F429129

General Info

Members Datasets Scaffolds Average Seq Length
381 299 762 148

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8005395548|8005401449
Length 174
Sequence DAPPLGSVLIPAPNRLSSFREGATVDAVLRGLTIYFTLLVIIRLSGRRTLAQMTPFDLVIVLVISETTQQAMLGDDFSITNSVILILTLFTTDIGLSYVKRWWPRAGHVIDGVPTVLVTDGVYDERALKGARLQKEDVMEAARSQEGIESVTEIKFAILEVSGAISIIKKQKSD

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
7 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
8 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
9 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
10 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
25 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
26 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
27 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
28 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
29 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
34 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
35 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
40 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
43 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
44 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
45 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
46 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
47 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
48 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
49 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
50 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
51 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
52 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
54 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
63 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
65 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
67 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
68 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
69 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
70 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
71 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
72 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
73 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
74 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
75 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
76 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
77 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
78 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
79 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
80 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
81 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
82 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
83 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
84 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
85 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
86 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
87 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
88 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
89 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
90 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
91 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
92 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
93 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
94 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
95 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
96 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
97 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
98 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
99 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
100 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
101 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
102 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
103 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
104 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
105 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
106 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
107 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
108 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
109 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
110 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
111 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
112 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
113 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
114 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
115 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
116 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
117 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
118 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
119 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
120 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
121 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
122 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
123 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
124 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
125 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
126 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
127 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
128 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
129 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
130 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
131 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
132 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
133 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
134 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
135 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
136 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
149 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
150 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
151 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
152 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
153 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
154 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
155 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
156 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
157 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
158 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
159 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
160 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
161 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
164 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
165 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
166 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
167 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
168 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
169 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
170 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
171 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
172 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
173 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
174 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
175 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
176 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
177 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
178 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
179 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
180 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
181 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
182 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
183 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
184 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
185 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
186 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
187 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
188 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
189 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
190 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
191 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
192 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
193 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
194 8005395548 Rhizobium sp. R339 Isolate Nodule
195 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
196 2509276019 Ensifer aridi TW10 Isolate Nodule
197 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
198 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
199 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
200 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
201 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
202 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
203 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
204 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
205 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
206 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
207 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
208 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
209 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
210 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
211 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
212 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
213 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
214 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
215 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
216 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
217 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
218 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
219 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
220 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
221 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
222 2718217927 Rhizobium sp. N324 Isolate Nodule
223 2718218423 Rhizobium sp. N941 Isolate Nodule
224 2721755809 Rhizobium sp. N541 Isolate Nodule
225 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
226 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
227 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
228 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
229 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
230 2791355261 Rhizobium sp. J15 Isolate Nodule
231 2791355267 Rhizobium sp. L18 Isolate Nodule
232 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
233 2802429634 Rhizobium anhuiense S10 Isolate Nodule
234 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
235 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
236 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
237 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
238 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
239 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
240 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
241 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
242 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
243 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
244 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
245 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
246 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
247 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
248 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
249 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
250 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
251 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
252 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
253 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
254 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
255 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
256 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
257 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
258 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
259 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
260 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
261 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
262 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
263 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
264 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
265 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
266 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
267 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
268 2865014394 Pantoea sp. R-71966 Isolate Unclassified
269 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
270 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
271 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
272 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
273 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
274 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
275 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
276 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
277 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
278 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
279 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
280 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
281 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
282 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
283 2996893221 Rhizobium sp. R635 Isolate Nodule
284 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
285 8005275841 Rhizobium sp. N4311 Isolate Nodule
286 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
287 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
288 8005382845 Rhizobium sp. R634 Isolate Nodule
289 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
290 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
291 8018176218 Rhizobium sp. N122 Isolate Nodule
292 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
293 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
294 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
295 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
296 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
297 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
298 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
299 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 71.92
Metatranscriptomes 0
Isolates 28.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.22
Nodule 22.05
Rhizoplane 1.05
Rhizosphere 46.98
Stem 0
Stem Tuber 0
Unclassified 6.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_28845 2162886007 Bacteria 1747
2 JGI25152J39213_1006740 3300002773 Bacteria 3062
3 JGI25151J46595_10047063 3300003187 Bacteria 1504
4 JGI25153J46596_10015751 3300003215 Bacteria 3062
5 rootH1_10256644 3300003323 Bacteria 1209
6 Ga0055524_1026250 3300003775 Bacteria 1805
7 Ga0055528_1007133 3300003790 Bacteria 4986
8 Ga0055540_1023271 3300003792 Bacteria 1563
9 Ga0058692_1019240 3300003856 Bacteria 1459
10 Ga0065714_10400414 3300005288 Unclassified 590
11 Ga0065704_10002405 3300005289 Bacteria 6794
12 Ga0065712_10365792 3300005290 Bacteria 769
13 Ga0065707_10552613 3300005295 Bacteria 720
14 Ga0070661_100155022 3300005344 Unclassified 1733
15 Ga0070692_10765183 3300005345 Bacteria 656
16 Ga0070668_100058076 3300005347 Bacteria 2992
17 Ga0070668_100652279 3300005347 Bacteria 925
18 Ga0070669_101120357 3300005353 Unclassified 678
19 Ga0070667_102277839 3300005367 Unclassified 510
20 Ga0070700_101007178 3300005441 Unclassified 685
21 Ga0070662_100023044 3300005457 Bacteria 4273
22 Ga0070679_100003051 3300005530 Bacteria 15302
23 Ga0070679_101526035 3300005530 Bacteria 615
24 Ga0070665_101206482 3300005548 Bacteria 767
25 Ga0070664_100672424 3300005564 Unclassified 963
26 Ga0075363_100075672 3300006048 Bacteria 1835
27 Ga0075364_10085742 3300006051 Bacteria 2086
28 Ga0075364_10846689 3300006051 Bacteria 623
29 Ga0075362_10262784 3300006177 Bacteria 851
30 Ga0075367_10137363 3300006178 Bacteria 1513
31 Ga0075367_10506872 3300006178 Bacteria 766
32 Ga0075370_10229752 3300006353 Bacteria 1098
33 Ga0068871_101074173 3300006358 Bacteria 752
34 Ga0075428_100000042 3300006844 Bacteria 102264
35 Ga0075428_102332295 3300006844 Bacteria 550
36 Ga0075430_100043081 3300006846 Bacteria 3815
37 Ga0075431_100171852 3300006847 Bacteria 2226
38 Ga0075429_100280501 3300006880 Unclassified 1459
39 Ga0079104_1057637 3300006946 Bacteria 846
40 Ga0105244_10383688 3300009036 Bacteria 647
41 Ga0111539_10000002 3300009094 Bacteria 983359
42 Ga0111539_10093990 3300009094 Bacteria 3522
43 Ga0114129_10434160 3300009147 Unclassified 1725
44 Ga0105239_11950634 3300010375 Bacteria 681
45 Ga0157373_10076838 3300013100 Bacteria 2356
46 Ga0157373_10094716 3300013100 Bacteria 2102
47 Ga0157371_10005848 3300013102 Bacteria 10280
48 Ga0157370_10000155 3300013104 Bacteria 84680
49 Ga0157370_11812167 3300013104 Unclassified 548
50 Ga0163163_11595573 3300014325 Bacteria 713
51 Ga0214544_1000063 3300021320 Bacteria 129929
52 Ga0214542_1000095 3300021321 Bacteria 116012
53 Ga0214542_1040220 3300021321 Bacteria 1210
54 Ga0214543_1000018 3300021327 Bacteria 272335
55 Ga0214543_1000026 3300021327 Bacteria 220652
56 Ga0207425_1016723 3300025245 Bacteria 1624
57 Ga0209129_1003947 3300025258 Bacteria 6136
58 Ga0209129_1012695 3300025258 Bacteria 1909
59 Ga0209673_1002723 3300025273 Bacteria 11657
60 Ga0209025_1011274 3300025294 Bacteria 5914
61 Ga0209564_1016581 3300025295 Bacteria 2920
62 Ga0209758_1000749 3300025297 Bacteria 47284
63 Ga0209758_1001555 3300025297 Bacteria 26337
64 Ga0209050_1003685 3300025298 Bacteria 11049
65 Ga0209256_1005955 3300025299 Bacteria 6702
66 Ga0209051_1000070 3300025303 Bacteria 215616
67 Ga0209051_1028484 3300025303 Bacteria 2205
68 Ga0209257_1011502 3300025304 Bacteria 4253
69 Ga0207660_10814786 3300025917 Bacteria 762
70 Ga0207649_10132672 3300025920 Unclassified 1694
71 Ga0207652_10047762 3300025921 Bacteria 3657
72 Ga0207650_10000125 3300025925 Bacteria 96107
73 Ga0207651_11117150 3300025960 Unclassified 707
74 Ga0207668_10112208 3300025972 Bacteria 2048
75 Ga0209371_1000580 3300027312 Bacteria 32894
76 Ga0209371_1005301 3300027312 Bacteria 5185
77 Ga0209974_10004667 3300027876 Bacteria 4870
78 Ga0209974_10103690 3300027876 Unclassified 996
79 Ga0207428_10000004 3300027907 Bacteria 727800
80 Ga0268266_11005304 3300028379 Bacteria 807
81 Ga0268256_1002730 3300030500 Bacteria 8628
82 Ga0268256_1005175 3300030500 Bacteria 5185
83 Ga0307413_10023682 3300031824 Plasmid 3331
84 Ga0307413_10204659 3300031824 Bacteria 1428
85 Ga0307413_11770149 3300031824 Bacteria 552
86 Ga0307406_10192935 3300031901 Bacteria 1493
87 Ga0307407_10344134 3300031903 Bacteria 1054
88 Ga0307416_100271595 3300032002 Bacteria 1665
89 Ga0307414_10050495 3300032004 Viruses 2881
90 Ga0307414_10287541 3300032004 Bacteria 1384
91 Ga0307414_10474684 3300032004 Bacteria 1102
92 Ga0307414_10823133 3300032004 Bacteria 848
93 Ga0395898_0046159 3300037466 Bacteria 4279
94 Ga0395901_0037730 3300038443 Bacteria 4997
95 Ga0439438_000020 3300041405 Bacteria 111381
96 Ga0439438_005383 3300041405 Bacteria 4719
97 Ga0439447_000561 3300041407 Bacteria 13808
98 Ga0439447_004392 3300041407 Bacteria 4862
99 Ga0439465_0010392 3300041413 Bacteria 2924
100 Ga0439465_0021824 3300041413 Bacteria 2010
101 Ga0451791_1436861 3300041451 Bacteria 1043
102 Ga0451798_0567132 3300041458 Bacteria 1651
103 Ga0451807_0418682 3300041486 Bacteria 768
104 Ga0451833_0082307 3300041491 Bacteria 3076
105 Ga0451833_0651323 3300041491 Bacteria 850
106 Ga0451835_0083258 3300041492 Bacteria 1306
107 Ga0451837_0229831 3300041494 Bacteria 2032
108 Ga0451837_1620162 3300041494 Bacteria 2103
109 Ga0451839_0240335 3300041496 Bacteria 1996
110 Ga0451845_0336321 3300041501 Bacteria 1315
111 Ga0451847_0561852 3300041503 Bacteria 1453
112 Ga0451847_0634815 3300041503 Bacteria 2029
113 Ga0451849_0570927 3300041505 Bacteria 1966
114 Ga0451849_0930439 3300041505 Bacteria 1943
115 Ga0451849_1036258 3300041505 Bacteria 2437
116 Ga0451843_0294544 3300041509 Bacteria 6537
117 Ga0451843_0443435 3300041509 Bacteria 976
118 Ga0451855_0161294 3300041511 Bacteria 1753
119 Ga0451855_1974264 3300041511 Bacteria 967
120 Ga0439445_0026769 3300042004 Bacteria 1478
121 Ga0439432_001067 3300042006 Bacteria 10427
122 Ga0439432_017045 3300042006 Bacteria 2440
123 Ga0439449_0070418 3300042007 Bacteria 1289
124 Ga0451577_0060214 3300042876 Bacteria 3384
125 Ga0451577_0809250 3300042876 Bacteria 846
126 Ga0453684_0160841 3300044712 Bacteria 2656
127 Ga0451576_0025657 3300045051 Bacteria 6349
128 Ga0495638_0000120 3300046460 Bacteria 127382
129 Ga0495638_0022810 3300046460 Bacteria 4104
130 Ga0495650_0046412 3300046471 Bacteria 1823
131 Ga0495585_0004930 3300046492 Bacteria 8538
132 Ga0495585_0046099 3300046492 Bacteria 2432
133 Ga0495596_0060640 3300046500 Bacteria 1474
134 Ga0495607_0066653 3300046501 Bacteria 2025
135 Ga0495607_0067597 3300046501 Bacteria 2007
136 Ga0495583_0148460 3300046506 Bacteria 973
137 Ga0495583_0158611 3300046506 Bacteria 934
138 Ga0495606_0000144 3300046507 Bacteria 122857
139 Ga0495606_0000286 3300046507 Bacteria 87736
140 Ga0495606_0014184 3300046507 Bacteria 6237
141 Ga0495606_0642815 3300046507 Bacteria 514
142 Ga0495610_0013902 3300046512 Bacteria 4756
143 Ga0495620_0006859 3300046515 Bacteria 6225
144 Ga0495620_0191290 3300046515 Bacteria 789
145 Ga0495631_0274811 3300046518 Bacteria 717
146 Ga0495632_0073051 3300046519 Bacteria 1645
147 Ga0495632_0085271 3300046519 Bacteria 1503
148 Ga0495632_0188306 3300046519 Bacteria 943
149 Ga0495643_0007279 3300046522 Bacteria 7154
150 Ga0495643_0013119 3300046522 Bacteria 4975
151 Ga0495643_0094280 3300046522 Bacteria 1541
152 Ga0495648_0042778 3300046524 Bacteria 2847
153 Ga0495654_0140458 3300046530 Unclassified 1077
154 Ga0495654_0179695 3300046530 Bacteria 917
155 Ga0495609_0056160 3300046538 Bacteria 1745
156 Ga0495597_0005557 3300046542 Bacteria 6659
157 Ga0495668_0101273 3300046616 Bacteria 1576
158 Ga0495611_0262606 3300046648 Bacteria 799
159 Ga0495625_0130119 3300046660 Bacteria 1705
160 Ga0495661_0113457 3300046665 Bacteria 1507
161 Ga0495671_0102389 3300046692 Bacteria 1399
162 Ga0495649_0000188 3300046694 Bacteria 54294
163 Ga0495660_0028429 3300046810 Bacteria 3159
164 Ga0495672_0009877 3300047320 Bacteria 6861
165 Ga0495683_0018039 3300047323 Bacteria 3653
166 Ga0495687_129075 3300047443 Bacteria 898
167 Ga0495677_0252224 3300047445 Bacteria 690
168 Ga0495685_119915 3300047447 Bacteria 864
169 Ga0495681_0042402 3300047470 Bacteria 2202
170 Ga0495686_0004530 3300047472 Bacteria 11387
171 Ga0495686_0028275 3300047472 Bacteria 3652
172 Ga0495615_0020494 3300048090 Bacteria 1482
173 Ga0496106_0000125 3300048909 Bacteria 59031
174 Ga0496118_0024502 3300048921 Bacteria 5204
175 Ga0496119_0233042 3300048922 Unclassified 936
176 Ga0496121_0000115 3300048924 Bacteria 178411
177 Ga0496121_0002299 3300048924 Bacteria 29642
178 Ga0496121_0014938 3300048924 Bacteria 8180
179 Ga0496121_0027242 3300048924 Bacteria 5353
180 Ga0496121_0033053 3300048924 Bacteria 4690
181 Ga0496121_0450821 3300048924 Bacteria 829
182 Ga0496121_0475746 3300048924 Bacteria 799
183 Ga0496121_0510415 3300048924 Bacteria 761
184 Ga0496121_0825707 3300048924 Unclassified 542
185 Ga0496122_0036200 3300048925 Bacteria 3997
186 Ga0496123_0015545 3300048926 Bacteria 6236
187 Ga0496123_0308761 3300048926 Unclassified 751
188 Ga0496124_0012547 3300048927 Bacteria 8352
189 Ga0496124_0045108 3300048927 Bacteria 3780
190 Ga0496124_0279865 3300048927 Bacteria 1217
191 Ga0496125_0031962 3300048928 Bacteria 4681
192 Ga0496125_0207065 3300048928 Bacteria 1278
193 Ga0496125_0596517 3300048928 Unclassified 604
194 Ga0495678_147320 3300049459 Bacteria 764
195 Ga0495682_0295318 3300049460 Bacteria 572
196 Ga0501031_0028346 3300049568 Bacteria 3650
197 Ga0501031_0059108 3300049568 Bacteria 2499
198 Ga0501033_0526238 3300049570 Bacteria 816
199 Ga0501034_0520379 3300049571 Bacteria 1101
200 Ga0501036_0020022 3300049572 Bacteria 5618
201 Ga0501036_0076958 3300049572 Bacteria 2823
202 Ga0501037_0286892 3300049573 Bacteria 1146
203 Ga0501038_0243954 3300049574 Bacteria 1425
204 Ga0501039_0352630 3300049575 Bacteria 1156
205 Ga0501040_0077661 3300049576 Unclassified 2297
206 Ga0501040_1054836 3300049576 Unclassified 589
207 Ga0501042_1424570 3300049578 Bacteria 505
208 Ga0501043_0611866 3300049579 Bacteria 804
209 Ga0501043_1261495 3300049579 Bacteria 517
210 Ga0501047_0494736 3300049581 Bacteria 1050
211 Ga0501048_0091105 3300049582 Bacteria 2151
212 Ga0501048_0469878 3300049582 Bacteria 901
213 Ga0501067_0016842 3300049583 Bacteria 4036
214 Ga0501068_0006486 3300049584 Bacteria 6454
215 Ga0501072_0058561 3300049588 Unclassified 3037
216 Ga0501072_0589879 3300049588 Bacteria 876
217 Ga0501075_0000349 3300049591 Bacteria 26247
218 Ga0501075_0062271 3300049591 Unclassified 2812
219 Ga0501075_0147379 3300049591 Bacteria 1794
220 Ga0501077_0001165 3300049593 Bacteria 15872
221 Ga0501077_0925345 3300049593 Bacteria 561
222 Ga0501223_000100 3300049663 Bacteria 24668
223 Ga0501224_000002 3300049664 Bacteria 229331
224 Ga0501233_009311 3300049668 Bacteria 1913
225 Ga0501225_0000120 3300049705 Bacteria 24331
226 Ga0501234_000923 3300049707 Bacteria 4644
227 Ga0501079_0033597 3300049741 Bacteria 3946
228 Ga0501079_0113861 3300049741 Bacteria 2103
229 Ga0501079_0433069 3300049741 Unclassified 1032
230 Ga0501080_0029863 3300049742 Bacteria 5074
231 Ga0501081_0016555 3300049743 Bacteria 4875
232 Ga0501081_0058557 3300049743 Unclassified 2666
233 Ga0501035_0202235 3300049822 Bacteria 1703
234 Ga0501045_0047812 3300049824 Bacteria 3117
235 Ga0501226_000089 3300049853 Bacteria 25215
236 nmdc:mga03n38_205298_c1 3300050490 Bacteria 1022
237 nmdc:mga03n38_267308_c1 3300050490 Bacteria 908
238 nmdc:mga00v17_128825_c1 3300050491 Bacteria 1616
239 nmdc:mga00v17_800674_c1 3300050491 Bacteria 600
240 nmdc:mga06z11_602424_c1 3300050494 Bacteria 668
241 nmdc:mga09592_192481_c1 3300050508 Bacteria 1765
242 nmdc:mga0qj67_33909_c1 3300050509 Bacteria 3985
243 nmdc:mga08y16_2_c1 3300050511 Bacteria 983367
244 Ga0495655_0013652 3300053083 Bacteria 1685
245 Ga0500578_0046800 3300053086 Bacteria 2775
246 Ga0500644_0193663 3300053088 Bacteria 838
247 Ga0500583_0033317 3300053092 Bacteria 2279
248 Ga0500651_0223348 3300053093 Bacteria 1104
249 Ga0500651_0289079 3300053093 Bacteria 943
250 Ga0500641_0010837 3300053096 Bacteria 3304
251 Ga0500562_086119 3300053108 Bacteria 851
252 Ga0500594_0180577 3300053118 Bacteria 688
253 Ga0500618_000098 3300053125 Bacteria 71763
254 Ga0500628_087233 3300053129 Bacteria 808
255 Ga0500652_205949 3300053131 Bacteria 796
256 Ga0500658_0000376 3300053134 Bacteria 19620
257 Ga0500658_0002500 3300053134 Bacteria 7116
258 Ga0500658_0035446 3300053134 Bacteria 1975
259 Ga0500659_0226120 3300053135 Bacteria 883
260 Ga0500568_0000101 3300053139 Bacteria 78689
261 Ga0500568_0003503 3300053139 Bacteria 8713
262 Ga0500577_0282778 3300053142 Bacteria 723
263 Ga0500604_0015909 3300053151 Bacteria 2066
264 Ga0500616_0000473 3300053153 Bacteria 52175
265 Ga0500616_0026069 3300053153 Bacteria 3239
266 Ga0500616_0042681 3300053153 Bacteria 2427
267 Ga0500620_164999 3300053155 Bacteria 767
268 Ga0500622_0154985 3300053156 Bacteria 1079
269 Ga0500627_0022961 3300053158 Bacteria 2538
270 Ga0500633_0003205 3300053160 Bacteria 3522
271 Ga0500633_0184510 3300053160 Bacteria 782
272 Ga0590071_044464 3300059421 Bacteria 1071
273 Ga0590074_109364 3300059423 Bacteria 544
274 Ga0590077_129169 3300059426 Bacteria 600
275 8005401449 8005395548 Bacteria 6806915
276 2509109974 2508501122 Bacteria 6292184
277 2509378407 2509276019 Bacteria 6802256
278 2509386358 2509276021 Bacteria 7634384
279 2509441573 2509276033 Bacteria 7180565
280 2510137661 2510065019 Bacteria 6903379
281 2510893509 2510461076 Bacteria 8618824
282 2513571717 2513237084 Bacteria 7231967
283 2513575787 2513237085 Bacteria 7695351
284 2513912942 2513237144 Bacteria 7530820
285 2514019040 2513237162 Bacteria 7468464
286 2514586390 2513237351 Bacteria 6968952
287 2515109236 2515075009 Bacteria 7288508
288 2515612548 2515154107 Bacteria 6795637
289 2515633453 2515154113 Bacteria 7807172
290 2515659058 2515154116 Bacteria 7552979
291 2515743826 2515154134 Bacteria 7220242
292 2517042370 2516653077 Bacteria 7555578
293 2517081242 2516653085 Bacteria 7346596
294 2517411712 2517287029 Bacteria 6905599
295 2524449793 2524023207 Bacteria 6813453
296 2558861789 2558860100 Bacteria 8458965
297 2585205794 2582581294 Bacteria 6626667
298 2585526334 2585427526 Bacteria 7258840
299 2585827994 2585427591 Bacteria 5482980
300 2585834924 2585427592 Bacteria 5370892
301 2644195109 2643221634 Bacteria 6705461
302 2657683998 2657244999 Bacteria 5946535
303 2719388788 2718217927 Bacteria 6972593
304 2721402513 2718218423 Bacteria 6438183
305 2724034579 2721755809 Bacteria 6438790
306 2725948049 2724679232 Bacteria 7646494
307 2739033876 2738541333 Bacteria 7106503
308 2739791054 2739367756 Bacteria 4553612
309 2739791099 2739367756 Bacteria 4553612
310 2792582562 2791355082 Bacteria 5973319
311 2793317881 2791355259 Bacteria 7254731
312 2793328580 2791355261 Bacteria 6661293
313 2793368362 2791355267 Bacteria 7222458
314 2804753310 2802429268 Bacteria 6094027
315 2806053361 2802429634 Bacteria 7083200
316 2806062402 2802429635 Bacteria 7650140
317 2812366758 2811994881 Bacteria 6298475
318 2819644267 2818991453 Bacteria 7181617
319 2838668348 2838661181 Bacteria 7385261
320 2838685667 2838680041 Bacteria 6545511
321 2838688261 2838686498 Bacteria 7807632
322 2838700249 2838694306 Bacteria 6853137
323 2838713708 2838707686 Bacteria 6619912
324 2838732440 2838729681 Bacteria 7400765
325 2838745142 2838742623 Bacteria 7396178
326 2841852001 2841851746 Bacteria 7532261
327 2841869538 2841864319 Bacteria 6742987
328 2842082879 2842077413 Bacteria 6508645
329 2842123997 2842118031 Bacteria 7033875
330 2842158923 2842156927 Bacteria 6894975
331 2842166355 2842163707 Bacteria 6916235
332 2842182537 2842180545 Bacteria 6888678
333 2842232900 2842229732 Bacteria 7475766
334 2842243111 2842237096 Bacteria 6620661
335 2842247316 2842243621 Bacteria 7421798
336 2842261593 2842257432 Bacteria 7401195
337 2842272789 2842271015 Bacteria 7807131
338 2842297194 2842291075 Bacteria 7076806
339 2842307767 2842304105 Bacteria 7023636
340 2842346246 2842341865 Bacteria 7003929
341 2842368071 2842363717 Bacteria 6844742
342 2842377142 2842370503 Bacteria 7038661
343 2842383557 2842377471 Bacteria 7140707
344 2842390550 2842384541 Bacteria 7057858
345 2842399312 2842395702 Bacteria 6780583
346 2842806395 2842805378 Bacteria 5385175
347 2844461687 2844454524 Bacteria 7952546
348 2850084163 2850079185 Bacteria 6848280
349 2857522699 2857516855 Bacteria 7787325
350 2865017539 2865014394 Bacteria 4764573
351 2889916450 2889914905 Bacteria 5702301
352 2898798233 2898795034 Bacteria 4294459
353 2913299829 2913295892 Bacteria 6333755
354 2920764963 2920760137 Bacteria 7427611
355 2923520792 2923519811 Bacteria 6298479
356 2923562485 2923556063 Bacteria 6793593
357 2929143094 2929138655 Bacteria 5810547
358 2933019610 2933016740 Bacteria 6355406
359 2933574218 2933570622 Bacteria 7023390
360 2935900317 2935894831 Bacteria 6620579
361 2935908305 2935901341 Bacteria 7341747
362 2936373780 2936367885 Bacteria 7324495
363 2936377306 2936375103 Bacteria 6652732
364 2937001932 2936996657 Bacteria 6298727
365 2996895439 2996893221 Bacteria 5823108
366 3005447516 3005445848 Bacteria 6906074
367 8005276199 8005275841 Bacteria 6929066
368 8005311841 8005307578 Bacteria 7395396
369 8005382295 8005376324 Bacteria 6590079
370 8005384350 8005382845 Bacteria 6732062
371 8005466344 8005460587 Bacteria 7157962
372 8005700404 8005695170 Bacteria 6912330
373 8018179360 8018176218 Bacteria 6896178
374 8023685849 8023680758 Bacteria 7729763
375 8024486318 8024479707 Bacteria 6954785
376 8049295925 8049293176 Bacteria 6128433
377 8054848800 8054844752 Bacteria 4450330
378 8054849364 8054849141 Bacteria 5232694
379 8056134634 8056131705 Bacteria 6107031
380 8056376485 8056375014 Bacteria 7006639
381 8057878273 8057874678 Bacteria 7494653
382 SwRhRL2b_contig_28845
383 JGI25152J39213_1006740
384 JGI25151J46595_10047063
385 JGI25153J46596_10015751
386 rootH1_10256644
387 Ga0055524_1026250
388 Ga0055528_1007133
389 Ga0055540_1023271
390 Ga0058692_1019240
391 Ga0065714_10400414
392 Ga0065704_10002405
393 Ga0065712_10365792
394 Ga0065707_10552613
395 Ga0070661_100155022
396 Ga0070692_10765183
397 Ga0070668_100058076
398 Ga0070668_100652279
399 Ga0070669_101120357
400 Ga0070667_102277839
401 Ga0070700_101007178
402 Ga0070662_100023044
403 Ga0070679_100003051
404 Ga0070679_101526035
405 Ga0070665_101206482
406 Ga0070664_100672424
407 Ga0075363_100075672
408 Ga0075364_10085742
409 Ga0075364_10846689
410 Ga0075362_10262784
411 Ga0075367_10137363
412 Ga0075367_10506872
413 Ga0075370_10229752
414 Ga0068871_101074173
415 Ga0075428_100000042
416 Ga0075428_102332295
417 Ga0075430_100043081
418 Ga0075431_100171852
419 Ga0075429_100280501
420 Ga0079104_1057637
421 Ga0105244_10383688
422 Ga0111539_10000002
423 Ga0111539_10093990
424 Ga0114129_10434160
425 Ga0105239_11950634
426 Ga0157373_10076838
427 Ga0157373_10094716
428 Ga0157371_10005848
429 Ga0157370_10000155
430 Ga0157370_11812167
431 Ga0163163_11595573
432 Ga0214544_1000063
433 Ga0214542_1000095
434 Ga0214542_1040220
435 Ga0214543_1000018
436 Ga0214543_1000026
437 Ga0207425_1016723
438 Ga0209129_1003947
439 Ga0209129_1012695
440 Ga0209673_1002723
441 Ga0209025_1011274
442 Ga0209564_1016581
443 Ga0209758_1000749
444 Ga0209758_1001555
445 Ga0209050_1003685
446 Ga0209256_1005955
447 Ga0209051_1000070
448 Ga0209051_1028484
449 Ga0209257_1011502
450 Ga0207660_10814786
451 Ga0207649_10132672
452 Ga0207652_10047762
453 Ga0207650_10000125
454 Ga0207651_11117150
455 Ga0207668_10112208
456 Ga0209371_1000580
457 Ga0209371_1005301
458 Ga0209974_10004667
459 Ga0209974_10103690
460 Ga0207428_10000004
461 Ga0268266_11005304
462 Ga0268256_1002730
463 Ga0268256_1005175
464 Ga0307413_10023682
465 Ga0307413_10204659
466 Ga0307413_11770149
467 Ga0307406_10192935
468 Ga0307407_10344134
469 Ga0307416_100271595
470 Ga0307414_10050495
471 Ga0307414_10287541
472 Ga0307414_10474684
473 Ga0307414_10823133
474 Ga0395898_0046159
475 Ga0395901_0037730
476 Ga0439438_000020
477 Ga0439438_005383
478 Ga0439447_000561
479 Ga0439447_004392
480 Ga0439465_0010392
481 Ga0439465_0021824
482 Ga0451791_1436861
483 Ga0451798_0567132
484 Ga0451807_0418682
485 Ga0451833_0082307
486 Ga0451833_0651323
487 Ga0451835_0083258
488 Ga0451837_0229831
489 Ga0451837_1620162
490 Ga0451839_0240335
491 Ga0451845_0336321
492 Ga0451847_0561852
493 Ga0451847_0634815
494 Ga0451849_0570927
495 Ga0451849_0930439
496 Ga0451849_1036258
497 Ga0451843_0294544
498 Ga0451843_0443435
499 Ga0451855_0161294
500 Ga0451855_1974264
501 Ga0439445_0026769
502 Ga0439432_001067
503 Ga0439432_017045
504 Ga0439449_0070418
505 Ga0451577_0060214
506 Ga0451577_0809250
507 Ga0453684_0160841
508 Ga0451576_0025657
509 Ga0495638_0000120
510 Ga0495638_0022810
511 Ga0495650_0046412
512 Ga0495585_0004930
513 Ga0495585_0046099
514 Ga0495596_0060640
515 Ga0495607_0066653
516 Ga0495607_0067597
517 Ga0495583_0148460
518 Ga0495583_0158611
519 Ga0495606_0000144
520 Ga0495606_0000286
521 Ga0495606_0014184
522 Ga0495606_0642815
523 Ga0495610_0013902
524 Ga0495620_0006859
525 Ga0495620_0191290
526 Ga0495631_0274811
527 Ga0495632_0073051
528 Ga0495632_0085271
529 Ga0495632_0188306
530 Ga0495643_0007279
531 Ga0495643_0013119
532 Ga0495643_0094280
533 Ga0495648_0042778
534 Ga0495654_0140458
535 Ga0495654_0179695
536 Ga0495609_0056160
537 Ga0495597_0005557
538 Ga0495668_0101273
539 Ga0495611_0262606
540 Ga0495625_0130119
541 Ga0495661_0113457
542 Ga0495671_0102389
543 Ga0495649_0000188
544 Ga0495660_0028429
545 Ga0495672_0009877
546 Ga0495683_0018039
547 Ga0495687_129075
548 Ga0495677_0252224
549 Ga0495685_119915
550 Ga0495681_0042402
551 Ga0495686_0004530
552 Ga0495686_0028275
553 Ga0495615_0020494
554 Ga0496106_0000125
555 Ga0496118_0024502
556 Ga0496119_0233042
557 Ga0496121_0000115
558 Ga0496121_0002299
559 Ga0496121_0014938
560 Ga0496121_0027242
561 Ga0496121_0033053
562 Ga0496121_0450821
563 Ga0496121_0475746
564 Ga0496121_0510415
565 Ga0496121_0825707
566 Ga0496122_0036200
567 Ga0496123_0015545
568 Ga0496123_0308761
569 Ga0496124_0012547
570 Ga0496124_0045108
571 Ga0496124_0279865
572 Ga0496125_0031962
573 Ga0496125_0207065
574 Ga0496125_0596517
575 Ga0495678_147320
576 Ga0495682_0295318
577 Ga0501031_0028346
578 Ga0501031_0059108
579 Ga0501033_0526238
580 Ga0501034_0520379
581 Ga0501036_0020022
582 Ga0501036_0076958
583 Ga0501037_0286892
584 Ga0501038_0243954
585 Ga0501039_0352630
586 Ga0501040_0077661
587 Ga0501040_1054836
588 Ga0501042_1424570
589 Ga0501043_0611866
590 Ga0501043_1261495
591 Ga0501047_0494736
592 Ga0501048_0091105
593 Ga0501048_0469878
594 Ga0501067_0016842
595 Ga0501068_0006486
596 Ga0501072_0058561
597 Ga0501072_0589879
598 Ga0501075_0000349
599 Ga0501075_0062271
600 Ga0501075_0147379
601 Ga0501077_0001165
602 Ga0501077_0925345
603 Ga0501223_000100
604 Ga0501224_000002
605 Ga0501233_009311
606 Ga0501225_0000120
607 Ga0501234_000923
608 Ga0501079_0033597
609 Ga0501079_0113861
610 Ga0501079_0433069
611 Ga0501080_0029863
612 Ga0501081_0016555
613 Ga0501081_0058557
614 Ga0501035_0202235
615 Ga0501045_0047812
616 Ga0501226_000089
617 nmdc:mga03n38_205298_c1
618 nmdc:mga03n38_267308_c1
619 nmdc:mga00v17_128825_c1
620 nmdc:mga00v17_800674_c1
621 nmdc:mga06z11_602424_c1
622 nmdc:mga09592_192481_c1
623 nmdc:mga0qj67_33909_c1
624 nmdc:mga08y16_2_c1
625 Ga0495655_0013652
626 Ga0500578_0046800
627 Ga0500644_0193663
628 Ga0500583_0033317
629 Ga0500651_0223348
630 Ga0500651_0289079
631 Ga0500641_0010837
632 Ga0500562_086119
633 Ga0500594_0180577
634 Ga0500618_000098
635 Ga0500628_087233
636 Ga0500652_205949
637 Ga0500658_0000376
638 Ga0500658_0002500
639 Ga0500658_0035446
640 Ga0500659_0226120
641 Ga0500568_0000101
642 Ga0500568_0003503
643 Ga0500577_0282778
644 Ga0500604_0015909
645 Ga0500616_0000473
646 Ga0500616_0026069
647 Ga0500616_0042681
648 Ga0500620_164999
649 Ga0500622_0154985
650 Ga0500627_0022961
651 Ga0500633_0003205
652 Ga0500633_0184510
653 Ga0590071_044464
654 Ga0590074_109364
655 Ga0590077_129169
656 8005401449
657 2509109974
658 2509378407
659 2509386358
660 2509441573
661 2510137661
662 2510893509
663 2513571717
664 2513575787
665 2513912942
666 2514019040
667 2514586390
668 2515109236
669 2515612548
670 2515633453
671 2515659058
672 2515743826
673 2517042370
674 2517081242
675 2517411712
676 2524449793
677 2558861789
678 2585205794
679 2585526334
680 2585827994
681 2585834924
682 2644195109
683 2657683998
684 2719388788
685 2721402513
686 2724034579
687 2725948049
688 2739033876
689 2739791054
690 2739791099
691 2792582562
692 2793317881
693 2793328580
694 2793368362
695 2804753310
696 2806053361
697 2806062402
698 2812366758
699 2819644267
700 2838668348
701 2838685667
702 2838688261
703 2838700249
704 2838713708
705 2838732440
706 2838745142
707 2841852001
708 2841869538
709 2842082879
710 2842123997
711 2842158923
712 2842166355
713 2842182537
714 2842232900
715 2842243111
716 2842247316
717 2842261593
718 2842272789
719 2842297194
720 2842307767
721 2842346246
722 2842368071
723 2842377142
724 2842383557
725 2842390550
726 2842399312
727 2842806395
728 2844461687
729 2850084163
730 2857522699
731 2865017539
732 2889916450
733 2898798233
734 2913299829
735 2920764963
736 2923520792
737 2923562485
738 2929143094
739 2933019610
740 2933574218
741 2935900317
742 2935908305
743 2936373780
744 2936377306
745 2937001932
746 2996895439
747 3005447516
748 8005276199
749 8005311841
750 8005382295
751 8005384350
752 8005466344
753 8005700404
754 8018179360
755 8023685849
756 8024486318
757 8049295925
758 8054848800
759 8054849364
760 8056134634
761 8056376485
762 8057878273

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04239

DUF421

YetF C-terminal domain

101

174

0.93

PF20730

YetF_N

YetF N-terminal transmembrane domain

25

98

0.89

Map