F413066

General Info

Members Datasets Scaffolds Average Seq Length
337 233 674 179

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10348548|Ga0105237_103485482
Length 204
Sequence MAQERPNCGPFATPADNPIEQEIPSMLTVGDTFPRFELTGVVSEDMNHAFQPFSSDSNKGKWKIVFFWPKDFTFVCPTEIAAFGKLNGEFNDRDAVVYGVSTDSEFVHLAWRKSHEDLKGLPFAMLADIKRELSQDLGVLDKKEGVALRATFIVDPEGIIRFASVNDLSVGRNPAEVLRVLDALQTDELCPCNWQKGQDTLKAA

Samples

Sample ID Description Type Environment
1 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
2 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003291 Grassland soil microbial communities from Hopland, California, USA - Sample H3_Rhizo_37 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003300 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300003559 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
12 3300003568 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
14 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
15 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
16 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
17 3300003611 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_27 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
18 3300003613 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_31 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
19 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
20 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
43 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
48 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
49 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300023304 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctno.R1 Metatranscriptome Rhizosphere
75 3300023309 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.ctcc.R1 Metatranscriptome Rhizosphere
76 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
77 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
79 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
80 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
82 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
109 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
110 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
111 3300029272 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.ctno.R1 Metatranscriptome Rhizosphere
112 3300029276 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.ctcc.R1 Metatranscriptome Rhizosphere
113 3300029277 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.ctcc.R1 Metatranscriptome Rhizosphere
114 3300029282 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B1.stcc.R1 Metatranscriptome Rhizosphere
115 3300029285 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B3.stno.R1 Metatranscriptome Rhizosphere
116 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
117 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
118 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
119 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
120 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
121 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
122 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
123 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
124 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
125 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
126 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
127 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
128 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
129 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
130 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
131 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
132 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
133 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
136 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
137 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
138 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
139 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
140 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
141 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
142 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
144 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
145 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
146 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
147 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
148 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
149 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
150 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
151 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
152 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
153 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
154 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
155 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
156 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
157 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
158 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
159 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
160 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
161 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
162 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
163 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
164 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
165 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
166 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
167 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
168 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
169 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
170 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
171 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
172 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
173 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
174 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
178 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
200 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
201 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
202 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
203 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
204 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
205 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
206 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
207 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
208 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
210 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
211 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
212 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
213 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
214 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
215 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
216 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
217 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
218 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
219 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
220 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
221 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
222 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
223 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
224 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
225 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
226 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
227 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
228 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
229 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
230 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
231 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
232 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
233 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.98
Metatranscriptomes 14.84
Isolates 1.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.12
Nodule 0.3
Rhizoplane 0
Rhizosphere 90.5
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105237_10348548 3300009545 Bacteria 1485
2 Ga0006778J45830_1008438 3300003162 Bacteria 1356
3 Ga0006759J45824_1004855 3300003163 Bacteria 1223
4 JGI25153J46596_10082802 3300003215 Bacteria 795
5 Ga0007421J48921_108510 3300003291 Bacteria 602
6 Ga0006758J48902_1005360 3300003300 Bacteria 628
7 Ga0006770J48903_1016485 3300003305 Bacteria 770
8 Ga0006777J48905_1009971 3300003308 Bacteria 1400
9 JGI25160J50197_1013411 3300003354 Bacteria 2794
10 Ga0007417J51691_1012848 3300003544 Bacteria 683
11 Ga0007417J51691_1031640 3300003544 Bacteria 590
12 Ga0007427J51700_107404 3300003559 Bacteria 699
13 Ga0006781J51513_1008320 3300003568 Bacteria 613
14 Ga0007410J51695_1007666 3300003574 Bacteria 1274
15 Ga0007410J51695_1018793 3300003574 Bacteria 622
16 Ga0007409J51694_1011181 3300003575 Bacteria 1141
17 Ga0007416J51690_1008384 3300003577 Bacteria 1262
18 Ga0007429J51699_1014077 3300003579 Bacteria 1239
19 Ga0007411J51799_104790 3300003611 Bacteria 625
20 Ga0007415J51800_110006 3300003613 Bacteria 578
21 Ga0032354_1001133 3300003693 Bacteria 960
22 Ga0006780_1012340 3300003735 Bacteria 795
23 Ga0070669_100064333 3300005353 Bacteria 2701
24 Ga0070675_100271077 3300005354 Bacteria 1490
25 Ga0070674_100353928 3300005356 Bacteria 1187
26 Ga0070674_100662495 3300005356 Bacteria 888
27 Ga0070667_100319872 3300005367 Bacteria 1400
28 Ga0070667_100748076 3300005367 Bacteria 906
29 Ga0070705_100027948 3300005440 Bacteria 3084
30 Ga0068867_100971866 3300005459 Bacteria 768
31 Ga0070685_10386161 3300005466 Bacteria 966
32 Ga0070706_100046575 3300005467 Bacteria 4003
33 Ga0070698_100030639 3300005471 Bacteria 5577
34 Ga0070684_100051269 3300005535 Bacteria 3585
35 Ga0068853_100850804 3300005539 Bacteria 875
36 Ga0068853_101258590 3300005539 Bacteria 715
37 Ga0070695_100124065 3300005545 Bacteria 1771
38 Ga0070665_100770596 3300005548 Bacteria 975
39 Ga0070704_100011638 3300005549 Bacteria 5401
40 Ga0068852_100543999 3300005616 Bacteria 1161
41 Ga0068864_101072577 3300005618 Bacteria 801
42 Ga0068866_10037976 3300005718 Bacteria 2369
43 Ga0068861_100006794 3300005719 Bacteria 7816
44 Ga0068863_100151257 3300005841 Bacteria 2221
45 Ga0068858_101237270 3300005842 Bacteria 734
46 Ga0068862_100817554 3300005844 Bacteria 911
47 Ga0081538_10002009 3300005981 Bacteria 20322
48 Ga0081540_1091970 3300005983 Bacteria 1332
49 Ga0081539_10063782 3300005985 Bacteria 2008
50 Ga0075365_10300029 3300006038 Bacteria 1130
51 Ga0070712_100998505 3300006175 Bacteria 724
52 Ga0075362_10014191 3300006177 Bacteria 3210
53 Ga0075362_10035764 3300006177 Bacteria 2170
54 Ga0075369_10280846 3300006186 Bacteria 776
55 Ga0075370_10209043 3300006353 Bacteria 1152
56 Ga0068871_100951986 3300006358 Bacteria 798
57 Ga0075428_100156803 3300006844 Bacteria 2472
58 Ga0075428_100818211 3300006844 Bacteria 990
59 Ga0075430_100017725 3300006846 Bacteria 6061
60 Ga0075431_100119434 3300006847 Bacteria 2720
61 Ga0075431_100551798 3300006847 Bacteria 1140
62 Ga0075433_10272635 3300006852 Bacteria 1499
63 Ga0075434_100257739 3300006871 Bacteria 1763
64 Ga0075429_100438422 3300006880 Bacteria 1145
65 Ga0105240_10001937 3300009093 Bacteria 34329
66 Ga0105240_10345721 3300009093 Bacteria 1688
67 Ga0105240_10355226 3300009093 Bacteria 1662
68 Ga0114129_10530058 3300009147 Bacteria 1534
69 Ga0105242_10376832 3300009176 Bacteria 1318
70 Ga0105248_10165176 3300009177 Bacteria 2496
71 Ga0105237_10655117 3300009545 Bacteria 1057
72 Ga0105249_10636409 3300009553 Bacteria 1123
73 Ga0157370_10101939 3300013104 Bacteria 2688
74 Ga0157378_10817189 3300013297 Bacteria 959
75 Ga0163162_10685784 3300013306 Bacteria 1147
76 Ga0163162_11052050 3300013306 Bacteria 921
77 Ga0157372_10669230 3300013307 Bacteria 1209
78 Ga0157375_10050616 3300013308 Bacteria 4075
79 Ga0157375_10388961 3300013308 Bacteria 1561
80 Ga0163163_10480616 3300014325 Bacteria 1303
81 Ga0157380_10219246 3300014326 Bacteria 1701
82 Ga0157379_11400200 3300014968 Bacteria 678
83 Ga0157376_10267386 3300014969 Bacteria 1605
84 Ga0197907_10782928 3300020069 Bacteria 1763
85 Ga0206352_10663921 3300020078 Bacteria 1568
86 Ga0224712_10058640 3300022467 Bacteria 1526
87 Ga0256714_100298 3300023304 Bacteria 832
88 Ga0256714_105754 3300023304 Bacteria 746
89 Ga0256744_100475 3300023309 Bacteria 637
90 Ga0209130_1000422 3300025284 Bacteria 45627
91 Ga0209675_1000533 3300025291 Bacteria 27869
92 Ga0209025_1000053 3300025294 Bacteria 317600
93 Ga0209758_1002069 3300025297 Bacteria 21429
94 Ga0209050_1020921 3300025298 Bacteria 2411
95 Ga0207426_1000198 3300025302 Bacteria 146241
96 Ga0207642_10139220 3300025899 Bacteria 1277
97 Ga0207680_10143096 3300025903 Bacteria 1587
98 Ga0207684_10031565 3300025910 Bacteria 4505
99 Ga0207695_10019526 3300025913 Bacteria 7800
100 Ga0207681_10087574 3300025923 Bacteria 2216
101 Ga0207681_10234486 3300025923 Bacteria 1426
102 Ga0207681_10827798 3300025923 Bacteria 774
103 Ga0207691_10150511 3300025940 Bacteria 2046
104 Ga0207711_10054695 3300025941 Bacteria 3426
105 Ga0207712_10255557 3300025961 Bacteria 1418
106 Ga0207658_10045145 3300025986 Bacteria 3211
107 Ga0207658_10524074 3300025986 Bacteria 1058
108 Ga0207639_10139189 3300026041 Bacteria 2020
109 Ga0207708_10625208 3300026075 Bacteria 914
110 Ga0207641_11776443 3300026088 Bacteria 618
111 Ga0207648_10772483 3300026089 Bacteria 893
112 Ga0207676_11169345 3300026095 Bacteria 762
113 Ga0207674_10037966 3300026116 Bacteria 5003
114 Ga0207674_10617396 3300026116 Bacteria 1047
115 Ga0207675_100003019 3300026118 Bacteria 16504
116 Ga0207675_101029980 3300026118 Bacteria 842
117 Ga0207698_10946248 3300026142 Bacteria 870
118 Ga0209967_1000608 3300027364 Bacteria 4625
119 Ga0210000_1014906 3300027462 Bacteria 1167
120 Ga0209995_1001296 3300027471 Bacteria 3847
121 Ga0209999_1000749 3300027543 Bacteria 5289
122 Ga0209983_1074739 3300027665 Bacteria 757
123 Ga0209983_1088117 3300027665 Bacteria 698
124 Ga0209971_1002737 3300027682 Bacteria 4210
125 Ga0209974_10012769 3300027876 Bacteria 2805
126 Ga0268266_10815313 3300028379 Bacteria 902
127 Ga0268265_10089779 3300028380 Bacteria 2453
128 Ga0265337_1058267 3300028556 Bacteria 1074
129 Ga0307517_10206556 3300028786 Bacteria 1218
130 Ga0265338_10010835 3300028800 Bacteria 10616
131 Ga0265338_10568315 3300028800 Bacteria 792
132 Ga0311000_110733 3300029272 Bacteria 864
133 Ga0311004_130691 3300029276 Bacteria 830
134 Ga0311004_142471 3300029276 Bacteria 843
135 Ga0311001_1079123 3300029277 Bacteria 857
136 Ga0311003_114296 3300029282 Bacteria 604
137 Ga0310981_1007128 3300029285 Bacteria 893
138 Ga0310981_1014463 3300029285 Bacteria 632
139 Ga0310981_1054434 3300029285 Bacteria 873
140 Ga0265762_1073805 3300030760 Bacteria 720
141 Ga0265330_10168251 3300031235 Bacteria 930
142 Ga0265332_10173774 3300031238 Bacteria 899
143 Ga0265325_10226781 3300031241 Bacteria 853
144 Ga0265331_10000716 3300031250 Bacteria 28256
145 Ga0265327_10000052 3300031251 Bacteria 256602
146 Ga0265316_10615410 3300031344 Bacteria 769
147 Ga0307513_10005914 3300031456 Bacteria 16056
148 Ga0307513_10090617 3300031456 Bacteria 3118
149 Ga0307408_100113266 3300031548 Bacteria 2088
150 Ga0307408_100843448 3300031548 Bacteria 835
151 Ga0307408_100897247 3300031548 Bacteria 811
152 Ga0265313_10103540 3300031595 Bacteria 1260
153 Ga0307508_10016094 3300031616 Bacteria 6813
154 Ga0265314_10024980 3300031711 Bacteria 4517
155 Ga0307413_10043082 3300031824 Bacteria 2657
156 Ga0307413_11006305 3300031824 Bacteria 715
157 Ga0307410_10061756 3300031852 Bacteria 2565
158 Ga0307406_10305188 3300031901 Bacteria 1225
159 Ga0307406_10782187 3300031901 Bacteria 804
160 Ga0307406_11203079 3300031901 Bacteria 658
161 Ga0307407_10004937 3300031903 Bacteria 5733
162 Ga0307407_10393954 3300031903 Bacteria 992
163 Ga0307412_10981513 3300031911 Bacteria 745
164 Ga0307409_100006276 3300031995 Bacteria 6964
165 Ga0307409_100887029 3300031995 Bacteria 905
166 Ga0307416_100111512 3300032002 Bacteria 2412
167 Ga0307416_100249841 3300032002 Bacteria 1725
168 Ga0307416_100305223 3300032002 Bacteria 1585
169 Ga0307416_102203383 3300032002 Bacteria 652
170 Ga0307414_11103027 3300032004 Bacteria 733
171 Ga0307411_10142263 3300032005 Bacteria 1770
172 Ga0307411_10828502 3300032005 Bacteria 817
173 Ga0307411_11343338 3300032005 Bacteria 652
174 Ga0307415_100204403 3300032126 Bacteria 1570
175 Ga0307507_10081734 3300033179 Bacteria 2838
176 Ga0316596_1038058 3300033541 Bacteria 1260
177 Ga0373939_0097748 3300035114 Bacteria 1003
178 Ga0373960_0195430 3300035121 Bacteria 713
179 Ga0373937_0446118 3300036401 Bacteria 1229
180 Ga0395905_0964251 3300037471 Bacteria 756
181 Ga0395901_1362758 3300038443 Bacteria 669
182 Ga0436360_0691360 3300039438 Bacteria 739
183 Ga0436361_1089016 3300039447 Bacteria 852
184 Ga0439465_0216977 3300041413 Bacteria 701
185 Ga0439431_0046885 3300041997 Bacteria 1113
186 Ga0439433_0034877 3300041999 Bacteria 1159
187 Ga0439445_0124306 3300042004 Bacteria 742
188 Ga0450923_008324 3300042125 Bacteria 1782
189 Ga0450898_010690 3300042134 Bacteria 1490
190 Ga0439446_0014302 3300042156 Bacteria 2189
191 Ga0450909_046829 3300042185 Bacteria 671
192 Ga0439435_0037155 3300042436 Bacteria 1349
193 Ga0450918_009420 3300042531 Bacteria 1712
194 Ga0451576_0205839 3300045051 Bacteria 2055
195 Ga0466967_1209473 3300045976 Bacteria 753
196 Ga0495638_0028182 3300046460 Bacteria 3629
197 Ga0495651_0658408 3300046462 Bacteria 656
198 Ga0495580_0039416 3300046472 Bacteria 3380
199 Ga0495580_0226397 3300046472 Bacteria 1284
200 Ga0495610_0079674 3300046512 Bacteria 1507
201 Ga0495666_0108327 3300046526 Bacteria 1306
202 Ga0495586_0702760 3300046535 Bacteria 584
203 Ga0495656_0157090 3300046615 Bacteria 1103
204 Ga0495657_0382056 3300046675 Bacteria 831
205 Ga0495599_0332038 3300046678 Bacteria 914
206 Ga0495669_0263006 3300046684 Bacteria 829
207 Ga0495613_0248523 3300046689 Bacteria 1242
208 Ga0495649_0277801 3300046694 Bacteria 856
209 Ga0495581_0047603 3300047315 Bacteria 2478
210 Ga0495675_0148420 3300047444 Bacteria 1450
211 Ga0495673_0252038 3300047469 Bacteria 644
212 Ga0501306_009365 3300049127 Bacteria 1214
213 Ga0501306_018561 3300049127 Bacteria 952
214 Ga0501310_055866 3300049130 Bacteria 580
215 Ga0501305_054668 3300049161 Bacteria 677
216 Ga0495682_0176718 3300049460 Bacteria 759
217 Ga0501311_024757 3300049527 Bacteria 837
218 Ga0501312_082942 3300049528 Bacteria 582
219 Ga0501313_007134 3300049529 Bacteria 1227
220 Ga0501314_006543 3300049530 Bacteria 1017
221 Ga0501314_020534 3300049530 Bacteria 684
222 Ga0501317_026332 3300049533 Bacteria 820
223 Ga0501317_047794 3300049533 Bacteria 672
224 Ga0501318_057063 3300049534 Bacteria 592
225 Ga0501321_004571 3300049537 Bacteria 1329
226 Ga0501322_019065 3300049538 Bacteria 591
227 Ga0501335_036173 3300049551 Bacteria 572
228 Ga0501032_0002226 3300049569 Bacteria 15274
229 Ga0501032_0281323 3300049569 Bacteria 1077
230 Ga0501033_0002027 3300049570 Bacteria 17616
231 Ga0501033_0055721 3300049570 Bacteria 2922
232 Ga0501033_0076726 3300049570 Bacteria 2453
233 Ga0501033_0245333 3300049570 Bacteria 1270
234 Ga0501033_0621507 3300049570 Bacteria 740
235 Ga0501033_0757064 3300049570 Bacteria 658
236 Ga0501034_0003286 3300049571 Bacteria 18465
237 Ga0501036_0130543 3300049572 Bacteria 2121
238 Ga0501036_0673913 3300049572 Bacteria 855
239 Ga0501037_0012672 3300049573 Bacteria 6213
240 Ga0501037_0028400 3300049573 Bacteria 4132
241 Ga0501037_0357939 3300049573 Bacteria 1006
242 Ga0501038_0007434 3300049574 Bacteria 10110
243 Ga0501038_0168187 3300049574 Bacteria 1777
244 Ga0501038_0189850 3300049574 Bacteria 1654
245 Ga0501038_0459156 3300049574 Bacteria 978
246 Ga0501039_0016196 3300049575 Bacteria 5711
247 Ga0501042_0073787 3300049578 Bacteria 2441
248 Ga0501042_0615514 3300049578 Bacteria 790
249 Ga0501043_0002665 3300049579 Bacteria 14994
250 Ga0501043_0210726 3300049579 Bacteria 1506
251 Ga0501046_0007756 3300049580 Bacteria 9416
252 Ga0501046_0394071 3300049580 Bacteria 1001
253 Ga0501047_0185818 3300049581 Bacteria 1943
254 Ga0501047_0366027 3300049581 Bacteria 1277
255 Ga0501048_0047537 3300049582 Bacteria 3062
256 Ga0501048_0276665 3300049582 Bacteria 1193
257 Ga0501068_0067302 3300049584 Bacteria 2182
258 Ga0501068_0095928 3300049584 Bacteria 1834
259 Ga0501068_0407362 3300049584 Bacteria 877
260 Ga0501069_0002537 3300049585 Bacteria 9326
261 Ga0501069_0003489 3300049585 Bacteria 8097
262 Ga0501069_0041581 3300049585 Bacteria 2541
263 Ga0501069_0067061 3300049585 Bacteria 2007
264 Ga0501070_0000118 3300049586 Bacteria 70586
265 Ga0501070_0000410 3300049586 Bacteria 39045
266 Ga0501070_0001189 3300049586 Bacteria 23275
267 Ga0501070_0165605 3300049586 Bacteria 1822
268 Ga0501070_0185163 3300049586 Bacteria 1713
269 Ga0501070_0330018 3300049586 Bacteria 1240
270 Ga0501070_0357115 3300049586 Bacteria 1186
271 Ga0501070_0396484 3300049586 Bacteria 1117
272 Ga0501070_0698386 3300049586 Bacteria 802
273 Ga0501072_0150729 3300049588 Bacteria 1854
274 Ga0501072_0425142 3300049588 Bacteria 1053
275 Ga0501073_0002428 3300049589 Bacteria 13944
276 Ga0501073_0018697 3300049589 Bacteria 5009
277 Ga0501073_0028265 3300049589 Bacteria 4007
278 Ga0501073_0048743 3300049589 Bacteria 2973
279 Ga0501073_0242162 3300049589 Bacteria 1245
280 Ga0501073_0617279 3300049589 Bacteria 749
281 Ga0501074_0019817 3300049590 Bacteria 4886
282 Ga0501080_0001509 3300049742 Bacteria 19649
283 Ga0501080_0028522 3300049742 Bacteria 5194
284 Ga0501080_0043112 3300049742 Bacteria 4200
285 Ga0501080_0176513 3300049742 Bacteria 1967
286 Ga0501080_0215292 3300049742 Bacteria 1760
287 Ga0501080_0260823 3300049742 Bacteria 1579
288 Ga0501080_0365298 3300049742 Bacteria 1302
289 Ga0501080_0457799 3300049742 Bacteria 1143
290 Ga0501081_0079891 3300049743 Bacteria 2288
291 Ga0501081_0102053 3300049743 Bacteria 2029
292 Ga0501081_0262500 3300049743 Bacteria 1262
293 Ga0501083_0000158 3300049744 Bacteria 45063
294 Ga0501083_0009439 3300049744 Bacteria 6892
295 Ga0501083_0022503 3300049744 Bacteria 4373
296 Ga0501083_0288957 3300049744 Bacteria 1066
297 Ga0501035_0004328 3300049822 Bacteria 13477
298 Ga0501035_0010281 3300049822 Bacteria 8679
299 Ga0501035_0124805 3300049822 Bacteria 2248
300 Ga0501035_1123287 3300049822 Bacteria 613
301 Ga0501044_0001611 3300049823 Bacteria 26427
302 Ga0501044_0018383 3300049823 Bacteria 7489
303 Ga0501044_0069505 3300049823 Bacteria 3584
304 Ga0501044_0212060 3300049823 Bacteria 1890
305 nmdc:mga03n38_361183_c1 3300050490 Bacteria 792
306 nmdc:mga0yw44_555460_c1 3300050492 Bacteria 780
307 nmdc:mga05p37_1239865_c1 3300050507 Bacteria 766
308 nmdc:mga05p37_368284_c1 3300050507 Bacteria 1687
309 nmdc:mga0qj67_249785_c1 3300050509 Bacteria 1439
310 nmdc:mga0qj67_728654_c1 3300050509 Bacteria 788
311 nmdc:mga06r32_368270_c1 3300050510 Bacteria 1420
312 nmdc:mga0n895_275884_c1 3300050512 Bacteria 1705
313 nmdc:mga08x19_232708_c1 3300050514 Bacteria 1268
314 Ga0500646_0301057 3300053090 Bacteria 575
315 Ga0500562_000261 3300053108 Bacteria 13243
316 Ga0500642_0252385 3300053130 Bacteria 810
317 Ga0500604_0010435 3300053151 Bacteria 2487
318 Ga0500616_0002241 3300053153 Bacteria 16523
319 Ga0500616_0013215 3300053153 Bacteria 4804
320 Ga0500637_0221010 3300053178 Bacteria 1071
321 Ga0500656_021480 3300053732 Bacteria 803
322 Ga0500552_008172 3300053733 Bacteria 1229
323 Ga0501084_0004046 3300054114 Bacteria 11944
324 Ga0501084_0555351 3300054114 Bacteria 970
325 Ga0501084_1239026 3300054114 Bacteria 626
326 Ga0590074_015831 3300059423 Bacteria 1282
327 Ga0590075_052768 3300059424 Bacteria 1044
328 Ga0590077_037693 3300059426 Bacteria 1069
329 Ga0501082_0001437 3300060353 Bacteria 20929
330 Ga0501082_0282964 3300060353 Bacteria 1443
331 Ga0501082_0309707 3300060353 Bacteria 1375
332 Ga0501082_0726879 3300060353 Bacteria 869
333 Ga0501082_1285398 3300060353 Bacteria 639
334 2821444396 2821443989 Bacteria 7658172
335 2842335986 2842333319 Bacteria 8899485
336 2844535799 2844533157 Bacteria 7517899
337 2884215936 2884215851 Bacteria 4554841
338 Ga0105237_10348548
339 Ga0006778J45830_1008438
340 Ga0006759J45824_1004855
341 JGI25153J46596_10082802
342 Ga0007421J48921_108510
343 Ga0006758J48902_1005360
344 Ga0006770J48903_1016485
345 Ga0006777J48905_1009971
346 JGI25160J50197_1013411
347 Ga0007417J51691_1012848
348 Ga0007417J51691_1031640
349 Ga0007427J51700_107404
350 Ga0006781J51513_1008320
351 Ga0007410J51695_1007666
352 Ga0007410J51695_1018793
353 Ga0007409J51694_1011181
354 Ga0007416J51690_1008384
355 Ga0007429J51699_1014077
356 Ga0007411J51799_104790
357 Ga0007415J51800_110006
358 Ga0032354_1001133
359 Ga0006780_1012340
360 Ga0070669_100064333
361 Ga0070675_100271077
362 Ga0070674_100353928
363 Ga0070674_100662495
364 Ga0070667_100319872
365 Ga0070667_100748076
366 Ga0070705_100027948
367 Ga0068867_100971866
368 Ga0070685_10386161
369 Ga0070706_100046575
370 Ga0070698_100030639
371 Ga0070684_100051269
372 Ga0068853_100850804
373 Ga0068853_101258590
374 Ga0070695_100124065
375 Ga0070665_100770596
376 Ga0070704_100011638
377 Ga0068852_100543999
378 Ga0068864_101072577
379 Ga0068866_10037976
380 Ga0068861_100006794
381 Ga0068863_100151257
382 Ga0068858_101237270
383 Ga0068862_100817554
384 Ga0081538_10002009
385 Ga0081540_1091970
386 Ga0081539_10063782
387 Ga0075365_10300029
388 Ga0070712_100998505
389 Ga0075362_10014191
390 Ga0075362_10035764
391 Ga0075369_10280846
392 Ga0075370_10209043
393 Ga0068871_100951986
394 Ga0075428_100156803
395 Ga0075428_100818211
396 Ga0075430_100017725
397 Ga0075431_100119434
398 Ga0075431_100551798
399 Ga0075433_10272635
400 Ga0075434_100257739
401 Ga0075429_100438422
402 Ga0105240_10001937
403 Ga0105240_10345721
404 Ga0105240_10355226
405 Ga0114129_10530058
406 Ga0105242_10376832
407 Ga0105248_10165176
408 Ga0105237_10655117
409 Ga0105249_10636409
410 Ga0157370_10101939
411 Ga0157378_10817189
412 Ga0163162_10685784
413 Ga0163162_11052050
414 Ga0157372_10669230
415 Ga0157375_10050616
416 Ga0157375_10388961
417 Ga0163163_10480616
418 Ga0157380_10219246
419 Ga0157379_11400200
420 Ga0157376_10267386
421 Ga0197907_10782928
422 Ga0206352_10663921
423 Ga0224712_10058640
424 Ga0256714_100298
425 Ga0256714_105754
426 Ga0256744_100475
427 Ga0209130_1000422
428 Ga0209675_1000533
429 Ga0209025_1000053
430 Ga0209758_1002069
431 Ga0209050_1020921
432 Ga0207426_1000198
433 Ga0207642_10139220
434 Ga0207680_10143096
435 Ga0207684_10031565
436 Ga0207695_10019526
437 Ga0207681_10087574
438 Ga0207681_10234486
439 Ga0207681_10827798
440 Ga0207691_10150511
441 Ga0207711_10054695
442 Ga0207712_10255557
443 Ga0207658_10045145
444 Ga0207658_10524074
445 Ga0207639_10139189
446 Ga0207708_10625208
447 Ga0207641_11776443
448 Ga0207648_10772483
449 Ga0207676_11169345
450 Ga0207674_10037966
451 Ga0207674_10617396
452 Ga0207675_100003019
453 Ga0207675_101029980
454 Ga0207698_10946248
455 Ga0209967_1000608
456 Ga0210000_1014906
457 Ga0209995_1001296
458 Ga0209999_1000749
459 Ga0209983_1074739
460 Ga0209983_1088117
461 Ga0209971_1002737
462 Ga0209974_10012769
463 Ga0268266_10815313
464 Ga0268265_10089779
465 Ga0265337_1058267
466 Ga0307517_10206556
467 Ga0265338_10010835
468 Ga0265338_10568315
469 Ga0311000_110733
470 Ga0311004_130691
471 Ga0311004_142471
472 Ga0311001_1079123
473 Ga0311003_114296
474 Ga0310981_1007128
475 Ga0310981_1014463
476 Ga0310981_1054434
477 Ga0265762_1073805
478 Ga0265330_10168251
479 Ga0265332_10173774
480 Ga0265325_10226781
481 Ga0265331_10000716
482 Ga0265327_10000052
483 Ga0265316_10615410
484 Ga0307513_10005914
485 Ga0307513_10090617
486 Ga0307408_100113266
487 Ga0307408_100843448
488 Ga0307408_100897247
489 Ga0265313_10103540
490 Ga0307508_10016094
491 Ga0265314_10024980
492 Ga0307413_10043082
493 Ga0307413_11006305
494 Ga0307410_10061756
495 Ga0307406_10305188
496 Ga0307406_10782187
497 Ga0307406_11203079
498 Ga0307407_10004937
499 Ga0307407_10393954
500 Ga0307412_10981513
501 Ga0307409_100006276
502 Ga0307409_100887029
503 Ga0307416_100111512
504 Ga0307416_100249841
505 Ga0307416_100305223
506 Ga0307416_102203383
507 Ga0307414_11103027
508 Ga0307411_10142263
509 Ga0307411_10828502
510 Ga0307411_11343338
511 Ga0307415_100204403
512 Ga0307507_10081734
513 Ga0316596_1038058
514 Ga0373939_0097748
515 Ga0373960_0195430
516 Ga0373937_0446118
517 Ga0395905_0964251
518 Ga0395901_1362758
519 Ga0436360_0691360
520 Ga0436361_1089016
521 Ga0439465_0216977
522 Ga0439431_0046885
523 Ga0439433_0034877
524 Ga0439445_0124306
525 Ga0450923_008324
526 Ga0450898_010690
527 Ga0439446_0014302
528 Ga0450909_046829
529 Ga0439435_0037155
530 Ga0450918_009420
531 Ga0451576_0205839
532 Ga0466967_1209473
533 Ga0495638_0028182
534 Ga0495651_0658408
535 Ga0495580_0039416
536 Ga0495580_0226397
537 Ga0495610_0079674
538 Ga0495666_0108327
539 Ga0495586_0702760
540 Ga0495656_0157090
541 Ga0495657_0382056
542 Ga0495599_0332038
543 Ga0495669_0263006
544 Ga0495613_0248523
545 Ga0495649_0277801
546 Ga0495581_0047603
547 Ga0495675_0148420
548 Ga0495673_0252038
549 Ga0501306_009365
550 Ga0501306_018561
551 Ga0501310_055866
552 Ga0501305_054668
553 Ga0495682_0176718
554 Ga0501311_024757
555 Ga0501312_082942
556 Ga0501313_007134
557 Ga0501314_006543
558 Ga0501314_020534
559 Ga0501317_026332
560 Ga0501317_047794
561 Ga0501318_057063
562 Ga0501321_004571
563 Ga0501322_019065
564 Ga0501335_036173
565 Ga0501032_0002226
566 Ga0501032_0281323
567 Ga0501033_0002027
568 Ga0501033_0055721
569 Ga0501033_0076726
570 Ga0501033_0245333
571 Ga0501033_0621507
572 Ga0501033_0757064
573 Ga0501034_0003286
574 Ga0501036_0130543
575 Ga0501036_0673913
576 Ga0501037_0012672
577 Ga0501037_0028400
578 Ga0501037_0357939
579 Ga0501038_0007434
580 Ga0501038_0168187
581 Ga0501038_0189850
582 Ga0501038_0459156
583 Ga0501039_0016196
584 Ga0501042_0073787
585 Ga0501042_0615514
586 Ga0501043_0002665
587 Ga0501043_0210726
588 Ga0501046_0007756
589 Ga0501046_0394071
590 Ga0501047_0185818
591 Ga0501047_0366027
592 Ga0501048_0047537
593 Ga0501048_0276665
594 Ga0501068_0067302
595 Ga0501068_0095928
596 Ga0501068_0407362
597 Ga0501069_0002537
598 Ga0501069_0003489
599 Ga0501069_0041581
600 Ga0501069_0067061
601 Ga0501070_0000118
602 Ga0501070_0000410
603 Ga0501070_0001189
604 Ga0501070_0165605
605 Ga0501070_0185163
606 Ga0501070_0330018
607 Ga0501070_0357115
608 Ga0501070_0396484
609 Ga0501070_0698386
610 Ga0501072_0150729
611 Ga0501072_0425142
612 Ga0501073_0002428
613 Ga0501073_0018697
614 Ga0501073_0028265
615 Ga0501073_0048743
616 Ga0501073_0242162
617 Ga0501073_0617279
618 Ga0501074_0019817
619 Ga0501080_0001509
620 Ga0501080_0028522
621 Ga0501080_0043112
622 Ga0501080_0176513
623 Ga0501080_0215292
624 Ga0501080_0260823
625 Ga0501080_0365298
626 Ga0501080_0457799
627 Ga0501081_0079891
628 Ga0501081_0102053
629 Ga0501081_0262500
630 Ga0501083_0000158
631 Ga0501083_0009439
632 Ga0501083_0022503
633 Ga0501083_0288957
634 Ga0501035_0004328
635 Ga0501035_0010281
636 Ga0501035_0124805
637 Ga0501035_1123287
638 Ga0501044_0001611
639 Ga0501044_0018383
640 Ga0501044_0069505
641 Ga0501044_0212060
642 nmdc:mga03n38_361183_c1
643 nmdc:mga0yw44_555460_c1
644 nmdc:mga05p37_1239865_c1
645 nmdc:mga05p37_368284_c1
646 nmdc:mga0qj67_249785_c1
647 nmdc:mga0qj67_728654_c1
648 nmdc:mga06r32_368270_c1
649 nmdc:mga0n895_275884_c1
650 nmdc:mga08x19_232708_c1
651 Ga0500646_0301057
652 Ga0500562_000261
653 Ga0500642_0252385
654 Ga0500604_0010435
655 Ga0500616_0002241
656 Ga0500616_0013215
657 Ga0500637_0221010
658 Ga0500656_021480
659 Ga0500552_008172
660 Ga0501084_0004046
661 Ga0501084_0555351
662 Ga0501084_1239026
663 Ga0590074_015831
664 Ga0590075_052768
665 Ga0590077_037693
666 Ga0501082_0001437
667 Ga0501082_0282964
668 Ga0501082_0309707
669 Ga0501082_0726879
670 Ga0501082_1285398
671 2821444396
672 2842335986
673 2844535799
674 2884215936

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

29

163

0.98

PF08534

Redoxin

Redoxin

28

181

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5y63-assembly1.cif.gz_A crystal structure of enterococcus faecalis ahpc 0.956 1 161
3emp-assembly1.cif.gz_D-2 crystal structure of the s-acetanilide modified form of c165s ahpc 0.9511 4 161
4xs1-assembly1.cif.gz_D-2 salmonella typhimurium ahpc t43v mutant 0.949 2 161
5uka-assembly1.cif.gz_B salmonella typhimurium ahpc e49q mutant 0.947 2 161
4ql7-assembly1.cif.gz_D-2 crystal structure of c-terminus truncated alkylhydroperoxide reductase subunit c (ahpc1-172) from e. coli 0.9452 1 160
ID Description Score Start End Superfamily
2bmxC00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9249 1 160 3.40.30.10
5ijtA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9026 4 161 3.40.30.10
af_P9WQB7_4_193_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8982 2 178 3.40.30.10
5b8aJ00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8977 1 169 3.40.30.10
af_A0A0R4J2P7_61_260_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8937 1 174 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A534CL15-F1-model_v4 Alkyl hydroperoxide reductase C (EC 1.11.1.26) (Peroxiredoxin) 0.9807 1 106 GO:0005829
GO:0006979
GO:0008379
GO:0033554
GO:0042744
GO:0045454
AF-A0A3C2E313-F1-model_v4 Alkyl hydroperoxide reductase C (EC 1.11.1.26) (Peroxiredoxin) 0.974 60 164 GO:0005829
GO:0006979
GO:0008379
GO:0033554
GO:0042744
GO:0045454
AF-A0A4Q6CWX4-F1-model_v4 deleted 0.9734 1 127
AF-A0A534CL15-F1-model_v4 Alkyl hydroperoxide reductase C (EC 1.11.1.26) (Peroxiredoxin) 0.9717 1 106 GO:0005829
GO:0006979
GO:0008379
GO:0033554
GO:0042744
GO:0045454
AF-A0A356KLJ1-F1-model_v4 Thioredoxin domain-containing protein 0.9688 1 160 GO:0005829
GO:0006979
GO:0008379
GO:0033554
GO:0042744
GO:0045454

Map