F413184
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 337 | 249 | 675 | 258 |
Family's Representative Sequence
| Representative Sequence | 3300042131|Ga0450894_016674|Ga0450894_016674_54_956 |
| Length | 300 |
| Sequence | MALISAARFLWIISTASSFTRKKAITLVSRFLKISRNYEMLRPRIIPCLLIQDGGLVKTVRFKDSKYVGDPINAVKIFNEKEADELIVLDIDATVTDREPNYKQIAILAAECRMPLCYGGGIRTVGQAQKIIASGVEKVAISSAALGNPQLVTQIANEIGRQSVVVVLDHKKRLLSKQHDVWTHNGKVNTKRNVLDVAKEMEALGAGEIVINSIDNDGRMKGYDLELSLQLRKAVNTPVTILGGAGSLDDMRAVISSCGVVGVAAGSFFVFKGPYRAVLISYPDITQKEKFIFSALHPTH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 4 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 5 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 6 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 7 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 8 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 9 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 10 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 11 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 26 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 30 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 34 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 35 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 36 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 37 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 38 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 39 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 40 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 41 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 42 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 43 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 44 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 45 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 46 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 47 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 48 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 49 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 50 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 75 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 101 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 102 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 103 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 104 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 105 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 106 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 107 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 108 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 109 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 110 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 111 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 112 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 113 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 114 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 115 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 116 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 117 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 118 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 119 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 120 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 121 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 122 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 123 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 124 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 125 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 126 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 127 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 128 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 129 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 130 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 131 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 132 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 133 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 134 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 135 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 136 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 137 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 138 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 139 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 140 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 141 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 142 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 143 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 177 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 178 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 179 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 180 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 181 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 182 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 183 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 184 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 185 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 186 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 187 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 188 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 189 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 190 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 191 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 192 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 193 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 195 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 196 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 197 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 198 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 199 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 200 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 201 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 202 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 203 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 204 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 205 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 206 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 207 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 208 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 209 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 210 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 211 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 212 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 213 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 214 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 215 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 216 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 217 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 218 | 2511231024 | Pseudomonas sp. GM84 | Isolate | Nodule |
| 219 | 2585428060 | Chryseobacterium sp. OV715 | Isolate | Rhizosphere |
| 220 | 2585428183 | Chryseobacterium sp. YR485 | Isolate | Rhizosphere |
| 221 | 2588253712 | Chryseobacterium sp. OV279 | Isolate | Rhizosphere |
| 222 | 2588254257 | Chryseobacterium sp. YR203 | Isolate | Rhizosphere |
| 223 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 224 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 225 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 226 | 2643221591 | Devosia sp. Root685 | Isolate | Unclassified |
| 227 | 2643221699 | Brevundimonas sp. Root1423 | Isolate | Unclassified |
| 228 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 229 | 2728369107 | Chryseobacterium kwangjuense KJ1R5 | Isolate | Unclassified |
| 230 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 231 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 232 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 233 | 2765235841 | Pseudomonas putida AA7 | Isolate | Unclassified |
| 234 | 2772190705 | Chryseobacterium contaminans C-26 | Isolate | Rhizosphere |
| 235 | 2775506739 | Chryseobacterium sp. 1335 | Isolate | Unclassified |
| 236 | 2806310737 | Pseudomonas mosselii BS011 | Isolate | Unclassified |
| 237 | 2806310745 | Pseudomonas mosselii PtA1 | Isolate | Unclassified |
| 238 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 239 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 240 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 241 | 2842083920 | Chryseobacterium lathyri KCTC 22544 | Isolate | Rhizosphere |
| 242 | 2871720351 | Chryseobacterium sp. KLBC 52 | Isolate | Nodule |
| 243 | 2902048731 | Pedobacter ureilyticus THG-T11 | Isolate | Rhizosphere |
| 244 | 2919097161 | Chryseobacterium ginsenosidimutans 1394 | Isolate | Rhizosphere |
| 245 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 246 | 2946019816 | Chryseobacterium sp. W4I1 | Isolate | Rhizosphere |
| 247 | 2993372514 | Chryseobacterium sp. SLBN-27 | Isolate | Rhizosphere |
| 248 | 2998344455 | Vogesella urethralis SLBN-145 | Isolate | Rhizosphere |
| 249 | 3007803356 | Pseudomonas sp. CM27 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.5 |
| Metatranscriptomes | 0 |
| Isolates | 9.5 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.06 |
| Nodule | 1.48 |
| Rhizoplane | 4.15 |
| Rhizosphere | 68.84 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.15 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0450894_016674 | 3300042131 | Bacteria | 975 |
| 2 | JGI25406J46586_10000014 | 3300003203 | Bacteria | 93855 |
| 3 | rootH2_10243076 | 3300003320 | Bacteria | 1484 |
| 4 | rootL2_10203214 | 3300003322 | Bacteria | 2375 |
| 5 | rootH1_10007743 | 3300003316 | Bacteria | 6031 |
| 6 | rootH1_10007743 | 3300003323 | Bacteria | 19767 |
| 7 | rootH1_10307812 | 3300003323 | Bacteria | 1083 |
| 8 | Ga0055525_1000246 | 3300003759 | Bacteria | 54885 |
| 9 | Ga0055536_1000387 | 3300003781 | Bacteria | 32286 |
| 10 | Ga0055534_1013646 | 3300003784 | Bacteria | 1553 |
| 11 | Ga0055530_10000089 | 3300003791 | Bacteria | 78801 |
| 12 | Ga0055531_10022249 | 3300003794 | Bacteria | 2423 |
| 13 | Ga0065704_10076392 | 3300005289 | Bacteria | 5139 |
| 14 | Ga0065704_10154262 | 3300005289 | Bacteria | 1393 |
| 15 | Ga0070658_10048436 | 3300005327 | Bacteria | 3441 |
| 16 | Ga0070658_10553971 | 3300005327 | Bacteria | 995 |
| 17 | Ga0070683_100010524 | 3300005329 | Bacteria | 7954 |
| 18 | Ga0070683_100365340 | 3300005329 | Bacteria | 1374 |
| 19 | Ga0070670_100016636 | 3300005331 | Bacteria | 6311 |
| 20 | Ga0070666_10315589 | 3300005335 | Unclassified | 1114 |
| 21 | Ga0070680_100677611 | 3300005336 | Bacteria | 887 |
| 22 | Ga0070691_10027757 | 3300005341 | Unclassified | 2642 |
| 23 | Ga0070661_100002180 | 3300005344 | Bacteria | 13483 |
| 24 | Ga0070674_100025207 | 3300005356 | Bacteria | 3869 |
| 25 | Ga0070674_100477338 | 3300005356 | Bacteria | 1034 |
| 26 | Ga0070688_100119318 | 3300005365 | Bacteria | 1764 |
| 27 | Ga0070659_100151017 | 3300005366 | Bacteria | 1895 |
| 28 | Ga0070667_100210057 | 3300005367 | Bacteria | 1730 |
| 29 | Ga0070714_100454658 | 3300005435 | Bacteria | 1217 |
| 30 | Ga0070678_100676577 | 3300005456 | Bacteria | 928 |
| 31 | Ga0068867_100109494 | 3300005459 | Bacteria | 2120 |
| 32 | Ga0068867_100365947 | 3300005459 | Bacteria | 1207 |
| 33 | Ga0070699_100001003 | 3300005518 | Bacteria | 26263 |
| 34 | Ga0070699_100184448 | 3300005518 | Unclassified | 1852 |
| 35 | Ga0070679_100001200 | 3300005530 | Bacteria | 22788 |
| 36 | Ga0070684_100092980 | 3300005535 | Bacteria | 2684 |
| 37 | Ga0068853_100159078 | 3300005539 | Bacteria | 2037 |
| 38 | Ga0070695_100059959 | 3300005545 | Bacteria | 2465 |
| 39 | Ga0070696_100039166 | 3300005546 | Bacteria | 3273 |
| 40 | Ga0070704_100179863 | 3300005549 | Bacteria | 1690 |
| 41 | Ga0068855_100056361 | 3300005563 | Bacteria | 4612 |
| 42 | Ga0068857_100136203 | 3300005577 | Bacteria | 2217 |
| 43 | Ga0068854_100606631 | 3300005578 | Bacteria | 935 |
| 44 | Ga0068859_100031392 | 3300005617 | Bacteria | 5335 |
| 45 | Ga0068859_100161681 | 3300005617 | Bacteria | 2318 |
| 46 | Ga0068859_100262040 | 3300005617 | Bacteria | 1820 |
| 47 | Ga0068859_100330710 | 3300005617 | Bacteria | 1618 |
| 48 | Ga0068860_100153587 | 3300005843 | Bacteria | 2218 |
| 49 | Ga0081540_1019319 | 3300005983 | Bacteria | 4147 |
| 50 | Ga0081540_1104633 | 3300005983 | Bacteria | 1211 |
| 51 | Ga0081539_10000001 | 3300005985 | Bacteria | 808331 |
| 52 | Ga0081539_10000008 | 3300005985 | Bacteria | 525071 |
| 53 | Ga0075364_10048036 | 3300006051 | Bacteria | 2780 |
| 54 | Ga0075364_10066095 | 3300006051 | Bacteria | 2375 |
| 55 | Ga0075362_10001043 | 3300006177 | Bacteria | 8543 |
| 56 | Ga0075367_10004139 | 3300006178 | Bacteria | 7035 |
| 57 | Ga0075367_10105360 | 3300006178 | Bacteria | 1727 |
| 58 | Ga0075369_10035019 | 3300006186 | Bacteria | 2133 |
| 59 | Ga0075366_10027621 | 3300006195 | Bacteria | 3330 |
| 60 | Ga0075366_10067940 | 3300006195 | Bacteria | 2121 |
| 61 | Ga0075370_10003466 | 3300006353 | Bacteria | 7515 |
| 62 | Ga0075370_10010444 | 3300006353 | Bacteria | 4855 |
| 63 | Ga0075370_10020129 | 3300006353 | Bacteria | 3643 |
| 64 | Ga0068871_100183318 | 3300006358 | Bacteria | 1800 |
| 65 | Ga0075430_100003833 | 3300006846 | Bacteria | 12661 |
| 66 | Ga0075434_100066550 | 3300006871 | Bacteria | 3589 |
| 67 | Ga0075429_100000282 | 3300006880 | Bacteria | 35849 |
| 68 | Ga0097620_100031390 | 3300006931 | Bacteria | 5335 |
| 69 | Ga0097620_100161689 | 3300006931 | Bacteria | 2318 |
| 70 | Ga0097620_100262062 | 3300006931 | Bacteria | 1820 |
| 71 | Ga0097620_100330720 | 3300006931 | Bacteria | 1618 |
| 72 | Ga0105251_10000751 | 3300009011 | Bacteria | 29613 |
| 73 | Ga0105250_10000586 | 3300009092 | Bacteria | 23882 |
| 74 | Ga0105250_10189609 | 3300009092 | Bacteria | 865 |
| 75 | Ga0105240_10196678 | 3300009093 | Bacteria | 2366 |
| 76 | Ga0105240_10284265 | 3300009093 | Bacteria | 1899 |
| 77 | Ga0111539_10016755 | 3300009094 | Bacteria | 9083 |
| 78 | Ga0111539_10042908 | 3300009094 | Bacteria | 5427 |
| 79 | Ga0105245_10009933 | 3300009098 | Bacteria | 8292 |
| 80 | Ga0105245_10352631 | 3300009098 | Bacteria | 1458 |
| 81 | Ga0105247_10312799 | 3300009101 | Bacteria | 1093 |
| 82 | Ga0105243_10000971 | 3300009148 | Bacteria | 26695 |
| 83 | Ga0105242_10157841 | 3300009176 | Bacteria | 1983 |
| 84 | Ga0105237_10058845 | 3300009545 | Bacteria | 3846 |
| 85 | Ga0105238_10457443 | 3300009551 | Bacteria | 1274 |
| 86 | Ga0105249_10796706 | 3300009553 | Bacteria | 1009 |
| 87 | Ga0105239_10037970 | 3300010375 | Bacteria | 5278 |
| 88 | Ga0157371_10003057 | 3300013102 | Bacteria | 15523 |
| 89 | Ga0157371_10004211 | 3300013102 | Bacteria | 12663 |
| 90 | Ga0157371_10008952 | 3300013102 | Bacteria | 7920 |
| 91 | Ga0157371_10010391 | 3300013102 | Bacteria | 7257 |
| 92 | Ga0157370_10000637 | 3300013104 | Bacteria | 43772 |
| 93 | Ga0157370_10002654 | 3300013104 | Bacteria | 21470 |
| 94 | Ga0157370_10003839 | 3300013104 | Bacteria | 17518 |
| 95 | Ga0157370_10277291 | 3300013104 | Bacteria | 1549 |
| 96 | Ga0157370_10467577 | 3300013104 | Bacteria | 1159 |
| 97 | Ga0157369_10000477 | 3300013105 | Bacteria | 53128 |
| 98 | Ga0163162_10000585 | 3300013306 | Bacteria | 33759 |
| 99 | Ga0163162_10258953 | 3300013306 | Bacteria | 1871 |
| 100 | Ga0157372_10001711 | 3300013307 | Bacteria | 23811 |
| 101 | Ga0157372_10111810 | 3300013307 | Bacteria | 3129 |
| 102 | Ga0157372_11284938 | 3300013307 | Bacteria | 845 |
| 103 | Ga0157375_10000220 | 3300013308 | Bacteria | 53557 |
| 104 | Ga0157375_10017740 | 3300013308 | Bacteria | 6434 |
| 105 | Ga0157375_10031078 | 3300013308 | Bacteria | 5041 |
| 106 | Ga0157380_10003703 | 3300014326 | Bacteria | 10507 |
| 107 | Ga0157380_10004132 | 3300014326 | Bacteria | 10031 |
| 108 | Ga0157380_10029945 | 3300014326 | Bacteria | 4165 |
| 109 | Ga0157380_10056191 | 3300014326 | Bacteria | 3129 |
| 110 | Ga0157376_10124743 | 3300014969 | Bacteria | 2288 |
| 111 | Ga0157376_10266765 | 3300014969 | Bacteria | 1606 |
| 112 | Ga0163161_10005519 | 3300017792 | Bacteria | 8763 |
| 113 | Ga0209563_100007 | 3300025230 | Bacteria | 1579402 |
| 114 | Ga0209677_104292 | 3300025253 | Bacteria | 4176 |
| 115 | Ga0209675_1000053 | 3300025291 | Bacteria | 194511 |
| 116 | Ga0209676_1000824 | 3300025292 | Bacteria | 40329 |
| 117 | Ga0209050_1000042 | 3300025298 | Bacteria | 402842 |
| 118 | Ga0209257_1000826 | 3300025304 | Bacteria | 44769 |
| 119 | Ga0207696_1000606 | 3300025711 | Bacteria | 26792 |
| 120 | Ga0207655_1023970 | 3300025728 | Bacteria | 3007 |
| 121 | Ga0207713_1000769 | 3300025735 | Bacteria | 29621 |
| 122 | Ga0207713_1001664 | 3300025735 | Bacteria | 17228 |
| 123 | Ga0207713_1004791 | 3300025735 | Bacteria | 8691 |
| 124 | Ga0207705_10027401 | 3300025909 | Bacteria | 4064 |
| 125 | Ga0207705_10410315 | 3300025909 | Bacteria | 1048 |
| 126 | Ga0207695_10153428 | 3300025913 | Bacteria | 2240 |
| 127 | Ga0207695_10272889 | 3300025913 | Bacteria | 1586 |
| 128 | Ga0207671_10043638 | 3300025914 | Bacteria | 3316 |
| 129 | Ga0207671_10070526 | 3300025914 | Bacteria | 2605 |
| 130 | Ga0207660_10011200 | 3300025917 | Bacteria | 5831 |
| 131 | Ga0207652_10002231 | 3300025921 | Bacteria | 16521 |
| 132 | Ga0207681_10235556 | 3300025923 | Bacteria | 1423 |
| 133 | Ga0207687_10004831 | 3300025927 | Bacteria | 8963 |
| 134 | Ga0207664_10406164 | 3300025929 | Bacteria | 1212 |
| 135 | Ga0207709_10041441 | 3300025935 | Bacteria | 2763 |
| 136 | Ga0207689_10173674 | 3300025942 | Bacteria | 1777 |
| 137 | Ga0207661_10010854 | 3300025944 | Bacteria | 6573 |
| 138 | Ga0207667_10003744 | 3300025949 | Bacteria | 18752 |
| 139 | Ga0207651_10123064 | 3300025960 | Bacteria | 1971 |
| 140 | Ga0207658_10025730 | 3300025986 | Bacteria | 4122 |
| 141 | Ga0207648_10138860 | 3300026089 | Bacteria | 2141 |
| 142 | Ga0207648_10302206 | 3300026089 | Unclassified | 1435 |
| 143 | Ga0207674_10402134 | 3300026116 | Bacteria | 1323 |
| 144 | Ga0207698_10129042 | 3300026142 | Bacteria | 2157 |
| 145 | Ga0209970_1000527 | 3300027614 | Bacteria | 6578 |
| 146 | Ga0268266_10033082 | 3300028379 | Bacteria | 4397 |
| 147 | Ga0265318_10000023 | 3300028577 | Bacteria | 160826 |
| 148 | Ga0307517_10217736 | 3300028786 | Bacteria | 1165 |
| 149 | Ga0307515_10037927 | 3300028794 | Bacteria | 7729 |
| 150 | Ga0265324_10032935 | 3300029957 | Bacteria | 1810 |
| 151 | Ga0316182_1155512 | 3300030745 | Bacteria | 2754 |
| 152 | Ga0265339_10113486 | 3300031249 | Unclassified | 1399 |
| 153 | Ga0307513_10100277 | 3300031456 | Unclassified | 2922 |
| 154 | Ga0307509_10011494 | 3300031507 | Bacteria | 10708 |
| 155 | Ga0307408_100000330 | 3300031548 | Bacteria | 45434 |
| 156 | Ga0307408_100000779 | 3300031548 | Bacteria | 25638 |
| 157 | Ga0307408_100060023 | 3300031548 | Bacteria | 2771 |
| 158 | Ga0265313_10010309 | 3300031595 | Bacteria | 5935 |
| 159 | Ga0265314_10000631 | 3300031711 | Bacteria | 43323 |
| 160 | Ga0307405_10223139 | 3300031731 | Unclassified | 1384 |
| 161 | Ga0307412_10000222 | 3300031911 | Bacteria | 38184 |
| 162 | Ga0307412_10104112 | 3300031911 | Bacteria | 2013 |
| 163 | Ga0307412_10129451 | 3300031911 | Unclassified | 1831 |
| 164 | Ga0307416_100094962 | 3300032002 | Bacteria | 2573 |
| 165 | Ga0307416_100428441 | 3300032002 | Unclassified | 1369 |
| 166 | Ga0307414_10000074 | 3300032004 | Bacteria | 94049 |
| 167 | Ga0307414_10000128 | 3300032004 | Bacteria | 53071 |
| 168 | Ga0307414_10000209 | 3300032004 | Bacteria | 39278 |
| 169 | Ga0307414_10013030 | 3300032004 | Bacteria | 4939 |
| 170 | Ga0307415_100021391 | 3300032126 | Bacteria | 3975 |
| 171 | Ga0373939_0074920 | 3300035114 | Bacteria | 1111 |
| 172 | Ga0373931_0119408 | 3300035691 | Bacteria | 1505 |
| 173 | Ga0395899_0000963 | 3300037312 | Bacteria | 26721 |
| 174 | Ga0395900_0011277 | 3300037418 | Bacteria | 9140 |
| 175 | Ga0395898_0000886 | 3300037466 | Bacteria | 48827 |
| 176 | Ga0395898_0005833 | 3300037466 | Bacteria | 13254 |
| 177 | Ga0395905_0013269 | 3300037471 | Bacteria | 7904 |
| 178 | Ga0395901_0021939 | 3300038443 | Bacteria | 6545 |
| 179 | Ga0400484_01941 | 3300038725 | Bacteria | 17261 |
| 180 | Ga0400488_58007 | 3300038741 | Bacteria | 10540 |
| 181 | Ga0439453_0001655 | 3300041408 | Bacteria | 2913 |
| 182 | Ga0451807_0646179 | 3300041486 | Bacteria | 1179 |
| 183 | Ga0439445_0000023 | 3300042004 | Bacteria | 20324 |
| 184 | Ga0439451_000029 | 3300042009 | Bacteria | 31111 |
| 185 | Ga0439463_002809 | 3300042016 | Bacteria | 4413 |
| 186 | Ga0439435_0027478 | 3300042436 | Unclassified | 1523 |
| 187 | Ga0439464_0022735 | 3300042439 | Bacteria | 1729 |
| 188 | Ga0451577_0200562 | 3300042876 | Bacteria | 1801 |
| 189 | Ga0466969_0017852 | 3300044656 | Bacteria | 3701 |
| 190 | Ga0453683_0004283 | 3300044673 | Bacteria | 10175 |
| 191 | Ga0466961_0002292 | 3300044693 | Bacteria | 11890 |
| 192 | Ga0466964_0017133 | 3300044706 | Bacteria | 2771 |
| 193 | Ga0453684_0453977 | 3300044712 | Unclassified | 1426 |
| 194 | Ga0453684_0549463 | 3300044712 | Bacteria | 1272 |
| 195 | Ga0466971_0000466 | 3300044719 | Bacteria | 15850 |
| 196 | Ga0466970_0015686 | 3300044765 | Bacteria | 3901 |
| 197 | Ga0466957_0000307 | 3300044842 | Bacteria | 23957 |
| 198 | Ga0451576_0000183 | 3300045051 | Bacteria | 157422 |
| 199 | Ga0451576_0037322 | 3300045051 | Bacteria | 5147 |
| 200 | Ga0451576_0101119 | 3300045051 | Bacteria | 2998 |
| 201 | Ga0451576_0111252 | 3300045051 | Bacteria | 2850 |
| 202 | Ga0466967_0455745 | 3300045976 | Bacteria | 1250 |
| 203 | Ga0495627_000245 | 3300046453 | Bacteria | 57165 |
| 204 | Ga0495590_0000338 | 3300046457 | Bacteria | 24377 |
| 205 | Ga0495638_0000726 | 3300046460 | Bacteria | 35496 |
| 206 | Ga0495584_0002205 | 3300046491 | Bacteria | 11109 |
| 207 | Ga0495585_0002038 | 3300046492 | Bacteria | 14899 |
| 208 | Ga0495585_0199329 | 3300046492 | Bacteria | 1020 |
| 209 | Ga0495607_0000810 | 3300046501 | Bacteria | 29648 |
| 210 | Ga0495583_0000460 | 3300046506 | Bacteria | 60178 |
| 211 | Ga0495606_0001096 | 3300046507 | Bacteria | 38817 |
| 212 | Ga0495606_0002199 | 3300046507 | Bacteria | 23384 |
| 213 | Ga0495632_0000120 | 3300046519 | Bacteria | 80853 |
| 214 | Ga0495637_0000574 | 3300046520 | Bacteria | 26147 |
| 215 | Ga0495643_0015956 | 3300046522 | Bacteria | 4423 |
| 216 | Ga0495648_0108691 | 3300046524 | Bacteria | 1514 |
| 217 | Ga0495642_0000421 | 3300046528 | Bacteria | 22501 |
| 218 | Ga0495654_0000711 | 3300046530 | Bacteria | 26011 |
| 219 | Ga0495597_0000822 | 3300046542 | Bacteria | 24434 |
| 220 | Ga0495622_0027292 | 3300046557 | Bacteria | 2665 |
| 221 | Ga0495668_0002285 | 3300046616 | Bacteria | 16110 |
| 222 | Ga0495625_0119832 | 3300046660 | Bacteria | 1792 |
| 223 | Ga0495625_0193334 | 3300046660 | Bacteria | 1347 |
| 224 | Ga0495635_0095125 | 3300046663 | Bacteria | 2037 |
| 225 | Ga0495659_0027104 | 3300046664 | Bacteria | 1974 |
| 226 | Ga0495661_0034122 | 3300046665 | Bacteria | 3204 |
| 227 | Ga0495661_0064591 | 3300046665 | Bacteria | 2159 |
| 228 | Ga0495669_0002671 | 3300046684 | Bacteria | 7300 |
| 229 | Ga0495613_0208010 | 3300046689 | Bacteria | 1377 |
| 230 | Ga0495671_0000349 | 3300046692 | Bacteria | 38480 |
| 231 | Ga0495671_0000405 | 3300046692 | Bacteria | 34951 |
| 232 | Ga0495671_0000501 | 3300046692 | Bacteria | 30161 |
| 233 | Ga0495649_0000913 | 3300046694 | Bacteria | 23330 |
| 234 | Ga0495589_0010358 | 3300046794 | Bacteria | 4841 |
| 235 | Ga0495660_0000971 | 3300046810 | Bacteria | 20957 |
| 236 | Ga0495604_0121629 | 3300047317 | Bacteria | 1889 |
| 237 | Ga0495672_0000795 | 3300047320 | Bacteria | 34131 |
| 238 | Ga0495683_0006783 | 3300047323 | Bacteria | 6225 |
| 239 | Ga0495677_0014934 | 3300047445 | Bacteria | 2824 |
| 240 | Ga0495673_0107215 | 3300047469 | Bacteria | 1121 |
| 241 | Ga0495686_0042086 | 3300047472 | Bacteria | 2906 |
| 242 | Ga0495686_0139150 | 3300047472 | Unclassified | 1433 |
| 243 | Ga0496102_0074008 | 3300048905 | Bacteria | 3131 |
| 244 | Ga0496104_0117007 | 3300048907 | Bacteria | 2558 |
| 245 | Ga0496105_0186220 | 3300048908 | Bacteria | 1699 |
| 246 | Ga0496105_0318869 | 3300048908 | Bacteria | 1246 |
| 247 | Ga0496110_0084734 | 3300048913 | Bacteria | 2829 |
| 248 | Ga0496112_0000008 | 3300048915 | Bacteria | 310323 |
| 249 | Ga0496113_0057161 | 3300048916 | Bacteria | 2931 |
| 250 | Ga0496114_0011085 | 3300048917 | Bacteria | 7194 |
| 251 | Ga0496115_0025775 | 3300048918 | Bacteria | 4582 |
| 252 | Ga0496115_0142184 | 3300048918 | Bacteria | 1980 |
| 253 | Ga0496116_0000006 | 3300048919 | Bacteria | 811937 |
| 254 | Ga0496117_0000027 | 3300048920 | Bacteria | 412234 |
| 255 | Ga0496118_0000620 | 3300048921 | Bacteria | 58296 |
| 256 | Ga0496119_0000006 | 3300048922 | Bacteria | 505999 |
| 257 | Ga0496119_0060202 | 3300048922 | Bacteria | 2275 |
| 258 | Ga0496122_0000444 | 3300048925 | Bacteria | 86587 |
| 259 | Ga0496122_0002040 | 3300048925 | Bacteria | 29985 |
| 260 | Ga0496122_0096477 | 3300048925 | Bacteria | 1993 |
| 261 | Ga0496123_0000958 | 3300048926 | Bacteria | 44671 |
| 262 | Ga0496123_0001660 | 3300048926 | Bacteria | 29864 |
| 263 | Ga0496123_0016233 | 3300048926 | Bacteria | 6058 |
| 264 | Ga0496124_0000475 | 3300048927 | Bacteria | 69109 |
| 265 | Ga0496124_0002357 | 3300048927 | Bacteria | 24921 |
| 266 | Ga0496124_0009718 | 3300048927 | Bacteria | 9847 |
| 267 | Ga0496124_0064775 | 3300048927 | Bacteria | 3050 |
| 268 | Ga0496125_0000031 | 3300048928 | Bacteria | 365156 |
| 269 | Ga0496125_0015116 | 3300048928 | Bacteria | 7484 |
| 270 | Ga0496125_0017623 | 3300048928 | Bacteria | 6803 |
| 271 | Ga0496126_0009607 | 3300048929 | Bacteria | 10259 |
| 272 | Ga0496126_0217890 | 3300048929 | Bacteria | 1605 |
| 273 | Ga0495678_006186 | 3300049459 | Bacteria | 6407 |
| 274 | Ga0501043_0535219 | 3300049579 | Unclassified | 872 |
| 275 | Ga0501047_0349635 | 3300049581 | Bacteria | 1315 |
| 276 | Ga0501198_014564 | 3300049649 | Bacteria | 1199 |
| 277 | Ga0501241_000018 | 3300049758 | Bacteria | 95195 |
| 278 | Ga0501269_000035 | 3300049766 | Bacteria | 41924 |
| 279 | Ga0501044_0022540 | 3300049823 | Bacteria | 6710 |
| 280 | Ga0501044_0493976 | 3300049823 | Unclassified | 1126 |
| 281 | nmdc:mga03683_13112_c1 | 3300050489 | Bacteria | 3044 |
| 282 | nmdc:mga00v17_136613_c1 | 3300050491 | Bacteria | 1570 |
| 283 | nmdc:mga00v17_15256_c1 | 3300050491 | Bacteria | 4309 |
| 284 | nmdc:mga0k408_150836_c1 | 3300050493 | Bacteria | 1384 |
| 285 | nmdc:mga0k408_27307_c1 | 3300050493 | Bacteria | 3242 |
| 286 | nmdc:mga0k408_30076_c1 | 3300050493 | Bacteria | 3095 |
| 287 | nmdc:mga0k408_33290_c1 | 3300050493 | Bacteria | 2948 |
| 288 | nmdc:mga0k408_52532_c1 | 3300050493 | Bacteria | 2362 |
| 289 | nmdc:mga06z11_19038_c1 | 3300050494 | Bacteria | 3148 |
| 290 | nmdc:mga07m45_17411_c1 | 3300050496 | Bacteria | 3860 |
| 291 | nmdc:mga07m45_20887_c1 | 3300050496 | Bacteria | 3560 |
| 292 | nmdc:mga07m45_6844_c1 | 3300050496 | Bacteria | 5796 |
| 293 | nmdc:mga07m45_8017_c1 | 3300050496 | Bacteria | 5416 |
| 294 | nmdc:mga09592_425_c1 | 3300050508 | Bacteria | 31113 |
| 295 | nmdc:mga0qj67_3517_c1 | 3300050509 | Bacteria | 11303 |
| 296 | nmdc:mga08y16_911436_c1 | 3300050511 | Bacteria | 864 |
| 297 | Ga0500646_0011229 | 3300053090 | Bacteria | 2302 |
| 298 | Ga0500641_0000062 | 3300053096 | Bacteria | 45077 |
| 299 | Ga0500650_0110338 | 3300053098 | Bacteria | 1284 |
| 300 | Ga0500555_053585 | 3300053103 | Bacteria | 1099 |
| 301 | Ga0500556_0050666 | 3300053104 | Bacteria | 1501 |
| 302 | Ga0500595_002193 | 3300053119 | Bacteria | 9918 |
| 303 | Ga0500652_157218 | 3300053131 | Bacteria | 941 |
| 304 | Ga0500655_029808 | 3300053133 | Bacteria | 1048 |
| 305 | Ga0500559_0101263 | 3300053136 | Bacteria | 1328 |
| 306 | Ga0466962_0001100 | 3300061719 | Bacteria | 12445 |
| 307 | 2511375636 | 2511231024 | Bacteria | 5835885 |
| 308 | 2587746060 | 2585428060 | Bacteria | 5304711 |
| 309 | 2588214550 | 2585428183 | Bacteria | 5166119 |
| 310 | 2588444179 | 2588253712 | Bacteria | 5403181 |
| 311 | 2590613943 | 2588254257 | Bacteria | 5436094 |
| 312 | 2599941834 | 2599185302 | Bacteria | 5954930 |
| 313 | 2599952646 | 2599185304 | Bacteria | 5951361 |
| 314 | 2600364300 | 2600254931 | Bacteria | 6734225 |
| 315 | 2643964983 | 2643221591 | Bacteria | 4397626 |
| 316 | 2644550416 | 2643221699 | Bacteria | 5731501 |
| 317 | 2678262568 | 2675903515 | Bacteria | 6580491 |
| 318 | 2729199965 | 2728369107 | Bacteria | 5082720 |
| 319 | 2738809677 | 2738541294 | Bacteria | 6925949 |
| 320 | 2738897037 | 2738541309 | Bacteria | 6926455 |
| 321 | 2745008910 | 2744054620 | Bacteria | 6551379 |
| 322 | 2765585391 | 2765235841 | Bacteria | 6137024 |
| 323 | 2772607489 | 2772190705 | Bacteria | 4666226 |
| 324 | 2775672003 | 2775506739 | Bacteria | 3855222 |
| 325 | 2807407231 | 2806310737 | Bacteria | 5751088 |
| 326 | 2807455560 | 2806310745 | Bacteria | 5742165 |
| 327 | 2825653078 | 2825651385 | Bacteria | 6715909 |
| 328 | 2842045189 | 2842038055 | Bacteria | 8002051 |
| 329 | 2842049149 | 2842045827 | Bacteria | 8006841 |
| 330 | 2842085990 | 2842083920 | Bacteria | 4857652 |
| 331 | 2871724023 | 2871720351 | Bacteria | 4862476 |
| 332 | 2902049523 | 2902048731 | Bacteria | 4976191 |
| 333 | 2919098559 | 2919097161 | Bacteria | 3860339 |
| 334 | 2941535251 | 2941531003 | Bacteria | 7653939 |
| 335 | 2946022592 | 2946019816 | Bacteria | 4621265 |
| 336 | 2993374593 | 2993372514 | Bacteria | 4214139 |
| 337 | 2998348387 | 2998344455 | Bacteria | 4222996 |
| 338 | 3007805160 | 3007803356 | Bacteria | 5931491 |
| 339 | Ga0450894_016674 | |||
| 340 | JGI25406J46586_10000014 | |||
| 341 | rootH2_10243076 | |||
| 342 | rootL2_10203214 | |||
| 343 | rootH1_10007743 | |||
| 344 | rootH1_10307812 | |||
| 345 | Ga0055525_1000246 | |||
| 346 | Ga0055536_1000387 | |||
| 347 | Ga0055534_1013646 | |||
| 348 | Ga0055530_10000089 | |||
| 349 | Ga0055531_10022249 | |||
| 350 | Ga0065704_10076392 | |||
| 351 | Ga0065704_10154262 | |||
| 352 | Ga0070658_10048436 | |||
| 353 | Ga0070658_10553971 | |||
| 354 | Ga0070683_100010524 | |||
| 355 | Ga0070683_100365340 | |||
| 356 | Ga0070670_100016636 | |||
| 357 | Ga0070666_10315589 | |||
| 358 | Ga0070680_100677611 | |||
| 359 | Ga0070691_10027757 | |||
| 360 | Ga0070661_100002180 | |||
| 361 | Ga0070674_100025207 | |||
| 362 | Ga0070674_100477338 | |||
| 363 | Ga0070688_100119318 | |||
| 364 | Ga0070659_100151017 | |||
| 365 | Ga0070667_100210057 | |||
| 366 | Ga0070714_100454658 | |||
| 367 | Ga0070678_100676577 | |||
| 368 | Ga0068867_100109494 | |||
| 369 | Ga0068867_100365947 | |||
| 370 | Ga0070699_100001003 | |||
| 371 | Ga0070699_100184448 | |||
| 372 | Ga0070679_100001200 | |||
| 373 | Ga0070684_100092980 | |||
| 374 | Ga0068853_100159078 | |||
| 375 | Ga0070695_100059959 | |||
| 376 | Ga0070696_100039166 | |||
| 377 | Ga0070704_100179863 | |||
| 378 | Ga0068855_100056361 | |||
| 379 | Ga0068857_100136203 | |||
| 380 | Ga0068854_100606631 | |||
| 381 | Ga0068859_100031392 | |||
| 382 | Ga0068859_100161681 | |||
| 383 | Ga0068859_100262040 | |||
| 384 | Ga0068859_100330710 | |||
| 385 | Ga0068860_100153587 | |||
| 386 | Ga0081540_1019319 | |||
| 387 | Ga0081540_1104633 | |||
| 388 | Ga0081539_10000001 | |||
| 389 | Ga0081539_10000008 | |||
| 390 | Ga0075364_10048036 | |||
| 391 | Ga0075364_10066095 | |||
| 392 | Ga0075362_10001043 | |||
| 393 | Ga0075367_10004139 | |||
| 394 | Ga0075367_10105360 | |||
| 395 | Ga0075369_10035019 | |||
| 396 | Ga0075366_10027621 | |||
| 397 | Ga0075366_10067940 | |||
| 398 | Ga0075370_10003466 | |||
| 399 | Ga0075370_10010444 | |||
| 400 | Ga0075370_10020129 | |||
| 401 | Ga0068871_100183318 | |||
| 402 | Ga0075430_100003833 | |||
| 403 | Ga0075434_100066550 | |||
| 404 | Ga0075429_100000282 | |||
| 405 | Ga0097620_100031390 | |||
| 406 | Ga0097620_100161689 | |||
| 407 | Ga0097620_100262062 | |||
| 408 | Ga0097620_100330720 | |||
| 409 | Ga0105251_10000751 | |||
| 410 | Ga0105250_10000586 | |||
| 411 | Ga0105250_10189609 | |||
| 412 | Ga0105240_10196678 | |||
| 413 | Ga0105240_10284265 | |||
| 414 | Ga0111539_10016755 | |||
| 415 | Ga0111539_10042908 | |||
| 416 | Ga0105245_10009933 | |||
| 417 | Ga0105245_10352631 | |||
| 418 | Ga0105247_10312799 | |||
| 419 | Ga0105243_10000971 | |||
| 420 | Ga0105242_10157841 | |||
| 421 | Ga0105237_10058845 | |||
| 422 | Ga0105238_10457443 | |||
| 423 | Ga0105249_10796706 | |||
| 424 | Ga0105239_10037970 | |||
| 425 | Ga0157371_10003057 | |||
| 426 | Ga0157371_10004211 | |||
| 427 | Ga0157371_10008952 | |||
| 428 | Ga0157371_10010391 | |||
| 429 | Ga0157370_10000637 | |||
| 430 | Ga0157370_10002654 | |||
| 431 | Ga0157370_10003839 | |||
| 432 | Ga0157370_10277291 | |||
| 433 | Ga0157370_10467577 | |||
| 434 | Ga0157369_10000477 | |||
| 435 | Ga0163162_10000585 | |||
| 436 | Ga0163162_10258953 | |||
| 437 | Ga0157372_10001711 | |||
| 438 | Ga0157372_10111810 | |||
| 439 | Ga0157372_11284938 | |||
| 440 | Ga0157375_10000220 | |||
| 441 | Ga0157375_10017740 | |||
| 442 | Ga0157375_10031078 | |||
| 443 | Ga0157380_10003703 | |||
| 444 | Ga0157380_10004132 | |||
| 445 | Ga0157380_10029945 | |||
| 446 | Ga0157380_10056191 | |||
| 447 | Ga0157376_10124743 | |||
| 448 | Ga0157376_10266765 | |||
| 449 | Ga0163161_10005519 | |||
| 450 | Ga0209563_100007 | |||
| 451 | Ga0209677_104292 | |||
| 452 | Ga0209675_1000053 | |||
| 453 | Ga0209676_1000824 | |||
| 454 | Ga0209050_1000042 | |||
| 455 | Ga0209257_1000826 | |||
| 456 | Ga0207696_1000606 | |||
| 457 | Ga0207655_1023970 | |||
| 458 | Ga0207713_1000769 | |||
| 459 | Ga0207713_1001664 | |||
| 460 | Ga0207713_1004791 | |||
| 461 | Ga0207705_10027401 | |||
| 462 | Ga0207705_10410315 | |||
| 463 | Ga0207695_10153428 | |||
| 464 | Ga0207695_10272889 | |||
| 465 | Ga0207671_10043638 | |||
| 466 | Ga0207671_10070526 | |||
| 467 | Ga0207660_10011200 | |||
| 468 | Ga0207652_10002231 | |||
| 469 | Ga0207681_10235556 | |||
| 470 | Ga0207687_10004831 | |||
| 471 | Ga0207664_10406164 | |||
| 472 | Ga0207709_10041441 | |||
| 473 | Ga0207689_10173674 | |||
| 474 | Ga0207661_10010854 | |||
| 475 | Ga0207667_10003744 | |||
| 476 | Ga0207651_10123064 | |||
| 477 | Ga0207658_10025730 | |||
| 478 | Ga0207648_10138860 | |||
| 479 | Ga0207648_10302206 | |||
| 480 | Ga0207674_10402134 | |||
| 481 | Ga0207698_10129042 | |||
| 482 | Ga0209970_1000527 | |||
| 483 | Ga0268266_10033082 | |||
| 484 | Ga0265318_10000023 | |||
| 485 | Ga0307517_10217736 | |||
| 486 | Ga0307515_10037927 | |||
| 487 | Ga0265324_10032935 | |||
| 488 | Ga0316182_1155512 | |||
| 489 | Ga0265339_10113486 | |||
| 490 | Ga0307513_10100277 | |||
| 491 | Ga0307509_10011494 | |||
| 492 | Ga0307408_100000330 | |||
| 493 | Ga0307408_100000779 | |||
| 494 | Ga0307408_100060023 | |||
| 495 | Ga0265313_10010309 | |||
| 496 | Ga0265314_10000631 | |||
| 497 | Ga0307405_10223139 | |||
| 498 | Ga0307412_10000222 | |||
| 499 | Ga0307412_10104112 | |||
| 500 | Ga0307412_10129451 | |||
| 501 | Ga0307416_100094962 | |||
| 502 | Ga0307416_100428441 | |||
| 503 | Ga0307414_10000074 | |||
| 504 | Ga0307414_10000128 | |||
| 505 | Ga0307414_10000209 | |||
| 506 | Ga0307414_10013030 | |||
| 507 | Ga0307415_100021391 | |||
| 508 | Ga0373939_0074920 | |||
| 509 | Ga0373931_0119408 | |||
| 510 | Ga0395899_0000963 | |||
| 511 | Ga0395900_0011277 | |||
| 512 | Ga0395898_0000886 | |||
| 513 | Ga0395898_0005833 | |||
| 514 | Ga0395905_0013269 | |||
| 515 | Ga0395901_0021939 | |||
| 516 | Ga0400484_01941 | |||
| 517 | Ga0400488_58007 | |||
| 518 | Ga0439453_0001655 | |||
| 519 | Ga0451807_0646179 | |||
| 520 | Ga0439445_0000023 | |||
| 521 | Ga0439451_000029 | |||
| 522 | Ga0439463_002809 | |||
| 523 | Ga0439435_0027478 | |||
| 524 | Ga0439464_0022735 | |||
| 525 | Ga0451577_0200562 | |||
| 526 | Ga0466969_0017852 | |||
| 527 | Ga0453683_0004283 | |||
| 528 | Ga0466961_0002292 | |||
| 529 | Ga0466964_0017133 | |||
| 530 | Ga0453684_0453977 | |||
| 531 | Ga0453684_0549463 | |||
| 532 | Ga0466971_0000466 | |||
| 533 | Ga0466970_0015686 | |||
| 534 | Ga0466957_0000307 | |||
| 535 | Ga0451576_0000183 | |||
| 536 | Ga0451576_0037322 | |||
| 537 | Ga0451576_0101119 | |||
| 538 | Ga0451576_0111252 | |||
| 539 | Ga0466967_0455745 | |||
| 540 | Ga0495627_000245 | |||
| 541 | Ga0495590_0000338 | |||
| 542 | Ga0495638_0000726 | |||
| 543 | Ga0495584_0002205 | |||
| 544 | Ga0495585_0002038 | |||
| 545 | Ga0495585_0199329 | |||
| 546 | Ga0495607_0000810 | |||
| 547 | Ga0495583_0000460 | |||
| 548 | Ga0495606_0001096 | |||
| 549 | Ga0495606_0002199 | |||
| 550 | Ga0495632_0000120 | |||
| 551 | Ga0495637_0000574 | |||
| 552 | Ga0495643_0015956 | |||
| 553 | Ga0495648_0108691 | |||
| 554 | Ga0495642_0000421 | |||
| 555 | Ga0495654_0000711 | |||
| 556 | Ga0495597_0000822 | |||
| 557 | Ga0495622_0027292 | |||
| 558 | Ga0495668_0002285 | |||
| 559 | Ga0495625_0119832 | |||
| 560 | Ga0495625_0193334 | |||
| 561 | Ga0495635_0095125 | |||
| 562 | Ga0495659_0027104 | |||
| 563 | Ga0495661_0034122 | |||
| 564 | Ga0495661_0064591 | |||
| 565 | Ga0495669_0002671 | |||
| 566 | Ga0495613_0208010 | |||
| 567 | Ga0495671_0000349 | |||
| 568 | Ga0495671_0000405 | |||
| 569 | Ga0495671_0000501 | |||
| 570 | Ga0495649_0000913 | |||
| 571 | Ga0495589_0010358 | |||
| 572 | Ga0495660_0000971 | |||
| 573 | Ga0495604_0121629 | |||
| 574 | Ga0495672_0000795 | |||
| 575 | Ga0495683_0006783 | |||
| 576 | Ga0495677_0014934 | |||
| 577 | Ga0495673_0107215 | |||
| 578 | Ga0495686_0042086 | |||
| 579 | Ga0495686_0139150 | |||
| 580 | Ga0496102_0074008 | |||
| 581 | Ga0496104_0117007 | |||
| 582 | Ga0496105_0186220 | |||
| 583 | Ga0496105_0318869 | |||
| 584 | Ga0496110_0084734 | |||
| 585 | Ga0496112_0000008 | |||
| 586 | Ga0496113_0057161 | |||
| 587 | Ga0496114_0011085 | |||
| 588 | Ga0496115_0025775 | |||
| 589 | Ga0496115_0142184 | |||
| 590 | Ga0496116_0000006 | |||
| 591 | Ga0496117_0000027 | |||
| 592 | Ga0496118_0000620 | |||
| 593 | Ga0496119_0000006 | |||
| 594 | Ga0496119_0060202 | |||
| 595 | Ga0496122_0000444 | |||
| 596 | Ga0496122_0002040 | |||
| 597 | Ga0496122_0096477 | |||
| 598 | Ga0496123_0000958 | |||
| 599 | Ga0496123_0001660 | |||
| 600 | Ga0496123_0016233 | |||
| 601 | Ga0496124_0000475 | |||
| 602 | Ga0496124_0002357 | |||
| 603 | Ga0496124_0009718 | |||
| 604 | Ga0496124_0064775 | |||
| 605 | Ga0496125_0000031 | |||
| 606 | Ga0496125_0015116 | |||
| 607 | Ga0496125_0017623 | |||
| 608 | Ga0496126_0009607 | |||
| 609 | Ga0496126_0217890 | |||
| 610 | Ga0495678_006186 | |||
| 611 | Ga0501043_0535219 | |||
| 612 | Ga0501047_0349635 | |||
| 613 | Ga0501198_014564 | |||
| 614 | Ga0501241_000018 | |||
| 615 | Ga0501269_000035 | |||
| 616 | Ga0501044_0022540 | |||
| 617 | Ga0501044_0493976 | |||
| 618 | nmdc:mga03683_13112_c1 | |||
| 619 | nmdc:mga00v17_136613_c1 | |||
| 620 | nmdc:mga00v17_15256_c1 | |||
| 621 | nmdc:mga0k408_150836_c1 | |||
| 622 | nmdc:mga0k408_27307_c1 | |||
| 623 | nmdc:mga0k408_30076_c1 | |||
| 624 | nmdc:mga0k408_33290_c1 | |||
| 625 | nmdc:mga0k408_52532_c1 | |||
| 626 | nmdc:mga06z11_19038_c1 | |||
| 627 | nmdc:mga07m45_17411_c1 | |||
| 628 | nmdc:mga07m45_20887_c1 | |||
| 629 | nmdc:mga07m45_6844_c1 | |||
| 630 | nmdc:mga07m45_8017_c1 | |||
| 631 | nmdc:mga09592_425_c1 | |||
| 632 | nmdc:mga0qj67_3517_c1 | |||
| 633 | nmdc:mga08y16_911436_c1 | |||
| 634 | Ga0500646_0011229 | |||
| 635 | Ga0500641_0000062 | |||
| 636 | Ga0500650_0110338 | |||
| 637 | Ga0500555_053585 | |||
| 638 | Ga0500556_0050666 | |||
| 639 | Ga0500595_002193 | |||
| 640 | Ga0500652_157218 | |||
| 641 | Ga0500655_029808 | |||
| 642 | Ga0500559_0101263 | |||
| 643 | Ga0466962_0001100 | |||
| 644 | 2511375636 | |||
| 645 | 2587746060 | |||
| 646 | 2588214550 | |||
| 647 | 2588444179 | |||
| 648 | 2590613943 | |||
| 649 | 2599941834 | |||
| 650 | 2599952646 | |||
| 651 | 2600364300 | |||
| 652 | 2643964983 | |||
| 653 | 2644550416 | |||
| 654 | 2678262568 | |||
| 655 | 2729199965 | |||
| 656 | 2738809677 | |||
| 657 | 2738897037 | |||
| 658 | 2745008910 | |||
| 659 | 2765585391 | |||
| 660 | 2772607489 | |||
| 661 | 2775672003 | |||
| 662 | 2807407231 | |||
| 663 | 2807455560 | |||
| 664 | 2825653078 | |||
| 665 | 2842045189 | |||
| 666 | 2842049149 | |||
| 667 | 2842085990 | |||
| 668 | 2871724023 | |||
| 669 | 2902049523 | |||
| 670 | 2919098559 | |||
| 671 | 2941535251 | |||
| 672 | 2946022592 | |||
| 673 | 2993374593 | |||
| 674 | 2998348387 | |||
| 675 | 3007805160 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3tdn-assembly1.cif.gz_A | computationally designed two-fold symmetric tim-barrel protein, flr | 0.9553 | 122 | 229 |
| 3tdm-assembly2.cif.gz_C | computationally designed tim-barrel protein, halfflr | 0.9442 | 122 | 228 |
| 4evz-assembly2.cif.gz_B | structure of hisf-luca | 0.9235 | 1 | 230 |
| 4fx7-assembly4.cif.gz_D | structure of sym2 d9v+d55v+d130v+d176v | 0.9143 | 5 | 229 |
| 4evz-assembly1.cif.gz_A | structure of hisf-luca | 0.9039 | 1 | 257 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3tdnA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9553 | 122 | 229 | 3.40.50.12600 |
| af_P10371_1_245_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9297 | 6 | 229 | 3.20.20.70 |
| af_Q2FUU2_4_232_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.901 | 8 | 229 | 3.20.20.70 |
| 4x2rA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.8907 | 3 | 229 | 3.20.20.70 |
| af_Q58927_1_237_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.882 | 5 | 254 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A383DGM3-F1-model_v4 | Uncharacterized protein | 0.9874 | 1 | 121 |
GO:0000105
GO:0000107 |
| AF-N1U730-F1-model_v4 | imidazole glycerol-phosphate synthase (EC 4.3.2.10) (IGP synthase cyclase subunit) | 0.987 | 1 | 185 |
GO:0000105
GO:0000107 GO:0016829 |
| AF-A0A379SSS1-F1-model_v4 | Imidazole glycerol phosphate synthase cyclasesubunit (EC 4.1.3.-) | 0.9852 | 1 | 106 |
GO:0000105
GO:0000107 GO:0016829 |
| AF-A0A109WUZ0-F1-model_v4 | Imidazole glycerol phosphate synthase subunit HisF (EC 4.1.3.-) | 0.9848 | 75 | 216 |
GO:0000105
GO:0000107 GO:0016829 |
| AF-A0A4V1SLZ8-F1-model_v4 | Imidazole glycerol phosphate synthase subunit HisF (EC 4.1.3.-) | 0.9835 | 1 | 165 |
GO:0000105
GO:0000107 GO:0016829 |