 58209
315 Ga0496121_0002935 3300048924 Bacteria 24926
316 Ga0496122_0000859 3300048925 Bacteria 57207
317 Ga0496122_0012523 3300048925 Bacteria 8431
318 Ga0496122_0051417 3300048925 Bacteria 3131
319 Ga0496123_0000417 3300048926 Bacteria 77334
320 Ga0496123_0006439 3300048926 Bacteria 11374
321 Ga0496124_0000052 3300048927 Bacteria 252750
322 Ga0496124_0000653 3300048927 Bacteria 57229
323 Ga0496125_0090524 3300048928 Bacteria 2296
324 Ga0496126_0011689 3300048929 Bacteria 9053
325 Ga0496126_0043826 3300048929 Bacteria 4125
326 Ga0501290_002722 3300049513 Bacteria 2263
327 Ga0501300_003078 3300049523 Bacteria 2489
328 Ga0501031_0043413 3300049568 Bacteria 2934
329 Ga0501031_0091532 3300049568 Bacteria 1984
330 Ga0501032_0005929 3300049569 Bacteria 9025
331 Ga0501032_0008336 3300049569 Bacteria 7554
332 Ga0501032_0641966 3300049569 Bacteria 674
333 Ga0501033_0205509 3300049570 Bacteria 1406
334 Ga0501034_0000636 3300049571 Bacteria 54505
335 Ga0501034_0001777 3300049571 Bacteria 27560
336 Ga0501034_0004664 3300049571 Bacteria 15185
337 Ga0501034_0060996 3300049571 Bacteria 3788
338 Ga0501036_0034775 3300049572 Bacteria 4263
339 Ga0501036_0118911 3300049572 Bacteria 2231
340 Ga0501037_0003917 3300049573 Bacteria 10799
341 Ga0501037_0400426 3300049573 Bacteria 941
342 Ga0501038_0005610 3300049574 Bacteria 11648
343 Ga0501039_0306308 3300049575 Bacteria 1249
344 Ga0501039_0394886 3300049575 Bacteria 1086
345 Ga0501042_0605477 3300049578 Bacteria 797
346 Ga0501043_0001529 3300049579 Bacteria 20190
347 Ga0501043_0008837 3300049579 Bacteria 7928
348 Ga0501046_0465985 3300049580 Bacteria 907
349 Ga0501047_0215165 3300049581 Bacteria 1779
350 Ga0501047_0563726 3300049581 Bacteria 962
351 Ga0501067_0338580 3300049583 Bacteria 838
352 Ga0501069_0541772 3300049585 Bacteria 696
353 Ga0501070_0163106 3300049586 Bacteria 1837
354 Ga0501070_0225766 3300049586 Bacteria 1535
355 Ga0501073_0000635 3300049589 Bacteria 24608
356 Ga0501074_0031329 3300049590 Bacteria 3853
357 Ga0501198_059533 3300049649 Bacteria 698
358 Ga0501252_006799 3300049682 Bacteria 1281
359 Ga0501253_092088 3300049683 Bacteria 699
360 Ga0501257_118549 3300049686 Bacteria 707
361 Ga0501080_0002738 3300049742 Bacteria 15466
362 Ga0501080_0358809 3300049742 Bacteria 1315
363 Ga0501083_0007757 3300049744 Bacteria 7603
364 Ga0501263_017552 3300049760 Bacteria 941
365 Ga0501266_048234 3300049763 Bacteria 652
366 Ga0501268_044831 3300049765 Bacteria 842
367 Ga0501275_000285 3300049772 Bacteria 5737
368 Ga0501035_0021820 3300049822 Bacteria 5884
369 Ga0501044_0027480 3300049823 Bacteria 6012
370 Ga0501044_0054152 3300049823 Bacteria 4125
371 Ga0501045_0914666 3300049824 Bacteria 644
372 nmdc:mga00v17_489_c1 3300050491 Bacteria 22233
373 nmdc:mga00v17_58801_c1 3300050491 Bacteria 2356
374 nmdc:mga00v17_654138_c1 3300050491 Bacteria 676
375 nmdc:mga00v17_96870_c1 3300050491 Bacteria 1859
376 Ga0500643_131239 3300053087 Bacteria 674
377 Ga0500658_0044379 3300053134 Bacteria 1794
378 Ga0500634_0000574 3300053161 Bacteria 12167
379 Ga0500609_016803 3300053731 Bacteria 993
380 Ga0501082_0250493 3300060353 Bacteria 1541

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025944 Ga0207661_10118219 Ga0207661_101182193 159
2 3300049570 Ga0501033_0205509 Ga0501033_0205509_490_981 163
3 iso_pu_bacteria 2524614729 2525556174 167
4 iso_pu_bacteria 2627854209 2630649404 167
5 iso_pu_bacteria 2571042365 2572254544 168
6 iso_pu_bacteria 2643221559 2643815627 168
7 iso_pu_bacteria 2643221573 2643882121 168
8 iso_pu_bacteria 2643221579 2643907300 168
9 iso_pu_bacteria 2643221581 2643915202 168
10 iso_pu_bacteria 2643221586 2643938232 168
11 iso_pu_bacteria 2643221593 2643976383 168
12 iso_pu_bacteria 2643221612 2644079850 168
13 iso_pu_bacteria 2643221720 2644663171 168
14 iso_pu_bacteria 2643221727 2644695999 168
15 iso_pu_bacteria 2643221728 2644699667 168
16 iso_pu_bacteria 2747842501 2748018900 168
17 iso_pu_bacteria 2818991457 2819662748 168
18 iso_pu_bacteria 2842780639 2842781684 168
19 iso_pu_bacteria 2852684882 2852687512 168
20 iso_pu_bacteria 2894414249 2894414476 168
21 iso_pu_bacteria 2895498888 2895501329 168
22 iso_pu_bacteria 2895511927 2895514472 168
23 iso_pu_bacteria 2895522137 2895524046 168
24 iso_pu_bacteria 2895525241 2895527534 168
25 iso_pu_bacteria 2919130084 2919134305 168
26 iso_pu_bacteria 2923516293 2923519259 168
27 iso_pu_bacteria 2929195423 2929198950 168
28 iso_pu_bacteria 2941489479 2941490111 168
29 iso_pu_bacteria 2995948881 2995950330 168
30 iso_pu_bacteria 8003014200 8003015034 168
31 iso_pu_bacteria 8021622325 8021622516 168
32 iso_pu_bacteria 8021626552 8021627976 168
33 iso_pu_bacteria 8021648035 8021652182 168
34 3300005543 Ga0070672_100000577 Ga0070672_10000057720 169
35 3300009093 Ga0105240_10029288 Ga0105240_100292889 169
36 3300009545 Ga0105237_10340468 Ga0105237_103404683 169
37 3300013296 Ga0157374_10258525 Ga0157374_102585253 169
38 3300025913 Ga0207695_10010702 Ga0207695_1001070210 169
39 3300031911 Ga0307412_10034205 Ga0307412_100342054 171
40 3300032004 Ga0307414_11071096 Ga0307414_110710961 171
41 3300032005 Ga0307411_10168536 Ga0307411_101685363 171
42 2162886007 SwRhRL2b_contig_3845428 SwRhRL2b_0169.00003170 172
43 2162886007 SwRhRL2b_contig_440373 SwRhRL2b_0263.00001510 172
44 3300002773 JGI25152J39213_1000480 JGI25152J39213_100048014 172
45 3300002774 JGI25150J39212_1000356 JGI25150J39212_100035613 172
46 3300002774 JGI25150J39212_1029777 JGI25150J39212_10297772 172
47 3300003187 JGI25151J46595_10000676 JGI25151J46595_1000067618 172
48 3300003187 JGI25151J46595_10000924 JGI25151J46595_1000092414 172
49 3300003187 JGI25151J46595_10015338 JGI25151J46595_100153382 172
50 3300003187 JGI25151J46595_10029237 JGI25151J46595_100292372 172
51 3300003215 JGI25153J46596_10000050 JGI25153J46596_10000050172 172
52 3300003771 Ga0055526_1000124 Ga0055526_100012418 172
53 3300003771 Ga0055526_1056417 Ga0055526_10564172 172
54 3300003771 Ga0055526_1071251 Ga0055526_10712511 172
55 3300003773 Ga0055537_1000351 Ga0055537_100035118 172
56 3300003775 Ga0055524_1000188 Ga0055524_100018818 172
57 3300003775 Ga0055524_1003485 Ga0055524_10034857 172
58 3300003775 Ga0055524_1010063 Ga0055524_10100633 172
59 3300003775 Ga0055524_1057554 Ga0055524_10575541 172
60 3300003781 Ga0055536_1002108 Ga0055536_100210814 172
61 3300003781 Ga0055536_1003924 Ga0055536_10039244 172
62 3300003781 Ga0055536_1011849 Ga0055536_10118494 172
63 3300003781 Ga0055536_1022616 Ga0055536_10226162 172
64 3300003784 Ga0055534_1000108 Ga0055534_100010840 172
65 3300003784 Ga0055534_1041576 Ga0055534_10415761 172
66 3300003790 Ga0055528_1000102 Ga0055528_100010218 172
67 3300003791 Ga0055530_10014200 Ga0055530_100142002 172
68 3300003794 Ga0055531_10002096 Ga0055531_100020965 172
69 3300003794 Ga0055531_10002569 Ga0055531_100025693 172
70 3300003794 Ga0055531_10011069 Ga0055531_100110694 172
71 3300003794 Ga0055531_10013553 Ga0055531_100135532 172
72 3300003794 Ga0055531_10027918 Ga0055531_100279183 172
73 3300003794 Ga0055531_10054827 Ga0055531_100548272 172
74 3300003856 Ga0058692_1000032 Ga0058692_1000032157 172
75 3300005288 Ga0065714_10115774 Ga0065714_101157742 172
76 3300005289 Ga0065704_10071251 Ga0065704_1007125113 172
77 3300005289 Ga0065704_10078342 Ga0065704_100783425 172
78 3300005328 Ga0070676_10221254 Ga0070676_102212542 172
79 3300005331 Ga0070670_100005259 Ga0070670_1000052592 172
80 3300005338 Ga0068868_100106169 Ga0068868_1001061692 172
81 3300005353 Ga0070669_100052094 Ga0070669_1000520942 172
82 3300005355 Ga0070671_100028673 Ga0070671_1000286735 172
83 3300005355 Ga0070671_100080063 Ga0070671_1000800633 172
84 3300005356 Ga0070674_100016109 Ga0070674_1000161095 172
85 3300005364 Ga0070673_100135673 Ga0070673_1001356733 172
86 3300005364 Ga0070673_100238013 Ga0070673_1002380132 172
87 3300005367 Ga0070667_100277547 Ga0070667_1002775472 172
88 3300005367 Ga0070667_100923225 Ga0070667_1009232251 172
89 3300005459 Ga0068867_100096762 Ga0068867_1000967622 172
90 3300005539 Ga0068853_100156106 Ga0068853_1001561062 172
91 3300005543 Ga0070672_100146893 Ga0070672_1001468933 172
92 3300005548 Ga0070665_101168218 Ga0070665_1011682182 172
93 3300005563 Ga0068855_101071856 Ga0068855_1010718562 172
94 3300005618 Ga0068864_100864186 Ga0068864_1008641862 172
95 3300005844 Ga0068862_100071796 Ga0068862_1000717963 172
96 3300006038 Ga0075365_10514028 Ga0075365_105140281 172
97 3300006051 Ga0075364_10000625 Ga0075364_1000062521 172
98 3300006051 Ga0075364_10134033 Ga0075364_101340332 172
99 3300006177 Ga0075362_10288022 Ga0075362_102880222 172
100 3300006195 Ga0075366_10446475 Ga0075366_104464751 172
101 3300009011 Ga0105251_10002229 Ga0105251_1000222914 172
102 3300009148 Ga0105243_10023660 Ga0105243_100236602 172
103 3300009148 Ga0105243_10505914 Ga0105243_105059142 172
104 3300009177 Ga0105248_10910761 Ga0105248_109107611 172
105 3300009987 Ga0105030_107673 Ga0105030_1076732 172
106 3300009988 Ga0105035_120238 Ga0105035_1202381 172
107 3300011119 Ga0105246_10086626 Ga0105246_100866262 172
108 3300012482 Ga0157318_1000915 Ga0157318_10009152 172
109 3300012498 Ga0157345_1017862 Ga0157345_10178621 172
110 3300013102 Ga0157371_10920085 Ga0157371_109200851 172
111 3300013874 Ga0157514_112427 Ga0157514_1124272 172
112 3300013875 Ga0157515_133431 Ga0157515_1334311 172
113 3300014325 Ga0163163_10933929 Ga0163163_109339292 172
114 3300014326 Ga0157380_10186658 Ga0157380_101866581 172
115 3300014497 Ga0182008_10103090 Ga0182008_101030902 172
116 3300014969 Ga0157376_11671538 Ga0157376_116715382 172
117 3300015265 Ga0182005_1008030 Ga0182005_10080302 172
118 3300015689 Ga0183360_10001 Ga0183360_100012761 172
119 3300025245 Ga0207425_1000117 Ga0207425_100011772 172
120 3300025245 Ga0207425_1006385 Ga0207425_10063852 172
121 3300025258 Ga0209129_1000011 Ga0209129_1000011309 172
122 3300025263 Ga0209565_1000001 Ga0209565_10000011112 172
123 3300025273 Ga0209673_1000001 Ga0209673_10000011112 172
124 3300025273 Ga0209673_1005553 Ga0209673_10055533 172
125 3300025273 Ga0209673_1060509 Ga0209673_10605092 172
126 3300025273 Ga0209673_1063010 Ga0209673_10630102 172
127 3300025284 Ga0209130_1006144 Ga0209130_10061444 172
128 3300025291 Ga0209675_1000001 Ga0209675_10000011421 172
129 3300025291 Ga0209675_1010658 Ga0209675_10106584 172
130 3300025291 Ga0209675_1016501 Ga0209675_10165012 172
131 3300025292 Ga0209676_1000436 Ga0209676_100043616 172
132 3300025292 Ga0209676_1001557 Ga0209676_100155713 172
133 3300025292 Ga0209676_1001981 Ga0209676_100198110 172
134 3300025292 Ga0209676_1002305 Ga0209676_100230510 172
135 3300025292 Ga0209676_1002769 Ga0209676_10027695 172
136 3300025292 Ga0209676_1004360 Ga0209676_10043607 172
137 3300025292 Ga0209676_1005388 Ga0209676_10053884 172
138 3300025292 Ga0209676_1006571 Ga0209676_10065712 172
139 3300025294 Ga0209025_1000002 Ga0209025_1000002489 172
140 3300025294 Ga0209025_1000006 Ga0209025_100000653 172
141 3300025294 Ga0209025_1000564 Ga0209025_10005645 172
142 3300025294 Ga0209025_1019266 Ga0209025_10192666 172
143 3300025294 Ga0209025_1137077 Ga0209025_11370771 172
144 3300025295 Ga0209564_1000001 Ga0209564_10000011583 172
145 3300025295 Ga0209564_1047968 Ga0209564_10479682 172
146 3300025295 Ga0209564_1047969 Ga0209564_10479692 172
147 3300025297 Ga0209758_1000003 Ga0209758_1000003496 172
148 3300025297 Ga0209758_1040999 Ga0209758_10409991 172
149 3300025297 Ga0209758_1062907 Ga0209758_10629073 172
150 3300025298 Ga0209050_1005567 Ga0209050_10055674 172
151 3300025298 Ga0209050_1007405 Ga0209050_10074054 172
152 3300025298 Ga0209050_1057507 Ga0209050_10575071 172
153 3300025299 Ga0209256_1000006 Ga0209256_100000619 172
154 3300025299 Ga0209256_1002374 Ga0209256_10023747 172
155 3300025299 Ga0209256_1002733 Ga0209256_100273313 172
156 3300025299 Ga0209256_1025187 Ga0209256_10251872 172
157 3300025303 Ga0209051_1020202 Ga0209051_10202022 172
158 3300025304 Ga0209257_1000343 Ga0209257_100034317 172
159 3300025304 Ga0209257_1000567 Ga0209257_100056721 172
160 3300025304 Ga0209257_1000738 Ga0209257_10007385 172
161 3300025304 Ga0209257_1000788 Ga0209257_100078831 172
162 3300025304 Ga0209257_1002327 Ga0209257_100232713 172
163 3300025304 Ga0209257_1004934 Ga0209257_10049344 172
164 3300025304 Ga0209257_1006402 Ga0209257_10064025 172
165 3300025735 Ga0207713_1000294 Ga0207713_10002945 172
166 3300025903 Ga0207680_10394770 Ga0207680_103947702 172
167 3300025907 Ga0207645_10184833 Ga0207645_101848332 172
168 3300025925 Ga0207650_10013553 Ga0207650_100135532 172
169 3300025925 Ga0207650_10072802 Ga0207650_100728024 172
170 3300025925 Ga0207650_10613707 Ga0207650_106137072 172
171 3300025925 Ga0207650_10646909 Ga0207650_106469092 172
172 3300025931 Ga0207644_10133320 Ga0207644_101333202 172
173 3300025931 Ga0207644_10261962 Ga0207644_102619622 172
174 3300025931 Ga0207644_10378913 Ga0207644_103789132 172
175 3300025935 Ga0207709_10394515 Ga0207709_103945152 172
176 3300025936 Ga0207670_10226561 Ga0207670_102265612 172
177 3300025940 Ga0207691_10008799 Ga0207691_1000879910 172
178 3300025972 Ga0207668_10037422 Ga0207668_100374224 172
179 3300026023 Ga0207677_10132843 Ga0207677_101328433 172
180 3300026075 Ga0207708_10968656 Ga0207708_109686562 172
181 3300026095 Ga0207676_10609300 Ga0207676_106093002 172
182 3300026121 Ga0207683_10093680 Ga0207683_100936804 172
183 3300027312 Ga0209371_1000055 Ga0209371_100005517 172
184 3300027364 Ga0209967_1032709 Ga0209967_10327091 172
185 3300027424 Ga0209984_1029591 Ga0209984_10295912 172
186 3300027471 Ga0209995_1016608 Ga0209995_10166082 172
187 3300027543 Ga0209999_1022095 Ga0209999_10220952 172
188 3300027552 Ga0209982_1008033 Ga0209982_10080332 172
189 3300027614 Ga0209970_1001244 Ga0209970_10012444 172
190 3300027617 Ga0210002_1052901 Ga0210002_10529011 172
191 3300027665 Ga0209983_1005407 Ga0209983_10054075 172
192 3300027682 Ga0209971_1005688 Ga0209971_10056883 172
193 3300028379 Ga0268266_10837479 Ga0268266_108374791 172
194 3300028379 Ga0268266_10929040 Ga0268266_109290401 172
195 3300028380 Ga0268265_10044957 Ga0268265_100449573 172
196 3300030500 Ga0268256_1000054 Ga0268256_1000054217 172
197 3300030731 Ga0316177_1019888 Ga0316177_10198884 172
198 3300030733 Ga0314311_1002365 Ga0314311_10023653 172
199 3300030745 Ga0316182_1085314 Ga0316182_10853142 172
200 3300031456 Ga0307513_10003461 Ga0307513_1000346115 172
201 3300031456 Ga0307513_10138265 Ga0307513_101382653 172
202 3300031548 Ga0307408_100043501 Ga0307408_1000435013 172
203 3300031548 Ga0307408_100097636 Ga0307408_1000976361 172
204 3300031548 Ga0307408_100561274 Ga0307408_1005612741 172
205 3300031730 Ga0307516_10093454 Ga0307516_100934543 172
206 3300031730 Ga0307516_10315010 Ga0307516_103150102 172
207 3300031731 Ga0307405_10296419 Ga0307405_102964193 172
208 3300031824 Ga0307413_10006589 Ga0307413_100065892 172
209 3300031824 Ga0307413_10043280 Ga0307413_100432802 172
210 3300031824 Ga0307413_10155336 Ga0307413_101553362 172
211 3300031824 Ga0307413_10447161 Ga0307413_104471612 172
212 3300031852 Ga0307410_10112774 Ga0307410_101127744 172
213 3300031852 Ga0307410_10455284 Ga0307410_104552842 172
214 3300031901 Ga0307406_10011312 Ga0307406_100113121 172
215 3300031901 Ga0307406_10013777 Ga0307406_100137773 172
216 3300031901 Ga0307406_10200612 Ga0307406_102006122 172
217 3300031903 Ga0307407_10080993 Ga0307407_100809934 172
218 3300031903 Ga0307407_10441542 Ga0307407_104415421 172
219 3300031911 Ga0307412_10161731 Ga0307412_101617311 172
220 3300031911 Ga0307412_10690818 Ga0307412_106908182 172
221 3300031911 Ga0307412_10806268 Ga0307412_108062681 172
222 3300031911 Ga0307412_11051951 Ga0307412_110519511 172
223 3300031995 Ga0307409_100030243 Ga0307409_1000302433 172
224 3300031995 Ga0307409_100385983 Ga0307409_1003859833 172
225 3300031995 Ga0307409_100690608 Ga0307409_1006906082 172
226 3300032002 Ga0307416_100055265 Ga0307416_1000552653 172
227 3300032002 Ga0307416_100090621 Ga0307416_1000906212 172
228 3300032004 Ga0307414_10002922 Ga0307414_100029225 172
229 3300032004 Ga0307414_10090827 Ga0307414_100908274 172
230 3300032004 Ga0307414_10136927 Ga0307414_101369273 172
231 3300032004 Ga0307414_10272551 Ga0307414_102725513 172
232 3300032004 Ga0307414_10747110 Ga0307414_107471102 172
233 3300032004 Ga0307414_10776771 Ga0307414_107767712 172
234 3300032004 Ga0307414_10887301 Ga0307414_108873012 172
235 3300032005 Ga0307411_10095683 Ga0307411_100956833 172
236 3300032005 Ga0307411_10614693 Ga0307411_106146932 172
237 3300032126 Ga0307415_100490020 Ga0307415_1004900202 172
238 3300032126 Ga0307415_100534800 Ga0307415_1005348002 172
239 3300032126 Ga0307415_100548011 Ga0307415_1005480112 172
240 3300032126 Ga0307415_101156192 Ga0307415_1011561921 172
241 3300037312 Ga0395899_0022853 Ga0395899_0022853_3417_3935 172
242 3300037418 Ga0395900_0028616 Ga0395900_0028616_3367_3885 172
243 3300037466 Ga0395898_0058673 Ga0395898_0058673_1956_2474 172
244 3300037471 Ga0395905_0002340 Ga0395905_0002340_16745_17263 172
245 3300037471 Ga0395905_0075886 Ga0395905_0075886_2336_2854 172
246 3300037471 Ga0395905_0118577 Ga0395905_0118577_386_937 172
247 3300038443 Ga0395901_0002043 Ga0395901_0002043_16631_17149 172
248 3300038705 Ga0237819_00412 Ga0237819_00412_2692_3210 172
249 3300038705 Ga0237819_04909 Ga0237819_04909_912_1430 172
250 3300039145 Ga0237816_00086 Ga0237816_00086_235_753 172
251 3300041404 Ga0439436_0004836 Ga0439436_0004836_2653_3258 172
252 3300041404 Ga0439436_0046305 Ga0439436_0046305_404_922 172
253 3300041404 Ga0439436_0091977 Ga0439436_0091977_35_553 172
254 3300041406 Ga0439439_0007005 Ga0439439_0007005_536_1141 172
255 3300041406 Ga0439439_0024518 Ga0439439_0024518_816_1334 172
256 3300041406 Ga0439439_0103971 Ga0439439_0103971_166_687 172
257 3300041407 Ga0439447_002198 Ga0439447_002198_5935_6453 172
258 3300041410 Ga0439461_0079168 Ga0439461_0079168_168_686 172
259 3300041413 Ga0439465_0000362 Ga0439465_0000362_4954_5472 172
260 3300041413 Ga0439465_0005244 Ga0439465_0005244_1703_2221 172
261 3300041413 Ga0439465_0016272 Ga0439465_0016272_388_909 172
262 3300041413 Ga0439465_0030025 Ga0439465_0030025_725_1243 172
263 3300041413 Ga0439465_0061335 Ga0439465_0061335_65_583 172
264 3300041413 Ga0439465_0143996 Ga0439465_0143996_192_713 172
265 3300041443 Ga0451789_0689845 Ga0451789_0689845_201_719 172
266 3300041451 Ga0451791_0228750 Ga0451791_0228750_326_844 172
267 3300041451 Ga0451791_1101586 Ga0451791_1101586_421_942 172
268 3300041453 Ga0451797_0493669 Ga0451797_0493669_762_1280 172
269 3300041453 Ga0451797_0598154 Ga0451797_0598154_207_725 172
270 3300041453 Ga0451797_0943323 Ga0451797_0943323_78_599 172
271 3300041453 Ga0451797_1231087 Ga0451797_1231087_129_647 172
272 3300041453 Ga0451797_1398069 Ga0451797_1398069_165_683 172
273 3300041453 Ga0451797_1413463 Ga0451797_1413463_592_1110 172
274 3300041456 Ga0451795_0735229 Ga0451795_0735229_114_632 172
275 3300041458 Ga0451798_0478081 Ga0451798_0478081_198_716 172
276 3300041459 Ga0451800_0514176 Ga0451800_0514176_4560_5078 172
277 3300041460 Ga0451802_0869472 Ga0451802_0869472_997_1515 172
278 3300041462 Ga0451806_112225 Ga0451806_112225_1403_1921 172
279 3300041463 Ga0451804_0844979 Ga0451804_0844979_168_686 172
280 3300041486 Ga0451807_0495113 Ga0451807_0495113_499_1017 172
281 3300041486 Ga0451807_1026549 Ga0451807_1026549_1228_1746 172
282 3300041494 Ga0451837_0624323 Ga0451837_0624323_815_1333 172
283 3300041494 Ga0451837_1025625 Ga0451837_1025625_1276_1794 172
284 3300041494 Ga0451837_1747075 Ga0451837_1747075_166_684 172
285 3300041507 Ga0451851_0044262 Ga0451851_0044262_121_639 172
286 3300041509 Ga0451843_0988962 Ga0451843_0988962_375_893 172
287 3300041509 Ga0451843_1204059 Ga0451843_1204059_167_685 172
288 3300041997 Ga0439431_0031747 Ga0439431_0031747_165_683 172
289 3300041999 Ga0439433_0051554 Ga0439433_0051554_411_929 172
290 3300042004 Ga0439445_0004816 Ga0439445_0004816_405_923 172
291 3300042004 Ga0439445_0018213 Ga0439445_0018213_350_955 172
292 3300042006 Ga0439432_005990 Ga0439432_005990_2685_3203 172
293 3300042006 Ga0439432_015006 Ga0439432_015006_1393_1911 172
294 3300042007 Ga0439449_0004898 Ga0439449_0004898_3535_4053 172
295 3300042007 Ga0439449_0007530 Ga0439449_0007530_1503_2021 172
296 3300042007 Ga0439449_0009677 Ga0439449_0009677_2936_3454 172
297 3300042007 Ga0439449_0023440 Ga0439449_0023440_1696_2217 172
298 3300042015 Ga0439462_0004797 Ga0439462_0004797_1068_1589 172
299 3300042156 Ga0439446_0049440 Ga0439446_0049440_504_1022 172
300 3300044712 Ga0453684_0001075 Ga0453684_0001075_11634_12155 172
301 3300044712 Ga0453684_0732213 Ga0453684_0732213_398_916 172
302 3300045051 Ga0451576_0000025 Ga0451576_0000025_74573_75094 172
303 3300046460 Ga0495638_0036836 Ga0495638_0036836_808_1329 172
304 3300046471 Ga0495650_0119572 Ga0495650_0119572_241_759 172
305 3300046501 Ga0495607_0076045 Ga0495607_0076045_385_903 172
306 3300046507 Ga0495606_0360582 Ga0495606_0360582_208_726 172
307 3300046513 Ga0495616_0049989 Ga0495616_0049989_720_1238 172
308 3300046519 Ga0495632_0125788 Ga0495632_0125788_116_634 172
309 3300046522 Ga0495643_0153107 Ga0495643_0153107_443_961 172
310 3300046525 Ga0495663_0009500 Ga0495663_0009500_827_1345 172
311 3300046525 Ga0495663_0039477 Ga0495663_0039477_43_561 172
312 3300046525 Ga0495663_0056335 Ga0495663_0056335_279_797 172
313 3300046525 Ga0495663_0097889 Ga0495663_0097889_118_639 172
314 3300046525 Ga0495663_0319576 Ga0495663_0319576_28_546 172
315 3300046537 Ga0495598_0086316 Ga0495598_0086316_201_719 172
316 3300046539 Ga0495621_0018448 Ga0495621_0018448_1375_1893 172
317 3300046558 Ga0495633_0109232 Ga0495633_0109232_32_550 172
318 3300046615 Ga0495656_0001213 Ga0495656_0001213_413_934 172
319 3300046615 Ga0495656_0011020 Ga0495656_0011020_1174_1695 172
320 3300046615 Ga0495656_0020511 Ga0495656_0020511_1257_1775 172
321 3300046616 Ga0495668_0006902 Ga0495668_0006902_3173_3691 172
322 3300046665 Ga0495661_0242240 Ga0495661_0242240_54_572 172
323 3300046691 Ga0495670_0276885 Ga0495670_0276885_300_818 172
324 3300046692 Ga0495671_0030282 Ga0495671_0030282_49_567 172
325 3300047318 Ga0495636_0001221 Ga0495636_0001221_7739_8308 172
326 3300047318 Ga0495636_0131705 Ga0495636_0131705_440_958 172
327 3300047318 Ga0495636_0197763 Ga0495636_0197763_247_765 172
328 3300047470 Ga0495681_0028334 Ga0495681_0028334_142_660 172
329 3300047472 Ga0495686_0068036 Ga0495686_0068036_1072_1590 172
330 3300048090 Ga0495615_0127172 Ga0495615_0127172_212_730 172
331 3300048903 Ga0496100_0029977 Ga0496100_0029977_1159_1677 172
332 3300048903 Ga0496100_0594769 Ga0496100_0594769_280_801 172
333 3300048904 Ga0496101_0113131 Ga0496101_0113131_504_1022 172
334 3300048905 Ga0496102_0678895 Ga0496102_0678895_148_669 172
335 3300048912 Ga0496109_0043544 Ga0496109_0043544_464_982 172
336 3300048912 Ga0496109_0609314 Ga0496109_0609314_33_551 172
337 3300048913 Ga0496110_0613098 Ga0496110_0613098_147_665 172
338 3300048917 Ga0496114_0007208 Ga0496114_0007208_2745_3263 172
339 3300048918 Ga0496115_0695418 Ga0496115_0695418_267_785 172
340 3300048919 Ga0496116_0130572 Ga0496116_0130572_104_622 172
341 3300048920 Ga0496117_0003368 Ga0496117_0003368_7042_7560 172
342 3300048920 Ga0496117_0192345 Ga0496117_0192345_494_1015 172
343 3300048921 Ga0496118_0013515 Ga0496118_0013515_4151_4669 172
344 3300048921 Ga0496118_0100692 Ga0496118_0100692_424_942 172
345 3300048922 Ga0496119_0002089 Ga0496119_0002089_12898_13416 172
346 3300048923 Ga0496120_0000537 Ga0496120_0000537_43770_44288 172
347 3300048924 Ga0496121_0002935 Ga0496121_0002935_12477_12995 172
348 3300048925 Ga0496122_0000859 Ga0496122_0000859_43872_44390 172
349 3300048925 Ga0496122_0012523 Ga0496122_0012523_2151_2669 172
350 3300048925 Ga0496122_0051417 Ga0496122_0051417_228_746 172
351 3300048926 Ga0496123_0000417 Ga0496123_0000417_63999_64517 172
352 3300048926 Ga0496123_0006439 Ga0496123_0006439_4602_5120 172
353 3300048927 Ga0496124_0000052 Ga0496124_0000052_20573_21091 172
354 3300048927 Ga0496124_0000653 Ga0496124_0000653_43882_44400 172
355 3300048928 Ga0496125_0090524 Ga0496125_0090524_492_1010 172
356 3300048929 Ga0496126_0011689 Ga0496126_0011689_3935_4453 172
357 3300048929 Ga0496126_0043826 Ga0496126_0043826_1046_1564 172
358 3300049513 Ga0501290_002722 Ga0501290_002722_1602_2120 172
359 3300049523 Ga0501300_003078 Ga0501300_003078_1563_2081 172
360 3300049568 Ga0501031_0043413 Ga0501031_0043413_1089_1607 172
361 3300049568 Ga0501031_0091532 Ga0501031_0091532_135_656 172
362 3300049569 Ga0501032_0005929 Ga0501032_0005929_7950_8468 172
363 3300049569 Ga0501032_0008336 Ga0501032_0008336_2284_2805 172
364 3300049569 Ga0501032_0641966 Ga0501032_0641966_63_590 172
365 3300049571 Ga0501034_0000636 Ga0501034_0000636_10352_10870 172
366 3300049571 Ga0501034_0001777 Ga0501034_0001777_6243_6761 172
367 3300049571 Ga0501034_0004664 Ga0501034_0004664_12865_13392 172
368 3300049571 Ga0501034_0060996 Ga0501034_0060996_2704_3222 172
369 3300049572 Ga0501036_0034775 Ga0501036_0034775_3540_4058 172
370 3300049572 Ga0501036_0118911 Ga0501036_0118911_1068_1595 172
371 3300049573 Ga0501037_0003917 Ga0501037_0003917_10167_10685 172
372 3300049573 Ga0501037_0400426 Ga0501037_0400426_207_734 172
373 3300049574 Ga0501038_0005610 Ga0501038_0005610_653_1171 172
374 3300049575 Ga0501039_0306308 Ga0501039_0306308_155_682 172
375 3300049575 Ga0501039_0394886 Ga0501039_0394886_15_533 172
376 3300049578 Ga0501042_0605477 Ga0501042_0605477_168_695 172
377 3300049579 Ga0501043_0001529 Ga0501043_0001529_10542_11069 172
378 3300049579 Ga0501043_0008837 Ga0501043_0008837_2609_3130 172
379 3300049580 Ga0501046_0465985 Ga0501046_0465985_28_555 172
380 3300049581 Ga0501047_0215165 Ga0501047_0215165_378_899 172
381 3300049581 Ga0501047_0563726 Ga0501047_0563726_156_683 172
382 3300049583 Ga0501067_0338580 Ga0501067_0338580_300_827 172
383 3300049585 Ga0501069_0541772 Ga0501069_0541772_12_530 172
384 3300049586 Ga0501070_0163106 Ga0501070_0163106_970_1497 172
385 3300049586 Ga0501070_0225766 Ga0501070_0225766_770_1288 172
386 3300049589 Ga0501073_0000635 Ga0501073_0000635_811_1338 172
387 3300049590 Ga0501074_0031329 Ga0501074_0031329_35_562 172
388 3300049649 Ga0501198_059533 Ga0501198_059533_25_543 172
389 3300049682 Ga0501252_006799 Ga0501252_006799_751_1269 172
390 3300049683 Ga0501253_092088 Ga0501253_092088_125_643 172
391 3300049686 Ga0501257_118549 Ga0501257_118549_47_565 172
392 3300049742 Ga0501080_0002738 Ga0501080_0002738_3192_3719 172
393 3300049742 Ga0501080_0358809 Ga0501080_0358809_70_588 172
394 3300049744 Ga0501083_0007757 Ga0501083_0007757_1062_1589 172
395 3300049760 Ga0501263_017552 Ga0501263_017552_312_833 172
396 3300049763 Ga0501266_048234 Ga0501266_048234_96_614 172
397 3300049765 Ga0501268_044831 Ga0501268_044831_200_718 172
398 3300049772 Ga0501275_000285 Ga0501275_000285_1685_2203 172
399 3300049822 Ga0501035_0021820 Ga0501035_0021820_1990_2508 172
400 3300049823 Ga0501044_0027480 Ga0501044_0027480_4962_5483 172
401 3300049823 Ga0501044_0054152 Ga0501044_0054152_365_892 172
402 3300049824 Ga0501045_0914666 Ga0501045_0914666_18_545 172
403 3300050491 nmdc:mga00v17_489_c1 nmdc:mga00v17_489_c1_14458_14979 172
404 3300050491 nmdc:mga00v17_58801_c1 nmdc:mga00v17_58801_c1_967_1485 172
405 3300050491 nmdc:mga00v17_654138_c1 nmdc:mga00v17_654138_c1_96_614 172
406 3300050491 nmdc:mga00v17_96870_c1 nmdc:mga00v17_96870_c1_1232_1750 172
407 3300053087 Ga0500643_131239 Ga0500643_131239_127_645 172
408 3300053134 Ga0500658_0044379 Ga0500658_0044379_743_1261 172
409 3300053161 Ga0500634_0000574 Ga0500634_0000574_9462_9980 172
410 3300053731 Ga0500609_016803 Ga0500609_016803_35_553 172
411 3300060353 Ga0501082_0250493 Ga0501082_0250493_470_997 172

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00994

MoCF_biosynth

Probable molybdopterin binding domain

37

180

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1mkz-assembly1.cif.gz_A crystal structure of moab protein at 1.6 a resolution. 0.9831 5 165
1r2k-assembly1.cif.gz_B crystal structure of moab from escherichia coli 0.981 5 165
1y5e-assembly1.cif.gz_C crystal structure of molybdenum cofactor biosynthesis protein b 0.9372 8 170
1r2k-assembly1.cif.gz_B crystal structure of moab from escherichia coli 0.9352 5 165
1mkz-assembly1.cif.gz_A crystal structure of moab protein at 1.6 a resolution. 0.9263 5 165
ID Description Score Start End Superfamily
1r2kA00 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9628 5 172 3.40.980.10
1r2kA00 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9402 5 172 3.40.980.10
1y5eB00 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9337 8 172 3.40.980.10
af_P39205_1_179_3.40.980.10 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9316 9 151 3.40.980.10
1y5eB00 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.911 8 172 3.40.980.10
ID Description Score Start End GO Terms
AF-A0A0K2ZJ77-F1-model_v4 Molybdenum cofactor biosynthesis protein B 0.9895 1 172 GO:0005829
GO:0006777
AF-A0A2S7DUJ2-F1-model_v4 Molybdenum cofactor biosynthesis protein B 0.9895 1 172 GO:0005829
GO:0006777
AF-A0A5E7BI58-F1-model_v4 Molybdenum cofactor biosynthesis protein B 0.9879 5 164 GO:0005829
GO:0006777
AF-A0A391NH38-F1-model_v4 Molybdenum cofactor biosynthesis protein B 0.9876 5 165 GO:0005829
GO:0006777
AF-A0A661DIQ2-F1-model_v4 Molybdenum cofactor biosynthesis protein B 0.9873 4 162 GO:0005829
GO:0006777

Feature Viewer

pLDDT pTM Quality
87.55 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map