F408656

General Info

Members Datasets Scaffolds Average Seq Length
327 240 655 119

Family's Representative Sequence

Representative Sequence 3300005434|Ga0070709_10515941|Ga0070709_105159412
Length 138
Sequence MPRVKRGTKRRARRKKLLKHAKGFFLTKGKLFRSAKEAVNRSLRYSYRDRRTRKRDYRTLWIQRIGAAARNNGITYSQLIHGLKASGIELDRKILADMAVRDAAGFTSLVESAKQHIAKAPAAAKAPKPEHPRHHDEG

Samples

Sample ID Description Type Environment
1 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
123 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
124 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
125 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
126 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
127 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
128 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
129 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
130 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
131 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
132 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
133 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
134 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
135 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
136 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
137 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
138 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
139 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
140 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
141 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
142 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
143 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
144 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
145 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
146 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
147 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
148 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
149 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
151 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
152 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
153 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
154 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
155 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
156 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
157 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
158 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
159 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
160 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
161 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
162 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
163 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
164 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
165 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
166 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
167 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
168 3300041444 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT Metatranscriptome Rhizoplane
169 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
170 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
171 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
172 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
173 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
174 3300041506 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT Metatranscriptome Unclassified
175 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
176 3300041510 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT Metatranscriptome Unclassified
177 3300041916 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT_extra_run Metatranscriptome Unclassified
178 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
179 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
180 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
181 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
182 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
183 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
184 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
185 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
186 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
187 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
188 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
189 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
190 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
191 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
192 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
193 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
194 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
195 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
210 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
211 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
212 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
213 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
214 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
215 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
216 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
217 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
218 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
219 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
220 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
221 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
222 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
223 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
224 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
225 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
226 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
227 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
230 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
231 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
232 2713897090 Paracoccus sphaerophysae HAMBI 3106 Isolate Nodule
233 2834578030 Paracoccus thiocyanatus SST Isolate Unclassified
234 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
235 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
236 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
237 3000017691 Rhodobacteraceae bacterium GH2-2 Isolate Rhizosphere
238 3000405567 Rhodobacteraceae bacterium LNNU 3342 Isolate Rhizosphere
239 8036736890 Flavobacterium dauae TCH3-2 Isolate Rhizosphere
240 8057132660 Paracoccus rhizosphaerae LMG 21293 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.69
Metatranscriptomes 8.56
Isolates 2.75

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.14
Nodule 0.31
Rhizoplane 3.06
Rhizosphere 85.32
Stem 0
Stem Tuber 0
Unclassified 11.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070709_10515941 3300005434 Bacteria 910
2 rootH1_10075538 3300003316 Bacteria 2397
3 rootH2_10026815 3300003320 Bacteria 11027
4 rootL2_10000797 3300003322 Bacteria 14731
5 rootL2_10010600 3300003322 Bacteria 6202
6 rootL2_10069194 3300003322 Bacteria 3752
7 rootL2_10230396 3300003322 Bacteria 7137
8 rootH1_10015133 3300003323 Bacteria 15106
9 rootH1_10098320 3300003316 Archaea 2923
10 rootH1_10098320 3300003323 Bacteria 6346
11 JGI26129J50193_1012138 3300003349 Bacteria 631
12 Ga0055531_10000223 3300003794 Bacteria 62728
13 Ga0058860_10009999 3300004801 Bacteria 2572
14 Ga0070658_10139946 3300005327 Bacteria 2021
15 Ga0070658_10529419 3300005327 Bacteria 1019
16 Ga0070683_100510510 3300005329 Bacteria 1149
17 Ga0070690_101632962 3300005330 Bacteria 523
18 Ga0070670_100051089 3300005331 Bacteria 3551
19 Ga0070680_100775900 3300005336 Bacteria 826
20 Ga0070682_101683731 3300005337 Bacteria 550
21 Ga0068868_102364547 3300005338 Unclassified 507
22 Ga0070660_100210067 3300005339 Bacteria 1580
23 Ga0070689_100876010 3300005340 Bacteria 793
24 Ga0070661_100011265 3300005344 Bacteria 6229
25 Ga0070692_10076757 3300005345 Bacteria 1791
26 Ga0070674_100723008 3300005356 Unclassified 853
27 Ga0070700_100439240 3300005441 Bacteria 990
28 Ga0070694_101348831 3300005444 Bacteria 601
29 Ga0070708_100859970 3300005445 Bacteria 852
30 Ga0070663_101822697 3300005455 Bacteria 546
31 Ga0070681_10472537 3300005458 Bacteria 1166
32 Ga0068867_101258209 3300005459 Unclassified 682
33 Ga0070706_100324035 3300005467 Bacteria 1437
34 Ga0070707_100126160 3300005468 Bacteria 2487
35 Ga0070698_100675072 3300005471 Bacteria 975
36 Ga0070698_101884987 3300005471 Bacteria 551
37 Ga0070699_100272526 3300005518 Bacteria 1515
38 Ga0070699_100289823 3300005518 Bacteria 1468
39 Ga0070679_100297964 3300005530 Bacteria 1563
40 Ga0070697_100186514 3300005536 Bacteria 1759
41 Ga0068853_100004773 3300005539 Bacteria 10536
42 Ga0070695_100033563 3300005545 Unclassified 3212
43 Ga0070695_100485189 3300005545 Bacteria 953
44 Ga0070695_101141423 3300005545 Bacteria 639
45 Ga0070693_100648546 3300005547 Bacteria 767
46 Ga0070665_100329574 3300005548 Bacteria 1531
47 Ga0070704_100986695 3300005549 Bacteria 761
48 Ga0068855_100127001 3300005563 Bacteria 2915
49 Ga0068855_101448036 3300005563 Bacteria 707
50 Ga0070664_100983356 3300005564 Bacteria 793
51 Ga0068857_100182758 3300005577 Bacteria 1908
52 Ga0068857_101252294 3300005577 Bacteria 719
53 Ga0068854_100023482 3300005578 Bacteria 4213
54 Ga0068854_101320965 3300005578 Bacteria 650
55 Ga0068854_101631956 3300005578 Bacteria 588
56 Ga0068856_100041566 3300005614 Bacteria 4519
57 Ga0068852_100023279 3300005616 Bacteria 4983
58 Ga0068859_100601915 3300005617 Unclassified 1192
59 Ga0068859_101359303 3300005617 Bacteria 783
60 Ga0068864_100389197 3300005618 Bacteria 1323
61 Ga0068864_100621887 3300005618 Bacteria 1050
62 Ga0068864_100635565 3300005618 Bacteria 1038
63 Ga0068851_10003679 3300005834 Bacteria 6844
64 Ga0068863_100167224 3300005841 Bacteria 2109
65 Ga0068863_100173322 3300005841 Bacteria 2070
66 Ga0068860_100326211 3300005843 Bacteria 1507
67 Ga0068860_101016216 3300005843 Unclassified 847
68 Ga0068862_100720217 3300005844 Bacteria 968
69 Ga0068862_101412302 3300005844 Bacteria 700
70 Ga0081538_10024293 3300005981 Bacteria 4321
71 Ga0070717_10914747 3300006028 Bacteria 799
72 Ga0070716_101429653 3300006173 Unclassified 563
73 Ga0097621_100047293 3300006237 Bacteria 3486
74 Ga0068871_102228990 3300006358 Unclassified 522
75 Ga0075431_101692202 3300006847 Bacteria 590
76 Ga0075433_10341749 3300006852 Bacteria 1323
77 Ga0075434_100328787 3300006871 Bacteria 1549
78 Ga0075434_100543881 3300006871 Bacteria 1181
79 Ga0075429_100613232 3300006880 Unclassified 953
80 Ga0075436_100547993 3300006914 Bacteria 849
81 Ga0097620_100601830 3300006931 Unclassified 1192
82 Ga0097620_101359311 3300006931 Bacteria 783
83 Ga0075435_101955670 3300007076 Bacteria 515
84 Ga0105240_10184739 3300009093 Bacteria 2457
85 Ga0105240_10653467 3300009093 Bacteria 1152
86 Ga0111539_10006568 3300009094 Bacteria 14987
87 Ga0111539_12827574 3300009094 Bacteria 562
88 Ga0105245_12699101 3300009098 Bacteria 550
89 Ga0105243_10191060 3300009148 Bacteria 1789
90 Ga0105248_10200098 3300009177 Bacteria 2251
91 Ga0105249_10682756 3300009553 Bacteria 1086
92 Ga0105239_10932868 3300010375 Bacteria 997
93 Ga0105239_11593522 3300010375 Bacteria 755
94 Ga0157370_10000615 3300013104 Bacteria 44268
95 Ga0157370_10231814 3300013104 Bacteria 1709
96 Ga0157370_11873674 3300013104 Unclassified 538
97 Ga0157378_10762053 3300013297 Bacteria 991
98 Ga0163162_10123790 3300013306 Bacteria 2691
99 Ga0163162_12690008 3300013306 Bacteria 573
100 Ga0157372_11235011 3300013307 Bacteria 863
101 Ga0157375_10389497 3300013308 Bacteria 1560
102 Ga0157380_10003590 3300014326 Bacteria 10674
103 Ga0157380_10106527 3300014326 Bacteria 2346
104 Ga0157380_10577734 3300014326 Bacteria 1108
105 Ga0182008_10244133 3300014497 Bacteria 925
106 Ga0157379_10804965 3300014968 Bacteria 887
107 Ga0157379_12340814 3300014968 Bacteria 532
108 Ga0163161_10102522 3300017792 Bacteria 2131
109 Ga0163161_10748081 3300017792 Bacteria 818
110 Ga0206356_10764017 3300020070 Bacteria 633
111 Ga0206353_10192625 3300020082 Bacteria 1118
112 Ga0224712_10133994 3300022467 Bacteria 1084
113 Ga0209257_1000005 3300025304 Bacteria 1592528
114 Ga0207656_10095241 3300025321 Bacteria 1357
115 Ga0207692_10363160 3300025898 Unclassified 895
116 Ga0207680_11034815 3300025903 Bacteria 588
117 Ga0207705_10251634 3300025909 Bacteria 1348
118 Ga0207705_11384794 3300025909 Bacteria 535
119 Ga0207684_10170846 3300025910 Bacteria 1874
120 Ga0207654_10114897 3300025911 Bacteria 1681
121 Ga0207707_10251942 3300025912 Bacteria 1534
122 Ga0207695_10124075 3300025913 Bacteria 2547
123 Ga0207695_10278316 3300025913 Bacteria 1567
124 Ga0207663_10895035 3300025916 Bacteria 709
125 Ga0207660_10305737 3300025917 Bacteria 1267
126 Ga0207660_11027982 3300025917 Bacteria 672
127 Ga0207657_10179667 3300025919 Bacteria 1711
128 Ga0207649_10002345 3300025920 Bacteria 10610
129 Ga0207652_10395204 3300025921 Bacteria 1248
130 Ga0207646_10980188 3300025922 Bacteria 747
131 Ga0207646_11173870 3300025922 Bacteria 674
132 Ga0207694_10038228 3300025924 Bacteria 3690
133 Ga0207650_10068254 3300025925 Bacteria 2669
134 Ga0207670_10599313 3300025936 Bacteria 904
135 Ga0207670_10641862 3300025936 Bacteria 875
136 Ga0207669_10852644 3300025937 Bacteria 758
137 Ga0207665_11222936 3300025939 Unclassified 599
138 Ga0207711_10475509 3300025941 Bacteria 1164
139 Ga0207661_11163283 3300025944 Bacteria 710
140 Ga0207667_10303439 3300025949 Bacteria 1631
141 Ga0207668_10290436 3300025972 Bacteria 1345
142 Ga0207640_10049881 3300025981 Bacteria 2712
143 Ga0207639_10018380 3300026041 Bacteria 4966
144 Ga0207678_11648850 3300026067 Bacteria 564
145 Ga0207708_10948467 3300026075 Bacteria 746
146 Ga0207708_11457338 3300026075 Bacteria 601
147 Ga0207702_10059336 3300026078 Bacteria 3259
148 Ga0207641_10020409 3300026088 Bacteria 5442
149 Ga0207641_10091432 3300026088 Unclassified 2663
150 Ga0207648_10043002 3300026089 Bacteria 3968
151 Ga0207648_10595000 3300026089 Bacteria 1019
152 Ga0207676_11924425 3300026095 Unclassified 590
153 Ga0207674_10046319 3300026116 Bacteria 4465
154 Ga0207674_10209820 3300026116 Bacteria 1897
155 Ga0207698_10019270 3300026142 Bacteria 4668
156 Ga0209995_1001962 3300027471 Bacteria 3221
157 Ga0209971_1013789 3300027682 Bacteria 1915
158 Ga0209998_10009045 3300027717 Bacteria 2063
159 Ga0209974_10027521 3300027876 Bacteria 1881
160 Ga0207428_10005431 3300027907 Bacteria 11887
161 Ga0207428_10024271 3300027907 Bacteria 5094
162 Ga0207428_10229095 3300027907 Bacteria 1391
163 Ga0268266_10610670 3300028379 Bacteria 1048
164 Ga0268264_10317974 3300028381 Bacteria 1471
165 Ga0307515_10156052 3300028794 Bacteria 2355
166 Ga0316181_1124607 3300030744 Bacteria 745
167 Ga0316182_1344331 3300030745 Bacteria 630
168 Ga0265760_10265274 3300031090 Bacteria 599
169 Ga0265320_10111178 3300031240 Bacteria 1255
170 Ga0265320_10139598 3300031240 Unclassified 1098
171 Ga0265325_10032158 3300031241 Bacteria 2803
172 Ga0265325_10062753 3300031241 Bacteria 1882
173 Ga0265329_10050788 3300031242 Unclassified 1321
174 Ga0265340_10074363 3300031247 Bacteria 1607
175 Ga0265339_10207672 3300031249 Bacteria 963
176 Ga0265331_10066732 3300031250 Bacteria 1689
177 Ga0265327_10214336 3300031251 Unclassified 868
178 Ga0265316_10052063 3300031344 Bacteria 3213
179 Ga0265316_10325717 3300031344 Unclassified 1115
180 Ga0307509_10224740 3300031507 Bacteria 1686
181 Ga0265313_10097292 3300031595 Unclassified 1311
182 Ga0316575_10004995 3300031665 Bacteria 4693
183 Ga0316579_10224606 3300031691 Bacteria 908
184 Ga0265314_10330408 3300031711 Unclassified 845
185 Ga0265342_10433724 3300031712 Bacteria 676
186 Ga0316578_10626240 3300031728 Bacteria 629
187 Ga0316577_10047310 3300031733 Bacteria 2402
188 Ga0316577_10129366 3300031733 Bacteria 1421
189 Ga0307413_10981853 3300031824 Bacteria 723
190 Ga0307416_100260697 3300032002 Bacteria 1694
191 Ga0307414_10003742 3300032004 Bacteria 8166
192 Ga0307414_10026130 3300032004 Bacteria 3753
193 Ga0307414_10735217 3300032004 Bacteria 896
194 Ga0316583_10006368 3300032133 Bacteria 4236
195 Ga0316585_10014228 3300032137 Bacteria 2376
196 Ga0316580_10124203 3300032139 Bacteria 790
197 Ga0316593_10065844 3300032168 Bacteria 1246
198 Ga0316593_10240568 3300032168 Bacteria 675
199 Ga0316593_10254411 3300032168 Bacteria 658
200 Ga0316593_10258605 3300032168 Bacteria 653
201 Ga0316593_10287767 3300032168 Bacteria 620
202 Ga0316592_1175793 3300033524 Bacteria 511
203 Ga0316588_1001144 3300033528 Bacteria 4208
204 Ga0373930_0113889 3300034816 Bacteria 653
205 Ga0373939_0146722 3300035114 Bacteria 855
206 Ga0373955_0648644 3300035172 Bacteria 647
207 Ga0373931_0133088 3300035691 Bacteria 1433
208 Ga0373931_0136360 3300035691 Bacteria 1417
209 Ga0373927_0013464 3300035695 Bacteria 5435
210 Ga0373933_0117219 3300035724 Bacteria 1665
211 Ga0373937_0221467 3300036401 Bacteria 1781
212 Ga0373937_0726992 3300036401 Bacteria 940
213 Ga0316582_0073212 3300036647 Bacteria 2223
214 Ga0316582_0263103 3300036647 Bacteria 1183
215 Ga0316584_0027603 3300036712 Bacteria 4179
216 Ga0316584_0052916 3300036712 Bacteria 3037
217 Ga0436364_1029426 3300037853 Bacteria 2926
218 Ga0395901_0051647 3300038443 Bacteria 4275
219 Ga0400483_005301 3300039062 Bacteria 3021
220 Ga0400483_091982 3300039062 Bacteria 1350
221 Ga0400483_149744 3300039062 Bacteria 1283
222 Ga0400483_192549 3300039062 Bacteria 3163
223 Ga0400483_209438 3300039062 Bacteria 2129
224 Ga0436365_1735207 3300039437 Unclassified 693
225 Ga0436360_0989193 3300039438 Bacteria 727
226 Ga0436361_0430208 3300039447 Bacteria 970
227 Ga0436363_0270127 3300039450 Bacteria 583
228 Ga0451789_0682187 3300041443 Unclassified 1219
229 Ga0451790_07132 3300041444 Bacteria 649
230 Ga0451798_0227980 3300041458 Unclassified 939
231 Ga0451805_006867 3300041461 Bacteria 585
232 Ga0451807_2105430 3300041486 Bacteria 1072
233 Ga0451837_0132719 3300041494 Bacteria 527
234 Ga0451837_1755060 3300041494 Bacteria 1644
235 Ga0451849_1500547 3300041505 Bacteria 949
236 Ga0451850_25346 3300041506 Bacteria 538
237 Ga0451843_0026409 3300041509 Bacteria 674
238 Ga0451854_08974 3300041510 Bacteria 526
239 Ga0452271_29157 3300041916 Bacteria 962
240 Ga0451577_0000064 3300042876 Bacteria 262482
241 Ga0451577_0998616 3300042876 Bacteria 751
242 Ga0453683_0001605 3300044673 Bacteria 19094
243 Ga0453683_0003649 3300044673 Bacteria 11286
244 Ga0453683_0020824 3300044673 Bacteria 4189
245 Ga0466964_0036075 3300044706 Bacteria 1981
246 Ga0453684_0000061 3300044712 Bacteria 489946
247 Ga0453684_0000954 3300044712 Bacteria 95326
248 Ga0453684_0031217 3300044712 Bacteria 7495
249 Ga0453684_0053491 3300044712 Bacteria 5269
250 Ga0453684_0058526 3300044712 Bacteria 4977
251 Ga0453684_0315858 3300044712 Bacteria 1771
252 Ga0451576_0000343 3300045051 Bacteria 112185
253 Ga0451576_0001271 3300045051 Bacteria 44253
254 Ga0451576_0003332 3300045051 Bacteria 22247
255 Ga0451576_0109133 3300045051 Unclassified 2879
256 Ga0451576_0210248 3300045051 Bacteria 2032
257 Ga0451576_0739293 3300045051 Bacteria 1033
258 Ga0451576_1349530 3300045051 Bacteria 743
259 Ga0495594_0441712 3300046499 Bacteria 740
260 Ga0495606_0019797 3300046507 Bacteria 4986
261 Ga0495608_0425800 3300046511 Unclassified 810
262 Ga0495630_0890032 3300046517 Bacteria 678
263 Ga0495587_0321130 3300046536 Unclassified 865
264 Ga0495581_0807763 3300047315 Bacteria 538
265 Ga0496111_0202150 3300048914 Bacteria 1477
266 Ga0496112_0613445 3300048915 Bacteria 1019
267 Ga0496114_1524531 3300048917 Bacteria 556
268 Ga0496115_0135415 3300048918 Bacteria 2031
269 Ga0496115_0161220 3300048918 Bacteria 1853
270 Ga0496125_0000031 3300048928 Bacteria 365156
271 Ga0496126_0402358 3300048929 Bacteria 1110
272 Ga0501306_035009 3300049127 Bacteria 760
273 Ga0501305_054661 3300049161 Bacteria 677
274 Ga0501313_018411 3300049529 Bacteria 848
275 Ga0501319_013732 3300049535 Bacteria 675
276 Ga0501320_060203 3300049536 Bacteria 533
277 Ga0501324_022864 3300049540 Bacteria 648
278 Ga0501335_023312 3300049551 Bacteria 671
279 Ga0501336_012611 3300049552 Bacteria 699
280 Ga0501034_0000161 3300049571 Bacteria 126011
281 Ga0501034_0690158 3300049571 Bacteria 920
282 Ga0501034_0788892 3300049571 Unclassified 843
283 Ga0501039_0605258 3300049575 Unclassified 859
284 Ga0501040_0065504 3300049576 Bacteria 2502
285 Ga0501043_0682502 3300049579 Bacteria 752
286 Ga0501047_0223228 3300049581 Bacteria 1740
287 Ga0501048_0526230 3300049582 Unclassified 848
288 Ga0501068_0500687 3300049584 Unclassified 788
289 Ga0501069_0255714 3300049585 Bacteria 1022
290 Ga0501071_0898720 3300049587 Unclassified 683
291 Ga0501074_1097597 3300049590 Bacteria 559
292 Ga0501074_1215714 3300049590 Unclassified 528
293 Ga0501077_0635124 3300049593 Unclassified 686
294 Ga0501080_0031691 3300049742 Bacteria 4926
295 Ga0501080_0420262 3300049742 Bacteria 1201
296 Ga0501280_100196 3300049776 Bacteria 556
297 Ga0501045_0458016 3300049824 Unclassified 948
298 nmdc:mga06r32_970897_c1 3300050510 Bacteria 803
299 nmdc:mga08y16_1042479_c1 3300050511 Unclassified 796
300 nmdc:mga08y16_1584_c1 3300050511 Bacteria 22956
301 nmdc:mga08y16_326884_c1 3300050511 Bacteria 1578
302 nmdc:mga08y16_34092_c1 3300050511 Bacteria 5347
303 nmdc:mga08y16_64708_c1 3300050511 Bacteria 3818
304 nmdc:mga0n895_807904_c1 3300050512 Bacteria 928
305 nmdc:mga08x19_460206_c1 3300050514 Bacteria 896
306 nmdc:mga08x19_753191_c1 3300050514 Bacteria 691
307 Ga0500578_0331327 3300053086 Bacteria 895
308 Ga0500641_0000352 3300053096 Bacteria 17154
309 Ga0500618_005061 3300053125 Bacteria 4067
310 Ga0500588_0060276 3300053146 Unclassified 1214
311 Ga0500636_0002049 3300053177 Bacteria 11109
312 Ga0501084_0514253 3300054114 Bacteria 1012
313 Ga0587085_139189 3300059506 Bacteria 550
314 Ga0587095_017030 3300059514 Bacteria 671
315 Ga0587108_014148 3300059653 Bacteria 707
316 Ga0501082_0323740 3300060353 Bacteria 1343
317 Ga0530510_0793784 3300061734 Bacteria 722
318 Ga0530510_1116067 3300061734 Unclassified 604
319 Ga0530510_1466940 3300061734 Unclassified 524
320 2715499037 2713897090 Bacteria 3353799
321 2834579893 2834578030 Bacteria 3530182
322 2840882704 2840878972 Bacteria 5483153
323 2854685368 2854681122 Bacteria 4548679
324 2899276561 2899275550 Bacteria 3958688
325 3000019900 3000017691 Bacteria 3772574
326 3000406764 3000405567 Bacteria 3779330
327 8036737959 8036736890 Bacteria 2944828
328 8057133953 8057132660 Bacteria 4061191
329 Ga0070709_10515941
330 rootH1_10075538
331 rootH2_10026815
332 rootL2_10000797
333 rootL2_10010600
334 rootL2_10069194
335 rootL2_10230396
336 rootH1_10015133
337 rootH1_10098320
338 JGI26129J50193_1012138
339 Ga0055531_10000223
340 Ga0058860_10009999
341 Ga0070658_10139946
342 Ga0070658_10529419
343 Ga0070683_100510510
344 Ga0070690_101632962
345 Ga0070670_100051089
346 Ga0070680_100775900
347 Ga0070682_101683731
348 Ga0068868_102364547
349 Ga0070660_100210067
350 Ga0070689_100876010
351 Ga0070661_100011265
352 Ga0070692_10076757
353 Ga0070674_100723008
354 Ga0070700_100439240
355 Ga0070694_101348831
356 Ga0070708_100859970
357 Ga0070663_101822697
358 Ga0070681_10472537
359 Ga0068867_101258209
360 Ga0070706_100324035
361 Ga0070707_100126160
362 Ga0070698_100675072
363 Ga0070698_101884987
364 Ga0070699_100272526
365 Ga0070699_100289823
366 Ga0070679_100297964
367 Ga0070697_100186514
368 Ga0068853_100004773
369 Ga0070695_100033563
370 Ga0070695_100485189
371 Ga0070695_101141423
372 Ga0070693_100648546
373 Ga0070665_100329574
374 Ga0070704_100986695
375 Ga0068855_100127001
376 Ga0068855_101448036
377 Ga0070664_100983356
378 Ga0068857_100182758
379 Ga0068857_101252294
380 Ga0068854_100023482
381 Ga0068854_101320965
382 Ga0068854_101631956
383 Ga0068856_100041566
384 Ga0068852_100023279
385 Ga0068859_100601915
386 Ga0068859_101359303
387 Ga0068864_100389197
388 Ga0068864_100621887
389 Ga0068864_100635565
390 Ga0068851_10003679
391 Ga0068863_100167224
392 Ga0068863_100173322
393 Ga0068860_100326211
394 Ga0068860_101016216
395 Ga0068862_100720217
396 Ga0068862_101412302
397 Ga0081538_10024293
398 Ga0070717_10914747
399 Ga0070716_101429653
400 Ga0097621_100047293
401 Ga0068871_102228990
402 Ga0075431_101692202
403 Ga0075433_10341749
404 Ga0075434_100328787
405 Ga0075434_100543881
406 Ga0075429_100613232
407 Ga0075436_100547993
408 Ga0097620_100601830
409 Ga0097620_101359311
410 Ga0075435_101955670
411 Ga0105240_10184739
412 Ga0105240_10653467
413 Ga0111539_10006568
414 Ga0111539_12827574
415 Ga0105245_12699101
416 Ga0105243_10191060
417 Ga0105248_10200098
418 Ga0105249_10682756
419 Ga0105239_10932868
420 Ga0105239_11593522
421 Ga0157370_10000615
422 Ga0157370_10231814
423 Ga0157370_11873674
424 Ga0157378_10762053
425 Ga0163162_10123790
426 Ga0163162_12690008
427 Ga0157372_11235011
428 Ga0157375_10389497
429 Ga0157380_10003590
430 Ga0157380_10106527
431 Ga0157380_10577734
432 Ga0182008_10244133
433 Ga0157379_10804965
434 Ga0157379_12340814
435 Ga0163161_10102522
436 Ga0163161_10748081
437 Ga0206356_10764017
438 Ga0206353_10192625
439 Ga0224712_10133994
440 Ga0209257_1000005
441 Ga0207656_10095241
442 Ga0207692_10363160
443 Ga0207680_11034815
444 Ga0207705_10251634
445 Ga0207705_11384794
446 Ga0207684_10170846
447 Ga0207654_10114897
448 Ga0207707_10251942
449 Ga0207695_10124075
450 Ga0207695_10278316
451 Ga0207663_10895035
452 Ga0207660_10305737
453 Ga0207660_11027982
454 Ga0207657_10179667
455 Ga0207649_10002345
456 Ga0207652_10395204
457 Ga0207646_10980188
458 Ga0207646_11173870
459 Ga0207694_10038228
460 Ga0207650_10068254
461 Ga0207670_10599313
462 Ga0207670_10641862
463 Ga0207669_10852644
464 Ga0207665_11222936
465 Ga0207711_10475509
466 Ga0207661_11163283
467 Ga0207667_10303439
468 Ga0207668_10290436
469 Ga0207640_10049881
470 Ga0207639_10018380
471 Ga0207678_11648850
472 Ga0207708_10948467
473 Ga0207708_11457338
474 Ga0207702_10059336
475 Ga0207641_10020409
476 Ga0207641_10091432
477 Ga0207648_10043002
478 Ga0207648_10595000
479 Ga0207676_11924425
480 Ga0207674_10046319
481 Ga0207674_10209820
482 Ga0207698_10019270
483 Ga0209995_1001962
484 Ga0209971_1013789
485 Ga0209998_10009045
486 Ga0209974_10027521
487 Ga0207428_10005431
488 Ga0207428_10024271
489 Ga0207428_10229095
490 Ga0268266_10610670
491 Ga0268264_10317974
492 Ga0307515_10156052
493 Ga0316181_1124607
494 Ga0316182_1344331
495 Ga0265760_10265274
496 Ga0265320_10111178
497 Ga0265320_10139598
498 Ga0265325_10032158
499 Ga0265325_10062753
500 Ga0265329_10050788
501 Ga0265340_10074363
502 Ga0265339_10207672
503 Ga0265331_10066732
504 Ga0265327_10214336
505 Ga0265316_10052063
506 Ga0265316_10325717
507 Ga0307509_10224740
508 Ga0265313_10097292
509 Ga0316575_10004995
510 Ga0316579_10224606
511 Ga0265314_10330408
512 Ga0265342_10433724
513 Ga0316578_10626240
514 Ga0316577_10047310
515 Ga0316577_10129366
516 Ga0307413_10981853
517 Ga0307416_100260697
518 Ga0307414_10003742
519 Ga0307414_10026130
520 Ga0307414_10735217
521 Ga0316583_10006368
522 Ga0316585_10014228
523 Ga0316580_10124203
524 Ga0316593_10065844
525 Ga0316593_10240568
526 Ga0316593_10254411
527 Ga0316593_10258605
528 Ga0316593_10287767
529 Ga0316592_1175793
530 Ga0316588_1001144
531 Ga0373930_0113889
532 Ga0373939_0146722
533 Ga0373955_0648644
534 Ga0373931_0133088
535 Ga0373931_0136360
536 Ga0373927_0013464
537 Ga0373933_0117219
538 Ga0373937_0221467
539 Ga0373937_0726992
540 Ga0316582_0073212
541 Ga0316582_0263103
542 Ga0316584_0027603
543 Ga0316584_0052916
544 Ga0436364_1029426
545 Ga0395901_0051647
546 Ga0400483_005301
547 Ga0400483_091982
548 Ga0400483_149744
549 Ga0400483_192549
550 Ga0400483_209438
551 Ga0436365_1735207
552 Ga0436360_0989193
553 Ga0436361_0430208
554 Ga0436363_0270127
555 Ga0451789_0682187
556 Ga0451790_07132
557 Ga0451798_0227980
558 Ga0451805_006867
559 Ga0451807_2105430
560 Ga0451837_0132719
561 Ga0451837_1755060
562 Ga0451849_1500547
563 Ga0451850_25346
564 Ga0451843_0026409
565 Ga0451854_08974
566 Ga0452271_29157
567 Ga0451577_0000064
568 Ga0451577_0998616
569 Ga0453683_0001605
570 Ga0453683_0003649
571 Ga0453683_0020824
572 Ga0466964_0036075
573 Ga0453684_0000061
574 Ga0453684_0000954
575 Ga0453684_0031217
576 Ga0453684_0053491
577 Ga0453684_0058526
578 Ga0453684_0315858
579 Ga0451576_0000343
580 Ga0451576_0001271
581 Ga0451576_0003332
582 Ga0451576_0109133
583 Ga0451576_0210248
584 Ga0451576_0739293
585 Ga0451576_1349530
586 Ga0495594_0441712
587 Ga0495606_0019797
588 Ga0495608_0425800
589 Ga0495630_0890032
590 Ga0495587_0321130
591 Ga0495581_0807763
592 Ga0496111_0202150
593 Ga0496112_0613445
594 Ga0496114_1524531
595 Ga0496115_0135415
596 Ga0496115_0161220
597 Ga0496125_0000031
598 Ga0496126_0402358
599 Ga0501306_035009
600 Ga0501305_054661
601 Ga0501313_018411
602 Ga0501319_013732
603 Ga0501320_060203
604 Ga0501324_022864
605 Ga0501335_023312
606 Ga0501336_012611
607 Ga0501034_0000161
608 Ga0501034_0690158
609 Ga0501034_0788892
610 Ga0501039_0605258
611 Ga0501040_0065504
612 Ga0501043_0682502
613 Ga0501047_0223228
614 Ga0501048_0526230
615 Ga0501068_0500687
616 Ga0501069_0255714
617 Ga0501071_0898720
618 Ga0501074_1097597
619 Ga0501074_1215714
620 Ga0501077_0635124
621 Ga0501080_0031691
622 Ga0501080_0420262
623 Ga0501280_100196
624 Ga0501045_0458016
625 nmdc:mga06r32_970897_c1
626 nmdc:mga08y16_1042479_c1
627 nmdc:mga08y16_1584_c1
628 nmdc:mga08y16_326884_c1
629 nmdc:mga08y16_34092_c1
630 nmdc:mga08y16_64708_c1
631 nmdc:mga0n895_807904_c1
632 nmdc:mga08x19_460206_c1
633 nmdc:mga08x19_753191_c1
634 Ga0500578_0331327
635 Ga0500641_0000352
636 Ga0500618_005061
637 Ga0500588_0060276
638 Ga0500636_0002049
639 Ga0501084_0514253
640 Ga0587085_139189
641 Ga0587095_017030
642 Ga0587108_014148
643 Ga0501082_0323740
644 Ga0530510_0793784
645 Ga0530510_1116067
646 Ga0530510_1466940
647 2715499037
648 2834579893
649 2840882704
650 2854685368
651 2899276561
652 3000019900
653 3000406764
654 8036737959
655 8057133953

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00453

Ribosomal_L20

Ribosomal protein L20

3

109

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1gyz-assembly1.cif.gz_A bacterial ribosomal protein l20 from aquifex aeolicus 0.8854 61 114
4v48-assembly1.cif.gz_AO real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the initiation-like state of e. coli 70s ribosome 0.8585 51 113
2ghj-assembly1.cif.gz_A crystal structure of folded and partially unfolded forms of aquifex aeolicus ribosomal protein l20 0.8155 21 113
6z1p-assembly1.cif.gz_Au structure of the mitochondrial ribosome from tetrahymena thermophila 0.8018 14 113
8apo-assembly1.cif.gz_Ao structure of the mitochondrial ribosome from polytomella magna with trnas bound to the a and p sites 0.7989 14 114
ID Description Score Start End Superfamily
2ghjD02 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain 0.9633 53 113 1.10.1900.20
2ghjB02 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain 0.9147 58 113 1.10.1900.20
1gyzA00 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain 0.8854 61 114 1.10.1900.20
2ghjD02 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain 0.8417 53 113 1.10.1900.20
1gyzA00 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain 0.7944 61 114 1.10.1900.20
ID Description Score Start End GO Terms
AF-A0A7Y3CE09-F1-model_v4 Large ribosomal subunit protein bL20 (50S ribosomal protein L20) 1 45 114 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A0L8V9X0-F1-model_v4 Large ribosomal subunit protein bL20 (50S ribosomal protein L20) 0.9936 44 114 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A519RZ15-F1-model_v4 50S ribosomal protein L20 0.9853 42 114 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A0F6SFS5-F1-model_v4 50S ribosomal protein L20 0.9851 43 114 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A7Y3CE09-F1-model_v4 Large ribosomal subunit protein bL20 (50S ribosomal protein L20) 0.9722 45 114 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Map