F413184

General Info

Members Datasets Scaffolds Average Seq Length
337 249 675 258

Family's Representative Sequence

Representative Sequence 3300042131|Ga0450894_016674|Ga0450894_016674_54_956
Length 300
Sequence MALISAARFLWIISTASSFTRKKAITLVSRFLKISRNYEMLRPRIIPCLLIQDGGLVKTVRFKDSKYVGDPINAVKIFNEKEADELIVLDIDATVTDREPNYKQIAILAAECRMPLCYGGGIRTVGQAQKIIASGVEKVAISSAALGNPQLVTQIANEIGRQSVVVVLDHKKRLLSKQHDVWTHNGKVNTKRNVLDVAKEMEALGAGEIVINSIDNDGRMKGYDLELSLQLRKAVNTPVTILGGAGSLDDMRAVISSCGVVGVAAGSFFVFKGPYRAVLISYPDITQKEKFIFSALHPTH

Samples

Sample ID Description Type Environment
1 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
7 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
8 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
9 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
10 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
41 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
42 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
43 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
52 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
101 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
102 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
103 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
104 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
105 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
106 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
107 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
108 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
109 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
110 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
111 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
112 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
113 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
114 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
115 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
116 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
117 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
118 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
119 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
120 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
121 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
122 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
123 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
124 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
125 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
126 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
127 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
128 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
129 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
130 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
131 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
132 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
133 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
134 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
135 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
136 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
137 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
138 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
139 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
140 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
141 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
142 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
143 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
144 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
145 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
146 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
147 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
148 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
149 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
150 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
151 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
152 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
153 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
154 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
155 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
156 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
157 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
158 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
159 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
160 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
161 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
162 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
163 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
164 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
165 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
166 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
167 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
168 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
169 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
170 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
171 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
172 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
173 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
174 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
175 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
176 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
177 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
178 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
179 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
180 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
181 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
182 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
183 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
184 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
185 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
186 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
187 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
188 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
189 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
190 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
191 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
192 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
193 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
194 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
197 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
198 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
199 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
200 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
201 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
202 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
203 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
204 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
205 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
206 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
207 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
208 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
209 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
210 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
211 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
212 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
213 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
214 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
215 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
216 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
217 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
218 2511231024 Pseudomonas sp. GM84 Isolate Nodule
219 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
220 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
221 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
222 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
223 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
224 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
225 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
226 2643221591 Devosia sp. Root685 Isolate Unclassified
227 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
228 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
229 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
230 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
231 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
232 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
233 2765235841 Pseudomonas putida AA7 Isolate Unclassified
234 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
235 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
236 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
237 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
238 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
239 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
240 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
241 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
242 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
243 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
244 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
245 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
246 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
247 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
248 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
249 3007803356 Pseudomonas sp. CM27 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 90.5
Metatranscriptomes 0
Isolates 9.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.06
Nodule 1.48
Rhizoplane 4.15
Rhizosphere 68.84
Stem 0
Stem Tuber 0
Unclassified 4.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0450894_016674 3300042131 Bacteria 975
2 JGI25406J46586_10000014 3300003203 Bacteria 93855
3 rootH2_10243076 3300003320 Bacteria 1484
4 rootL2_10203214 3300003322 Bacteria 2375
5 rootH1_10007743 3300003316 Bacteria 6031
6 rootH1_10007743 3300003323 Bacteria 19767
7 rootH1_10307812 3300003323 Bacteria 1083
8 Ga0055525_1000246 3300003759 Bacteria 54885
9 Ga0055536_1000387 3300003781 Bacteria 32286
10 Ga0055534_1013646 3300003784 Bacteria 1553
11 Ga0055530_10000089 3300003791 Bacteria 78801
12 Ga0055531_10022249 3300003794 Bacteria 2423
13 Ga0065704_10076392 3300005289 Bacteria 5139
14 Ga0065704_10154262 3300005289 Bacteria 1393
15 Ga0070658_10048436 3300005327 Bacteria 3441
16 Ga0070658_10553971 3300005327 Bacteria 995
17 Ga0070683_100010524 3300005329 Bacteria 7954
18 Ga0070683_100365340 3300005329 Bacteria 1374
19 Ga0070670_100016636 3300005331 Bacteria 6311
20 Ga0070666_10315589 3300005335 Unclassified 1114
21 Ga0070680_100677611 3300005336 Bacteria 887
22 Ga0070691_10027757 3300005341 Unclassified 2642
23 Ga0070661_100002180 3300005344 Bacteria 13483
24 Ga0070674_100025207 3300005356 Bacteria 3869
25 Ga0070674_100477338 3300005356 Bacteria 1034
26 Ga0070688_100119318 3300005365 Bacteria 1764
27 Ga0070659_100151017 3300005366 Bacteria 1895
28 Ga0070667_100210057 3300005367 Bacteria 1730
29 Ga0070714_100454658 3300005435 Bacteria 1217
30 Ga0070678_100676577 3300005456 Bacteria 928
31 Ga0068867_100109494 3300005459 Bacteria 2120
32 Ga0068867_100365947 3300005459 Bacteria 1207
33 Ga0070699_100001003 3300005518 Bacteria 26263
34 Ga0070699_100184448 3300005518 Unclassified 1852
35 Ga0070679_100001200 3300005530 Bacteria 22788
36 Ga0070684_100092980 3300005535 Bacteria 2684
37 Ga0068853_100159078 3300005539 Bacteria 2037
38 Ga0070695_100059959 3300005545 Bacteria 2465
39 Ga0070696_100039166 3300005546 Bacteria 3273
40 Ga0070704_100179863 3300005549 Bacteria 1690
41 Ga0068855_100056361 3300005563 Bacteria 4612
42 Ga0068857_100136203 3300005577 Bacteria 2217
43 Ga0068854_100606631 3300005578 Bacteria 935
44 Ga0068859_100031392 3300005617 Bacteria 5335
45 Ga0068859_100161681 3300005617 Bacteria 2318
46 Ga0068859_100262040 3300005617 Bacteria 1820
47 Ga0068859_100330710 3300005617 Bacteria 1618
48 Ga0068860_100153587 3300005843 Bacteria 2218
49 Ga0081540_1019319 3300005983 Bacteria 4147
50 Ga0081540_1104633 3300005983 Bacteria 1211
51 Ga0081539_10000001 3300005985 Bacteria 808331
52 Ga0081539_10000008 3300005985 Bacteria 525071
53 Ga0075364_10048036 3300006051 Bacteria 2780
54 Ga0075364_10066095 3300006051 Bacteria 2375
55 Ga0075362_10001043 3300006177 Bacteria 8543
56 Ga0075367_10004139 3300006178 Bacteria 7035
57 Ga0075367_10105360 3300006178 Bacteria 1727
58 Ga0075369_10035019 3300006186 Bacteria 2133
59 Ga0075366_10027621 3300006195 Bacteria 3330
60 Ga0075366_10067940 3300006195 Bacteria 2121
61 Ga0075370_10003466 3300006353 Bacteria 7515
62 Ga0075370_10010444 3300006353 Bacteria 4855
63 Ga0075370_10020129 3300006353 Bacteria 3643
64 Ga0068871_100183318 3300006358 Bacteria 1800
65 Ga0075430_100003833 3300006846 Bacteria 12661
66 Ga0075434_100066550 3300006871 Bacteria 3589
67 Ga0075429_100000282 3300006880 Bacteria 35849
68 Ga0097620_100031390 3300006931 Bacteria 5335
69 Ga0097620_100161689 3300006931 Bacteria 2318
70 Ga0097620_100262062 3300006931 Bacteria 1820
71 Ga0097620_100330720 3300006931 Bacteria 1618
72 Ga0105251_10000751 3300009011 Bacteria 29613
73 Ga0105250_10000586 3300009092 Bacteria 23882
74 Ga0105250_10189609 3300009092 Bacteria 865
75 Ga0105240_10196678 3300009093 Bacteria 2366
76 Ga0105240_10284265 3300009093 Bacteria 1899
77 Ga0111539_10016755 3300009094 Bacteria 9083
78 Ga0111539_10042908 3300009094 Bacteria 5427
79 Ga0105245_10009933 3300009098 Bacteria 8292
80 Ga0105245_10352631 3300009098 Bacteria 1458
81 Ga0105247_10312799 3300009101 Bacteria 1093
82 Ga0105243_10000971 3300009148 Bacteria 26695
83 Ga0105242_10157841 3300009176 Bacteria 1983
84 Ga0105237_10058845 3300009545 Bacteria 3846
85 Ga0105238_10457443 3300009551 Bacteria 1274
86 Ga0105249_10796706 3300009553 Bacteria 1009
87 Ga0105239_10037970 3300010375 Bacteria 5278
88 Ga0157371_10003057 3300013102 Bacteria 15523
89 Ga0157371_10004211 3300013102 Bacteria 12663
90 Ga0157371_10008952 3300013102 Bacteria 7920
91 Ga0157371_10010391 3300013102 Bacteria 7257
92 Ga0157370_10000637 3300013104 Bacteria 43772
93 Ga0157370_10002654 3300013104 Bacteria 21470
94 Ga0157370_10003839 3300013104 Bacteria 17518
95 Ga0157370_10277291 3300013104 Bacteria 1549
96 Ga0157370_10467577 3300013104 Bacteria 1159
97 Ga0157369_10000477 3300013105 Bacteria 53128
98 Ga0163162_10000585 3300013306 Bacteria 33759
99 Ga0163162_10258953 3300013306 Bacteria 1871
100 Ga0157372_10001711 3300013307 Bacteria 23811
101 Ga0157372_10111810 3300013307 Bacteria 3129
102 Ga0157372_11284938 3300013307 Bacteria 845
103 Ga0157375_10000220 3300013308 Bacteria 53557
104 Ga0157375_10017740 3300013308 Bacteria 6434
105 Ga0157375_10031078 3300013308 Bacteria 5041
106 Ga0157380_10003703 3300014326 Bacteria 10507
107 Ga0157380_10004132 3300014326 Bacteria 10031
108 Ga0157380_10029945 3300014326 Bacteria 4165
109 Ga0157380_10056191 3300014326 Bacteria 3129
110 Ga0157376_10124743 3300014969 Bacteria 2288
111 Ga0157376_10266765 3300014969 Bacteria 1606
112 Ga0163161_10005519 3300017792 Bacteria 8763
113 Ga0209563_100007 3300025230 Bacteria 1579402
114 Ga0209677_104292 3300025253 Bacteria 4176
115 Ga0209675_1000053 3300025291 Bacteria 194511
116 Ga0209676_1000824 3300025292 Bacteria 40329
117 Ga0209050_1000042 3300025298 Bacteria 402842
118 Ga0209257_1000826 3300025304 Bacteria 44769
119 Ga0207696_1000606 3300025711 Bacteria 26792
120 Ga0207655_1023970 3300025728 Bacteria 3007
121 Ga0207713_1000769 3300025735 Bacteria 29621
122 Ga0207713_1001664 3300025735 Bacteria 17228
123 Ga0207713_1004791 3300025735 Bacteria 8691
124 Ga0207705_10027401 3300025909 Bacteria 4064
125 Ga0207705_10410315 3300025909 Bacteria 1048
126 Ga0207695_10153428 3300025913 Bacteria 2240
127 Ga0207695_10272889 3300025913 Bacteria 1586
128 Ga0207671_10043638 3300025914 Bacteria 3316
129 Ga0207671_10070526 3300025914 Bacteria 2605
130 Ga0207660_10011200 3300025917 Bacteria 5831
131 Ga0207652_10002231 3300025921 Bacteria 16521
132 Ga0207681_10235556 3300025923 Bacteria 1423
133 Ga0207687_10004831 3300025927 Bacteria 8963
134 Ga0207664_10406164 3300025929 Bacteria 1212
135 Ga0207709_10041441 3300025935 Bacteria 2763
136 Ga0207689_10173674 3300025942 Bacteria 1777
137 Ga0207661_10010854 3300025944 Bacteria 6573
138 Ga0207667_10003744 3300025949 Bacteria 18752
139 Ga0207651_10123064 3300025960 Bacteria 1971
140 Ga0207658_10025730 3300025986 Bacteria 4122
141 Ga0207648_10138860 3300026089 Bacteria 2141
142 Ga0207648_10302206 3300026089 Unclassified 1435
143 Ga0207674_10402134 3300026116 Bacteria 1323
144 Ga0207698_10129042 3300026142 Bacteria 2157
145 Ga0209970_1000527 3300027614 Bacteria 6578
146 Ga0268266_10033082 3300028379 Bacteria 4397
147 Ga0265318_10000023 3300028577 Bacteria 160826
148 Ga0307517_10217736 3300028786 Bacteria 1165
149 Ga0307515_10037927 3300028794 Bacteria 7729
150 Ga0265324_10032935 3300029957 Bacteria 1810
151 Ga0316182_1155512 3300030745 Bacteria 2754
152 Ga0265339_10113486 3300031249 Unclassified 1399
153 Ga0307513_10100277 3300031456 Unclassified 2922
154 Ga0307509_10011494 3300031507 Bacteria 10708
155 Ga0307408_100000330 3300031548 Bacteria 45434
156 Ga0307408_100000779 3300031548 Bacteria 25638
157 Ga0307408_100060023 3300031548 Bacteria 2771
158 Ga0265313_10010309 3300031595 Bacteria 5935
159 Ga0265314_10000631 3300031711 Bacteria 43323
160 Ga0307405_10223139 3300031731 Unclassified 1384
161 Ga0307412_10000222 3300031911 Bacteria 38184
162 Ga0307412_10104112 3300031911 Bacteria 2013
163 Ga0307412_10129451 3300031911 Unclassified 1831
164 Ga0307416_100094962 3300032002 Bacteria 2573
165 Ga0307416_100428441 3300032002 Unclassified 1369
166 Ga0307414_10000074 3300032004 Bacteria 94049
167 Ga0307414_10000128 3300032004 Bacteria 53071
168 Ga0307414_10000209 3300032004 Bacteria 39278
169 Ga0307414_10013030 3300032004 Bacteria 4939
170 Ga0307415_100021391 3300032126 Bacteria 3975
171 Ga0373939_0074920 3300035114 Bacteria 1111
172 Ga0373931_0119408 3300035691 Bacteria 1505
173 Ga0395899_0000963 3300037312 Bacteria 26721
174 Ga0395900_0011277 3300037418 Bacteria 9140
175 Ga0395898_0000886 3300037466 Bacteria 48827
176 Ga0395898_0005833 3300037466 Bacteria 13254
177 Ga0395905_0013269 3300037471 Bacteria 7904
178 Ga0395901_0021939 3300038443 Bacteria 6545
179 Ga0400484_01941 3300038725 Bacteria 17261
180 Ga0400488_58007 3300038741 Bacteria 10540
181 Ga0439453_0001655 3300041408 Bacteria 2913
182 Ga0451807_0646179 3300041486 Bacteria 1179
183 Ga0439445_0000023 3300042004 Bacteria 20324
184 Ga0439451_000029 3300042009 Bacteria 31111
185 Ga0439463_002809 3300042016 Bacteria 4413
186 Ga0439435_0027478 3300042436 Unclassified 1523
187 Ga0439464_0022735 3300042439 Bacteria 1729
188 Ga0451577_0200562 3300042876 Bacteria 1801
189 Ga0466969_0017852 3300044656 Bacteria 3701
190 Ga0453683_0004283 3300044673 Bacteria 10175
191 Ga0466961_0002292 3300044693 Bacteria 11890
192 Ga0466964_0017133 3300044706 Bacteria 2771
193 Ga0453684_0453977 3300044712 Unclassified 1426
194 Ga0453684_0549463 3300044712 Bacteria 1272
195 Ga0466971_0000466 3300044719 Bacteria 15850
196 Ga0466970_0015686 3300044765 Bacteria 3901
197 Ga0466957_0000307 3300044842 Bacteria 23957
198 Ga0451576_0000183 3300045051 Bacteria 157422
199 Ga0451576_0037322 3300045051 Bacteria 5147
200 Ga0451576_0101119 3300045051 Bacteria 2998
201 Ga0451576_0111252 3300045051 Bacteria 2850
202 Ga0466967_0455745 3300045976 Bacteria 1250
203 Ga0495627_000245 3300046453 Bacteria 57165
204 Ga0495590_0000338 3300046457 Bacteria 24377
205 Ga0495638_0000726 3300046460 Bacteria 35496
206 Ga0495584_0002205 3300046491 Bacteria 11109
207 Ga0495585_0002038 3300046492 Bacteria 14899
208 Ga0495585_0199329 3300046492 Bacteria 1020
209 Ga0495607_0000810 3300046501 Bacteria 29648
210 Ga0495583_0000460 3300046506 Bacteria 60178
211 Ga0495606_0001096 3300046507 Bacteria 38817
212 Ga0495606_0002199 3300046507 Bacteria 23384
213 Ga0495632_0000120 3300046519 Bacteria 80853
214 Ga0495637_0000574 3300046520 Bacteria 26147
215 Ga0495643_0015956 3300046522 Bacteria 4423
216 Ga0495648_0108691 3300046524 Bacteria 1514
217 Ga0495642_0000421 3300046528 Bacteria 22501
218 Ga0495654_0000711 3300046530 Bacteria 26011
219 Ga0495597_0000822 3300046542 Bacteria 24434
220 Ga0495622_0027292 3300046557 Bacteria 2665
221 Ga0495668_0002285 3300046616 Bacteria 16110
222 Ga0495625_0119832 3300046660 Bacteria 1792
223 Ga0495625_0193334 3300046660 Bacteria 1347
224 Ga0495635_0095125 3300046663 Bacteria 2037
225 Ga0495659_0027104 3300046664 Bacteria 1974
226 Ga0495661_0034122 3300046665 Bacteria 3204
227 Ga0495661_0064591 3300046665 Bacteria 2159
228 Ga0495669_0002671 3300046684 Bacteria 7300
229 Ga0495613_0208010 3300046689 Bacteria 1377
230 Ga0495671_0000349 3300046692 Bacteria 38480
231 Ga0495671_0000405 3300046692 Bacteria 34951
232 Ga0495671_0000501 3300046692 Bacteria 30161
233 Ga0495649_0000913 3300046694 Bacteria 23330
234 Ga0495589_0010358 3300046794 Bacteria 4841
235 Ga0495660_0000971 3300046810 Bacteria 20957
236 Ga0495604_0121629 3300047317 Bacteria 1889
237 Ga0495672_0000795 3300047320 Bacteria 34131
238 Ga0495683_0006783 3300047323 Bacteria 6225
239 Ga0495677_0014934 3300047445 Bacteria 2824
240 Ga0495673_0107215 3300047469 Bacteria 1121
241 Ga0495686_0042086 3300047472 Bacteria 2906
242 Ga0495686_0139150 3300047472 Unclassified 1433
243 Ga0496102_0074008 3300048905 Bacteria 3131
244 Ga0496104_0117007 3300048907 Bacteria 2558
245 Ga0496105_0186220 3300048908 Bacteria 1699
246 Ga0496105_0318869 3300048908 Bacteria 1246
247 Ga0496110_0084734 3300048913 Bacteria 2829
248 Ga0496112_0000008 3300048915 Bacteria 310323
249 Ga0496113_0057161 3300048916 Bacteria 2931
250 Ga0496114_0011085 3300048917 Bacteria 7194
251 Ga0496115_0025775 3300048918 Bacteria 4582
252 Ga0496115_0142184 3300048918 Bacteria 1980
253 Ga0496116_0000006 3300048919 Bacteria 811937
254 Ga0496117_0000027 3300048920 Bacteria 412234
255 Ga0496118_0000620 3300048921 Bacteria 58296
256 Ga0496119_0000006 3300048922 Bacteria 505999
257 Ga0496119_0060202 3300048922 Bacteria 2275
258 Ga0496122_0000444 3300048925 Bacteria 86587
259 Ga0496122_0002040 3300048925 Bacteria 29985
260 Ga0496122_0096477 3300048925 Bacteria 1993
261 Ga0496123_0000958 3300048926 Bacteria 44671
262 Ga0496123_0001660 3300048926 Bacteria 29864
263 Ga0496123_0016233 3300048926 Bacteria 6058
264 Ga0496124_0000475 3300048927 Bacteria 69109
265 Ga0496124_0002357 3300048927 Bacteria 24921
266 Ga0496124_0009718 3300048927 Bacteria 9847
267 Ga0496124_0064775 3300048927 Bacteria 3050
268 Ga0496125_0000031 3300048928 Bacteria 365156
269 Ga0496125_0015116 3300048928 Bacteria 7484
270 Ga0496125_0017623 3300048928 Bacteria 6803
271 Ga0496126_0009607 3300048929 Bacteria 10259
272 Ga0496126_0217890 3300048929 Bacteria 1605
273 Ga0495678_006186 3300049459 Bacteria 6407
274 Ga0501043_0535219 3300049579 Unclassified 872
275 Ga0501047_0349635 3300049581 Bacteria 1315
276 Ga0501198_014564 3300049649 Bacteria 1199
277 Ga0501241_000018 3300049758 Bacteria 95195
278 Ga0501269_000035 3300049766 Bacteria 41924
279 Ga0501044_0022540 3300049823 Bacteria 6710
280 Ga0501044_0493976 3300049823 Unclassified 1126
281 nmdc:mga03683_13112_c1 3300050489 Bacteria 3044
282 nmdc:mga00v17_136613_c1 3300050491 Bacteria 1570
283 nmdc:mga00v17_15256_c1 3300050491 Bacteria 4309
284 nmdc:mga0k408_150836_c1 3300050493 Bacteria 1384
285 nmdc:mga0k408_27307_c1 3300050493 Bacteria 3242
286 nmdc:mga0k408_30076_c1 3300050493 Bacteria 3095
287 nmdc:mga0k408_33290_c1 3300050493 Bacteria 2948
288 nmdc:mga0k408_52532_c1 3300050493 Bacteria 2362
289 nmdc:mga06z11_19038_c1 3300050494 Bacteria 3148
290 nmdc:mga07m45_17411_c1 3300050496 Bacteria 3860
291 nmdc:mga07m45_20887_c1 3300050496 Bacteria 3560
292 nmdc:mga07m45_6844_c1 3300050496 Bacteria 5796
293 nmdc:mga07m45_8017_c1 3300050496 Bacteria 5416
294 nmdc:mga09592_425_c1 3300050508 Bacteria 31113
295 nmdc:mga0qj67_3517_c1 3300050509 Bacteria 11303
296 nmdc:mga08y16_911436_c1 3300050511 Bacteria 864
297 Ga0500646_0011229 3300053090 Bacteria 2302
298 Ga0500641_0000062 3300053096 Bacteria 45077
299 Ga0500650_0110338 3300053098 Bacteria 1284
300 Ga0500555_053585 3300053103 Bacteria 1099
301 Ga0500556_0050666 3300053104 Bacteria 1501
302 Ga0500595_002193 3300053119 Bacteria 9918
303 Ga0500652_157218 3300053131 Bacteria 941
304 Ga0500655_029808 3300053133 Bacteria 1048
305 Ga0500559_0101263 3300053136 Bacteria 1328
306 Ga0466962_0001100 3300061719 Bacteria 12445
307 2511375636 2511231024 Bacteria 5835885
308 2587746060 2585428060 Bacteria 5304711
309 2588214550 2585428183 Bacteria 5166119
310 2588444179 2588253712 Bacteria 5403181
311 2590613943 2588254257 Bacteria 5436094
312 2599941834 2599185302 Bacteria 5954930
313 2599952646 2599185304 Bacteria 5951361
314 2600364300 2600254931 Bacteria 6734225
315 2643964983 2643221591 Bacteria 4397626
316 2644550416 2643221699 Bacteria 5731501
317 2678262568 2675903515 Bacteria 6580491
318 2729199965 2728369107 Bacteria 5082720
319 2738809677 2738541294 Bacteria 6925949
320 2738897037 2738541309 Bacteria 6926455
321 2745008910 2744054620 Bacteria 6551379
322 2765585391 2765235841 Bacteria 6137024
323 2772607489 2772190705 Bacteria 4666226
324 2775672003 2775506739 Bacteria 3855222
325 2807407231 2806310737 Bacteria 5751088
326 2807455560 2806310745 Bacteria 5742165
327 2825653078 2825651385 Bacteria 6715909
328 2842045189 2842038055 Bacteria 8002051
329 2842049149 2842045827 Bacteria 8006841
330 2842085990 2842083920 Bacteria 4857652
331 2871724023 2871720351 Bacteria 4862476
332 2902049523 2902048731 Bacteria 4976191
333 2919098559 2919097161 Bacteria 3860339
334 2941535251 2941531003 Bacteria 7653939
335 2946022592 2946019816 Bacteria 4621265
336 2993374593 2993372514 Bacteria 4214139
337 2998348387 2998344455 Bacteria 4222996
338 3007805160 3007803356 Bacteria 5931491
339 Ga0450894_016674
340 JGI25406J46586_10000014
341 rootH2_10243076
342 rootL2_10203214
343 rootH1_10007743
344 rootH1_10307812
345 Ga0055525_1000246
346 Ga0055536_1000387
347 Ga0055534_1013646
348 Ga0055530_10000089
349 Ga0055531_10022249
350 Ga0065704_10076392
351 Ga0065704_10154262
352 Ga0070658_10048436
353 Ga0070658_10553971
354 Ga0070683_100010524
355 Ga0070683_100365340
356 Ga0070670_100016636
357 Ga0070666_10315589
358 Ga0070680_100677611
359 Ga0070691_10027757
360 Ga0070661_100002180
361 Ga0070674_100025207
362 Ga0070674_100477338
363 Ga0070688_100119318
364 Ga0070659_100151017
365 Ga0070667_100210057
366 Ga0070714_100454658
367 Ga0070678_100676577
368 Ga0068867_100109494
369 Ga0068867_100365947
370 Ga0070699_100001003
371 Ga0070699_100184448
372 Ga0070679_100001200
373 Ga0070684_100092980
374 Ga0068853_100159078
375 Ga0070695_100059959
376 Ga0070696_100039166
377 Ga0070704_100179863
378 Ga0068855_100056361
379 Ga0068857_100136203
380 Ga0068854_100606631
381 Ga0068859_100031392
382 Ga0068859_100161681
383 Ga0068859_100262040
384 Ga0068859_100330710
385 Ga0068860_100153587
386 Ga0081540_1019319
387 Ga0081540_1104633
388 Ga0081539_10000001
389 Ga0081539_10000008
390 Ga0075364_10048036
391 Ga0075364_10066095
392 Ga0075362_10001043
393 Ga0075367_10004139
394 Ga0075367_10105360
395 Ga0075369_10035019
396 Ga0075366_10027621
397 Ga0075366_10067940
398 Ga0075370_10003466
399 Ga0075370_10010444
400 Ga0075370_10020129
401 Ga0068871_100183318
402 Ga0075430_100003833
403 Ga0075434_100066550
404 Ga0075429_100000282
405 Ga0097620_100031390
406 Ga0097620_100161689
407 Ga0097620_100262062
408 Ga0097620_100330720
409 Ga0105251_10000751
410 Ga0105250_10000586
411 Ga0105250_10189609
412 Ga0105240_10196678
413 Ga0105240_10284265
414 Ga0111539_10016755
415 Ga0111539_10042908
416 Ga0105245_10009933
417 Ga0105245_10352631
418 Ga0105247_10312799
419 Ga0105243_10000971
420 Ga0105242_10157841
421 Ga0105237_10058845
422 Ga0105238_10457443
423 Ga0105249_10796706
424 Ga0105239_10037970
425 Ga0157371_10003057
426 Ga0157371_10004211
427 Ga0157371_10008952
428 Ga0157371_10010391
429 Ga0157370_10000637
430 Ga0157370_10002654
431 Ga0157370_10003839
432 Ga0157370_10277291
433 Ga0157370_10467577
434 Ga0157369_10000477
435 Ga0163162_10000585
436 Ga0163162_10258953
437 Ga0157372_10001711
438 Ga0157372_10111810
439 Ga0157372_11284938
440 Ga0157375_10000220
441 Ga0157375_10017740
442 Ga0157375_10031078
443 Ga0157380_10003703
444 Ga0157380_10004132
445 Ga0157380_10029945
446 Ga0157380_10056191
447 Ga0157376_10124743
448 Ga0157376_10266765
449 Ga0163161_10005519
450 Ga0209563_100007
451 Ga0209677_104292
452 Ga0209675_1000053
453 Ga0209676_1000824
454 Ga0209050_1000042
455 Ga0209257_1000826
456 Ga0207696_1000606
457 Ga0207655_1023970
458 Ga0207713_1000769
459 Ga0207713_1001664
460 Ga0207713_1004791
461 Ga0207705_10027401
462 Ga0207705_10410315
463 Ga0207695_10153428
464 Ga0207695_10272889
465 Ga0207671_10043638
466 Ga0207671_10070526
467 Ga0207660_10011200
468 Ga0207652_10002231
469 Ga0207681_10235556
470 Ga0207687_10004831
471 Ga0207664_10406164
472 Ga0207709_10041441
473 Ga0207689_10173674
474 Ga0207661_10010854
475 Ga0207667_10003744
476 Ga0207651_10123064
477 Ga0207658_10025730
478 Ga0207648_10138860
479 Ga0207648_10302206
480 Ga0207674_10402134
481 Ga0207698_10129042
482 Ga0209970_1000527
483 Ga0268266_10033082
484 Ga0265318_10000023
485 Ga0307517_10217736
486 Ga0307515_10037927
487 Ga0265324_10032935
488 Ga0316182_1155512
489 Ga0265339_10113486
490 Ga0307513_10100277
491 Ga0307509_10011494
492 Ga0307408_100000330
493 Ga0307408_100000779
494 Ga0307408_100060023
495 Ga0265313_10010309
496 Ga0265314_10000631
497 Ga0307405_10223139
498 Ga0307412_10000222
499 Ga0307412_10104112
500 Ga0307412_10129451
501 Ga0307416_100094962
502 Ga0307416_100428441
503 Ga0307414_10000074
504 Ga0307414_10000128
505 Ga0307414_10000209
506 Ga0307414_10013030
507 Ga0307415_100021391
508 Ga0373939_0074920
509 Ga0373931_0119408
510 Ga0395899_0000963
511 Ga0395900_0011277
512 Ga0395898_0000886
513 Ga0395898_0005833
514 Ga0395905_0013269
515 Ga0395901_0021939
516 Ga0400484_01941
517 Ga0400488_58007
518 Ga0439453_0001655
519 Ga0451807_0646179
520 Ga0439445_0000023
521 Ga0439451_000029
522 Ga0439463_002809
523 Ga0439435_0027478
524 Ga0439464_0022735
525 Ga0451577_0200562
526 Ga0466969_0017852
527 Ga0453683_0004283
528 Ga0466961_0002292
529 Ga0466964_0017133
530 Ga0453684_0453977
531 Ga0453684_0549463
532 Ga0466971_0000466
533 Ga0466970_0015686
534 Ga0466957_0000307
535 Ga0451576_0000183
536 Ga0451576_0037322
537 Ga0451576_0101119
538 Ga0451576_0111252
539 Ga0466967_0455745
540 Ga0495627_000245
541 Ga0495590_0000338
542 Ga0495638_0000726
543 Ga0495584_0002205
544 Ga0495585_0002038
545 Ga0495585_0199329
546 Ga0495607_0000810
547 Ga0495583_0000460
548 Ga0495606_0001096
549 Ga0495606_0002199
550 Ga0495632_0000120
551 Ga0495637_0000574
552 Ga0495643_0015956
553 Ga0495648_0108691
554 Ga0495642_0000421
555 Ga0495654_0000711
556 Ga0495597_0000822
557 Ga0495622_0027292
558 Ga0495668_0002285
559 Ga0495625_0119832
560 Ga0495625_0193334
561 Ga0495635_0095125
562 Ga0495659_0027104
563 Ga0495661_0034122
564 Ga0495661_0064591
565 Ga0495669_0002671
566 Ga0495613_0208010
567 Ga0495671_0000349
568 Ga0495671_0000405
569 Ga0495671_0000501
570 Ga0495649_0000913
571 Ga0495589_0010358
572 Ga0495660_0000971
573 Ga0495604_0121629
574 Ga0495672_0000795
575 Ga0495683_0006783
576 Ga0495677_0014934
577 Ga0495673_0107215
578 Ga0495686_0042086
579 Ga0495686_0139150
580 Ga0496102_0074008
581 Ga0496104_0117007
582 Ga0496105_0186220
583 Ga0496105_0318869
584 Ga0496110_0084734
585 Ga0496112_0000008
586 Ga0496113_0057161
587 Ga0496114_0011085
588 Ga0496115_0025775
589 Ga0496115_0142184
590 Ga0496116_0000006
591 Ga0496117_0000027
592 Ga0496118_0000620
593 Ga0496119_0000006
594 Ga0496119_0060202
595 Ga0496122_0000444
596 Ga0496122_0002040
597 Ga0496122_0096477
598 Ga0496123_0000958
599 Ga0496123_0001660
600 Ga0496123_0016233
601 Ga0496124_0000475
602 Ga0496124_0002357
603 Ga0496124_0009718
604 Ga0496124_0064775
605 Ga0496125_0000031
606 Ga0496125_0015116
607 Ga0496125_0017623
608 Ga0496126_0009607
609 Ga0496126_0217890
610 Ga0495678_006186
611 Ga0501043_0535219
612 Ga0501047_0349635
613 Ga0501198_014564
614 Ga0501241_000018
615 Ga0501269_000035
616 Ga0501044_0022540
617 Ga0501044_0493976
618 nmdc:mga03683_13112_c1
619 nmdc:mga00v17_136613_c1
620 nmdc:mga00v17_15256_c1
621 nmdc:mga0k408_150836_c1
622 nmdc:mga0k408_27307_c1
623 nmdc:mga0k408_30076_c1
624 nmdc:mga0k408_33290_c1
625 nmdc:mga0k408_52532_c1
626 nmdc:mga06z11_19038_c1
627 nmdc:mga07m45_17411_c1
628 nmdc:mga07m45_20887_c1
629 nmdc:mga07m45_6844_c1
630 nmdc:mga07m45_8017_c1
631 nmdc:mga09592_425_c1
632 nmdc:mga0qj67_3517_c1
633 nmdc:mga08y16_911436_c1
634 Ga0500646_0011229
635 Ga0500641_0000062
636 Ga0500650_0110338
637 Ga0500555_053585
638 Ga0500556_0050666
639 Ga0500595_002193
640 Ga0500652_157218
641 Ga0500655_029808
642 Ga0500559_0101263
643 Ga0466962_0001100
644 2511375636
645 2587746060
646 2588214550
647 2588444179
648 2590613943
649 2599941834
650 2599952646
651 2600364300
652 2643964983
653 2644550416
654 2678262568
655 2729199965
656 2738809677
657 2738897037
658 2745008910
659 2765585391
660 2772607489
661 2775672003
662 2807407231
663 2807455560
664 2825653078
665 2842045189
666 2842049149
667 2842085990
668 2871724023
669 2902049523
670 2919098559
671 2941535251
672 2946022592
673 2993374593
674 2998348387
675 3007805160

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00977

His_biosynth

Histidine biosynthesis protein

44

275

0.97

PF01207

Dus

Dihydrouridine synthase (Dus)

92

189

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tdn-assembly1.cif.gz_A computationally designed two-fold symmetric tim-barrel protein, flr 0.9553 122 229
3tdm-assembly2.cif.gz_C computationally designed tim-barrel protein, halfflr 0.9442 122 228
4evz-assembly2.cif.gz_B structure of hisf-luca 0.9235 1 230
4fx7-assembly4.cif.gz_D structure of sym2 d9v+d55v+d130v+d176v 0.9143 5 229
4evz-assembly1.cif.gz_A structure of hisf-luca 0.9039 1 257
ID Description Score Start End Superfamily
3tdnA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9553 122 229 3.40.50.12600
af_P10371_1_245_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9297 6 229 3.20.20.70
af_Q2FUU2_4_232_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.901 8 229 3.20.20.70
4x2rA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8907 3 229 3.20.20.70
af_Q58927_1_237_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.882 5 254 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A383DGM3-F1-model_v4 Uncharacterized protein 0.9874 1 121 GO:0000105
GO:0000107
AF-N1U730-F1-model_v4 imidazole glycerol-phosphate synthase (EC 4.3.2.10) (IGP synthase cyclase subunit) 0.987 1 185 GO:0000105
GO:0000107
GO:0016829
AF-A0A379SSS1-F1-model_v4 Imidazole glycerol phosphate synthase cyclasesubunit (EC 4.1.3.-) 0.9852 1 106 GO:0000105
GO:0000107
GO:0016829
AF-A0A109WUZ0-F1-model_v4 Imidazole glycerol phosphate synthase subunit HisF (EC 4.1.3.-) 0.9848 75 216 GO:0000105
GO:0000107
GO:0016829
AF-A0A4V1SLZ8-F1-model_v4 Imidazole glycerol phosphate synthase subunit HisF (EC 4.1.3.-) 0.9835 1 165 GO:0000105
GO:0000107
GO:0016829

Map