F421464
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 359 | 245 | 718 | 259 |
Family's Representative Sequence
| Representative Sequence | 3300005578|Ga0068854_100078114|Ga0068854_1000781142 |
| Length | 307 |
| Sequence | VVATVDDHGDAADRSGTTGYQPVPAPIRAARPTSPGRRPAEVSVPVTTLYSMLIGAHVREADPVVSAAERGAEVVQMFLADPQGWKKPPAHPQAQELRDGPLTVVVHAPYVVNLASPNNRIRIPSRKLVAQHAVGAAEVGAIGLVVHGGHVTAKDDPVDGVENWRKFLARQADEGGFPVPVLIENTAGGEHAMARRFDALGRLWDAVAEFGVGFCLDTCHAHAAGEDLVGVVDRIKAITGRIDLVHLNDSRDAFGSGADRHANVGDGTIDPELLVAVCAAAGAPVVVETPAEGQAADIAFLRERLGS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 4 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 6 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 8 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 14 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 19 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 23 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 25 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 26 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 27 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 28 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 29 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 30 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 31 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 32 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 33 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 34 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 35 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 36 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 37 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 38 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 39 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009988 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG | Metagenome | Rhizosphere |
| 47 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013875 | Rhizosphere microbial communities from switchgrass unharvested rhizosphere in Austin, TX, USA - RS_233 | Metagenome | Rhizosphere |
| 55 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 59 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 60 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 96 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 99 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 100 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 101 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 102 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 103 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 104 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 105 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 106 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 107 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 108 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 109 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 110 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 111 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 112 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 113 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 114 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 115 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 116 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 117 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 118 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 119 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 120 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 121 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 122 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 123 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 124 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 125 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 126 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 127 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 128 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 129 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 130 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 131 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 132 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 133 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 134 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 135 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 136 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 137 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 138 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 139 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 140 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 141 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 142 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 143 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 144 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 145 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 146 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 147 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 148 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 149 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 150 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 151 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 161 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 162 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 163 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 164 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 165 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 166 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 167 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 168 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 169 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 170 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 171 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 172 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 173 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 174 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 175 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 176 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 177 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 178 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 179 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 180 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 181 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 182 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 183 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 184 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 185 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 186 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 187 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 188 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 189 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 190 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 191 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 192 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 193 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 194 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 195 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 196 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 197 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 198 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 199 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 200 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 201 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 203 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 204 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 205 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 206 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 207 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 208 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 209 | 2547132424 | Nocardia nova SH22a | Isolate | Unclassified |
| 210 | 2551306166 | Nocardia tenerifensis NBRC 101015 | Isolate | Rhizosphere |
| 211 | 2558860112 | Pseudonocardia acaciae DSM 45401 | Isolate | Unclassified |
| 212 | 2558860280 | Kutzneria sp. 744 | Isolate | Unclassified |
| 213 | 2582580736 | Prauserella sp. Am3 | Isolate | Unclassified |
| 214 | 2643221690 | Cellulomonas sp. Root485 | Isolate | Unclassified |
| 215 | 2643221692 | Nocardia sp. Root136 | Isolate | Unclassified |
| 216 | 2643221694 | Cellulomonas sp. Root137 | Isolate | Unclassified |
| 217 | 2643221722 | Cellulomonas sp. Root930 | Isolate | Unclassified |
| 218 | 2738543005 | Rhodococcus sp. OK519 | Isolate | Unclassified |
| 219 | 2738543011 | Rhodococcus sp. OK611 | Isolate | Unclassified |
| 220 | 2738543034 | Rhodococcus sp. OK269 | Isolate | Unclassified |
| 221 | 2744054611 | Aldersonia kunmingensis DSM 45001 | Isolate | Rhizosphere |
| 222 | 2791354901 | Actinophytocola xanthii 11-183 | Isolate | Rhizosphere |
| 223 | 2795385470 | Labedaea rhizosphaerae DSM 45361 | Isolate | Rhizosphere |
| 224 | 2795385472 | Herbihabitans rhizosphaerae DSM 101727 | Isolate | Rhizosphere |
| 225 | 2808606522 | Amycolatopsis sp. BJA-103 | Isolate | Unclassified |
| 226 | 2816332139 | Pseudonocardia kunmingensis DSM 45301 | Isolate | Unclassified |
| 227 | 2842888712 | Tsukamurella sp. R-71941 | Isolate | Unclassified |
| 228 | 2870782633 | Pseudonocardia eucalypti DSM 45351 | Isolate | Unclassified |
| 229 | 2889300758 | Rhodococcus sp. PvR099 | Isolate | Rhizosphere |
| 230 | 2899359706 | Amycolatopsis anabasis EGI 650086 | Isolate | Unclassified |
| 231 | 2899370129 | Amycolatopsis alkalitolerans SYSUP0005 | Isolate | Stem Tuber |
| 232 | 2904765812 | Rhodococcus fascians 1590 | Isolate | Rhizosphere |
| 233 | 2904770941 | Rhodococcus fascians 1339 | Isolate | Rhizosphere |
| 234 | 2908811453 | Rhodococcus sp. 1R11 | Isolate | Unclassified |
| 235 | 2915358134 | Pseudonocardia pini CAP47R | Isolate | Unclassified |
| 236 | 2919420072 | Rhodococcus fascians 3241 | Isolate | Rhizosphere |
| 237 | 2919432681 | Rhodococcus sp. 3258 | Isolate | Rhizosphere |
| 238 | 2919713450 | Nocardia kruczakiae 4272 | Isolate | Rhizosphere |
| 239 | 2928142448 | Prescottella equi DPS 2018 | Isolate | Unclassified |
| 240 | 2939743619 | Rhodococcus sp. PvR044 | Isolate | Rhizosphere |
| 241 | 3002998708 | Actinomadura barringtoniae GKU 128 | Isolate | Unclassified |
| 242 | 8003314358 | Amycolatopsis sp. MtRt-6 | Isolate | Unclassified |
| 243 | 8047710418 | Umezawaea endophytica DSM 103496 | Isolate | Unclassified |
| 244 | 8053945823 | Actinomadura terrae OS3-83 | Isolate | Rhizosphere |
| 245 | 8054472261 | Pseudonocardia terrae RS11V-5 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.69 |
| Metatranscriptomes | 0 |
| Isolates | 10.31 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.62 |
| Nodule | 0 |
| Rhizoplane | 6.96 |
| Rhizosphere | 76.04 |
| Stem | 0 |
| Stem Tuber | 0.28 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0068854_100078114 | 3300005578 | Bacteria | 2437 |
| 2 | Ga0070658_10075862 | 3300005327 | Bacteria | 2758 |
| 3 | Ga0070658_10316313 | 3300005327 | Bacteria | 1332 |
| 4 | Ga0070658_10465689 | 3300005327 | Bacteria | 1090 |
| 5 | Ga0068869_100460189 | 3300005334 | Bacteria | 1056 |
| 6 | Ga0070682_100071889 | 3300005337 | Bacteria | 2215 |
| 7 | Ga0070682_100246016 | 3300005337 | Bacteria | 1286 |
| 8 | Ga0068868_100098908 | 3300005338 | Bacteria | 2359 |
| 9 | Ga0068868_100283708 | 3300005338 | Bacteria | 1402 |
| 10 | Ga0070689_100118955 | 3300005340 | Bacteria | 2109 |
| 11 | Ga0070692_10010058 | 3300005345 | Bacteria | 4292 |
| 12 | Ga0070669_100260049 | 3300005353 | Bacteria | 1385 |
| 13 | Ga0070714_100051772 | 3300005435 | Bacteria | 3502 |
| 14 | Ga0070714_100063189 | 3300005435 | Bacteria | 3183 |
| 15 | Ga0070700_100329326 | 3300005441 | Bacteria | 1125 |
| 16 | Ga0070663_100000784 | 3300005455 | Bacteria | 17288 |
| 17 | Ga0070662_100337473 | 3300005457 | Bacteria | 1232 |
| 18 | Ga0068867_100187191 | 3300005459 | Bacteria | 1650 |
| 19 | Ga0070685_10009148 | 3300005466 | Bacteria | 5111 |
| 20 | Ga0070685_10321791 | 3300005466 | Bacteria | 1048 |
| 21 | Ga0070706_100021523 | 3300005467 | Bacteria | 5937 |
| 22 | Ga0070679_100126309 | 3300005530 | Bacteria | 2540 |
| 23 | Ga0070684_100208486 | 3300005535 | Bacteria | 1781 |
| 24 | Ga0068853_100047763 | 3300005539 | Bacteria | 3674 |
| 25 | Ga0070686_100105419 | 3300005544 | Bacteria | 1911 |
| 26 | Ga0070693_100414705 | 3300005547 | Bacteria | 937 |
| 27 | Ga0070665_100030019 | 3300005548 | Bacteria | 5471 |
| 28 | Ga0070665_100168838 | 3300005548 | Bacteria | 2189 |
| 29 | Ga0070665_100411492 | 3300005548 | Bacteria | 1361 |
| 30 | Ga0070665_100487274 | 3300005548 | Bacteria | 1244 |
| 31 | Ga0068856_100061031 | 3300005614 | Bacteria | 3724 |
| 32 | Ga0068856_100189772 | 3300005614 | Bacteria | 2069 |
| 33 | Ga0070702_100039400 | 3300005615 | Bacteria | 2637 |
| 34 | Ga0070702_100045841 | 3300005615 | Bacteria | 2475 |
| 35 | Ga0068852_100536009 | 3300005616 | Bacteria | 1169 |
| 36 | Ga0068866_10083332 | 3300005718 | Bacteria | 1722 |
| 37 | Ga0068861_100047650 | 3300005719 | Bacteria | 3236 |
| 38 | Ga0068870_10117966 | 3300005840 | Bacteria | 1524 |
| 39 | Ga0068863_100079229 | 3300005841 | Bacteria | 3111 |
| 40 | Ga0068863_100119932 | 3300005841 | Bacteria | 2507 |
| 41 | Ga0068860_100012998 | 3300005843 | Bacteria | 8175 |
| 42 | Ga0068862_100136270 | 3300005844 | Bacteria | 2175 |
| 43 | Ga0081539_10000023 | 3300005985 | Bacteria | 356082 |
| 44 | Ga0081539_10022005 | 3300005985 | Bacteria | 4234 |
| 45 | Ga0081539_10141098 | 3300005985 | Bacteria | 1171 |
| 46 | Ga0075363_100036346 | 3300006048 | Bacteria | 2583 |
| 47 | Ga0075363_100101200 | 3300006048 | Bacteria | 1595 |
| 48 | Ga0075364_10002040 | 3300006051 | Bacteria | 11262 |
| 49 | Ga0075370_10083018 | 3300006353 | Bacteria | 1843 |
| 50 | Ga0075428_100002665 | 3300006844 | Bacteria | 19393 |
| 51 | Ga0075428_100066833 | 3300006844 | Bacteria | 3936 |
| 52 | Ga0075428_100177631 | 3300006844 | Bacteria | 2306 |
| 53 | Ga0075428_100186888 | 3300006844 | Bacteria | 2242 |
| 54 | Ga0075430_100004635 | 3300006846 | Bacteria | 11566 |
| 55 | Ga0075431_100025721 | 3300006847 | Bacteria | 6032 |
| 56 | Ga0075431_100158947 | 3300006847 | Bacteria | 2324 |
| 57 | Ga0075431_100649052 | 3300006847 | Bacteria | 1036 |
| 58 | Ga0075429_100002834 | 3300006880 | Bacteria | 14675 |
| 59 | Ga0075429_100003101 | 3300006880 | Bacteria | 14112 |
| 60 | Ga0075429_100094341 | 3300006880 | Bacteria | 2610 |
| 61 | Ga0075429_100437418 | 3300006880 | Bacteria | 1146 |
| 62 | Ga0111539_10022939 | 3300009094 | Bacteria | 7663 |
| 63 | Ga0111539_10368284 | 3300009094 | Bacteria | 1673 |
| 64 | Ga0105247_10013010 | 3300009101 | Bacteria | 4990 |
| 65 | Ga0114129_10031771 | 3300009147 | Bacteria | 7463 |
| 66 | Ga0114129_10134700 | 3300009147 | Bacteria | 3390 |
| 67 | Ga0114129_10243369 | 3300009147 | Bacteria | 2418 |
| 68 | Ga0114129_10306864 | 3300009147 | Bacteria | 2114 |
| 69 | Ga0105243_10000931 | 3300009148 | Bacteria | 27438 |
| 70 | Ga0105243_10285189 | 3300009148 | Bacteria | 1489 |
| 71 | Ga0105242_10115511 | 3300009176 | Bacteria | 2294 |
| 72 | Ga0105248_10137478 | 3300009177 | Bacteria | 2756 |
| 73 | Ga0105248_10289047 | 3300009177 | Bacteria | 1846 |
| 74 | Ga0105238_10034245 | 3300009551 | Bacteria | 5168 |
| 75 | Ga0105238_10111885 | 3300009551 | Bacteria | 2710 |
| 76 | Ga0105238_10122222 | 3300009551 | Bacteria | 2583 |
| 77 | Ga0105238_10226979 | 3300009551 | Bacteria | 1844 |
| 78 | Ga0105035_100579 | 3300009988 | Bacteria | 2265 |
| 79 | Ga0105239_10030154 | 3300010375 | Bacteria | 5963 |
| 80 | Ga0157371_10099793 | 3300013102 | Bacteria | 2059 |
| 81 | Ga0157371_10213726 | 3300013102 | Bacteria | 1384 |
| 82 | Ga0157370_10263721 | 3300013104 | Bacteria | 1592 |
| 83 | Ga0157369_10203907 | 3300013105 | Bacteria | 2075 |
| 84 | Ga0157369_10651261 | 3300013105 | Bacteria | 1086 |
| 85 | Ga0157378_10437356 | 3300013297 | Bacteria | 1296 |
| 86 | Ga0157372_10139430 | 3300013307 | Bacteria | 2793 |
| 87 | Ga0157375_10110541 | 3300013308 | Bacteria | 2846 |
| 88 | Ga0157375_10122293 | 3300013308 | Bacteria | 2714 |
| 89 | Ga0157515_118767 | 3300013875 | Bacteria | 1647 |
| 90 | Ga0163163_10247603 | 3300014325 | Bacteria | 1832 |
| 91 | Ga0163163_10454594 | 3300014325 | Bacteria | 1341 |
| 92 | Ga0157377_10055030 | 3300014745 | Bacteria | 2255 |
| 93 | Ga0157379_10261006 | 3300014968 | Bacteria | 1574 |
| 94 | Ga0157379_10527300 | 3300014968 | Bacteria | 1097 |
| 95 | Ga0157379_10535470 | 3300014968 | Bacteria | 1088 |
| 96 | Ga0213873_10000687 | 3300021358 | Bacteria | 5527 |
| 97 | Ga0213875_10002803 | 3300021388 | Bacteria | 10252 |
| 98 | Ga0207692_10004979 | 3300025898 | Bacteria | 5287 |
| 99 | Ga0207647_10045976 | 3300025904 | Bacteria | 2721 |
| 100 | Ga0207705_10468032 | 3300025909 | Bacteria | 978 |
| 101 | Ga0207684_10219665 | 3300025910 | Bacteria | 1640 |
| 102 | Ga0207671_10402362 | 3300025914 | Bacteria | 1089 |
| 103 | Ga0207660_10056860 | 3300025917 | Bacteria | 2800 |
| 104 | Ga0207657_10025958 | 3300025919 | Bacteria | 5393 |
| 105 | Ga0207652_10083611 | 3300025921 | Bacteria | 2795 |
| 106 | Ga0207652_10166567 | 3300025921 | Bacteria | 1976 |
| 107 | Ga0207652_10222436 | 3300025921 | Bacteria | 1701 |
| 108 | Ga0207681_10529087 | 3300025923 | Bacteria | 968 |
| 109 | Ga0207694_10063960 | 3300025924 | Bacteria | 2866 |
| 110 | Ga0207659_10155645 | 3300025926 | Bacteria | 1789 |
| 111 | Ga0207687_10104128 | 3300025927 | Bacteria | 2094 |
| 112 | Ga0207664_10014303 | 3300025929 | Bacteria | 5726 |
| 113 | Ga0207664_10121242 | 3300025929 | Bacteria | 2188 |
| 114 | Ga0207690_10345677 | 3300025932 | Bacteria | 1175 |
| 115 | Ga0207706_10066499 | 3300025933 | Bacteria | 3172 |
| 116 | Ga0207686_10504133 | 3300025934 | Bacteria | 939 |
| 117 | Ga0207709_10013022 | 3300025935 | Bacteria | 4585 |
| 118 | Ga0207691_10090386 | 3300025940 | Bacteria | 2745 |
| 119 | Ga0207711_10136870 | 3300025941 | Bacteria | 2200 |
| 120 | Ga0207711_10262550 | 3300025941 | Bacteria | 1587 |
| 121 | Ga0207689_10314481 | 3300025942 | Bacteria | 1299 |
| 122 | Ga0207667_10181936 | 3300025949 | Bacteria | 2158 |
| 123 | Ga0207651_10466374 | 3300025960 | Bacteria | 1086 |
| 124 | Ga0207712_10614889 | 3300025961 | Bacteria | 941 |
| 125 | Ga0207668_10141556 | 3300025972 | Bacteria | 1850 |
| 126 | Ga0207640_10099856 | 3300025981 | Bacteria | 2032 |
| 127 | Ga0207677_10349644 | 3300026023 | Bacteria | 1238 |
| 128 | Ga0207639_10467031 | 3300026041 | Bacteria | 1148 |
| 129 | Ga0207678_10000045 | 3300026067 | Bacteria | 91982 |
| 130 | Ga0207678_10055142 | 3300026067 | Bacteria | 3423 |
| 131 | Ga0207678_10164143 | 3300026067 | Bacteria | 1897 |
| 132 | Ga0207678_10286997 | 3300026067 | Bacteria | 1413 |
| 133 | Ga0207708_10115104 | 3300026075 | Bacteria | 2091 |
| 134 | Ga0207641_10257118 | 3300026088 | Bacteria | 1633 |
| 135 | Ga0207648_10023175 | 3300026089 | Bacteria | 5568 |
| 136 | Ga0207676_10158022 | 3300026095 | Bacteria | 1961 |
| 137 | Ga0207675_100029110 | 3300026118 | Bacteria | 5148 |
| 138 | Ga0207683_10059674 | 3300026121 | Bacteria | 3351 |
| 139 | Ga0207683_10673927 | 3300026121 | Bacteria | 958 |
| 140 | Ga0207698_10060580 | 3300026142 | Bacteria | 2944 |
| 141 | Ga0207428_10052883 | 3300027907 | Bacteria | 3241 |
| 142 | Ga0268266_10371059 | 3300028379 | Bacteria | 1348 |
| 143 | Ga0268264_10293079 | 3300028381 | Bacteria | 1529 |
| 144 | Ga0307515_10045544 | 3300028794 | Bacteria | 6735 |
| 145 | Ga0307511_10004148 | 3300030521 | Bacteria | 14802 |
| 146 | Ga0307512_10003647 | 3300030522 | Bacteria | 17602 |
| 147 | Ga0307512_10150266 | 3300030522 | Bacteria | 1396 |
| 148 | Ga0316177_1054102 | 3300030731 | Bacteria | 1133 |
| 149 | Ga0314311_1015293 | 3300030733 | Bacteria | 5968 |
| 150 | Ga0316179_1094143 | 3300030734 | Bacteria | 1916 |
| 151 | Ga0316180_1082295 | 3300030736 | Bacteria | 4669 |
| 152 | Ga0316181_1194812 | 3300030744 | Bacteria | 1245 |
| 153 | Ga0307513_10003648 | 3300031456 | Bacteria | 20830 |
| 154 | Ga0307513_10017897 | 3300031456 | Bacteria | 8484 |
| 155 | Ga0307513_10109411 | 3300031456 | Bacteria | 2761 |
| 156 | Ga0307509_10381990 | 3300031507 | Bacteria | 1121 |
| 157 | Ga0307508_10137645 | 3300031616 | Bacteria | 2045 |
| 158 | Ga0307508_10138518 | 3300031616 | Bacteria | 2037 |
| 159 | Ga0316576_10023334 | 3300031727 | Bacteria | 4307 |
| 160 | Ga0316578_10001147 | 3300031728 | Bacteria | 10412 |
| 161 | Ga0307405_10455907 | 3300031731 | Bacteria | 1015 |
| 162 | Ga0307413_10245663 | 3300031824 | Bacteria | 1324 |
| 163 | Ga0307413_10552964 | 3300031824 | Bacteria | 934 |
| 164 | Ga0307410_10030052 | 3300031852 | Bacteria | 3468 |
| 165 | Ga0307410_10190477 | 3300031852 | Bacteria | 1559 |
| 166 | Ga0326468_10006151 | 3300031889 | Bacteria | 1103 |
| 167 | Ga0307407_10137246 | 3300031903 | Bacteria | 1573 |
| 168 | Ga0307409_100142333 | 3300031995 | Bacteria | 2068 |
| 169 | Ga0307409_100151256 | 3300031995 | Bacteria | 2015 |
| 170 | Ga0307409_100877198 | 3300031995 | Bacteria | 909 |
| 171 | Ga0307416_100030509 | 3300032002 | Bacteria | 4046 |
| 172 | Ga0307416_100047429 | 3300032002 | Bacteria | 3400 |
| 173 | Ga0307414_10299266 | 3300032004 | Bacteria | 1360 |
| 174 | Ga0307414_10649151 | 3300032004 | Bacteria | 951 |
| 175 | Ga0307411_10137273 | 3300032005 | Bacteria | 1797 |
| 176 | Ga0307411_10411115 | 3300032005 | Bacteria | 1121 |
| 177 | Ga0307415_100029187 | 3300032126 | Bacteria | 3522 |
| 178 | Ga0307415_100090444 | 3300032126 | Bacteria | 2214 |
| 179 | Ga0307415_100425801 | 3300032126 | Bacteria | 1140 |
| 180 | Ga0307507_10049707 | 3300033179 | Bacteria | 4059 |
| 181 | Ga0307510_10070318 | 3300033180 | Bacteria | 3496 |
| 182 | Ga0373956_0002315 | 3300035119 | Bacteria | 7827 |
| 183 | Ga0316574_0186424 | 3300035398 | Bacteria | 1334 |
| 184 | Ga0373931_0094294 | 3300035691 | Bacteria | 1673 |
| 185 | Ga0395899_0179799 | 3300037312 | Bacteria | 1486 |
| 186 | Ga0395900_0073666 | 3300037418 | Bacteria | 3511 |
| 187 | Ga0395900_0256087 | 3300037418 | Bacteria | 1750 |
| 188 | Ga0436364_0454887 | 3300037853 | Bacteria | 53594 |
| 189 | Ga0395901_0008463 | 3300038443 | Bacteria | 10397 |
| 190 | Ga0395901_0178091 | 3300038443 | Bacteria | 2230 |
| 191 | Ga0395901_0317212 | 3300038443 | Bacteria | 1613 |
| 192 | Ga0400485_12497 | 3300038735 | Bacteria | 2932 |
| 193 | Ga0436365_1307720 | 3300039437 | Bacteria | 1974 |
| 194 | Ga0436362_0506247 | 3300039453 | Bacteria | 34546 |
| 195 | Ga0451791_0950023 | 3300041451 | Bacteria | 2451 |
| 196 | Ga0451797_1143526 | 3300041453 | Bacteria | 1478 |
| 197 | Ga0439463_052848 | 3300042016 | Bacteria | 1037 |
| 198 | Ga0466969_0008615 | 3300044656 | Bacteria | 5409 |
| 199 | Ga0466972_0000367 | 3300044658 | Bacteria | 24375 |
| 200 | Ga0466972_0001536 | 3300044658 | Bacteria | 11249 |
| 201 | Ga0466972_0117958 | 3300044658 | Bacteria | 1252 |
| 202 | Ga0466965_0006497 | 3300044683 | Bacteria | 5314 |
| 203 | Ga0466965_0156060 | 3300044683 | Bacteria | 1195 |
| 204 | Ga0466966_0000453 | 3300044684 | Bacteria | 26427 |
| 205 | Ga0466966_0007972 | 3300044684 | Bacteria | 7019 |
| 206 | Ga0466961_0004745 | 3300044693 | Bacteria | 8557 |
| 207 | Ga0466961_0039663 | 3300044693 | Bacteria | 3019 |
| 208 | Ga0466961_0097323 | 3300044693 | Bacteria | 1855 |
| 209 | Ga0466963_0002863 | 3300044694 | Bacteria | 9742 |
| 210 | Ga0466963_0035775 | 3300044694 | Bacteria | 3235 |
| 211 | Ga0466963_0123899 | 3300044694 | Bacteria | 1781 |
| 212 | Ga0466963_0177870 | 3300044694 | Bacteria | 1485 |
| 213 | Ga0466963_0260586 | 3300044694 | Bacteria | 1217 |
| 214 | Ga0466964_0107865 | 3300044706 | Bacteria | 1238 |
| 215 | Ga0466964_0233931 | 3300044706 | Bacteria | 898 |
| 216 | Ga0466971_0024799 | 3300044719 | Bacteria | 2677 |
| 217 | Ga0466971_0034224 | 3300044719 | Bacteria | 2277 |
| 218 | Ga0466971_0096566 | 3300044719 | Bacteria | 1355 |
| 219 | Ga0466971_0118639 | 3300044719 | Bacteria | 1224 |
| 220 | Ga0466968_0008466 | 3300044735 | Bacteria | 3940 |
| 221 | Ga0466968_0142589 | 3300044735 | Bacteria | 1097 |
| 222 | Ga0466970_0001917 | 3300044765 | Bacteria | 10064 |
| 223 | Ga0466970_0173261 | 3300044765 | Bacteria | 1196 |
| 224 | Ga0466957_0001294 | 3300044842 | Bacteria | 13059 |
| 225 | Ga0466957_0058364 | 3300044842 | Bacteria | 2364 |
| 226 | Ga0466960_0016304 | 3300044901 | Bacteria | 3219 |
| 227 | Ga0466960_0031465 | 3300044901 | Bacteria | 2449 |
| 228 | Ga0466960_0051324 | 3300044901 | Bacteria | 1992 |
| 229 | Ga0466960_0082959 | 3300044901 | Bacteria | 1619 |
| 230 | Ga0466960_0303753 | 3300044901 | Bacteria | 900 |
| 231 | Ga0466959_0006922 | 3300045049 | Bacteria | 7921 |
| 232 | Ga0466959_0066510 | 3300045049 | Bacteria | 2615 |
| 233 | Ga0466959_0100382 | 3300045049 | Bacteria | 2072 |
| 234 | Ga0466959_0307247 | 3300045049 | Bacteria | 1085 |
| 235 | Ga0466958_0003135 | 3300045836 | Bacteria | 8506 |
| 236 | Ga0466958_0014988 | 3300045836 | Bacteria | 4435 |
| 237 | Ga0466958_0075894 | 3300045836 | Bacteria | 2062 |
| 238 | Ga0466958_0257932 | 3300045836 | Bacteria | 1116 |
| 239 | Ga0466958_0341918 | 3300045836 | Bacteria | 963 |
| 240 | Ga0466967_0000516 | 3300045976 | Bacteria | 18846 |
| 241 | Ga0466967_0011123 | 3300045976 | Bacteria | 6798 |
| 242 | Ga0466967_0022774 | 3300045976 | Bacteria | 5121 |
| 243 | Ga0466967_0070791 | 3300045976 | Bacteria | 3120 |
| 244 | Ga0466967_0088631 | 3300045976 | Bacteria | 2809 |
| 245 | Ga0466967_0220065 | 3300045976 | Bacteria | 1804 |
| 246 | Ga0495641_0034743 | 3300046461 | Bacteria | 2381 |
| 247 | Ga0495650_0029468 | 3300046471 | Bacteria | 2501 |
| 248 | Ga0495594_0034115 | 3300046499 | Bacteria | 2768 |
| 249 | Ga0495607_0045728 | 3300046501 | Bacteria | 2573 |
| 250 | Ga0495665_0008858 | 3300046531 | Bacteria | 5460 |
| 251 | Ga0495588_0129073 | 3300046674 | Bacteria | 1333 |
| 252 | Ga0495581_0037939 | 3300047315 | Bacteria | 2788 |
| 253 | Ga0495672_0012935 | 3300047320 | Bacteria | 5785 |
| 254 | Ga0495683_0002599 | 3300047323 | Bacteria | 10838 |
| 255 | Ga0496100_0115371 | 3300048903 | Bacteria | 1873 |
| 256 | Ga0496100_0325749 | 3300048903 | Bacteria | 1155 |
| 257 | Ga0496101_0010612 | 3300048904 | Bacteria | 6085 |
| 258 | Ga0496102_0000560 | 3300048905 | Bacteria | 39736 |
| 259 | Ga0496102_0213661 | 3300048905 | Bacteria | 1818 |
| 260 | Ga0496103_0000385 | 3300048906 | Bacteria | 39543 |
| 261 | Ga0496104_0007064 | 3300048907 | Bacteria | 9902 |
| 262 | Ga0496104_0061058 | 3300048907 | Bacteria | 3572 |
| 263 | Ga0496104_0230927 | 3300048907 | Bacteria | 1762 |
| 264 | Ga0496105_0089903 | 3300048908 | Bacteria | 2537 |
| 265 | Ga0496106_0193609 | 3300048909 | Bacteria | 1617 |
| 266 | Ga0496106_0293331 | 3300048909 | Bacteria | 1304 |
| 267 | Ga0496107_0368790 | 3300048910 | Bacteria | 1068 |
| 268 | Ga0496107_0491201 | 3300048910 | Bacteria | 911 |
| 269 | Ga0496108_0168912 | 3300048911 | Bacteria | 1892 |
| 270 | Ga0496108_0244332 | 3300048911 | Bacteria | 1561 |
| 271 | Ga0496108_0375501 | 3300048911 | Bacteria | 1241 |
| 272 | Ga0496109_0164454 | 3300048912 | Bacteria | 2080 |
| 273 | Ga0496109_0199769 | 3300048912 | Bacteria | 1879 |
| 274 | Ga0496112_0117179 | 3300048915 | Bacteria | 2633 |
| 275 | Ga0496114_0090746 | 3300048917 | Bacteria | 2594 |
| 276 | Ga0496114_0270861 | 3300048917 | Bacteria | 1496 |
| 277 | Ga0496114_0421136 | 3300048917 | Bacteria | 1183 |
| 278 | Ga0496116_0006479 | 3300048919 | Bacteria | 10607 |
| 279 | Ga0496117_0001161 | 3300048920 | Bacteria | 39578 |
| 280 | Ga0496118_0001214 | 3300048921 | Bacteria | 39626 |
| 281 | Ga0496119_0002169 | 3300048922 | Bacteria | 22032 |
| 282 | Ga0496120_0003329 | 3300048923 | Bacteria | 14772 |
| 283 | Ga0496121_0020770 | 3300048924 | Bacteria | 6474 |
| 284 | Ga0496122_0310546 | 3300048925 | Bacteria | 844 |
| 285 | Ga0496124_0073859 | 3300048927 | Bacteria | 2820 |
| 286 | Ga0496126_0001311 | 3300048929 | Bacteria | 39607 |
| 287 | Ga0501040_0092247 | 3300049576 | Bacteria | 2106 |
| 288 | Ga0501041_0443993 | 3300049577 | Bacteria | 823 |
| 289 | Ga0501042_0032020 | 3300049578 | Bacteria | 3722 |
| 290 | Ga0501046_0173367 | 3300049580 | Bacteria | 1617 |
| 291 | Ga0501047_0154762 | 3300049581 | Bacteria | 2167 |
| 292 | Ga0501047_0226748 | 3300049581 | Bacteria | 1723 |
| 293 | Ga0501069_0111483 | 3300049585 | Bacteria | 1558 |
| 294 | Ga0501070_0036068 | 3300049586 | Bacteria | 4130 |
| 295 | Ga0501076_0167468 | 3300049592 | Bacteria | 1791 |
| 296 | Ga0501077_0232467 | 3300049593 | Bacteria | 1172 |
| 297 | Ga0501083_0250428 | 3300049744 | Bacteria | 1153 |
| 298 | Ga0501044_0226313 | 3300049823 | Bacteria | 1820 |
| 299 | nmdc:mga03683_264940_c1 | 3300050489 | Bacteria | 800 |
| 300 | nmdc:mga03n38_78358_c1 | 3300050490 | Bacteria | 1546 |
| 301 | nmdc:mga00v17_25777_c1 | 3300050491 | Bacteria | 3420 |
| 302 | nmdc:mga06z11_378730_c1 | 3300050494 | Bacteria | 850 |
| 303 | nmdc:mga07m45_78370_c1 | 3300050496 | Bacteria | 1885 |
| 304 | nmdc:mga05p37_129691_c1 | 3300050507 | Bacteria | 3094 |
| 305 | nmdc:mga05p37_44649_c1 | 3300050507 | Bacteria | 5452 |
| 306 | nmdc:mga05p37_44725_c1 | 3300050507 | Bacteria | 5448 |
| 307 | nmdc:mga09592_258704_c1 | 3300050508 | Bacteria | 1509 |
| 308 | nmdc:mga09592_26142_c1 | 3300050508 | Bacteria | 3401 |
| 309 | nmdc:mga09592_48581_c1 | 3300050508 | Bacteria | 3577 |
| 310 | nmdc:mga09592_88500_c1 | 3300050508 | Bacteria | 2645 |
| 311 | nmdc:mga0qj67_328402_c1 | 3300050509 | Bacteria | 1238 |
| 312 | nmdc:mga06r32_1277_c4 | 3300050510 | Bacteria | 3021 |
| 313 | nmdc:mga06r32_596967_c1 | 3300050510 | Bacteria | 1075 |
| 314 | Ga0495619_0017069 | 3300053085 | Bacteria | 4602 |
| 315 | Ga0500655_037415 | 3300053133 | Bacteria | 946 |
| 316 | Ga0500559_0008124 | 3300053136 | Bacteria | 4616 |
| 317 | Ga0500577_0050443 | 3300053142 | Bacteria | 1560 |
| 318 | Ga0500616_0140476 | 3300053153 | Bacteria | 1129 |
| 319 | Ga0501082_0306457 | 3300060353 | Bacteria | 1383 |
| 320 | Ga0466962_0000954 | 3300061719 | Bacteria | 13117 |
| 321 | Ga0466962_0131324 | 3300061719 | Bacteria | 1210 |
| 322 | Ga0530510_0484611 | 3300061734 | Bacteria | 937 |
| 323 | 2548698613 | 2547132424 | Bacteria | 8348532 |
| 324 | 2552110261 | 2551306166 | Bacteria | 9731570 |
| 325 | 2558910219 | 2558860112 | Bacteria | 9931328 |
| 326 | 2559428043 | 2558860280 | Bacteria | 11429938 |
| 327 | 2583152802 | 2582580736 | Bacteria | 5325865 |
| 328 | 2644503946 | 2643221690 | Bacteria | 4654705 |
| 329 | 2644513597 | 2643221692 | Bacteria | 7282860 |
| 330 | 2644525755 | 2643221694 | Bacteria | 4392972 |
| 331 | 2644669826 | 2643221722 | Bacteria | 4247614 |
| 332 | 2739203849 | 2738543005 | Bacteria | 5278128 |
| 333 | 2739238459 | 2738543011 | Bacteria | 5731169 |
| 334 | 2739365015 | 2738543034 | Bacteria | 6084756 |
| 335 | 2744957551 | 2744054611 | Bacteria | 5611514 |
| 336 | 2791911135 | 2791354901 | Bacteria | 8322202 |
| 337 | 2795780912 | 2795385470 | Bacteria | 8317180 |
| 338 | 2795794818 | 2795385472 | Bacteria | 6627535 |
| 339 | 2809594064 | 2808606522 | Bacteria | 9488490 |
| 340 | 2816506273 | 2816332139 | Bacteria | 9138787 |
| 341 | 2842890397 | 2842888712 | Bacteria | 4279094 |
| 342 | 2870782795 | 2870782633 | Bacteria | 9624083 |
| 343 | 2889302897 | 2889300758 | Bacteria | 5690814 |
| 344 | 2899359924 | 2899359706 | Bacteria | 10940472 |
| 345 | 2899377054 | 2899370129 | Bacteria | 6781179 |
| 346 | 2904768843 | 2904765812 | Bacteria | 5369154 |
| 347 | 2904771869 | 2904770941 | Bacteria | 5580202 |
| 348 | 2908812910 | 2908811453 | Bacteria | 5478616 |
| 349 | 2915362938 | 2915358134 | Bacteria | 6050864 |
| 350 | 2919422202 | 2919420072 | Bacteria | 5390363 |
| 351 | 2919434240 | 2919432681 | Bacteria | 5390474 |
| 352 | 2919719284 | 2919713450 | Bacteria | 7431245 |
| 353 | 2928145578 | 2928142448 | Bacteria | 5288925 |
| 354 | 2939746226 | 2939743619 | Bacteria | 5762299 |
| 355 | 3003003624 | 3002998708 | Bacteria | 11715108 |
| 356 | 8003314818 | 8003314358 | Bacteria | 10575343 |
| 357 | 8047719136 | 8047710418 | Bacteria | 11023148 |
| 358 | 8053951926 | 8053945823 | Bacteria | 8962862 |
| 359 | 8054474838 | 8054472261 | Bacteria | 7464355 |
| 360 | Ga0068854_100078114 | |||
| 361 | Ga0070658_10075862 | |||
| 362 | Ga0070658_10316313 | |||
| 363 | Ga0070658_10465689 | |||
| 364 | Ga0068869_100460189 | |||
| 365 | Ga0070682_100071889 | |||
| 366 | Ga0070682_100246016 | |||
| 367 | Ga0068868_100098908 | |||
| 368 | Ga0068868_100283708 | |||
| 369 | Ga0070689_100118955 | |||
| 370 | Ga0070692_10010058 | |||
| 371 | Ga0070669_100260049 | |||
| 372 | Ga0070714_100051772 | |||
| 373 | Ga0070714_100063189 | |||
| 374 | Ga0070700_100329326 | |||
| 375 | Ga0070663_100000784 | |||
| 376 | Ga0070662_100337473 | |||
| 377 | Ga0068867_100187191 | |||
| 378 | Ga0070685_10009148 | |||
| 379 | Ga0070685_10321791 | |||
| 380 | Ga0070706_100021523 | |||
| 381 | Ga0070679_100126309 | |||
| 382 | Ga0070684_100208486 | |||
| 383 | Ga0068853_100047763 | |||
| 384 | Ga0070686_100105419 | |||
| 385 | Ga0070693_100414705 | |||
| 386 | Ga0070665_100030019 | |||
| 387 | Ga0070665_100168838 | |||
| 388 | Ga0070665_100411492 | |||
| 389 | Ga0070665_100487274 | |||
| 390 | Ga0068856_100061031 | |||
| 391 | Ga0068856_100189772 | |||
| 392 | Ga0070702_100039400 | |||
| 393 | Ga0070702_100045841 | |||
| 394 | Ga0068852_100536009 | |||
| 395 | Ga0068866_10083332 | |||
| 396 | Ga0068861_100047650 | |||
| 397 | Ga0068870_10117966 | |||
| 398 | Ga0068863_100079229 | |||
| 399 | Ga0068863_100119932 | |||
| 400 | Ga0068860_100012998 | |||
| 401 | Ga0068862_100136270 | |||
| 402 | Ga0081539_10000023 | |||
| 403 | Ga0081539_10022005 | |||
| 404 | Ga0081539_10141098 | |||
| 405 | Ga0075363_100036346 | |||
| 406 | Ga0075363_100101200 | |||
| 407 | Ga0075364_10002040 | |||
| 408 | Ga0075370_10083018 | |||
| 409 | Ga0075428_100002665 | |||
| 410 | Ga0075428_100066833 | |||
| 411 | Ga0075428_100177631 | |||
| 412 | Ga0075428_100186888 | |||
| 413 | Ga0075430_100004635 | |||
| 414 | Ga0075431_100025721 | |||
| 415 | Ga0075431_100158947 | |||
| 416 | Ga0075431_100649052 | |||
| 417 | Ga0075429_100002834 | |||
| 418 | Ga0075429_100003101 | |||
| 419 | Ga0075429_100094341 | |||
| 420 | Ga0075429_100437418 | |||
| 421 | Ga0111539_10022939 | |||
| 422 | Ga0111539_10368284 | |||
| 423 | Ga0105247_10013010 | |||
| 424 | Ga0114129_10031771 | |||
| 425 | Ga0114129_10134700 | |||
| 426 | Ga0114129_10243369 | |||
| 427 | Ga0114129_10306864 | |||
| 428 | Ga0105243_10000931 | |||
| 429 | Ga0105243_10285189 | |||
| 430 | Ga0105242_10115511 | |||
| 431 | Ga0105248_10137478 | |||
| 432 | Ga0105248_10289047 | |||
| 433 | Ga0105238_10034245 | |||
| 434 | Ga0105238_10111885 | |||
| 435 | Ga0105238_10122222 | |||
| 436 | Ga0105238_10226979 | |||
| 437 | Ga0105035_100579 | |||
| 438 | Ga0105239_10030154 | |||
| 439 | Ga0157371_10099793 | |||
| 440 | Ga0157371_10213726 | |||
| 441 | Ga0157370_10263721 | |||
| 442 | Ga0157369_10203907 | |||
| 443 | Ga0157369_10651261 | |||
| 444 | Ga0157378_10437356 | |||
| 445 | Ga0157372_10139430 | |||
| 446 | Ga0157375_10110541 | |||
| 447 | Ga0157375_10122293 | |||
| 448 | Ga0157515_118767 | |||
| 449 | Ga0163163_10247603 | |||
| 450 | Ga0163163_10454594 | |||
| 451 | Ga0157377_10055030 | |||
| 452 | Ga0157379_10261006 | |||
| 453 | Ga0157379_10527300 | |||
| 454 | Ga0157379_10535470 | |||
| 455 | Ga0213873_10000687 | |||
| 456 | Ga0213875_10002803 | |||
| 457 | Ga0207692_10004979 | |||
| 458 | Ga0207647_10045976 | |||
| 459 | Ga0207705_10468032 | |||
| 460 | Ga0207684_10219665 | |||
| 461 | Ga0207671_10402362 | |||
| 462 | Ga0207660_10056860 | |||
| 463 | Ga0207657_10025958 | |||
| 464 | Ga0207652_10083611 | |||
| 465 | Ga0207652_10166567 | |||
| 466 | Ga0207652_10222436 | |||
| 467 | Ga0207681_10529087 | |||
| 468 | Ga0207694_10063960 | |||
| 469 | Ga0207659_10155645 | |||
| 470 | Ga0207687_10104128 | |||
| 471 | Ga0207664_10014303 | |||
| 472 | Ga0207664_10121242 | |||
| 473 | Ga0207690_10345677 | |||
| 474 | Ga0207706_10066499 | |||
| 475 | Ga0207686_10504133 | |||
| 476 | Ga0207709_10013022 | |||
| 477 | Ga0207691_10090386 | |||
| 478 | Ga0207711_10136870 | |||
| 479 | Ga0207711_10262550 | |||
| 480 | Ga0207689_10314481 | |||
| 481 | Ga0207667_10181936 | |||
| 482 | Ga0207651_10466374 | |||
| 483 | Ga0207712_10614889 | |||
| 484 | Ga0207668_10141556 | |||
| 485 | Ga0207640_10099856 | |||
| 486 | Ga0207677_10349644 | |||
| 487 | Ga0207639_10467031 | |||
| 488 | Ga0207678_10000045 | |||
| 489 | Ga0207678_10055142 | |||
| 490 | Ga0207678_10164143 | |||
| 491 | Ga0207678_10286997 | |||
| 492 | Ga0207708_10115104 | |||
| 493 | Ga0207641_10257118 | |||
| 494 | Ga0207648_10023175 | |||
| 495 | Ga0207676_10158022 | |||
| 496 | Ga0207675_100029110 | |||
| 497 | Ga0207683_10059674 | |||
| 498 | Ga0207683_10673927 | |||
| 499 | Ga0207698_10060580 | |||
| 500 | Ga0207428_10052883 | |||
| 501 | Ga0268266_10371059 | |||
| 502 | Ga0268264_10293079 | |||
| 503 | Ga0307515_10045544 | |||
| 504 | Ga0307511_10004148 | |||
| 505 | Ga0307512_10003647 | |||
| 506 | Ga0307512_10150266 | |||
| 507 | Ga0316177_1054102 | |||
| 508 | Ga0314311_1015293 | |||
| 509 | Ga0316179_1094143 | |||
| 510 | Ga0316180_1082295 | |||
| 511 | Ga0316181_1194812 | |||
| 512 | Ga0307513_10003648 | |||
| 513 | Ga0307513_10017897 | |||
| 514 | Ga0307513_10109411 | |||
| 515 | Ga0307509_10381990 | |||
| 516 | Ga0307508_10137645 | |||
| 517 | Ga0307508_10138518 | |||
| 518 | Ga0316576_10023334 | |||
| 519 | Ga0316578_10001147 | |||
| 520 | Ga0307405_10455907 | |||
| 521 | Ga0307413_10245663 | |||
| 522 | Ga0307413_10552964 | |||
| 523 | Ga0307410_10030052 | |||
| 524 | Ga0307410_10190477 | |||
| 525 | Ga0326468_10006151 | |||
| 526 | Ga0307407_10137246 | |||
| 527 | Ga0307409_100142333 | |||
| 528 | Ga0307409_100151256 | |||
| 529 | Ga0307409_100877198 | |||
| 530 | Ga0307416_100030509 | |||
| 531 | Ga0307416_100047429 | |||
| 532 | Ga0307414_10299266 | |||
| 533 | Ga0307414_10649151 | |||
| 534 | Ga0307411_10137273 | |||
| 535 | Ga0307411_10411115 | |||
| 536 | Ga0307415_100029187 | |||
| 537 | Ga0307415_100090444 | |||
| 538 | Ga0307415_100425801 | |||
| 539 | Ga0307507_10049707 | |||
| 540 | Ga0307510_10070318 | |||
| 541 | Ga0373956_0002315 | |||
| 542 | Ga0316574_0186424 | |||
| 543 | Ga0373931_0094294 | |||
| 544 | Ga0395899_0179799 | |||
| 545 | Ga0395900_0073666 | |||
| 546 | Ga0395900_0256087 | |||
| 547 | Ga0436364_0454887 | |||
| 548 | Ga0395901_0008463 | |||
| 549 | Ga0395901_0178091 | |||
| 550 | Ga0395901_0317212 | |||
| 551 | Ga0400485_12497 | |||
| 552 | Ga0436365_1307720 | |||
| 553 | Ga0436362_0506247 | |||
| 554 | Ga0451791_0950023 | |||
| 555 | Ga0451797_1143526 | |||
| 556 | Ga0439463_052848 | |||
| 557 | Ga0466969_0008615 | |||
| 558 | Ga0466972_0000367 | |||
| 559 | Ga0466972_0001536 | |||
| 560 | Ga0466972_0117958 | |||
| 561 | Ga0466965_0006497 | |||
| 562 | Ga0466965_0156060 | |||
| 563 | Ga0466966_0000453 | |||
| 564 | Ga0466966_0007972 | |||
| 565 | Ga0466961_0004745 | |||
| 566 | Ga0466961_0039663 | |||
| 567 | Ga0466961_0097323 | |||
| 568 | Ga0466963_0002863 | |||
| 569 | Ga0466963_0035775 | |||
| 570 | Ga0466963_0123899 | |||
| 571 | Ga0466963_0177870 | |||
| 572 | Ga0466963_0260586 | |||
| 573 | Ga0466964_0107865 | |||
| 574 | Ga0466964_0233931 | |||
| 575 | Ga0466971_0024799 | |||
| 576 | Ga0466971_0034224 | |||
| 577 | Ga0466971_0096566 | |||
| 578 | Ga0466971_0118639 | |||
| 579 | Ga0466968_0008466 | |||
| 580 | Ga0466968_0142589 | |||
| 581 | Ga0466970_0001917 | |||
| 582 | Ga0466970_0173261 | |||
| 583 | Ga0466957_0001294 | |||
| 584 | Ga0466957_0058364 | |||
| 585 | Ga0466960_0016304 | |||
| 586 | Ga0466960_0031465 | |||
| 587 | Ga0466960_0051324 | |||
| 588 | Ga0466960_0082959 | |||
| 589 | Ga0466960_0303753 | |||
| 590 | Ga0466959_0006922 | |||
| 591 | Ga0466959_0066510 | |||
| 592 | Ga0466959_0100382 | |||
| 593 | Ga0466959_0307247 | |||
| 594 | Ga0466958_0003135 | |||
| 595 | Ga0466958_0014988 | |||
| 596 | Ga0466958_0075894 | |||
| 597 | Ga0466958_0257932 | |||
| 598 | Ga0466958_0341918 | |||
| 599 | Ga0466967_0000516 | |||
| 600 | Ga0466967_0011123 | |||
| 601 | Ga0466967_0022774 | |||
| 602 | Ga0466967_0070791 | |||
| 603 | Ga0466967_0088631 | |||
| 604 | Ga0466967_0220065 | |||
| 605 | Ga0495641_0034743 | |||
| 606 | Ga0495650_0029468 | |||
| 607 | Ga0495594_0034115 | |||
| 608 | Ga0495607_0045728 | |||
| 609 | Ga0495665_0008858 | |||
| 610 | Ga0495588_0129073 | |||
| 611 | Ga0495581_0037939 | |||
| 612 | Ga0495672_0012935 | |||
| 613 | Ga0495683_0002599 | |||
| 614 | Ga0496100_0115371 | |||
| 615 | Ga0496100_0325749 | |||
| 616 | Ga0496101_0010612 | |||
| 617 | Ga0496102_0000560 | |||
| 618 | Ga0496102_0213661 | |||
| 619 | Ga0496103_0000385 | |||
| 620 | Ga0496104_0007064 | |||
| 621 | Ga0496104_0061058 | |||
| 622 | Ga0496104_0230927 | |||
| 623 | Ga0496105_0089903 | |||
| 624 | Ga0496106_0193609 | |||
| 625 | Ga0496106_0293331 | |||
| 626 | Ga0496107_0368790 | |||
| 627 | Ga0496107_0491201 | |||
| 628 | Ga0496108_0168912 | |||
| 629 | Ga0496108_0244332 | |||
| 630 | Ga0496108_0375501 | |||
| 631 | Ga0496109_0164454 | |||
| 632 | Ga0496109_0199769 | |||
| 633 | Ga0496112_0117179 | |||
| 634 | Ga0496114_0090746 | |||
| 635 | Ga0496114_0270861 | |||
| 636 | Ga0496114_0421136 | |||
| 637 | Ga0496116_0006479 | |||
| 638 | Ga0496117_0001161 | |||
| 639 | Ga0496118_0001214 | |||
| 640 | Ga0496119_0002169 | |||
| 641 | Ga0496120_0003329 | |||
| 642 | Ga0496121_0020770 | |||
| 643 | Ga0496122_0310546 | |||
| 644 | Ga0496124_0073859 | |||
| 645 | Ga0496126_0001311 | |||
| 646 | Ga0501040_0092247 | |||
| 647 | Ga0501041_0443993 | |||
| 648 | Ga0501042_0032020 | |||
| 649 | Ga0501046_0173367 | |||
| 650 | Ga0501047_0154762 | |||
| 651 | Ga0501047_0226748 | |||
| 652 | Ga0501069_0111483 | |||
| 653 | Ga0501070_0036068 | |||
| 654 | Ga0501076_0167468 | |||
| 655 | Ga0501077_0232467 | |||
| 656 | Ga0501083_0250428 | |||
| 657 | Ga0501044_0226313 | |||
| 658 | nmdc:mga03683_264940_c1 | |||
| 659 | nmdc:mga03n38_78358_c1 | |||
| 660 | nmdc:mga00v17_25777_c1 | |||
| 661 | nmdc:mga06z11_378730_c1 | |||
| 662 | nmdc:mga07m45_78370_c1 | |||
| 663 | nmdc:mga05p37_129691_c1 | |||
| 664 | nmdc:mga05p37_44649_c1 | |||
| 665 | nmdc:mga05p37_44725_c1 | |||
| 666 | nmdc:mga09592_258704_c1 | |||
| 667 | nmdc:mga09592_26142_c1 | |||
| 668 | nmdc:mga09592_48581_c1 | |||
| 669 | nmdc:mga09592_88500_c1 | |||
| 670 | nmdc:mga0qj67_328402_c1 | |||
| 671 | nmdc:mga06r32_1277_c4 | |||
| 672 | nmdc:mga06r32_596967_c1 | |||
| 673 | Ga0495619_0017069 | |||
| 674 | Ga0500655_037415 | |||
| 675 | Ga0500559_0008124 | |||
| 676 | Ga0500577_0050443 | |||
| 677 | Ga0500616_0140476 | |||
| 678 | Ga0501082_0306457 | |||
| 679 | Ga0466962_0000954 | |||
| 680 | Ga0466962_0131324 | |||
| 681 | Ga0530510_0484611 | |||
| 682 | 2548698613 | |||
| 683 | 2552110261 | |||
| 684 | 2558910219 | |||
| 685 | 2559428043 | |||
| 686 | 2583152802 | |||
| 687 | 2644503946 | |||
| 688 | 2644513597 | |||
| 689 | 2644525755 | |||
| 690 | 2644669826 | |||
| 691 | 2739203849 | |||
| 692 | 2739238459 | |||
| 693 | 2739365015 | |||
| 694 | 2744957551 | |||
| 695 | 2791911135 | |||
| 696 | 2795780912 | |||
| 697 | 2795794818 | |||
| 698 | 2809594064 | |||
| 699 | 2816506273 | |||
| 700 | 2842890397 | |||
| 701 | 2870782795 | |||
| 702 | 2889302897 | |||
| 703 | 2899359924 | |||
| 704 | 2899377054 | |||
| 705 | 2904768843 | |||
| 706 | 2904771869 | |||
| 707 | 2908812910 | |||
| 708 | 2915362938 | |||
| 709 | 2919422202 | |||
| 710 | 2919434240 | |||
| 711 | 2919719284 | |||
| 712 | 2928145578 | |||
| 713 | 2939746226 | |||
| 714 | 3003003624 | |||
| 715 | 8003314818 | |||
| 716 | 8047719136 | |||
| 717 | 8053951926 | |||
| 718 | 8054474838 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5zhz-assembly1.cif.gz_A | crystal structure of the apurinic/apyrimidinic endonuclease iv from mycobacterium tuberculosis | 0.9837 | 1 | 255 |
| 5zhz-assembly1.cif.gz_A | crystal structure of the apurinic/apyrimidinic endonuclease iv from mycobacterium tuberculosis | 0.976 | 1 | 255 |
| 4k1g-assembly2.cif.gz_B | structure of e. coli nfo(endo iv)-h69a mutant bound to a cleaved dna duplex containing a alphada:t basepair | 0.8843 | 2 | 253 |
| 2nq9-assembly1.cif.gz_A | high resolution crystal structure of escherichia coli endonuclease iv (endo iv) y72a mutant bound to damaged dna | 0.8835 | 2 | 253 |
| 2nqj-assembly1.cif.gz_A | crystal structure of escherichia coli endonuclease iv (endo iv) e261q mutant bound to damaged dna | 0.8835 | 2 | 253 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WQ13_1_251_3.20.20.150 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.9874 | 1 | 254 | 3.20.20.150 |
| af_P9WQ13_1_251_3.20.20.150 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.9796 | 1 | 254 | 3.20.20.150 |
| af_Q8IE02_304_597_3.20.20.150 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.9011 | 2 | 254 | 3.20.20.150 |
| af_Q10002_117_395_3.20.20.150 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.9009 | 2 | 253 | 3.20.20.150 |
| af_A0A2R8Q599_47_340_3.20.20.150 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.8824 | 2 | 253 | 3.20.20.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2S9FRG2-F1-model_v4 | Deoxyribonuclease IV | 1.005 | 165 | 254 |
GO:0003677
GO:0003906 GO:0006284 GO:0008081 GO:0008270 |
| AF-A0A7U8YN31-F1-model_v4 | deleted | 1.003 | 162 | 255 |
|
| AF-A0A655AUG5-F1-model_v4 | Endonuclease IV (EC 3.1.21.2) | 0.9957 | 142 | 255 |
GO:0003677
GO:0003906 GO:0006284 GO:0008081 GO:0008270 GO:0008833 |
| AF-A0A4R7QU14-F1-model_v4 | deleted | 0.9956 | 1 | 254 |
|
| AF-A0A2T5L677-F1-model_v4 | deleted | 0.9952 | 1 | 256 |
|