F399058

General Info

Members Datasets Scaffolds Average Seq Length
307 204 614 171

Family's Representative Sequence

Representative Sequence 3300005456|Ga0070678_100530851|Ga0070678_1005308512
Length 185
Sequence MIRVRADSIAVADIRKSTVSCTLDQFAAACHRILAADSGLEGRKRVRAFLGEVCSDEAFVATYLDDHLPIRQILYEDPELGFCIVGHVEQNSRQSRPHDHGPTWAIYGQAAGETVMSDWVIVSPPPGKGLPGKARRVSDYTLTPGSAQVYNEGDVHSPRRNGPTRLLRIEGRNLEHICSTFFEPI

Samples

Sample ID Description Type Environment
1 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
2 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
8 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
11 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
30 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
57 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
58 3300019183 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
59 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
62 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
68 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
69 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
70 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
89 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
91 3300030836 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
92 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
93 3300030877 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
94 3300030888 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
95 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
96 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
97 3300032120 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
99 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
100 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
101 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
102 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
103 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
104 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
105 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
106 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
107 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
108 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
109 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
110 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
111 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
112 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
113 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
114 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
115 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
116 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
117 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
118 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
119 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
120 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
121 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
122 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
123 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
124 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
125 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
126 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
127 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
128 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
129 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
130 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
131 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
132 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
133 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
134 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
135 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
136 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
137 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
142 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
143 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
144 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
145 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
146 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
147 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
148 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
149 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
150 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
151 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
152 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
153 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
154 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
155 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
156 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
157 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
158 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
159 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300059609 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 227R_SD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300059629 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 186R_SW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300059631 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300059656 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 153R_AW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300059659 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 157R_AD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300060243 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 1R_CW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
204 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 66.12
Metatranscriptomes 33.55
Isolates 0.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.95
Rhizosphere 90.55
Stem 0
Stem Tuber 0
Unclassified 18.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070678_100530851 3300005456 Unclassified 1042
2 Ga0007417J51691_1059005 3300003544 Bacteria 828
3 Ga0007410J51695_1093714 3300003574 Bacteria 711
4 Ga0007416J51690_1112845 3300003577 Bacteria 1084
5 Ga0007429J51699_1091118 3300003579 Bacteria 1123
6 Ga0006780_1042861 3300003735 Bacteria 833
7 Ga0058859_10052661 3300004798 Bacteria 709
8 Ga0058859_11362354 3300004798 Unclassified 831
9 Ga0058859_11767143 3300004798 Bacteria 694
10 Ga0058863_11633547 3300004799 Unclassified 780
11 Ga0058863_11810378 3300004799 Unclassified 1059
12 Ga0058861_11718723 3300004800 Unclassified 782
13 Ga0058860_10002141 3300004801 Bacteria 866
14 Ga0058860_12131740 3300004801 Bacteria 1173
15 Ga0058862_10127204 3300004803 Unclassified 1022
16 Ga0058862_10234108 3300004803 Unclassified 683
17 Ga0058862_12683838 3300004803 Bacteria 678
18 Ga0070671_100288525 3300005355 Unclassified 1396
19 Ga0070709_10051259 3300005434 Bacteria 2589
20 Ga0070714_100008614 3300005435 Bacteria 7981
21 Ga0070714_100411774 3300005435 Bacteria 1280
22 Ga0070714_100881298 3300005435 Unclassified 869
23 Ga0070713_100013899 3300005436 Bacteria 5959
24 Ga0070711_100025808 3300005439 Bacteria 3846
25 Ga0068867_100707140 3300005459 Bacteria 890
26 Ga0070706_100290474 3300005467 Bacteria 1526
27 Ga0070707_100088410 3300005468 Bacteria 2997
28 Ga0070698_100317185 3300005471 Bacteria 1489
29 Ga0070699_100139512 3300005518 Bacteria 2140
30 Ga0070696_100428210 3300005546 Bacteria 1040
31 Ga0068857_100513391 3300005577 Bacteria 1126
32 Ga0068852_100528131 3300005616 Bacteria 1178
33 Ga0068862_100475345 3300005844 Bacteria 1182
34 Ga0081455_10282284 3300005937 Bacteria 1199
35 Ga0081539_10003231 3300005985 Bacteria 20543
36 Ga0070717_10135193 3300006028 Bacteria 2123
37 Ga0070717_10919465 3300006028 Unclassified 796
38 Ga0075432_10036079 3300006058 Bacteria 1719
39 Ga0070716_100556006 3300006173 Bacteria 856
40 Ga0070712_100444914 3300006175 Unclassified 1078
41 Ga0068871_101609566 3300006358 Bacteria 615
42 Ga0075428_100000714 3300006844 Bacteria 34372
43 Ga0075428_100180186 3300006844 Bacteria 2287
44 Ga0075428_100293143 3300006844 Bacteria 1750
45 Ga0075428_101279426 3300006844 Bacteria 772
46 Ga0075430_100000013 3300006846 Bacteria 93627
47 Ga0075431_100003364 3300006847 Bacteria 15501
48 Ga0075431_100003617 3300006847 Bacteria 14981
49 Ga0075433_10012476 3300006852 Bacteria 6868
50 Ga0075433_10054508 3300006852 Bacteria 3489
51 Ga0075433_10085802 3300006852 Bacteria 2780
52 Ga0075433_10110257 3300006852 Bacteria 2441
53 Ga0075433_10147125 3300006852 Bacteria 2094
54 Ga0075434_100073583 3300006871 Bacteria 3409
55 Ga0075434_100102576 3300006871 Unclassified 2868
56 Ga0075429_100000062 3300006880 Bacteria 52895
57 Ga0075429_100006561 3300006880 Bacteria 10074
58 Ga0075429_100406078 3300006880 Unclassified 1193
59 Ga0075436_100328254 3300006914 Bacteria 1100
60 Ga0075435_100047203 3300007076 Bacteria 3457
61 Ga0075435_100254224 3300007076 Bacteria 1496
62 Ga0075435_101499065 3300007076 Unclassified 591
63 Ga0099794_10193034 3300007265 Unclassified 1042
64 Ga0105240_10638018 3300009093 Bacteria 1169
65 Ga0111539_10002338 3300009094 Bacteria 25243
66 Ga0111539_10133767 3300009094 Bacteria 2903
67 Ga0111539_10468941 3300009094 Bacteria 1466
68 Ga0111539_11420273 3300009094 Bacteria 805
69 Ga0114129_10020149 3300009147 Bacteria 9492
70 Ga0114129_10023440 3300009147 Bacteria 8751
71 Ga0114129_10077943 3300009147 Bacteria 4609
72 Ga0114129_10294736 3300009147 Bacteria 2164
73 Ga0114129_11505754 3300009147 Bacteria 827
74 Ga0105243_10396020 3300009148 Bacteria 1281
75 Ga0105248_10388206 3300009177 Bacteria 1572
76 Ga0105237_11038128 3300009545 Bacteria 826
77 Ga0105249_10646698 3300009553 Bacteria 1115
78 Ga0099796_10131536 3300010159 Bacteria 970
79 Ga0105239_10021611 3300010375 Bacteria 7095
80 Ga0105239_11833842 3300010375 Bacteria 703
81 Ga0157371_10146481 3300013102 Bacteria 1683
82 Ga0157369_11706502 3300013105 Unclassified 640
83 Ga0157369_11931701 3300013105 Bacteria 599
84 Ga0157374_10943690 3300013296 Unclassified 881
85 Ga0163162_10213838 3300013306 Unclassified 2058
86 Ga0163162_10976298 3300013306 Bacteria 957
87 Ga0163162_11950956 3300013306 Unclassified 672
88 Ga0157372_10241999 3300013307 Bacteria 2094
89 Ga0182008_10044273 3300014497 Bacteria 2213
90 Ga0182008_10120822 3300014497 Unclassified 1302
91 Ga0163161_10318233 3300017792 Bacteria 1229
92 Ga0184601_118899 3300019183 Bacteria 814
93 Ga0184601_140074 3300019183 Unclassified 631
94 Ga0197907_10113045 3300020069 Bacteria 766
95 Ga0197907_10405005 3300020069 Bacteria 1013
96 Ga0197907_11475669 3300020069 Bacteria 938
97 Ga0206349_1554268 3300020075 Bacteria 591
98 Ga0206349_1845784 3300020075 Bacteria 1137
99 Ga0206355_1066820 3300020076 Bacteria 812
100 Ga0206355_1122976 3300020076 Bacteria 801
101 Ga0206351_10255307 3300020077 Unclassified 1071
102 Ga0206351_10688190 3300020077 Bacteria 637
103 Ga0206352_10049373 3300020078 Bacteria 1180
104 Ga0206352_10356851 3300020078 Unclassified 1031
105 Ga0206352_10519499 3300020078 Bacteria 594
106 Ga0206352_10569752 3300020078 Bacteria 1097
107 Ga0206352_11200002 3300020078 Bacteria 613
108 Ga0206350_10434662 3300020080 Bacteria 1154
109 Ga0206350_10530763 3300020080 Bacteria 721
110 Ga0206350_10657606 3300020080 Bacteria 1196
111 Ga0206354_10185388 3300020081 Bacteria 699
112 Ga0206353_10076150 3300020082 Bacteria 1849
113 Ga0154015_1165588 3300020610 Unclassified 685
114 Ga0154015_1310146 3300020610 Unclassified 1355
115 Ga0213876_10165276 3300021384 Bacteria 1177
116 Ga0213875_10000392 3300021388 Bacteria 38933
117 Ga0213875_10001400 3300021388 Bacteria 15723
118 Ga0213875_10267036 3300021388 Unclassified 807
119 Ga0213875_10280131 3300021388 Unclassified 787
120 Ga0224712_10117039 3300022467 Unclassified 1150
121 Ga0224712_10118205 3300022467 Bacteria 1145
122 Ga0224712_10213445 3300022467 Unclassified 881
123 Ga0224712_10302686 3300022467 Bacteria 748
124 Ga0207692_10338461 3300025898 Bacteria 925
125 Ga0207647_10455568 3300025904 Bacteria 717
126 Ga0207684_10955539 3300025910 Unclassified 718
127 Ga0207693_10165485 3300025915 Unclassified 1741
128 Ga0207646_10018992 3300025922 Bacteria 6400
129 Ga0207700_10149314 3300025928 Unclassified 1930
130 Ga0207664_10166345 3300025929 Bacteria 1884
131 Ga0207664_10182173 3300025929 Bacteria 1804
132 Ga0207706_10078717 3300025933 Bacteria 2899
133 Ga0207665_10182305 3300025939 Bacteria 1521
134 Ga0207711_10374023 3300025941 Bacteria 1321
135 Ga0207651_11137614 3300025960 Unclassified 700
136 Ga0207702_10152496 3300026078 Bacteria 2103
137 Ga0207702_10691718 3300026078 Bacteria 1005
138 Ga0207648_10601023 3300026089 Bacteria 1014
139 Ga0207683_10394244 3300026121 Unclassified 1273
140 Ga0209588_1090949 3300027671 Unclassified 983
141 Ga0209966_1092519 3300027695 Unclassified 678
142 Ga0209974_10030881 3300027876 Bacteria 1774
143 Ga0207428_10000063 3300027907 Bacteria 151868
144 Ga0207428_10082579 3300027907 Bacteria 2507
145 Ga0268265_10039764 3300028380 Bacteria 3468
146 Ga0265338_10015274 3300028800 Bacteria 8453
147 Ga0265338_10688932 3300028800 Unclassified 706
148 Ga0265767_113242 3300030836 Unclassified 577
149 Ga0265766_1008084 3300030863 Bacteria 718
150 Ga0265777_112646 3300030877 Unclassified 638
151 Ga0265769_108109 3300030888 Bacteria 687
152 Ga0265320_10299609 3300031240 Unclassified 711
153 Ga0307411_10242638 3300032005 Bacteria 1412
154 Ga0316053_115744 3300032120 Bacteria 565
155 Ga0373926_0102332 3300035083 Bacteria 1072
156 Ga0373943_0459386 3300035170 Unclassified 741
157 Ga0373935_0042192 3300035692 Unclassified 2868
158 Ga0373927_0070597 3300035695 Unclassified 2261
159 Ga0373933_0247492 3300035724 Bacteria 1147
160 Ga0373947_0185992 3300035725 Bacteria 1354
161 Ga0265778_008319 3300036457 Unclassified 1152
162 Ga0265778_011059 3300036457 Unclassified 1035
163 Ga0265778_023184 3300036457 Bacteria 776
164 Ga0373925_0018762 3300037068 Bacteria 5028
165 Ga0395899_0392176 3300037312 Bacteria 920
166 Ga0395900_0198491 3300037418 Bacteria 2031
167 Ga0395898_0008711 3300037466 Bacteria 10704
168 Ga0436364_0492851 3300037853 Bacteria 1867
169 Ga0436364_0593069 3300037853 Bacteria 62407
170 Ga0436364_0942989 3300037853 Unclassified 1252
171 Ga0436364_1008322 3300037853 Unclassified 985
172 Ga0436364_1077301 3300037853 Bacteria 703
173 Ga0436364_1135983 3300037853 Bacteria 898
174 Ga0436364_1331333 3300037853 Bacteria 94585
175 Ga0395901_0006256 3300038443 Bacteria 12066
176 Ga0242420_021788 3300038996 Bacteria 1149
177 Ga0436365_0376409 3300039437 Bacteria 1283
178 Ga0436365_1265008 3300039437 Bacteria 1815
179 Ga0436365_1707153 3300039437 Bacteria 2061
180 Ga0436360_0401427 3300039438 Bacteria 1274
181 Ga0436360_1377787 3300039438 Bacteria 7589
182 Ga0436361_0030283 3300039447 Bacteria 4065
183 Ga0436361_1032301 3300039447 Bacteria 3050
184 Ga0436363_0163545 3300039450 Bacteria 1450
185 Ga0436363_0666390 3300039450 Bacteria 1074
186 Ga0436363_1427391 3300039450 Bacteria 3029
187 Ga0436362_0072576 3300039453 Bacteria 1868
188 Ga0450890_026141 3300042127 Unclassified 812
189 Ga0450898_051616 3300042134 Bacteria 795
190 Ga0450909_063150 3300042185 Bacteria 587
191 Ga0439460_0170060 3300042461 Bacteria 733
192 Ga0451577_0055773 3300042876 Bacteria 3524
193 Ga0453683_0043662 3300044673 Bacteria 2813
194 Ga0453684_0040899 3300044712 Bacteria 6283
195 Ga0451576_0128054 3300045051 Bacteria 2645
196 Ga0451576_0175606 3300045051 Bacteria 2236
197 Ga0466958_0479972 3300045836 Bacteria 806
198 Ga0495664_0290357 3300046477 Bacteria 988
199 Ga0495664_0630544 3300046477 Unclassified 636
200 Ga0495640_0339994 3300046533 Bacteria 928
201 Ga0495667_0883571 3300046559 Unclassified 549
202 Ga0495635_0094005 3300046663 Bacteria 2050
203 Ga0495647_0118640 3300046681 Bacteria 1111
204 Ga0495602_0020672 3300048088 Bacteria 6502
205 Ga0496103_0270945 3300048906 Bacteria 1092
206 Ga0496107_0222378 3300048910 Unclassified 1405
207 Ga0496108_0680807 3300048911 Bacteria 893
208 Ga0496112_0855115 3300048915 Bacteria 833
209 Ga0496114_0182485 3300048917 Bacteria 1833
210 Ga0496114_1118262 3300048917 Bacteria 673
211 Ga0501038_0052765 3300049574 Bacteria 3504
212 Ga0501039_0185512 3300049575 Bacteria 1636
213 Ga0501039_0266108 3300049575 Bacteria 1347
214 Ga0501041_0126587 3300049577 Bacteria 1590
215 Ga0501042_0049389 3300049578 Bacteria 3001
216 Ga0501042_0367689 3300049578 Archaea 1041
217 Ga0501072_0048197 3300049588 Bacteria 3355
218 Ga0501074_0934158 3300049590 Bacteria 610
219 Ga0501075_0085937 3300049591 Bacteria 2383
220 Ga0501076_0464329 3300049592 Bacteria 1042
221 Ga0501079_0011543 3300049741 Bacteria 6744
222 Ga0501079_0122058 3300049741 Bacteria 2026
223 Ga0501081_0033629 3300049743 Bacteria 3485
224 Ga0501035_0566395 3300049822 Bacteria 929
225 nmdc:mga05p37_24221_c1 3300050507 Bacteria 7376
226 nmdc:mga05p37_281772_c1 3300050507 Bacteria 1982
227 nmdc:mga05p37_35537_c1 3300050507 Bacteria 6110
228 nmdc:mga05p37_79190_c1 3300050507 Bacteria 4047
229 nmdc:mga05p37_931834_c1 3300050507 Archaea 932
230 nmdc:mga09592_11565_c1 3300050508 Bacteria 7178
231 nmdc:mga09592_51091_c1 3300050508 Bacteria 3487
232 nmdc:mga0qj67_162493_c1 3300050509 Bacteria 1813
233 nmdc:mga0qj67_313734_c1 3300050509 Bacteria 1270
234 nmdc:mga06r32_54221_c1 3300050510 Bacteria 3844
235 nmdc:mga08y16_10380_c1 3300050511 Bacteria 9770
236 nmdc:mga08y16_271409_c1 3300050511 Bacteria 1751
237 nmdc:mga08y16_54612_c1 3300050511 Bacteria 4174
238 nmdc:mga0n895_191668_c1 3300050512 Unclassified 1103
239 nmdc:mga0n895_43713_c1 3300050512 Bacteria 4367
240 nmdc:mga0rr50_1319572_c1 3300050513 Unclassified 612
241 nmdc:mga0rr50_13561_c1 3300050513 Bacteria 5312
242 nmdc:mga0rr50_181842_c1 3300050513 Bacteria 1719
243 nmdc:mga08x19_445508_c1 3300050514 Bacteria 911
244 nmdc:mga08x19_98820_c1 3300050514 Unclassified 1934
245 nmdc:mga0a205_12118_c1 3300050515 Bacteria 7969
246 nmdc:mga0a205_13562_c1 3300050515 Bacteria 7592
247 nmdc:mga0a205_150659_c1 3300050515 Bacteria 2226
248 nmdc:mga0a205_3176_c1 3300050515 Bacteria 14590
249 nmdc:mga0a205_94451_c1 3300050515 Bacteria 2889
250 Ga0495655_0051054 3300053083 Unclassified 1095
251 Ga0501084_0157130 3300054114 Bacteria 1918
252 Ga0587093_007379 3300059478 Bacteria 1225
253 Ga0587066_007165 3300059490 Bacteria 1501
254 Ga0587066_032617 3300059490 Bacteria 938
255 Ga0587070_010568 3300059491 Bacteria 1363
256 Ga0587073_0010911 3300059492 Bacteria 1539
257 Ga0587077_013208 3300059493 Bacteria 1335
258 Ga0587077_158225 3300059493 Bacteria 597
259 Ga0587080_018910 3300059503 Bacteria 1111
260 Ga0587082_131306 3300059504 Unclassified 576
261 Ga0587086_005967 3300059507 Bacteria 1340
262 Ga0587086_055900 3300059507 Bacteria 647
263 Ga0587088_007675 3300059508 Bacteria 1501
264 Ga0587088_023047 3300059508 Bacteria 1055
265 Ga0587089_004932 3300059509 Bacteria 1491
266 Ga0587090_028114 3300059510 Bacteria 924
267 Ga0587091_012139 3300059511 Bacteria 1358
268 Ga0587092_009062 3300059512 Bacteria 1330
269 Ga0587092_044582 3300059512 Bacteria 783
270 Ga0587094_005536 3300059513 Bacteria 1479
271 Ga0587095_005594 3300059514 Bacteria 954
272 Ga0587106_022531 3300059605 Bacteria 947
273 Ga0587125_008674 3300059607 Bacteria 1014
274 Ga0587131_004508 3300059609 Bacteria 843
275 Ga0587101_019660 3300059623 Bacteria 959
276 Ga0587101_056438 3300059623 Unclassified 690
277 Ga0587113_005092 3300059625 Bacteria 1071
278 Ga0587115_013397 3300059626 Bacteria 1061
279 Ga0587127_003569 3300059629 Bacteria 994
280 Ga0587128_005657 3300059630 Bacteria 1505
281 Ga0587130_009219 3300059631 Bacteria 947
282 Ga0587130_027049 3300059631 Bacteria 646
283 Ga0587062_004431 3300059639 Bacteria 1490
284 Ga0587067_046239 3300059640 Bacteria 864
285 Ga0587068_022263 3300059641 Bacteria 1049
286 Ga0587069_009527 3300059642 Bacteria 1257
287 Ga0587072_011812 3300059643 Bacteria 1433
288 Ga0587075_007986 3300059644 Bacteria 1342
289 Ga0587076_022767 3300059645 Bacteria 1050
290 Ga0587078_004111 3300059646 Bacteria 1509
291 Ga0587079_014008 3300059647 Bacteria 1339
292 Ga0587100_018100 3300059648 Bacteria 666
293 Ga0587102_003594 3300059649 Bacteria 1272
294 Ga0587107_005724 3300059652 Bacteria 1328
295 Ga0587107_041520 3300059652 Bacteria 745
296 Ga0587110_021376 3300059654 Bacteria 735
297 Ga0587114_010607 3300059655 Bacteria 1130
298 Ga0587116_11288 3300059656 Bacteria 608
299 Ga0587119_006647 3300059658 Bacteria 1224
300 Ga0587120_005496 3300059659 Bacteria 975
301 Ga0587060_016819 3300060243 Bacteria 672
302 Ga0587071_013750 3300060344 Bacteria 1399
303 Ga0587111_0033919 3300060346 Unclassified 1057
304 Ga0530510_0093905 3300061734 Bacteria 2191
305 Ga0530510_0098179 3300061734 Bacteria 2142
306 Ga0530510_0235699 3300061734 Bacteria 1362
307 2894776377 2894772417 Bacteria 5305674
308 Ga0070678_100530851
309 Ga0007417J51691_1059005
310 Ga0007410J51695_1093714
311 Ga0007416J51690_1112845
312 Ga0007429J51699_1091118
313 Ga0006780_1042861
314 Ga0058859_10052661
315 Ga0058859_11362354
316 Ga0058859_11767143
317 Ga0058863_11633547
318 Ga0058863_11810378
319 Ga0058861_11718723
320 Ga0058860_10002141
321 Ga0058860_12131740
322 Ga0058862_10127204
323 Ga0058862_10234108
324 Ga0058862_12683838
325 Ga0070671_100288525
326 Ga0070709_10051259
327 Ga0070714_100008614
328 Ga0070714_100411774
329 Ga0070714_100881298
330 Ga0070713_100013899
331 Ga0070711_100025808
332 Ga0068867_100707140
333 Ga0070706_100290474
334 Ga0070707_100088410
335 Ga0070698_100317185
336 Ga0070699_100139512
337 Ga0070696_100428210
338 Ga0068857_100513391
339 Ga0068852_100528131
340 Ga0068862_100475345
341 Ga0081455_10282284
342 Ga0081539_10003231
343 Ga0070717_10135193
344 Ga0070717_10919465
345 Ga0075432_10036079
346 Ga0070716_100556006
347 Ga0070712_100444914
348 Ga0068871_101609566
349 Ga0075428_100000714
350 Ga0075428_100180186
351 Ga0075428_100293143
352 Ga0075428_101279426
353 Ga0075430_100000013
354 Ga0075431_100003364
355 Ga0075431_100003617
356 Ga0075433_10012476
357 Ga0075433_10054508
358 Ga0075433_10085802
359 Ga0075433_10110257
360 Ga0075433_10147125
361 Ga0075434_100073583
362 Ga0075434_100102576
363 Ga0075429_100000062
364 Ga0075429_100006561
365 Ga0075429_100406078
366 Ga0075436_100328254
367 Ga0075435_100047203
368 Ga0075435_100254224
369 Ga0075435_101499065
370 Ga0099794_10193034
371 Ga0105240_10638018
372 Ga0111539_10002338
373 Ga0111539_10133767
374 Ga0111539_10468941
375 Ga0111539_11420273
376 Ga0114129_10020149
377 Ga0114129_10023440
378 Ga0114129_10077943
379 Ga0114129_10294736
380 Ga0114129_11505754
381 Ga0105243_10396020
382 Ga0105248_10388206
383 Ga0105237_11038128
384 Ga0105249_10646698
385 Ga0099796_10131536
386 Ga0105239_10021611
387 Ga0105239_11833842
388 Ga0157371_10146481
389 Ga0157369_11706502
390 Ga0157369_11931701
391 Ga0157374_10943690
392 Ga0163162_10213838
393 Ga0163162_10976298
394 Ga0163162_11950956
395 Ga0157372_10241999
396 Ga0182008_10044273
397 Ga0182008_10120822
398 Ga0163161_10318233
399 Ga0184601_118899
400 Ga0184601_140074
401 Ga0197907_10113045
402 Ga0197907_10405005
403 Ga0197907_11475669
404 Ga0206349_1554268
405 Ga0206349_1845784
406 Ga0206355_1066820
407 Ga0206355_1122976
408 Ga0206351_10255307
409 Ga0206351_10688190
410 Ga0206352_10049373
411 Ga0206352_10356851
412 Ga0206352_10519499
413 Ga0206352_10569752
414 Ga0206352_11200002
415 Ga0206350_10434662
416 Ga0206350_10530763
417 Ga0206350_10657606
418 Ga0206354_10185388
419 Ga0206353_10076150
420 Ga0154015_1165588
421 Ga0154015_1310146
422 Ga0213876_10165276
423 Ga0213875_10000392
424 Ga0213875_10001400
425 Ga0213875_10267036
426 Ga0213875_10280131
427 Ga0224712_10117039
428 Ga0224712_10118205
429 Ga0224712_10213445
430 Ga0224712_10302686
431 Ga0207692_10338461
432 Ga0207647_10455568
433 Ga0207684_10955539
434 Ga0207693_10165485
435 Ga0207646_10018992
436 Ga0207700_10149314
437 Ga0207664_10166345
438 Ga0207664_10182173
439 Ga0207706_10078717
440 Ga0207665_10182305
441 Ga0207711_10374023
442 Ga0207651_11137614
443 Ga0207702_10152496
444 Ga0207702_10691718
445 Ga0207648_10601023
446 Ga0207683_10394244
447 Ga0209588_1090949
448 Ga0209966_1092519
449 Ga0209974_10030881
450 Ga0207428_10000063
451 Ga0207428_10082579
452 Ga0268265_10039764
453 Ga0265338_10015274
454 Ga0265338_10688932
455 Ga0265767_113242
456 Ga0265766_1008084
457 Ga0265777_112646
458 Ga0265769_108109
459 Ga0265320_10299609
460 Ga0307411_10242638
461 Ga0316053_115744
462 Ga0373926_0102332
463 Ga0373943_0459386
464 Ga0373935_0042192
465 Ga0373927_0070597
466 Ga0373933_0247492
467 Ga0373947_0185992
468 Ga0265778_008319
469 Ga0265778_011059
470 Ga0265778_023184
471 Ga0373925_0018762
472 Ga0395899_0392176
473 Ga0395900_0198491
474 Ga0395898_0008711
475 Ga0436364_0492851
476 Ga0436364_0593069
477 Ga0436364_0942989
478 Ga0436364_1008322
479 Ga0436364_1077301
480 Ga0436364_1135983
481 Ga0436364_1331333
482 Ga0395901_0006256
483 Ga0242420_021788
484 Ga0436365_0376409
485 Ga0436365_1265008
486 Ga0436365_1707153
487 Ga0436360_0401427
488 Ga0436360_1377787
489 Ga0436361_0030283
490 Ga0436361_1032301
491 Ga0436363_0163545
492 Ga0436363_0666390
493 Ga0436363_1427391
494 Ga0436362_0072576
495 Ga0450890_026141
496 Ga0450898_051616
497 Ga0450909_063150
498 Ga0439460_0170060
499 Ga0451577_0055773
500 Ga0453683_0043662
501 Ga0453684_0040899
502 Ga0451576_0128054
503 Ga0451576_0175606
504 Ga0466958_0479972
505 Ga0495664_0290357
506 Ga0495664_0630544
507 Ga0495640_0339994
508 Ga0495667_0883571
509 Ga0495635_0094005
510 Ga0495647_0118640
511 Ga0495602_0020672
512 Ga0496103_0270945
513 Ga0496107_0222378
514 Ga0496108_0680807
515 Ga0496112_0855115
516 Ga0496114_0182485
517 Ga0496114_1118262
518 Ga0501038_0052765
519 Ga0501039_0185512
520 Ga0501039_0266108
521 Ga0501041_0126587
522 Ga0501042_0049389
523 Ga0501042_0367689
524 Ga0501072_0048197
525 Ga0501074_0934158
526 Ga0501075_0085937
527 Ga0501076_0464329
528 Ga0501079_0011543
529 Ga0501079_0122058
530 Ga0501081_0033629
531 Ga0501035_0566395
532 nmdc:mga05p37_24221_c1
533 nmdc:mga05p37_281772_c1
534 nmdc:mga05p37_35537_c1
535 nmdc:mga05p37_79190_c1
536 nmdc:mga05p37_931834_c1
537 nmdc:mga09592_11565_c1
538 nmdc:mga09592_51091_c1
539 nmdc:mga0qj67_162493_c1
540 nmdc:mga0qj67_313734_c1
541 nmdc:mga06r32_54221_c1
542 nmdc:mga08y16_10380_c1
543 nmdc:mga08y16_271409_c1
544 nmdc:mga08y16_54612_c1
545 nmdc:mga0n895_191668_c1
546 nmdc:mga0n895_43713_c1
547 nmdc:mga0rr50_1319572_c1
548 nmdc:mga0rr50_13561_c1
549 nmdc:mga0rr50_181842_c1
550 nmdc:mga08x19_445508_c1
551 nmdc:mga08x19_98820_c1
552 nmdc:mga0a205_12118_c1
553 nmdc:mga0a205_13562_c1
554 nmdc:mga0a205_150659_c1
555 nmdc:mga0a205_3176_c1
556 nmdc:mga0a205_94451_c1
557 Ga0495655_0051054
558 Ga0501084_0157130
559 Ga0587093_007379
560 Ga0587066_007165
561 Ga0587066_032617
562 Ga0587070_010568
563 Ga0587073_0010911
564 Ga0587077_013208
565 Ga0587077_158225
566 Ga0587080_018910
567 Ga0587082_131306
568 Ga0587086_005967
569 Ga0587086_055900
570 Ga0587088_007675
571 Ga0587088_023047
572 Ga0587089_004932
573 Ga0587090_028114
574 Ga0587091_012139
575 Ga0587092_009062
576 Ga0587092_044582
577 Ga0587094_005536
578 Ga0587095_005594
579 Ga0587106_022531
580 Ga0587125_008674
581 Ga0587131_004508
582 Ga0587101_019660
583 Ga0587101_056438
584 Ga0587113_005092
585 Ga0587115_013397
586 Ga0587127_003569
587 Ga0587128_005657
588 Ga0587130_009219
589 Ga0587130_027049
590 Ga0587062_004431
591 Ga0587067_046239
592 Ga0587068_022263
593 Ga0587069_009527
594 Ga0587072_011812
595 Ga0587075_007986
596 Ga0587076_022767
597 Ga0587078_004111
598 Ga0587079_014008
599 Ga0587100_018100
600 Ga0587102_003594
601 Ga0587107_005724
602 Ga0587107_041520
603 Ga0587110_021376
604 Ga0587114_010607
605 Ga0587116_11288
606 Ga0587119_006647
607 Ga0587120_005496
608 Ga0587060_016819
609 Ga0587071_013750
610 Ga0587111_0033919
611 Ga0530510_0093905
612 Ga0530510_0098179
613 Ga0530510_0235699
614 2894776377

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pfw-assembly1.cif.gz_B crystal structure of a rmlc-like cupin (sfri_3105) from shewanella frigidimarina ncimb 400 at 1.90 a resolution 0.8974 53 151
5fq0-assembly1.cif.gz_A the structure of kdgf from halomonas sp. 0.8649 53 151
3d82-assembly1.cif.gz_E crystal structure of a cupin-2 domain containing protein (sfri_3543) from shewanella frigidimarina ncimb 400 at 2.05 a resolution 0.8623 53 150
5fq0-assembly2.cif.gz_D the structure of kdgf from halomonas sp. 0.86 53 151
8awp-assembly1.cif.gz_A crystal structure of a manganese-containing cupin (tm1459) from thermotoga maritima, variant 208 (v19i/r23h/m38i/i60f/c106q) 0.8555 53 151
ID Description Score Start End Superfamily
af_P17410_9_96_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8578 64 151 2.60.120.10
af_A0A1D6L414_250_358_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8504 53 151 2.60.120.10
3myxA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8462 53 151 2.60.120.10
af_E7FAC3_1039_1126_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8381 53 151 2.60.120.10
5fpxA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8329 53 151 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A7C2YD17-F1-model_v4 Cysteine dioxygenase 0.9837 1 166
AF-A0A3B9FG26-F1-model_v4 Cysteine dioxygenase 0.9828 52 166
AF-A0A2T0XBH9-F1-model_v4 Cysteine dioxygenase 0.9805 1 167
AF-A0A849FME4-F1-model_v4 Uncharacterized protein 0.9798 29 166
AF-A0A2T0XBH9-F1-model_v4 Cysteine dioxygenase 0.9747 1 167

Map