F421464

General Info

Members Datasets Scaffolds Average Seq Length
359 245 718 259

Family's Representative Sequence

Representative Sequence 3300005578|Ga0068854_100078114|Ga0068854_1000781142
Length 307
Sequence VVATVDDHGDAADRSGTTGYQPVPAPIRAARPTSPGRRPAEVSVPVTTLYSMLIGAHVREADPVVSAAERGAEVVQMFLADPQGWKKPPAHPQAQELRDGPLTVVVHAPYVVNLASPNNRIRIPSRKLVAQHAVGAAEVGAIGLVVHGGHVTAKDDPVDGVENWRKFLARQADEGGFPVPVLIENTAGGEHAMARRFDALGRLWDAVAEFGVGFCLDTCHAHAAGEDLVGVVDRIKAITGRIDLVHLNDSRDAFGSGADRHANVGDGTIDPELLVAVCAAAGAPVVVETPAEGQAADIAFLRERLGS

Samples

Sample ID Description Type Environment
1 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
20 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
33 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
34 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300013875 Rhizosphere microbial communities from switchgrass unharvested rhizosphere in Austin, TX, USA - RS_233 Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
59 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
60 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
96 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
99 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
100 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
101 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
102 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
103 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
104 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
105 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
106 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
107 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
108 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
109 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
110 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
111 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
112 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
113 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
114 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
115 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
116 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
117 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
118 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
119 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
120 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
121 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
122 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
123 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
124 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
125 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
126 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
127 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
128 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
129 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
130 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
131 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
132 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
133 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
134 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
135 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
136 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
137 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
138 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
139 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
140 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
141 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
142 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
143 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
144 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
145 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
146 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
147 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
148 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
149 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
150 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
151 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
152 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
153 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
154 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
155 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
156 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
157 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
158 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
159 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
160 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
161 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
162 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
163 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
164 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
165 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
166 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
167 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
168 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
169 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
170 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
171 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
172 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
173 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
174 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
175 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
176 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
177 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
178 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
179 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
180 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
181 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
187 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
188 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
189 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
190 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
191 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
192 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
193 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
194 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
195 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
196 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
197 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
198 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
199 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
200 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
201 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
202 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
203 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
204 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
205 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
206 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
207 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
208 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
209 2547132424 Nocardia nova SH22a Isolate Unclassified
210 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
211 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
212 2558860280 Kutzneria sp. 744 Isolate Unclassified
213 2582580736 Prauserella sp. Am3 Isolate Unclassified
214 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
215 2643221692 Nocardia sp. Root136 Isolate Unclassified
216 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
217 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
218 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
219 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
220 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
221 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
222 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
223 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
224 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
225 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
226 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
227 2842888712 Tsukamurella sp. R-71941 Isolate Unclassified
228 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
229 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
230 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
231 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
232 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
233 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
234 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
235 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
236 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
237 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
238 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
239 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
240 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
241 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
242 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
243 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
244 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
245 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.69
Metatranscriptomes 0
Isolates 10.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.62
Nodule 0
Rhizoplane 6.96
Rhizosphere 76.04
Stem 0
Stem Tuber 0.28
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068854_100078114 3300005578 Bacteria 2437
2 Ga0070658_10075862 3300005327 Bacteria 2758
3 Ga0070658_10316313 3300005327 Bacteria 1332
4 Ga0070658_10465689 3300005327 Bacteria 1090
5 Ga0068869_100460189 3300005334 Bacteria 1056
6 Ga0070682_100071889 3300005337 Bacteria 2215
7 Ga0070682_100246016 3300005337 Bacteria 1286
8 Ga0068868_100098908 3300005338 Bacteria 2359
9 Ga0068868_100283708 3300005338 Bacteria 1402
10 Ga0070689_100118955 3300005340 Bacteria 2109
11 Ga0070692_10010058 3300005345 Bacteria 4292
12 Ga0070669_100260049 3300005353 Bacteria 1385
13 Ga0070714_100051772 3300005435 Bacteria 3502
14 Ga0070714_100063189 3300005435 Bacteria 3183
15 Ga0070700_100329326 3300005441 Bacteria 1125
16 Ga0070663_100000784 3300005455 Bacteria 17288
17 Ga0070662_100337473 3300005457 Bacteria 1232
18 Ga0068867_100187191 3300005459 Bacteria 1650
19 Ga0070685_10009148 3300005466 Bacteria 5111
20 Ga0070685_10321791 3300005466 Bacteria 1048
21 Ga0070706_100021523 3300005467 Bacteria 5937
22 Ga0070679_100126309 3300005530 Bacteria 2540
23 Ga0070684_100208486 3300005535 Bacteria 1781
24 Ga0068853_100047763 3300005539 Bacteria 3674
25 Ga0070686_100105419 3300005544 Bacteria 1911
26 Ga0070693_100414705 3300005547 Bacteria 937
27 Ga0070665_100030019 3300005548 Bacteria 5471
28 Ga0070665_100168838 3300005548 Bacteria 2189
29 Ga0070665_100411492 3300005548 Bacteria 1361
30 Ga0070665_100487274 3300005548 Bacteria 1244
31 Ga0068856_100061031 3300005614 Bacteria 3724
32 Ga0068856_100189772 3300005614 Bacteria 2069
33 Ga0070702_100039400 3300005615 Bacteria 2637
34 Ga0070702_100045841 3300005615 Bacteria 2475
35 Ga0068852_100536009 3300005616 Bacteria 1169
36 Ga0068866_10083332 3300005718 Bacteria 1722
37 Ga0068861_100047650 3300005719 Bacteria 3236
38 Ga0068870_10117966 3300005840 Bacteria 1524
39 Ga0068863_100079229 3300005841 Bacteria 3111
40 Ga0068863_100119932 3300005841 Bacteria 2507
41 Ga0068860_100012998 3300005843 Bacteria 8175
42 Ga0068862_100136270 3300005844 Bacteria 2175
43 Ga0081539_10000023 3300005985 Bacteria 356082
44 Ga0081539_10022005 3300005985 Bacteria 4234
45 Ga0081539_10141098 3300005985 Bacteria 1171
46 Ga0075363_100036346 3300006048 Bacteria 2583
47 Ga0075363_100101200 3300006048 Bacteria 1595
48 Ga0075364_10002040 3300006051 Bacteria 11262
49 Ga0075370_10083018 3300006353 Bacteria 1843
50 Ga0075428_100002665 3300006844 Bacteria 19393
51 Ga0075428_100066833 3300006844 Bacteria 3936
52 Ga0075428_100177631 3300006844 Bacteria 2306
53 Ga0075428_100186888 3300006844 Bacteria 2242
54 Ga0075430_100004635 3300006846 Bacteria 11566
55 Ga0075431_100025721 3300006847 Bacteria 6032
56 Ga0075431_100158947 3300006847 Bacteria 2324
57 Ga0075431_100649052 3300006847 Bacteria 1036
58 Ga0075429_100002834 3300006880 Bacteria 14675
59 Ga0075429_100003101 3300006880 Bacteria 14112
60 Ga0075429_100094341 3300006880 Bacteria 2610
61 Ga0075429_100437418 3300006880 Bacteria 1146
62 Ga0111539_10022939 3300009094 Bacteria 7663
63 Ga0111539_10368284 3300009094 Bacteria 1673
64 Ga0105247_10013010 3300009101 Bacteria 4990
65 Ga0114129_10031771 3300009147 Bacteria 7463
66 Ga0114129_10134700 3300009147 Bacteria 3390
67 Ga0114129_10243369 3300009147 Bacteria 2418
68 Ga0114129_10306864 3300009147 Bacteria 2114
69 Ga0105243_10000931 3300009148 Bacteria 27438
70 Ga0105243_10285189 3300009148 Bacteria 1489
71 Ga0105242_10115511 3300009176 Bacteria 2294
72 Ga0105248_10137478 3300009177 Bacteria 2756
73 Ga0105248_10289047 3300009177 Bacteria 1846
74 Ga0105238_10034245 3300009551 Bacteria 5168
75 Ga0105238_10111885 3300009551 Bacteria 2710
76 Ga0105238_10122222 3300009551 Bacteria 2583
77 Ga0105238_10226979 3300009551 Bacteria 1844
78 Ga0105035_100579 3300009988 Bacteria 2265
79 Ga0105239_10030154 3300010375 Bacteria 5963
80 Ga0157371_10099793 3300013102 Bacteria 2059
81 Ga0157371_10213726 3300013102 Bacteria 1384
82 Ga0157370_10263721 3300013104 Bacteria 1592
83 Ga0157369_10203907 3300013105 Bacteria 2075
84 Ga0157369_10651261 3300013105 Bacteria 1086
85 Ga0157378_10437356 3300013297 Bacteria 1296
86 Ga0157372_10139430 3300013307 Bacteria 2793
87 Ga0157375_10110541 3300013308 Bacteria 2846
88 Ga0157375_10122293 3300013308 Bacteria 2714
89 Ga0157515_118767 3300013875 Bacteria 1647
90 Ga0163163_10247603 3300014325 Bacteria 1832
91 Ga0163163_10454594 3300014325 Bacteria 1341
92 Ga0157377_10055030 3300014745 Bacteria 2255
93 Ga0157379_10261006 3300014968 Bacteria 1574
94 Ga0157379_10527300 3300014968 Bacteria 1097
95 Ga0157379_10535470 3300014968 Bacteria 1088
96 Ga0213873_10000687 3300021358 Bacteria 5527
97 Ga0213875_10002803 3300021388 Bacteria 10252
98 Ga0207692_10004979 3300025898 Bacteria 5287
99 Ga0207647_10045976 3300025904 Bacteria 2721
100 Ga0207705_10468032 3300025909 Bacteria 978
101 Ga0207684_10219665 3300025910 Bacteria 1640
102 Ga0207671_10402362 3300025914 Bacteria 1089
103 Ga0207660_10056860 3300025917 Bacteria 2800
104 Ga0207657_10025958 3300025919 Bacteria 5393
105 Ga0207652_10083611 3300025921 Bacteria 2795
106 Ga0207652_10166567 3300025921 Bacteria 1976
107 Ga0207652_10222436 3300025921 Bacteria 1701
108 Ga0207681_10529087 3300025923 Bacteria 968
109 Ga0207694_10063960 3300025924 Bacteria 2866
110 Ga0207659_10155645 3300025926 Bacteria 1789
111 Ga0207687_10104128 3300025927 Bacteria 2094
112 Ga0207664_10014303 3300025929 Bacteria 5726
113 Ga0207664_10121242 3300025929 Bacteria 2188
114 Ga0207690_10345677 3300025932 Bacteria 1175
115 Ga0207706_10066499 3300025933 Bacteria 3172
116 Ga0207686_10504133 3300025934 Bacteria 939
117 Ga0207709_10013022 3300025935 Bacteria 4585
118 Ga0207691_10090386 3300025940 Bacteria 2745
119 Ga0207711_10136870 3300025941 Bacteria 2200
120 Ga0207711_10262550 3300025941 Bacteria 1587
121 Ga0207689_10314481 3300025942 Bacteria 1299
122 Ga0207667_10181936 3300025949 Bacteria 2158
123 Ga0207651_10466374 3300025960 Bacteria 1086
124 Ga0207712_10614889 3300025961 Bacteria 941
125 Ga0207668_10141556 3300025972 Bacteria 1850
126 Ga0207640_10099856 3300025981 Bacteria 2032
127 Ga0207677_10349644 3300026023 Bacteria 1238
128 Ga0207639_10467031 3300026041 Bacteria 1148
129 Ga0207678_10000045 3300026067 Bacteria 91982
130 Ga0207678_10055142 3300026067 Bacteria 3423
131 Ga0207678_10164143 3300026067 Bacteria 1897
132 Ga0207678_10286997 3300026067 Bacteria 1413
133 Ga0207708_10115104 3300026075 Bacteria 2091
134 Ga0207641_10257118 3300026088 Bacteria 1633
135 Ga0207648_10023175 3300026089 Bacteria 5568
136 Ga0207676_10158022 3300026095 Bacteria 1961
137 Ga0207675_100029110 3300026118 Bacteria 5148
138 Ga0207683_10059674 3300026121 Bacteria 3351
139 Ga0207683_10673927 3300026121 Bacteria 958
140 Ga0207698_10060580 3300026142 Bacteria 2944
141 Ga0207428_10052883 3300027907 Bacteria 3241
142 Ga0268266_10371059 3300028379 Bacteria 1348
143 Ga0268264_10293079 3300028381 Bacteria 1529
144 Ga0307515_10045544 3300028794 Bacteria 6735
145 Ga0307511_10004148 3300030521 Bacteria 14802
146 Ga0307512_10003647 3300030522 Bacteria 17602
147 Ga0307512_10150266 3300030522 Bacteria 1396
148 Ga0316177_1054102 3300030731 Bacteria 1133
149 Ga0314311_1015293 3300030733 Bacteria 5968
150 Ga0316179_1094143 3300030734 Bacteria 1916
151 Ga0316180_1082295 3300030736 Bacteria 4669
152 Ga0316181_1194812 3300030744 Bacteria 1245
153 Ga0307513_10003648 3300031456 Bacteria 20830
154 Ga0307513_10017897 3300031456 Bacteria 8484
155 Ga0307513_10109411 3300031456 Bacteria 2761
156 Ga0307509_10381990 3300031507 Bacteria 1121
157 Ga0307508_10137645 3300031616 Bacteria 2045
158 Ga0307508_10138518 3300031616 Bacteria 2037
159 Ga0316576_10023334 3300031727 Bacteria 4307
160 Ga0316578_10001147 3300031728 Bacteria 10412
161 Ga0307405_10455907 3300031731 Bacteria 1015
162 Ga0307413_10245663 3300031824 Bacteria 1324
163 Ga0307413_10552964 3300031824 Bacteria 934
164 Ga0307410_10030052 3300031852 Bacteria 3468
165 Ga0307410_10190477 3300031852 Bacteria 1559
166 Ga0326468_10006151 3300031889 Bacteria 1103
167 Ga0307407_10137246 3300031903 Bacteria 1573
168 Ga0307409_100142333 3300031995 Bacteria 2068
169 Ga0307409_100151256 3300031995 Bacteria 2015
170 Ga0307409_100877198 3300031995 Bacteria 909
171 Ga0307416_100030509 3300032002 Bacteria 4046
172 Ga0307416_100047429 3300032002 Bacteria 3400
173 Ga0307414_10299266 3300032004 Bacteria 1360
174 Ga0307414_10649151 3300032004 Bacteria 951
175 Ga0307411_10137273 3300032005 Bacteria 1797
176 Ga0307411_10411115 3300032005 Bacteria 1121
177 Ga0307415_100029187 3300032126 Bacteria 3522
178 Ga0307415_100090444 3300032126 Bacteria 2214
179 Ga0307415_100425801 3300032126 Bacteria 1140
180 Ga0307507_10049707 3300033179 Bacteria 4059
181 Ga0307510_10070318 3300033180 Bacteria 3496
182 Ga0373956_0002315 3300035119 Bacteria 7827
183 Ga0316574_0186424 3300035398 Bacteria 1334
184 Ga0373931_0094294 3300035691 Bacteria 1673
185 Ga0395899_0179799 3300037312 Bacteria 1486
186 Ga0395900_0073666 3300037418 Bacteria 3511
187 Ga0395900_0256087 3300037418 Bacteria 1750
188 Ga0436364_0454887 3300037853 Bacteria 53594
189 Ga0395901_0008463 3300038443 Bacteria 10397
190 Ga0395901_0178091 3300038443 Bacteria 2230
191 Ga0395901_0317212 3300038443 Bacteria 1613
192 Ga0400485_12497 3300038735 Bacteria 2932
193 Ga0436365_1307720 3300039437 Bacteria 1974
194 Ga0436362_0506247 3300039453 Bacteria 34546
195 Ga0451791_0950023 3300041451 Bacteria 2451
196 Ga0451797_1143526 3300041453 Bacteria 1478
197 Ga0439463_052848 3300042016 Bacteria 1037
198 Ga0466969_0008615 3300044656 Bacteria 5409
199 Ga0466972_0000367 3300044658 Bacteria 24375
200 Ga0466972_0001536 3300044658 Bacteria 11249
201 Ga0466972_0117958 3300044658 Bacteria 1252
202 Ga0466965_0006497 3300044683 Bacteria 5314
203 Ga0466965_0156060 3300044683 Bacteria 1195
204 Ga0466966_0000453 3300044684 Bacteria 26427
205 Ga0466966_0007972 3300044684 Bacteria 7019
206 Ga0466961_0004745 3300044693 Bacteria 8557
207 Ga0466961_0039663 3300044693 Bacteria 3019
208 Ga0466961_0097323 3300044693 Bacteria 1855
209 Ga0466963_0002863 3300044694 Bacteria 9742
210 Ga0466963_0035775 3300044694 Bacteria 3235
211 Ga0466963_0123899 3300044694 Bacteria 1781
212 Ga0466963_0177870 3300044694 Bacteria 1485
213 Ga0466963_0260586 3300044694 Bacteria 1217
214 Ga0466964_0107865 3300044706 Bacteria 1238
215 Ga0466964_0233931 3300044706 Bacteria 898
216 Ga0466971_0024799 3300044719 Bacteria 2677
217 Ga0466971_0034224 3300044719 Bacteria 2277
218 Ga0466971_0096566 3300044719 Bacteria 1355
219 Ga0466971_0118639 3300044719 Bacteria 1224
220 Ga0466968_0008466 3300044735 Bacteria 3940
221 Ga0466968_0142589 3300044735 Bacteria 1097
222 Ga0466970_0001917 3300044765 Bacteria 10064
223 Ga0466970_0173261 3300044765 Bacteria 1196
224 Ga0466957_0001294 3300044842 Bacteria 13059
225 Ga0466957_0058364 3300044842 Bacteria 2364
226 Ga0466960_0016304 3300044901 Bacteria 3219
227 Ga0466960_0031465 3300044901 Bacteria 2449
228 Ga0466960_0051324 3300044901 Bacteria 1992
229 Ga0466960_0082959 3300044901 Bacteria 1619
230 Ga0466960_0303753 3300044901 Bacteria 900
231 Ga0466959_0006922 3300045049 Bacteria 7921
232 Ga0466959_0066510 3300045049 Bacteria 2615
233 Ga0466959_0100382 3300045049 Bacteria 2072
234 Ga0466959_0307247 3300045049 Bacteria 1085
235 Ga0466958_0003135 3300045836 Bacteria 8506
236 Ga0466958_0014988 3300045836 Bacteria 4435
237 Ga0466958_0075894 3300045836 Bacteria 2062
238 Ga0466958_0257932 3300045836 Bacteria 1116
239 Ga0466958_0341918 3300045836 Bacteria 963
240 Ga0466967_0000516 3300045976 Bacteria 18846
241 Ga0466967_0011123 3300045976 Bacteria 6798
242 Ga0466967_0022774 3300045976 Bacteria 5121
243 Ga0466967_0070791 3300045976 Bacteria 3120
244 Ga0466967_0088631 3300045976 Bacteria 2809
245 Ga0466967_0220065 3300045976 Bacteria 1804
246 Ga0495641_0034743 3300046461 Bacteria 2381
247 Ga0495650_0029468 3300046471 Bacteria 2501
248 Ga0495594_0034115 3300046499 Bacteria 2768
249 Ga0495607_0045728 3300046501 Bacteria 2573
250 Ga0495665_0008858 3300046531 Bacteria 5460
251 Ga0495588_0129073 3300046674 Bacteria 1333
252 Ga0495581_0037939 3300047315 Bacteria 2788
253 Ga0495672_0012935 3300047320 Bacteria 5785
254 Ga0495683_0002599 3300047323 Bacteria 10838
255 Ga0496100_0115371 3300048903 Bacteria 1873
256 Ga0496100_0325749 3300048903 Bacteria 1155
257 Ga0496101_0010612 3300048904 Bacteria 6085
258 Ga0496102_0000560 3300048905 Bacteria 39736
259 Ga0496102_0213661 3300048905 Bacteria 1818
260 Ga0496103_0000385 3300048906 Bacteria 39543
261 Ga0496104_0007064 3300048907 Bacteria 9902
262 Ga0496104_0061058 3300048907 Bacteria 3572
263 Ga0496104_0230927 3300048907 Bacteria 1762
264 Ga0496105_0089903 3300048908 Bacteria 2537
265 Ga0496106_0193609 3300048909 Bacteria 1617
266 Ga0496106_0293331 3300048909 Bacteria 1304
267 Ga0496107_0368790 3300048910 Bacteria 1068
268 Ga0496107_0491201 3300048910 Bacteria 911
269 Ga0496108_0168912 3300048911 Bacteria 1892
270 Ga0496108_0244332 3300048911 Bacteria 1561
271 Ga0496108_0375501 3300048911 Bacteria 1241
272 Ga0496109_0164454 3300048912 Bacteria 2080
273 Ga0496109_0199769 3300048912 Bacteria 1879
274 Ga0496112_0117179 3300048915 Bacteria 2633
275 Ga0496114_0090746 3300048917 Bacteria 2594
276 Ga0496114_0270861 3300048917 Bacteria 1496
277 Ga0496114_0421136 3300048917 Bacteria 1183
278 Ga0496116_0006479 3300048919 Bacteria 10607
279 Ga0496117_0001161 3300048920 Bacteria 39578
280 Ga0496118_0001214 3300048921 Bacteria 39626
281 Ga0496119_0002169 3300048922 Bacteria 22032
282 Ga0496120_0003329 3300048923 Bacteria 14772
283 Ga0496121_0020770 3300048924 Bacteria 6474
284 Ga0496122_0310546 3300048925 Bacteria 844
285 Ga0496124_0073859 3300048927 Bacteria 2820
286 Ga0496126_0001311 3300048929 Bacteria 39607
287 Ga0501040_0092247 3300049576 Bacteria 2106
288 Ga0501041_0443993 3300049577 Bacteria 823
289 Ga0501042_0032020 3300049578 Bacteria 3722
290 Ga0501046_0173367 3300049580 Bacteria 1617
291 Ga0501047_0154762 3300049581 Bacteria 2167
292 Ga0501047_0226748 3300049581 Bacteria 1723
293 Ga0501069_0111483 3300049585 Bacteria 1558
294 Ga0501070_0036068 3300049586 Bacteria 4130
295 Ga0501076_0167468 3300049592 Bacteria 1791
296 Ga0501077_0232467 3300049593 Bacteria 1172
297 Ga0501083_0250428 3300049744 Bacteria 1153
298 Ga0501044_0226313 3300049823 Bacteria 1820
299 nmdc:mga03683_264940_c1 3300050489 Bacteria 800
300 nmdc:mga03n38_78358_c1 3300050490 Bacteria 1546
301 nmdc:mga00v17_25777_c1 3300050491 Bacteria 3420
302 nmdc:mga06z11_378730_c1 3300050494 Bacteria 850
303 nmdc:mga07m45_78370_c1 3300050496 Bacteria 1885
304 nmdc:mga05p37_129691_c1 3300050507 Bacteria 3094
305 nmdc:mga05p37_44649_c1 3300050507 Bacteria 5452
306 nmdc:mga05p37_44725_c1 3300050507 Bacteria 5448
307 nmdc:mga09592_258704_c1 3300050508 Bacteria 1509
308 nmdc:mga09592_26142_c1 3300050508 Bacteria 3401
309 nmdc:mga09592_48581_c1 3300050508 Bacteria 3577
310 nmdc:mga09592_88500_c1 3300050508 Bacteria 2645
311 nmdc:mga0qj67_328402_c1 3300050509 Bacteria 1238
312 nmdc:mga06r32_1277_c4 3300050510 Bacteria 3021
313 nmdc:mga06r32_596967_c1 3300050510 Bacteria 1075
314 Ga0495619_0017069 3300053085 Bacteria 4602
315 Ga0500655_037415 3300053133 Bacteria 946
316 Ga0500559_0008124 3300053136 Bacteria 4616
317 Ga0500577_0050443 3300053142 Bacteria 1560
318 Ga0500616_0140476 3300053153 Bacteria 1129
319 Ga0501082_0306457 3300060353 Bacteria 1383
320 Ga0466962_0000954 3300061719 Bacteria 13117
321 Ga0466962_0131324 3300061719 Bacteria 1210
322 Ga0530510_0484611 3300061734 Bacteria 937
323 2548698613 2547132424 Bacteria 8348532
324 2552110261 2551306166 Bacteria 9731570
325 2558910219 2558860112 Bacteria 9931328
326 2559428043 2558860280 Bacteria 11429938
327 2583152802 2582580736 Bacteria 5325865
328 2644503946 2643221690 Bacteria 4654705
329 2644513597 2643221692 Bacteria 7282860
330 2644525755 2643221694 Bacteria 4392972
331 2644669826 2643221722 Bacteria 4247614
332 2739203849 2738543005 Bacteria 5278128
333 2739238459 2738543011 Bacteria 5731169
334 2739365015 2738543034 Bacteria 6084756
335 2744957551 2744054611 Bacteria 5611514
336 2791911135 2791354901 Bacteria 8322202
337 2795780912 2795385470 Bacteria 8317180
338 2795794818 2795385472 Bacteria 6627535
339 2809594064 2808606522 Bacteria 9488490
340 2816506273 2816332139 Bacteria 9138787
341 2842890397 2842888712 Bacteria 4279094
342 2870782795 2870782633 Bacteria 9624083
343 2889302897 2889300758 Bacteria 5690814
344 2899359924 2899359706 Bacteria 10940472
345 2899377054 2899370129 Bacteria 6781179
346 2904768843 2904765812 Bacteria 5369154
347 2904771869 2904770941 Bacteria 5580202
348 2908812910 2908811453 Bacteria 5478616
349 2915362938 2915358134 Bacteria 6050864
350 2919422202 2919420072 Bacteria 5390363
351 2919434240 2919432681 Bacteria 5390474
352 2919719284 2919713450 Bacteria 7431245
353 2928145578 2928142448 Bacteria 5288925
354 2939746226 2939743619 Bacteria 5762299
355 3003003624 3002998708 Bacteria 11715108
356 8003314818 8003314358 Bacteria 10575343
357 8047719136 8047710418 Bacteria 11023148
358 8053951926 8053945823 Bacteria 8962862
359 8054474838 8054472261 Bacteria 7464355
360 Ga0068854_100078114
361 Ga0070658_10075862
362 Ga0070658_10316313
363 Ga0070658_10465689
364 Ga0068869_100460189
365 Ga0070682_100071889
366 Ga0070682_100246016
367 Ga0068868_100098908
368 Ga0068868_100283708
369 Ga0070689_100118955
370 Ga0070692_10010058
371 Ga0070669_100260049
372 Ga0070714_100051772
373 Ga0070714_100063189
374 Ga0070700_100329326
375 Ga0070663_100000784
376 Ga0070662_100337473
377 Ga0068867_100187191
378 Ga0070685_10009148
379 Ga0070685_10321791
380 Ga0070706_100021523
381 Ga0070679_100126309
382 Ga0070684_100208486
383 Ga0068853_100047763
384 Ga0070686_100105419
385 Ga0070693_100414705
386 Ga0070665_100030019
387 Ga0070665_100168838
388 Ga0070665_100411492
389 Ga0070665_100487274
390 Ga0068856_100061031
391 Ga0068856_100189772
392 Ga0070702_100039400
393 Ga0070702_100045841
394 Ga0068852_100536009
395 Ga0068866_10083332
396 Ga0068861_100047650
397 Ga0068870_10117966
398 Ga0068863_100079229
399 Ga0068863_100119932
400 Ga0068860_100012998
401 Ga0068862_100136270
402 Ga0081539_10000023
403 Ga0081539_10022005
404 Ga0081539_10141098
405 Ga0075363_100036346
406 Ga0075363_100101200
407 Ga0075364_10002040
408 Ga0075370_10083018
409 Ga0075428_100002665
410 Ga0075428_100066833
411 Ga0075428_100177631
412 Ga0075428_100186888
413 Ga0075430_100004635
414 Ga0075431_100025721
415 Ga0075431_100158947
416 Ga0075431_100649052
417 Ga0075429_100002834
418 Ga0075429_100003101
419 Ga0075429_100094341
420 Ga0075429_100437418
421 Ga0111539_10022939
422 Ga0111539_10368284
423 Ga0105247_10013010
424 Ga0114129_10031771
425 Ga0114129_10134700
426 Ga0114129_10243369
427 Ga0114129_10306864
428 Ga0105243_10000931
429 Ga0105243_10285189
430 Ga0105242_10115511
431 Ga0105248_10137478
432 Ga0105248_10289047
433 Ga0105238_10034245
434 Ga0105238_10111885
435 Ga0105238_10122222
436 Ga0105238_10226979
437 Ga0105035_100579
438 Ga0105239_10030154
439 Ga0157371_10099793
440 Ga0157371_10213726
441 Ga0157370_10263721
442 Ga0157369_10203907
443 Ga0157369_10651261
444 Ga0157378_10437356
445 Ga0157372_10139430
446 Ga0157375_10110541
447 Ga0157375_10122293
448 Ga0157515_118767
449 Ga0163163_10247603
450 Ga0163163_10454594
451 Ga0157377_10055030
452 Ga0157379_10261006
453 Ga0157379_10527300
454 Ga0157379_10535470
455 Ga0213873_10000687
456 Ga0213875_10002803
457 Ga0207692_10004979
458 Ga0207647_10045976
459 Ga0207705_10468032
460 Ga0207684_10219665
461 Ga0207671_10402362
462 Ga0207660_10056860
463 Ga0207657_10025958
464 Ga0207652_10083611
465 Ga0207652_10166567
466 Ga0207652_10222436
467 Ga0207681_10529087
468 Ga0207694_10063960
469 Ga0207659_10155645
470 Ga0207687_10104128
471 Ga0207664_10014303
472 Ga0207664_10121242
473 Ga0207690_10345677
474 Ga0207706_10066499
475 Ga0207686_10504133
476 Ga0207709_10013022
477 Ga0207691_10090386
478 Ga0207711_10136870
479 Ga0207711_10262550
480 Ga0207689_10314481
481 Ga0207667_10181936
482 Ga0207651_10466374
483 Ga0207712_10614889
484 Ga0207668_10141556
485 Ga0207640_10099856
486 Ga0207677_10349644
487 Ga0207639_10467031
488 Ga0207678_10000045
489 Ga0207678_10055142
490 Ga0207678_10164143
491 Ga0207678_10286997
492 Ga0207708_10115104
493 Ga0207641_10257118
494 Ga0207648_10023175
495 Ga0207676_10158022
496 Ga0207675_100029110
497 Ga0207683_10059674
498 Ga0207683_10673927
499 Ga0207698_10060580
500 Ga0207428_10052883
501 Ga0268266_10371059
502 Ga0268264_10293079
503 Ga0307515_10045544
504 Ga0307511_10004148
505 Ga0307512_10003647
506 Ga0307512_10150266
507 Ga0316177_1054102
508 Ga0314311_1015293
509 Ga0316179_1094143
510 Ga0316180_1082295
511 Ga0316181_1194812
512 Ga0307513_10003648
513 Ga0307513_10017897
514 Ga0307513_10109411
515 Ga0307509_10381990
516 Ga0307508_10137645
517 Ga0307508_10138518
518 Ga0316576_10023334
519 Ga0316578_10001147
520 Ga0307405_10455907
521 Ga0307413_10245663
522 Ga0307413_10552964
523 Ga0307410_10030052
524 Ga0307410_10190477
525 Ga0326468_10006151
526 Ga0307407_10137246
527 Ga0307409_100142333
528 Ga0307409_100151256
529 Ga0307409_100877198
530 Ga0307416_100030509
531 Ga0307416_100047429
532 Ga0307414_10299266
533 Ga0307414_10649151
534 Ga0307411_10137273
535 Ga0307411_10411115
536 Ga0307415_100029187
537 Ga0307415_100090444
538 Ga0307415_100425801
539 Ga0307507_10049707
540 Ga0307510_10070318
541 Ga0373956_0002315
542 Ga0316574_0186424
543 Ga0373931_0094294
544 Ga0395899_0179799
545 Ga0395900_0073666
546 Ga0395900_0256087
547 Ga0436364_0454887
548 Ga0395901_0008463
549 Ga0395901_0178091
550 Ga0395901_0317212
551 Ga0400485_12497
552 Ga0436365_1307720
553 Ga0436362_0506247
554 Ga0451791_0950023
555 Ga0451797_1143526
556 Ga0439463_052848
557 Ga0466969_0008615
558 Ga0466972_0000367
559 Ga0466972_0001536
560 Ga0466972_0117958
561 Ga0466965_0006497
562 Ga0466965_0156060
563 Ga0466966_0000453
564 Ga0466966_0007972
565 Ga0466961_0004745
566 Ga0466961_0039663
567 Ga0466961_0097323
568 Ga0466963_0002863
569 Ga0466963_0035775
570 Ga0466963_0123899
571 Ga0466963_0177870
572 Ga0466963_0260586
573 Ga0466964_0107865
574 Ga0466964_0233931
575 Ga0466971_0024799
576 Ga0466971_0034224
577 Ga0466971_0096566
578 Ga0466971_0118639
579 Ga0466968_0008466
580 Ga0466968_0142589
581 Ga0466970_0001917
582 Ga0466970_0173261
583 Ga0466957_0001294
584 Ga0466957_0058364
585 Ga0466960_0016304
586 Ga0466960_0031465
587 Ga0466960_0051324
588 Ga0466960_0082959
589 Ga0466960_0303753
590 Ga0466959_0006922
591 Ga0466959_0066510
592 Ga0466959_0100382
593 Ga0466959_0307247
594 Ga0466958_0003135
595 Ga0466958_0014988
596 Ga0466958_0075894
597 Ga0466958_0257932
598 Ga0466958_0341918
599 Ga0466967_0000516
600 Ga0466967_0011123
601 Ga0466967_0022774
602 Ga0466967_0070791
603 Ga0466967_0088631
604 Ga0466967_0220065
605 Ga0495641_0034743
606 Ga0495650_0029468
607 Ga0495594_0034115
608 Ga0495607_0045728
609 Ga0495665_0008858
610 Ga0495588_0129073
611 Ga0495581_0037939
612 Ga0495672_0012935
613 Ga0495683_0002599
614 Ga0496100_0115371
615 Ga0496100_0325749
616 Ga0496101_0010612
617 Ga0496102_0000560
618 Ga0496102_0213661
619 Ga0496103_0000385
620 Ga0496104_0007064
621 Ga0496104_0061058
622 Ga0496104_0230927
623 Ga0496105_0089903
624 Ga0496106_0193609
625 Ga0496106_0293331
626 Ga0496107_0368790
627 Ga0496107_0491201
628 Ga0496108_0168912
629 Ga0496108_0244332
630 Ga0496108_0375501
631 Ga0496109_0164454
632 Ga0496109_0199769
633 Ga0496112_0117179
634 Ga0496114_0090746
635 Ga0496114_0270861
636 Ga0496114_0421136
637 Ga0496116_0006479
638 Ga0496117_0001161
639 Ga0496118_0001214
640 Ga0496119_0002169
641 Ga0496120_0003329
642 Ga0496121_0020770
643 Ga0496122_0310546
644 Ga0496124_0073859
645 Ga0496126_0001311
646 Ga0501040_0092247
647 Ga0501041_0443993
648 Ga0501042_0032020
649 Ga0501046_0173367
650 Ga0501047_0154762
651 Ga0501047_0226748
652 Ga0501069_0111483
653 Ga0501070_0036068
654 Ga0501076_0167468
655 Ga0501077_0232467
656 Ga0501083_0250428
657 Ga0501044_0226313
658 nmdc:mga03683_264940_c1
659 nmdc:mga03n38_78358_c1
660 nmdc:mga00v17_25777_c1
661 nmdc:mga06z11_378730_c1
662 nmdc:mga07m45_78370_c1
663 nmdc:mga05p37_129691_c1
664 nmdc:mga05p37_44649_c1
665 nmdc:mga05p37_44725_c1
666 nmdc:mga09592_258704_c1
667 nmdc:mga09592_26142_c1
668 nmdc:mga09592_48581_c1
669 nmdc:mga09592_88500_c1
670 nmdc:mga0qj67_328402_c1
671 nmdc:mga06r32_1277_c4
672 nmdc:mga06r32_596967_c1
673 Ga0495619_0017069
674 Ga0500655_037415
675 Ga0500559_0008124
676 Ga0500577_0050443
677 Ga0500616_0140476
678 Ga0501082_0306457
679 Ga0466962_0000954
680 Ga0466962_0131324
681 Ga0530510_0484611
682 2548698613
683 2552110261
684 2558910219
685 2559428043
686 2583152802
687 2644503946
688 2644513597
689 2644525755
690 2644669826
691 2739203849
692 2739238459
693 2739365015
694 2744957551
695 2791911135
696 2795780912
697 2795794818
698 2809594064
699 2816506273
700 2842890397
701 2870782795
702 2889302897
703 2899359924
704 2899377054
705 2904768843
706 2904771869
707 2908812910
708 2915362938
709 2919422202
710 2919434240
711 2919719284
712 2928145578
713 2939746226
714 3003003624
715 8003314818
716 8047719136
717 8053951926
718 8054474838

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01261

AP_endonuc_2

Xylose isomerase-like TIM barrel

64

304

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
5zhz-assembly1.cif.gz_A crystal structure of the apurinic/apyrimidinic endonuclease iv from mycobacterium tuberculosis 0.9837 1 255
5zhz-assembly1.cif.gz_A crystal structure of the apurinic/apyrimidinic endonuclease iv from mycobacterium tuberculosis 0.976 1 255
4k1g-assembly2.cif.gz_B structure of e. coli nfo(endo iv)-h69a mutant bound to a cleaved dna duplex containing a alphada:t basepair 0.8843 2 253
2nq9-assembly1.cif.gz_A high resolution crystal structure of escherichia coli endonuclease iv (endo iv) y72a mutant bound to damaged dna 0.8835 2 253
2nqj-assembly1.cif.gz_A crystal structure of escherichia coli endonuclease iv (endo iv) e261q mutant bound to damaged dna 0.8835 2 253
ID Description Score Start End Superfamily
af_P9WQ13_1_251_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9874 1 254 3.20.20.150
af_P9WQ13_1_251_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9796 1 254 3.20.20.150
af_Q8IE02_304_597_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9011 2 254 3.20.20.150
af_Q10002_117_395_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9009 2 253 3.20.20.150
af_A0A2R8Q599_47_340_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8824 2 253 3.20.20.150
ID Description Score Start End GO Terms
AF-A0A2S9FRG2-F1-model_v4 Deoxyribonuclease IV 1.005 165 254 GO:0003677
GO:0003906
GO:0006284
GO:0008081
GO:0008270
AF-A0A7U8YN31-F1-model_v4 deleted 1.003 162 255
AF-A0A655AUG5-F1-model_v4 Endonuclease IV (EC 3.1.21.2) 0.9957 142 255 GO:0003677
GO:0003906
GO:0006284
GO:0008081
GO:0008270
GO:0008833
AF-A0A4R7QU14-F1-model_v4 deleted 0.9956 1 254
AF-A0A2T5L677-F1-model_v4 deleted 0.9952 1 256

Map