F398174
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 305 | 216 | 300 | 208 |
Family's Representative Sequence
| Representative Sequence | 3300028577|Ga0265318_10143310|Ga0265318_101433102 |
| Length | 239 |
| Sequence | MQAPLHRTRIKICGLTREQDIDAAVHAGADAVGFVMYRASPRHVTVARAAELARRLPPFVTPVLLFVNETAPTVIAARAAVAGAVIQFHGDETPEQCNAVGPSFIRAARIPLDAAAAGFDLVKYAQAYRQAQAILLDAHVEGYGGGGKTFNWSLISKSLTSDPAPTGAGLCPLVLSGGLTAANVIDGILQIRPWAVDVSSGVEASKGIKDPEKIHQFVAAVRLADERIAGLKNVRLPAT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 2 | 2643221577 | Rhodanobacter sp. Root627 | Isolate | Unclassified |
| 3 | 2643221685 | Rhodanobacter sp. Root480 | Isolate | Unclassified |
| 4 | 2687453130 | Dyella thiooxydans ATSB10 | Isolate | Unclassified |
| 5 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
| 6 | 2886848708 | Mitsuaria sp. TWR114 | Isolate | Rhizosphere |
| 7 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 8 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 9 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 10 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 11 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 12 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 13 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 14 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 15 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 16 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 17 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 18 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 19 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 20 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 21 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 22 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 23 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 24 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 25 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 26 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 27 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 28 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 45 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 46 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 47 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 48 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 49 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 50 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 51 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 52 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 53 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 54 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 55 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 57 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 58 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 60 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 61 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 70 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 75 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 77 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 84 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 85 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 88 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 91 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 92 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 94 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 114 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 117 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 120 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 121 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 122 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 123 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 124 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 125 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 126 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 127 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 128 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 129 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 130 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 131 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 132 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 133 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 134 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 135 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 136 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 137 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 138 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 139 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 140 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 141 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 142 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 143 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 144 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 145 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 146 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 147 | 3300044536 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E | Metagenome | Unclassified |
| 148 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 149 | 3300044663 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E_TR | Metagenome | Unclassified |
| 150 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 151 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 152 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 153 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 154 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 155 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 156 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 157 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 158 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 159 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 160 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 161 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 162 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 171 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 172 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 173 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 174 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 175 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 176 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 177 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 178 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 179 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 180 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 181 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 182 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 183 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 184 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 185 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 186 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 187 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 188 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 189 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 190 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 191 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 192 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 193 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 194 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 195 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 196 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 197 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 198 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 199 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 200 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 201 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 202 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 203 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 204 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 205 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 206 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 207 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 208 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 209 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 210 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 211 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 212 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 213 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 214 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 215 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 216 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.7 |
| Metatranscriptomes | 0.33 |
| Isolates | 1.97 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 24.59 |
| Nodule | 1.31 |
| Rhizoplane | 0.98 |
| Rhizosphere | 63.28 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.84 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25156J39149_1016013 | 3300002705 | Bacteria | 1476 |
| 2 | JGI25162J39368_1006056 | 3300002737 | Bacteria | 2178 |
| 3 | JGI25154J39366_1004852 | 3300002738 | Bacteria | 2284 |
| 4 | JGI25157J39369_1001473 | 3300002741 | Bacteria | 8720 |
| 5 | JGI25157J39369_1003405 | 3300002741 | Bacteria | 3270 |
| 6 | JGI25164J39214_1000587 | 3300002772 | Bacteria | 16308 |
| 7 | JGI25165J46597_1001159 | 3300003214 | Bacteria | 16326 |
| 8 | rootL2_10006461 | 3300003322 | Bacteria | 12808 |
| 9 | rootH1_10024766 | 3300003316 | Bacteria | 5634 |
| 10 | rootH1_10024766 | 3300003323 | Bacteria | 6031 |
| 11 | Ga0055539_1005625 | 3300003752 | Bacteria | 1622 |
| 12 | Ga0055539_1016633 | 3300003752 | Bacteria | 892 |
| 13 | Ga0055533_1006060 | 3300003756 | Bacteria | 1840 |
| 14 | Ga0055525_1000233 | 3300003759 | Bacteria | 58310 |
| 15 | Ga0055525_1000346 | 3300003759 | Bacteria | 33587 |
| 16 | Ga0055527_1000149 | 3300003760 | Bacteria | 49224 |
| 17 | Ga0055527_1000259 | 3300003760 | Bacteria | 32195 |
| 18 | Ga0055527_1000266 | 3300003760 | Bacteria | 31574 |
| 19 | Ga0055527_1006338 | 3300003760 | Bacteria | 1485 |
| 20 | Ga0055535_1000395 | 3300003761 | Bacteria | 41210 |
| 21 | Ga0055535_1000606 | 3300003761 | Bacteria | 29564 |
| 22 | Ga0055535_1000651 | 3300003761 | Bacteria | 27644 |
| 23 | Ga0055535_1001113 | 3300003761 | Bacteria | 16309 |
| 24 | Ga0055542_1000167 | 3300003762 | Bacteria | 83068 |
| 25 | Ga0055542_1000264 | 3300003762 | Bacteria | 58581 |
| 26 | Ga0055542_1000364 | 3300003762 | Bacteria | 47003 |
| 27 | Ga0055542_1008129 | 3300003762 | Bacteria | 2071 |
| 28 | Ga0055529_1000416 | 3300003763 | Bacteria | 43929 |
| 29 | Ga0055529_1000640 | 3300003763 | Bacteria | 25655 |
| 30 | Ga0055529_1000908 | 3300003763 | Bacteria | 16313 |
| 31 | Ga0055526_1001331 | 3300003771 | Bacteria | 17689 |
| 32 | Ga0055540_1018447 | 3300003792 | Bacteria | 1912 |
| 33 | Ga0055531_10005778 | 3300003794 | Bacteria | 7163 |
| 34 | Ga0055543_1002541 | 3300004625 | Bacteria | 5953 |
| 35 | Ga0058859_10043507 | 3300004798 | Bacteria | 1526 |
| 36 | Ga0065165_1000395 | 3300005262 | Bacteria | 70688 |
| 37 | Ga0065165_1000995 | 3300005262 | Bacteria | 34985 |
| 38 | Ga0070658_10235109 | 3300005327 | Bacteria | 1552 |
| 39 | Ga0070658_10372803 | 3300005327 | Bacteria | 1224 |
| 40 | Ga0070676_10024179 | 3300005328 | Bacteria | 3419 |
| 41 | Ga0070666_10000007 | 3300005335 | Bacteria | 293732 |
| 42 | Ga0070687_100331020 | 3300005343 | Bacteria | 976 |
| 43 | Ga0070661_100090668 | 3300005344 | Bacteria | 2264 |
| 44 | Ga0070668_100151328 | 3300005347 | Bacteria | 1877 |
| 45 | Ga0070668_100762213 | 3300005347 | Bacteria | 857 |
| 46 | Ga0070671_100020110 | 3300005355 | Bacteria | 5440 |
| 47 | Ga0070674_100080320 | 3300005356 | Bacteria | 2328 |
| 48 | Ga0070688_100611785 | 3300005365 | Bacteria | 835 |
| 49 | Ga0070667_100037500 | 3300005367 | Bacteria | 4063 |
| 50 | Ga0070700_100035822 | 3300005441 | Bacteria | 3006 |
| 51 | Ga0070663_100582984 | 3300005455 | Bacteria | 938 |
| 52 | Ga0070678_101017214 | 3300005456 | Bacteria | 762 |
| 53 | Ga0068867_100000005 | 3300005459 | Bacteria | 174097 |
| 54 | Ga0068853_100826189 | 3300005539 | Bacteria | 888 |
| 55 | Ga0070665_100000817 | 3300005548 | Bacteria | 40729 |
| 56 | Ga0068854_100020103 | 3300005578 | Bacteria | 4511 |
| 57 | Ga0068856_100002593 | 3300005614 | Bacteria | 18615 |
| 58 | Ga0068852_100003098 | 3300005616 | Bacteria | 11576 |
| 59 | Ga0068859_100083583 | 3300005617 | Bacteria | 3236 |
| 60 | Ga0068870_10022163 | 3300005840 | Bacteria | 3118 |
| 61 | Ga0068862_100260597 | 3300005844 | Bacteria | 1582 |
| 62 | Ga0081455_10103511 | 3300005937 | Bacteria | 2279 |
| 63 | Ga0081539_10003782 | 3300005985 | Bacteria | 17888 |
| 64 | Ga0075362_10033677 | 3300006177 | Bacteria | 2229 |
| 65 | Ga0075362_10060236 | 3300006177 | Bacteria | 1715 |
| 66 | Ga0075367_10093105 | 3300006178 | Bacteria | 1835 |
| 67 | Ga0075366_10017777 | 3300006195 | Bacteria | 4099 |
| 68 | Ga0097621_100075175 | 3300006237 | Bacteria | 2799 |
| 69 | Ga0075370_10007774 | 3300006353 | Bacteria | 5477 |
| 70 | Ga0075370_10044698 | 3300006353 | Bacteria | 2504 |
| 71 | Ga0068871_100066264 | 3300006358 | Bacteria | 2960 |
| 72 | Ga0097620_100083588 | 3300006931 | Bacteria | 3236 |
| 73 | Ga0099824_1043770 | 3300006942 | Bacteria | 987 |
| 74 | Ga0099823_1000985 | 3300006944 | Bacteria | 21888 |
| 75 | Ga0111539_10005820 | 3300009094 | Bacteria | 15939 |
| 76 | Ga0111539_10231417 | 3300009094 | Bacteria | 2152 |
| 77 | Ga0105247_10059414 | 3300009101 | Bacteria | 2367 |
| 78 | Ga0114129_10847373 | 3300009147 | Bacteria | 1162 |
| 79 | Ga0105243_10006176 | 3300009148 | Bacteria | 9263 |
| 80 | Ga0105237_10000595 | 3300009545 | Bacteria | 50470 |
| 81 | Ga0105238_10001931 | 3300009551 | Bacteria | 20819 |
| 82 | Ga0105238_10216353 | 3300009551 | Bacteria | 1892 |
| 83 | Ga0105249_10819678 | 3300009553 | Bacteria | 995 |
| 84 | Ga0105249_11377201 | 3300009553 | Unclassified | 777 |
| 85 | Ga0105246_10059714 | 3300011119 | Bacteria | 2646 |
| 86 | Ga0157319_1000006 | 3300012497 | Bacteria | 361506 |
| 87 | Ga0157370_10006616 | 3300013104 | Bacteria | 12736 |
| 88 | Ga0163162_10001668 | 3300013306 | Bacteria | 20833 |
| 89 | Ga0157375_11149778 | 3300013308 | Bacteria | 909 |
| 90 | Ga0157377_10000244 | 3300014745 | Bacteria | 27334 |
| 91 | Ga0183369_1009 | 3300015685 | Bacteria | 346348 |
| 92 | Ga0163161_10113330 | 3300017792 | Bacteria | 2029 |
| 93 | Ga0213872_10000647 | 3300021361 | Bacteria | 26348 |
| 94 | Ga0209674_100523 | 3300025226 | Bacteria | 15570 |
| 95 | Ga0209672_100007 | 3300025228 | Bacteria | 959482 |
| 96 | Ga0209672_100018 | 3300025228 | Bacteria | 432924 |
| 97 | Ga0209672_100198 | 3300025228 | Bacteria | 47906 |
| 98 | Ga0209672_100599 | 3300025228 | Bacteria | 18942 |
| 99 | Ga0209563_100071 | 3300025230 | Bacteria | 232653 |
| 100 | Ga0207427_100036 | 3300025231 | Bacteria | 309540 |
| 101 | Ga0209437_101013 | 3300025233 | Bacteria | 9710 |
| 102 | Ga0209258_100017 | 3300025242 | Bacteria | 590785 |
| 103 | Ga0209258_100024 | 3300025242 | Bacteria | 542096 |
| 104 | Ga0209258_100035 | 3300025242 | Bacteria | 430864 |
| 105 | Ga0209258_100379 | 3300025242 | Bacteria | 57256 |
| 106 | Ga0209258_112615 | 3300025242 | Bacteria | 1031 |
| 107 | Ga0209646_1001471 | 3300025246 | Bacteria | 6278 |
| 108 | Ga0209646_1005067 | 3300025246 | Bacteria | 2335 |
| 109 | Ga0209026_1000056 | 3300025250 | Bacteria | 236450 |
| 110 | Ga0209026_1000162 | 3300025250 | Bacteria | 102867 |
| 111 | Ga0209026_1000513 | 3300025250 | Bacteria | 27282 |
| 112 | Ga0209677_101331 | 3300025253 | Bacteria | 10857 |
| 113 | Ga0209677_106509 | 3300025253 | Bacteria | 2747 |
| 114 | Ga0209148_1000009 | 3300025254 | Bacteria | 1395625 |
| 115 | Ga0209148_1000044 | 3300025254 | Bacteria | 458417 |
| 116 | Ga0209148_1000045 | 3300025254 | Bacteria | 448076 |
| 117 | Ga0209148_1000048 | 3300025254 | Bacteria | 430913 |
| 118 | Ga0209759_1000166 | 3300025256 | Bacteria | 113080 |
| 119 | Ga0209759_1000670 | 3300025256 | Bacteria | 31566 |
| 120 | Ga0209233_1000101 | 3300025261 | Bacteria | 286063 |
| 121 | Ga0209455_1000010 | 3300025272 | Bacteria | 959482 |
| 122 | Ga0209455_1000029 | 3300025272 | Bacteria | 542096 |
| 123 | Ga0209455_1000035 | 3300025272 | Bacteria | 479071 |
| 124 | Ga0209455_1000560 | 3300025272 | Bacteria | 25084 |
| 125 | Ga0209673_1010710 | 3300025273 | Bacteria | 3843 |
| 126 | Ga0209564_1000003 | 3300025295 | Bacteria | 1585848 |
| 127 | Ga0209050_1012336 | 3300025298 | Bacteria | 3930 |
| 128 | Ga0209256_1002401 | 3300025299 | Bacteria | 15389 |
| 129 | Ga0209051_1003352 | 3300025303 | Bacteria | 10557 |
| 130 | Ga0209257_1001931 | 3300025304 | Bacteria | 22372 |
| 131 | Ga0207680_10000002 | 3300025903 | Bacteria | 1018646 |
| 132 | Ga0207705_10032332 | 3300025909 | Bacteria | 3738 |
| 133 | Ga0207671_10010424 | 3300025914 | Bacteria | 7668 |
| 134 | Ga0207662_10400316 | 3300025918 | Bacteria | 931 |
| 135 | Ga0207649_10062885 | 3300025920 | Bacteria | 2341 |
| 136 | Ga0207694_10000177 | 3300025924 | Bacteria | 65875 |
| 137 | Ga0207694_10133598 | 3300025924 | Bacteria | 1991 |
| 138 | Ga0207709_10003666 | 3300025935 | Bacteria | 9044 |
| 139 | Ga0207667_10317081 | 3300025949 | Bacteria | 1592 |
| 140 | Ga0207640_10015853 | 3300025981 | Bacteria | 4373 |
| 141 | Ga0207658_10108538 | 3300025986 | Bacteria | 2189 |
| 142 | Ga0207703_10556671 | 3300026035 | Bacteria | 1082 |
| 143 | Ga0207639_10464967 | 3300026041 | Bacteria | 1151 |
| 144 | Ga0207678_10146910 | 3300026067 | Bacteria | 2012 |
| 145 | Ga0207678_10290017 | 3300026067 | Bacteria | 1405 |
| 146 | Ga0207708_10062788 | 3300026075 | Bacteria | 2838 |
| 147 | Ga0207702_10018842 | 3300026078 | Bacteria | 5709 |
| 148 | Ga0207648_10000541 | 3300026089 | Bacteria | 42157 |
| 149 | Ga0207698_10366601 | 3300026142 | Bacteria | 1366 |
| 150 | Ga0209389_1010870 | 3300027296 | Bacteria | 8227 |
| 151 | Ga0209813_10101827 | 3300027866 | Bacteria | 978 |
| 152 | Ga0209974_10001160 | 3300027876 | Bacteria | 9386 |
| 153 | Ga0207428_10013975 | 3300027907 | Bacteria | 6992 |
| 154 | Ga0207428_10106898 | 3300027907 | Bacteria | 2156 |
| 155 | Ga0268266_10000004 | 3300028379 | Bacteria | 1495817 |
| 156 | Ga0268265_10211370 | 3300028380 | Bacteria | 1691 |
| 157 | Ga0265318_10143310 | 3300028577 | Bacteria | 877 |
| 158 | Ga0307515_10002409 | 3300028794 | Bacteria | 40792 |
| 159 | Ga0265331_10042041 | 3300031250 | Bacteria | 2219 |
| 160 | Ga0307513_10137312 | 3300031456 | Bacteria | 2378 |
| 161 | Ga0307513_10464561 | 3300031456 | Bacteria | 988 |
| 162 | Ga0316578_10000202 | 3300031728 | Bacteria | 16966 |
| 163 | Ga0307516_10001303 | 3300031730 | Bacteria | 34698 |
| 164 | Ga0316577_10013725 | 3300031733 | Bacteria | 4438 |
| 165 | Ga0307413_10370352 | 3300031824 | Bacteria | 1112 |
| 166 | Ga0307410_10010051 | 3300031852 | Bacteria | 5342 |
| 167 | Ga0307414_10066531 | 3300032004 | Bacteria | 2577 |
| 168 | Ga0307411_10199788 | 3300032005 | Bacteria | 1534 |
| 169 | Ga0307510_10001742 | 3300033180 | Bacteria | 24237 |
| 170 | Ga0373947_0466735 | 3300035725 | Bacteria | 856 |
| 171 | Ga0373925_0069518 | 3300037068 | Bacteria | 2660 |
| 172 | Ga0395899_0000404 | 3300037312 | Bacteria | 50522 |
| 173 | Ga0395899_0010991 | 3300037312 | Bacteria | 6934 |
| 174 | Ga0395900_0000107 | 3300037418 | Bacteria | 149024 |
| 175 | Ga0395898_0000078 | 3300037466 | Bacteria | 244514 |
| 176 | Ga0395898_0000211 | 3300037466 | Bacteria | 149301 |
| 177 | Ga0395905_0029070 | 3300037471 | Bacteria | 5208 |
| 178 | Ga0395905_0044723 | 3300037471 | Bacteria | 4154 |
| 179 | Ga0395901_0146934 | 3300038443 | Bacteria | 2478 |
| 180 | Ga0395901_0304485 | 3300038443 | Bacteria | 1652 |
| 181 | Ga0436361_0882487 | 3300039447 | Bacteria | 26486 |
| 182 | Ga0436361_0969151 | 3300039447 | Bacteria | 1099 |
| 183 | Ga0451793_0466386 | 3300041452 | Bacteria | 1499 |
| 184 | Ga0451800_0410668 | 3300041459 | Bacteria | 2378 |
| 185 | Ga0439431_0001183 | 3300041997 | Bacteria | 5703 |
| 186 | Ga0450890_004141 | 3300042127 | Bacteria | 1903 |
| 187 | Ga0450898_029761 | 3300042134 | Bacteria | 997 |
| 188 | Ga0450908_002562 | 3300042184 | Bacteria | 3565 |
| 189 | Ga0439459_0002812 | 3300042438 | Bacteria | 2715 |
| 190 | Ga0451577_0027444 | 3300042876 | Bacteria | 5154 |
| 191 | Ga0451577_0637187 | 3300042876 | Bacteria | 967 |
| 192 | Ga0466988_0066541 | 3300044536 | Bacteria | 2126 |
| 193 | Ga0466969_0002513 | 3300044656 | Bacteria | 9807 |
| 194 | Ga0466969_0234492 | 3300044656 | Bacteria | 833 |
| 195 | Ga0466989_0182326 | 3300044663 | Bacteria | 1247 |
| 196 | Ga0466966_0016803 | 3300044684 | Bacteria | 4834 |
| 197 | Ga0466966_0061311 | 3300044684 | Bacteria | 2372 |
| 198 | Ga0466961_0000906 | 3300044693 | Bacteria | 18402 |
| 199 | Ga0466961_0002884 | 3300044693 | Bacteria | 10664 |
| 200 | Ga0466961_0022546 | 3300044693 | Bacteria | 4050 |
| 201 | Ga0466961_0139611 | 3300044693 | Bacteria | 1517 |
| 202 | Ga0466963_0149236 | 3300044694 | Bacteria | 1623 |
| 203 | Ga0466964_0008393 | 3300044706 | Bacteria | 3881 |
| 204 | Ga0453684_0665103 | 3300044712 | Bacteria | 1135 |
| 205 | Ga0466968_0057910 | 3300044735 | Bacteria | 1667 |
| 206 | Ga0466970_0005775 | 3300044765 | Bacteria | 6151 |
| 207 | Ga0466970_0006092 | 3300044765 | Bacteria | 6011 |
| 208 | Ga0466957_0062767 | 3300044842 | Bacteria | 2282 |
| 209 | Ga0466959_0000110 | 3300045049 | Bacteria | 52740 |
| 210 | Ga0466959_0029071 | 3300045049 | Bacteria | 4094 |
| 211 | Ga0466959_0102986 | 3300045049 | Bacteria | 2042 |
| 212 | Ga0451576_0820558 | 3300045051 | Bacteria | 976 |
| 213 | Ga0466958_0081242 | 3300045836 | Bacteria | 1994 |
| 214 | Ga0466967_0011210 | 3300045976 | Bacteria | 6776 |
| 215 | Ga0495594_0219075 | 3300046499 | Bacteria | 1085 |
| 216 | Ga0495606_0070583 | 3300046507 | Bacteria | 2202 |
| 217 | Ga0495610_0063981 | 3300046512 | Bacteria | 1740 |
| 218 | Ga0495620_0010812 | 3300046515 | Bacteria | 4799 |
| 219 | Ga0495632_0240399 | 3300046519 | Bacteria | 814 |
| 220 | Ga0495643_0174248 | 3300046522 | Bacteria | 1050 |
| 221 | Ga0495625_0009603 | 3300046660 | Bacteria | 8075 |
| 222 | Ga0495625_0018610 | 3300046660 | Bacteria | 5415 |
| 223 | Ga0495686_0081747 | 3300047472 | Bacteria | 1972 |
| 224 | Ga0496102_0114266 | 3300048905 | Bacteria | 2519 |
| 225 | Ga0496117_0191253 | 3300048920 | Bacteria | 1165 |
| 226 | Ga0496124_0024076 | 3300048927 | Bacteria | 5543 |
| 227 | Ga0496125_0181577 | 3300048928 | Bacteria | 1401 |
| 228 | Ga0496126_0122272 | 3300048929 | Bacteria | 2256 |
| 229 | Ga0496126_0849715 | 3300048929 | Bacteria | 696 |
| 230 | Ga0501299_064850 | 3300049522 | Bacteria | 781 |
| 231 | Ga0501031_0494147 | 3300049568 | Bacteria | 789 |
| 232 | Ga0501032_0007967 | 3300049569 | Bacteria | 7722 |
| 233 | Ga0501033_0595315 | 3300049570 | Bacteria | 759 |
| 234 | Ga0501034_0069897 | 3300049571 | Bacteria | 3522 |
| 235 | Ga0501036_0149290 | 3300049572 | Bacteria | 1971 |
| 236 | Ga0501036_0528173 | 3300049572 | Bacteria | 981 |
| 237 | Ga0501037_0025221 | 3300049573 | Bacteria | 4393 |
| 238 | Ga0501037_0343737 | 3300049573 | Unclassified | 1030 |
| 239 | Ga0501039_0148072 | 3300049575 | Bacteria | 1845 |
| 240 | Ga0501040_0001956 | 3300049576 | Bacteria | 13274 |
| 241 | Ga0501040_0217152 | 3300049576 | Bacteria | 1360 |
| 242 | Ga0501041_0025885 | 3300049577 | Bacteria | 3528 |
| 243 | Ga0501041_0026419 | 3300049577 | Bacteria | 3493 |
| 244 | Ga0501042_0021837 | 3300049578 | Bacteria | 4466 |
| 245 | Ga0501043_0000108 | 3300049579 | Bacteria | 77329 |
| 246 | Ga0501043_0022379 | 3300049579 | Bacteria | 4958 |
| 247 | Ga0501043_0048142 | 3300049579 | Bacteria | 3352 |
| 248 | Ga0501043_0623449 | 3300049579 | Bacteria | 795 |
| 249 | Ga0501046_0000050 | 3300049580 | Bacteria | 134922 |
| 250 | Ga0501046_0065029 | 3300049580 | Bacteria | 2846 |
| 251 | Ga0501047_0000012 | 3300049581 | Bacteria | 368824 |
| 252 | Ga0501048_0001920 | 3300049582 | Bacteria | 15783 |
| 253 | Ga0501048_0033944 | 3300049582 | Bacteria | 3684 |
| 254 | Ga0501048_0063971 | 3300049582 | Bacteria | 2601 |
| 255 | Ga0501048_0437144 | 3300049582 | Bacteria | 936 |
| 256 | Ga0501068_0457041 | 3300049584 | Bacteria | 826 |
| 257 | Ga0501071_0080701 | 3300049587 | Bacteria | 2379 |
| 258 | Ga0501071_0086219 | 3300049587 | Bacteria | 2303 |
| 259 | Ga0501072_0003566 | 3300049588 | Bacteria | 11705 |
| 260 | Ga0501072_0181691 | 3300049588 | Bacteria | 1678 |
| 261 | Ga0501074_0051752 | 3300049590 | Bacteria | 2964 |
| 262 | Ga0501075_0000204 | 3300049591 | Bacteria | 31579 |
| 263 | Ga0501075_0047064 | 3300049591 | Bacteria | 3241 |
| 264 | Ga0501076_0038593 | 3300049592 | Bacteria | 3749 |
| 265 | Ga0501076_0069475 | 3300049592 | Bacteria | 2814 |
| 266 | Ga0501077_0019438 | 3300049593 | Bacteria | 4297 |
| 267 | Ga0501077_0154333 | 3300049593 | Bacteria | 1457 |
| 268 | Ga0501077_0351021 | 3300049593 | Unclassified | 941 |
| 269 | Ga0501222_002144 | 3300049662 | Bacteria | 2737 |
| 270 | Ga0501079_0003175 | 3300049741 | Bacteria | 12037 |
| 271 | Ga0501079_0109360 | 3300049741 | Bacteria | 2147 |
| 272 | Ga0501080_0025780 | 3300049742 | Bacteria | 5461 |
| 273 | Ga0501081_0173510 | 3300049743 | Bacteria | 1557 |
| 274 | Ga0501081_0197484 | 3300049743 | Unclassified | 1458 |
| 275 | Ga0501035_0343415 | 3300049822 | Bacteria | 1250 |
| 276 | Ga0501035_0434339 | 3300049822 | Bacteria | 1088 |
| 277 | Ga0501035_0444388 | 3300049822 | Bacteria | 1073 |
| 278 | Ga0501045_0002562 | 3300049824 | Bacteria | 12390 |
| 279 | Ga0501045_0005119 | 3300049824 | Bacteria | 9072 |
| 280 | Ga0501045_0214051 | 3300049824 | Bacteria | 1435 |
| 281 | nmdc:mga03683_36049_c1 | 3300050489 | Bacteria | 2010 |
| 282 | nmdc:mga0k408_27041_c1 | 3300050493 | Bacteria | 3256 |
| 283 | nmdc:mga0k408_27087_c1 | 3300050493 | Bacteria | 3253 |
| 284 | nmdc:mga0k408_483312_c1 | 3300050493 | Bacteria | 735 |
| 285 | nmdc:mga04h51_149383_c1 | 3300050495 | Bacteria | 892 |
| 286 | nmdc:mga05p37_693041_c2 | 3300050507 | Unclassified | 817 |
| 287 | nmdc:mga08y16_284465_c1 | 3300050511 | Bacteria | 1705 |
| 288 | nmdc:mga08y16_481_c1 | 3300050511 | Bacteria | 36847 |
| 289 | Ga0500595_026020 | 3300053119 | Bacteria | 2021 |
| 290 | Ga0500658_0010715 | 3300053134 | Bacteria | 3382 |
| 291 | Ga0500622_0018928 | 3300053156 | Bacteria | 3659 |
| 292 | Ga0500587_001782 | 3300053739 | Bacteria | 3059 |
| 293 | Ga0501084_0008089 | 3300054114 | Bacteria | 8661 |
| 294 | Ga0590075_018267 | 3300059424 | Bacteria | 1733 |
| 295 | Ga0501082_0007651 | 3300060353 | Bacteria | 9320 |
| 296 | Ga0501082_0219953 | 3300060353 | Bacteria | 1652 |
| 297 | Ga0466962_0002526 | 3300061719 | Bacteria | 8691 |
| 298 | Ga0466962_0034403 | 3300061719 | Bacteria | 2426 |
| 299 | Ga0466962_0196859 | 3300061719 | Bacteria | 984 |
| 300 | Ga0530510_0023561 | 3300061734 | Bacteria | 4388 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049522 | Ga0501299_064850 | Ga0501299_064850_16_543 | 166 |
| 2 | 3300048929 | Ga0496126_0849715 | Ga0496126_0849715_13_537 | 174 |
| 3 | 3300050493 | nmdc:mga0k408_27087_c1 | nmdc:mga0k408_27087_c1_1780_2334 | 175 |
| 4 | 3300031728 | Ga0316578_10000202 | Ga0316578_100002022 | 179 |
| 5 | 3300031733 | Ga0316577_10013725 | Ga0316577_100137253 | 179 |
| 6 | 3300048905 | Ga0496102_0114266 | Ga0496102_0114266_34_594 | 183 |
| 7 | 3300006177 | Ga0075362_10033677 | Ga0075362_100336772 | 184 |
| 8 | 3300006195 | Ga0075366_10017777 | Ga0075366_100177772 | 184 |
| 9 | 3300050489 | nmdc:mga03683_36049_c1 | nmdc:mga03683_36049_c1_927_1574 | 184 |
| 10 | 3300050493 | nmdc:mga0k408_27041_c1 | nmdc:mga0k408_27041_c1_702_1349 | 184 |
| 11 | 3300048920 | Ga0496117_0191253 | Ga0496117_0191253_572_1147 | 188 |
| 12 | 3300005937 | Ga0081455_10103511 | Ga0081455_101035112 | 189 |
| 13 | 3300009553 | Ga0105249_11377201 | Ga0105249_113772012 | 190 |
| 14 | 3300025246 | Ga0209646_1001471 | Ga0209646_10014717 | 190 |
| 15 | 3300025250 | Ga0209026_1000162 | Ga0209026_100016231 | 190 |
| 16 | iso_pu_bacteria | 2687453130 | 2687582457 | 192 |
| 17 | 3300005365 | Ga0070688_100611785 | Ga0070688_1006117851 | 195 |
| 18 | 3300044536 | Ga0466988_0066541 | Ga0466988_0066541_372_962 | 196 |
| 19 | 3300044656 | Ga0466969_0002513 | Ga0466969_0002513_486_1076 | 196 |
| 20 | 3300044663 | Ga0466989_0182326 | Ga0466989_0182326_604_1194 | 196 |
| 21 | 3300044684 | Ga0466966_0061311 | Ga0466966_0061311_1405_1995 | 196 |
| 22 | 3300044693 | Ga0466961_0139611 | Ga0466961_0139611_29_619 | 196 |
| 23 | 3300045976 | Ga0466967_0011210 | Ga0466967_0011210_6125_6730 | 196 |
| 24 | 3300049822 | Ga0501035_0343415 | Ga0501035_0343415_510_1121 | 196 |
| 25 | 3300061719 | Ga0466962_0002526 | Ga0466962_0002526_3991_4581 | 196 |
| 26 | 3300049593 | Ga0501077_0351021 | Ga0501077_0351021_101_766 | 198 |
| 27 | iso_pu_bacteria | 2643221577 | 2643894210 | 200 |
| 28 | iso_pu_bacteria | 2643221685 | 2644476412 | 200 |
| 29 | 3300004798 | Ga0058859_10043507 | Ga0058859_100435072 | 201 |
| 30 | 3300005347 | Ga0070668_100151328 | Ga0070668_1001513282 | 201 |
| 31 | 3300005441 | Ga0070700_100035822 | Ga0070700_1000358222 | 201 |
| 32 | 3300005617 | Ga0068859_100083583 | Ga0068859_1000835832 | 201 |
| 33 | 3300005844 | Ga0068862_100260597 | Ga0068862_1002605973 | 201 |
| 34 | 3300005985 | Ga0081539_10003782 | Ga0081539_1000378216 | 201 |
| 35 | 3300006931 | Ga0097620_100083588 | Ga0097620_1000835884 | 201 |
| 36 | 3300009094 | Ga0111539_10231417 | Ga0111539_102314173 | 201 |
| 37 | 3300009101 | Ga0105247_10059414 | Ga0105247_100594143 | 201 |
| 38 | 3300009147 | Ga0114129_10847373 | Ga0114129_108473732 | 201 |
| 39 | 3300011119 | Ga0105246_10059714 | Ga0105246_100597142 | 201 |
| 40 | 3300013308 | Ga0157375_11149778 | Ga0157375_111497781 | 201 |
| 41 | 3300017792 | Ga0163161_10113330 | Ga0163161_101133303 | 201 |
| 42 | 3300026035 | Ga0207703_10556671 | Ga0207703_105566712 | 201 |
| 43 | 3300026075 | Ga0207708_10062788 | Ga0207708_100627883 | 201 |
| 44 | 3300027907 | Ga0207428_10106898 | Ga0207428_101068982 | 201 |
| 45 | 3300028380 | Ga0268265_10211370 | Ga0268265_102113702 | 201 |
| 46 | 3300050507 | nmdc:mga05p37_693041_c2 | nmdc:mga05p37_693041_c2_154_774 | 201 |
| 47 | 3300050511 | nmdc:mga08y16_284465_c1 | nmdc:mga08y16_284465_c1_557_1177 | 201 |
| 48 | iso_pu_bacteria | 2886848708 | 2886854429 | 201 |
| 49 | 3300005343 | Ga0070687_100331020 | Ga0070687_1003310202 | 202 |
| 50 | 3300009094 | Ga0111539_10005820 | Ga0111539_100058204 | 202 |
| 51 | 3300025918 | Ga0207662_10400316 | Ga0207662_104003162 | 202 |
| 52 | 3300027907 | Ga0207428_10013975 | Ga0207428_100139752 | 202 |
| 53 | 3300050511 | nmdc:mga08y16_481_c1 | nmdc:mga08y16_481_c1_23328_23984 | 202 |
| 54 | iso_pu_bacteria | 2585428062 | 2587757634 | 202 |
| 55 | 3300003322 | rootL2_10006461 | rootL2_100064618 | 203 |
| 56 | 3300003323 | rootH1_10024766 | rootH1_100247664 | 203 |
| 57 | 3300003771 | Ga0055526_1001331 | Ga0055526_100133110 | 203 |
| 58 | 3300003792 | Ga0055540_1018447 | Ga0055540_10184472 | 203 |
| 59 | 3300003794 | Ga0055531_10005778 | Ga0055531_100057785 | 203 |
| 60 | 3300004625 | Ga0055543_1002541 | Ga0055543_10025415 | 203 |
| 61 | 3300005262 | Ga0065165_1000395 | Ga0065165_100039556 | 203 |
| 62 | 3300005262 | Ga0065165_1000995 | Ga0065165_100099530 | 203 |
| 63 | 3300005327 | Ga0070658_10372803 | Ga0070658_103728032 | 203 |
| 64 | 3300005328 | Ga0070676_10024179 | Ga0070676_100241792 | 203 |
| 65 | 3300005355 | Ga0070671_100020110 | Ga0070671_1000201103 | 203 |
| 66 | 3300005356 | Ga0070674_100080320 | Ga0070674_1000803202 | 203 |
| 67 | 3300005459 | Ga0068867_100000005 | Ga0068867_10000000522 | 203 |
| 68 | 3300005840 | Ga0068870_10022163 | Ga0068870_100221633 | 203 |
| 69 | 3300006177 | Ga0075362_10060236 | Ga0075362_100602362 | 203 |
| 70 | 3300006178 | Ga0075367_10093105 | Ga0075367_100931052 | 203 |
| 71 | 3300006353 | Ga0075370_10007774 | Ga0075370_100077743 | 203 |
| 72 | 3300006353 | Ga0075370_10044698 | Ga0075370_100446982 | 203 |
| 73 | 3300006942 | Ga0099824_1043770 | Ga0099824_10437701 | 203 |
| 74 | 3300006944 | Ga0099823_1000985 | Ga0099823_100098514 | 203 |
| 75 | 3300009148 | Ga0105243_10006176 | Ga0105243_100061769 | 203 |
| 76 | 3300012497 | Ga0157319_1000006 | Ga0157319_100000696 | 203 |
| 77 | 3300014745 | Ga0157377_10000244 | Ga0157377_1000024423 | 203 |
| 78 | 3300021361 | Ga0213872_10000647 | Ga0213872_1000064720 | 203 |
| 79 | 3300025242 | Ga0209258_112615 | Ga0209258_1126152 | 203 |
| 80 | 3300025273 | Ga0209673_1010710 | Ga0209673_10107104 | 203 |
| 81 | 3300025295 | Ga0209564_1000003 | Ga0209564_10000031350 | 203 |
| 82 | 3300025298 | Ga0209050_1012336 | Ga0209050_10123362 | 203 |
| 83 | 3300025299 | Ga0209256_1002401 | Ga0209256_10024017 | 203 |
| 84 | 3300025303 | Ga0209051_1003352 | Ga0209051_100335210 | 203 |
| 85 | 3300025304 | Ga0209257_1001931 | Ga0209257_10019316 | 203 |
| 86 | 3300025935 | Ga0207709_10003666 | Ga0207709_100036662 | 203 |
| 87 | 3300026089 | Ga0207648_10000541 | Ga0207648_1000054116 | 203 |
| 88 | 3300026142 | Ga0207698_10366601 | Ga0207698_103666012 | 203 |
| 89 | 3300027296 | Ga0209389_1010870 | Ga0209389_10108704 | 203 |
| 90 | 3300027866 | Ga0209813_10101827 | Ga0209813_101018272 | 203 |
| 91 | 3300027876 | Ga0209974_10001160 | Ga0209974_100011603 | 203 |
| 92 | 3300028577 | Ga0265318_10143310 | Ga0265318_101433102 | 203 |
| 93 | 3300028794 | Ga0307515_10002409 | Ga0307515_1000240910 | 203 |
| 94 | 3300031456 | Ga0307513_10137312 | Ga0307513_101373122 | 203 |
| 95 | 3300031456 | Ga0307513_10464561 | Ga0307513_104645612 | 203 |
| 96 | 3300031730 | Ga0307516_10001303 | Ga0307516_1000130318 | 203 |
| 97 | 3300032005 | Ga0307411_10199788 | Ga0307411_101997882 | 203 |
| 98 | 3300035725 | Ga0373947_0466735 | Ga0373947_0466735_134_760 | 203 |
| 99 | 3300037068 | Ga0373925_0069518 | Ga0373925_0069518_1193_1819 | 203 |
| 100 | 3300037471 | Ga0395905_0029070 | Ga0395905_0029070_2889_3548 | 203 |
| 101 | 3300037471 | Ga0395905_0044723 | Ga0395905_0044723_2060_2710 | 203 |
| 102 | 3300038443 | Ga0395901_0146934 | Ga0395901_0146934_1520_2179 | 203 |
| 103 | 3300039447 | Ga0436361_0882487 | Ga0436361_0882487_25289_25918 | 203 |
| 104 | 3300039447 | Ga0436361_0969151 | Ga0436361_0969151_408_1049 | 203 |
| 105 | 3300041452 | Ga0451793_0466386 | Ga0451793_0466386_363_1010 | 203 |
| 106 | 3300041459 | Ga0451800_0410668 | Ga0451800_0410668_422_1069 | 203 |
| 107 | 3300041997 | Ga0439431_0001183 | Ga0439431_0001183_524_1171 | 203 |
| 108 | 3300042127 | Ga0450890_004141 | Ga0450890_004141_237_872 | 203 |
| 109 | 3300042134 | Ga0450898_029761 | Ga0450898_029761_341_982 | 203 |
| 110 | 3300042438 | Ga0439459_0002812 | Ga0439459_0002812_1104_1739 | 203 |
| 111 | 3300042876 | Ga0451577_0027444 | Ga0451577_0027444_672_1301 | 203 |
| 112 | 3300042876 | Ga0451577_0637187 | Ga0451577_0637187_73_690 | 203 |
| 113 | 3300044694 | Ga0466963_0149236 | Ga0466963_0149236_576_1211 | 203 |
| 114 | 3300044712 | Ga0453684_0665103 | Ga0453684_0665103_133_780 | 203 |
| 115 | 3300045051 | Ga0451576_0820558 | Ga0451576_0820558_62_712 | 203 |
| 116 | 3300046499 | Ga0495594_0219075 | Ga0495594_0219075_32_679 | 203 |
| 117 | 3300046512 | Ga0495610_0063981 | Ga0495610_0063981_743_1390 | 203 |
| 118 | 3300046515 | Ga0495620_0010812 | Ga0495620_0010812_3535_4182 | 203 |
| 119 | 3300046519 | Ga0495632_0240399 | Ga0495632_0240399_123_770 | 203 |
| 120 | 3300046522 | Ga0495643_0174248 | Ga0495643_0174248_177_824 | 203 |
| 121 | 3300046660 | Ga0495625_0009603 | Ga0495625_0009603_2175_2822 | 203 |
| 122 | 3300047472 | Ga0495686_0081747 | Ga0495686_0081747_46_693 | 203 |
| 123 | 3300048927 | Ga0496124_0024076 | Ga0496124_0024076_663_1298 | 203 |
| 124 | 3300049579 | Ga0501043_0000108 | Ga0501043_0000108_11705_12352 | 203 |
| 125 | 3300049580 | Ga0501046_0000050 | Ga0501046_0000050_65016_65663 | 203 |
| 126 | 3300049581 | Ga0501047_0000012 | Ga0501047_0000012_303169_303816 | 203 |
| 127 | 3300049582 | Ga0501048_0001920 | Ga0501048_0001920_9282_9929 | 203 |
| 128 | 3300049662 | Ga0501222_002144 | Ga0501222_002144_1921_2559 | 203 |
| 129 | 3300049824 | Ga0501045_0005119 | Ga0501045_0005119_6777_7424 | 203 |
| 130 | 3300050493 | nmdc:mga0k408_483312_c1 | nmdc:mga0k408_483312_c1_65_712 | 203 |
| 131 | 3300050495 | nmdc:mga04h51_149383_c1 | nmdc:mga04h51_149383_c1_43_690 | 203 |
| 132 | 3300053134 | Ga0500658_0010715 | Ga0500658_0010715_2285_2932 | 203 |
| 133 | 3300053156 | Ga0500622_0018928 | Ga0500622_0018928_2266_2901 | 203 |
| 134 | 3300053739 | Ga0500587_001782 | Ga0500587_001782_277_924 | 203 |
| 135 | 3300059424 | Ga0590075_018267 | Ga0590075_018267_660_1307 | 203 |
| 136 | iso_pu_bacteria | 2831864461 | 2831869958 | 203 |
| 137 | 3300002705 | JGI25156J39149_1016013 | JGI25156J39149_10160132 | 204 |
| 138 | 3300002737 | JGI25162J39368_1006056 | JGI25162J39368_10060563 | 204 |
| 139 | 3300002738 | JGI25154J39366_1004852 | JGI25154J39366_10048521 | 204 |
| 140 | 3300002741 | JGI25157J39369_1001473 | JGI25157J39369_10014732 | 204 |
| 141 | 3300002741 | JGI25157J39369_1003405 | JGI25157J39369_10034053 | 204 |
| 142 | 3300002772 | JGI25164J39214_1000587 | JGI25164J39214_10005873 | 204 |
| 143 | 3300003214 | JGI25165J46597_1001159 | JGI25165J46597_10011593 | 204 |
| 144 | 3300003752 | Ga0055539_1005625 | Ga0055539_10056251 | 204 |
| 145 | 3300003752 | Ga0055539_1016633 | Ga0055539_10166332 | 204 |
| 146 | 3300003756 | Ga0055533_1006060 | Ga0055533_10060602 | 204 |
| 147 | 3300003759 | Ga0055525_1000233 | Ga0055525_100023328 | 204 |
| 148 | 3300003759 | Ga0055525_1000346 | Ga0055525_10003465 | 204 |
| 149 | 3300003760 | Ga0055527_1000149 | Ga0055527_100014941 | 204 |
| 150 | 3300003760 | Ga0055527_1000259 | Ga0055527_100025920 | 204 |
| 151 | 3300003760 | Ga0055527_1000266 | Ga0055527_100026611 | 204 |
| 152 | 3300003760 | Ga0055527_1006338 | Ga0055527_10063383 | 204 |
| 153 | 3300003761 | Ga0055535_1000395 | Ga0055535_10003953 | 204 |
| 154 | 3300003761 | Ga0055535_1000606 | Ga0055535_10006069 | 204 |
| 155 | 3300003761 | Ga0055535_1000651 | Ga0055535_100065115 | 204 |
| 156 | 3300003761 | Ga0055535_1001113 | Ga0055535_100111314 | 204 |
| 157 | 3300003762 | Ga0055542_1000167 | Ga0055542_100016741 | 204 |
| 158 | 3300003762 | Ga0055542_1000264 | Ga0055542_100026420 | 204 |
| 159 | 3300003762 | Ga0055542_1000364 | Ga0055542_10003643 | 204 |
| 160 | 3300003762 | Ga0055542_1008129 | Ga0055542_10081292 | 204 |
| 161 | 3300003763 | Ga0055529_1000416 | Ga0055529_100041632 | 204 |
| 162 | 3300003763 | Ga0055529_1000640 | Ga0055529_100064022 | 204 |
| 163 | 3300003763 | Ga0055529_1000908 | Ga0055529_10009082 | 204 |
| 164 | 3300005327 | Ga0070658_10235109 | Ga0070658_102351091 | 204 |
| 165 | 3300005335 | Ga0070666_10000007 | Ga0070666_10000007192 | 204 |
| 166 | 3300005344 | Ga0070661_100090668 | Ga0070661_1000906682 | 204 |
| 167 | 3300005347 | Ga0070668_100762213 | Ga0070668_1007622131 | 204 |
| 168 | 3300005367 | Ga0070667_100037500 | Ga0070667_1000375002 | 204 |
| 169 | 3300005455 | Ga0070663_100582984 | Ga0070663_1005829841 | 204 |
| 170 | 3300005456 | Ga0070678_101017214 | Ga0070678_1010172141 | 204 |
| 171 | 3300005539 | Ga0068853_100826189 | Ga0068853_1008261892 | 204 |
| 172 | 3300005548 | Ga0070665_100000817 | Ga0070665_10000081723 | 204 |
| 173 | 3300005578 | Ga0068854_100020103 | Ga0068854_1000201033 | 204 |
| 174 | 3300005614 | Ga0068856_100002593 | Ga0068856_1000025939 | 204 |
| 175 | 3300005616 | Ga0068852_100003098 | Ga0068852_1000030987 | 204 |
| 176 | 3300006237 | Ga0097621_100075175 | Ga0097621_1000751753 | 204 |
| 177 | 3300006358 | Ga0068871_100066264 | Ga0068871_1000662643 | 204 |
| 178 | 3300009545 | Ga0105237_10000595 | Ga0105237_1000059531 | 204 |
| 179 | 3300009551 | Ga0105238_10001931 | Ga0105238_1000193117 | 204 |
| 180 | 3300009551 | Ga0105238_10216353 | Ga0105238_102163533 | 204 |
| 181 | 3300009553 | Ga0105249_10819678 | Ga0105249_108196782 | 204 |
| 182 | 3300013104 | Ga0157370_10006616 | Ga0157370_100066164 | 204 |
| 183 | 3300013306 | Ga0163162_10001668 | Ga0163162_100016685 | 204 |
| 184 | 3300015685 | Ga0183369_1009 | Ga0183369_1009189 | 204 |
| 185 | 3300025226 | Ga0209674_100523 | Ga0209674_1005239 | 204 |
| 186 | 3300025228 | Ga0209672_100007 | Ga0209672_100007468 | 204 |
| 187 | 3300025228 | Ga0209672_100018 | Ga0209672_100018271 | 204 |
| 188 | 3300025228 | Ga0209672_100198 | Ga0209672_10019842 | 204 |
| 189 | 3300025228 | Ga0209672_100599 | Ga0209672_10059920 | 204 |
| 190 | 3300025230 | Ga0209563_100071 | Ga0209563_100071136 | 204 |
| 191 | 3300025231 | Ga0207427_100036 | Ga0207427_100036248 | 204 |
| 192 | 3300025233 | Ga0209437_101013 | Ga0209437_1010138 | 204 |
| 193 | 3300025242 | Ga0209258_100017 | Ga0209258_100017350 | 204 |
| 194 | 3300025242 | Ga0209258_100024 | Ga0209258_100024377 | 204 |
| 195 | 3300025242 | Ga0209258_100035 | Ga0209258_100035197 | 204 |
| 196 | 3300025242 | Ga0209258_100379 | Ga0209258_10037914 | 204 |
| 197 | 3300025246 | Ga0209646_1005067 | Ga0209646_10050672 | 204 |
| 198 | 3300025250 | Ga0209026_1000056 | Ga0209026_1000056156 | 204 |
| 199 | 3300025250 | Ga0209026_1000513 | Ga0209026_100051315 | 204 |
| 200 | 3300025253 | Ga0209677_101331 | Ga0209677_10133110 | 204 |
| 201 | 3300025253 | Ga0209677_106509 | Ga0209677_1065093 | 204 |
| 202 | 3300025254 | Ga0209148_1000009 | Ga0209148_1000009705 | 204 |
| 203 | 3300025254 | Ga0209148_1000044 | Ga0209148_1000044352 | 204 |
| 204 | 3300025254 | Ga0209148_1000045 | Ga0209148_100004542 | 204 |
| 205 | 3300025254 | Ga0209148_1000048 | Ga0209148_1000048165 | 204 |
| 206 | 3300025256 | Ga0209759_1000166 | Ga0209759_100016637 | 204 |
| 207 | 3300025256 | Ga0209759_1000670 | Ga0209759_10006703 | 204 |
| 208 | 3300025261 | Ga0209233_1000101 | Ga0209233_1000101248 | 204 |
| 209 | 3300025272 | Ga0209455_1000010 | Ga0209455_1000010468 | 204 |
| 210 | 3300025272 | Ga0209455_1000029 | Ga0209455_1000029377 | 204 |
| 211 | 3300025272 | Ga0209455_1000035 | Ga0209455_100003542 | 204 |
| 212 | 3300025272 | Ga0209455_1000560 | Ga0209455_100056027 | 204 |
| 213 | 3300025903 | Ga0207680_10000002 | Ga0207680_10000002634 | 204 |
| 214 | 3300025909 | Ga0207705_10032332 | Ga0207705_100323321 | 204 |
| 215 | 3300025914 | Ga0207671_10010424 | Ga0207671_100104244 | 204 |
| 216 | 3300025920 | Ga0207649_10062885 | Ga0207649_100628852 | 204 |
| 217 | 3300025924 | Ga0207694_10000177 | Ga0207694_1000017724 | 204 |
| 218 | 3300025924 | Ga0207694_10133598 | Ga0207694_101335983 | 204 |
| 219 | 3300025949 | Ga0207667_10317081 | Ga0207667_103170812 | 204 |
| 220 | 3300025981 | Ga0207640_10015853 | Ga0207640_100158534 | 204 |
| 221 | 3300025986 | Ga0207658_10108538 | Ga0207658_101085383 | 204 |
| 222 | 3300026041 | Ga0207639_10464967 | Ga0207639_104649671 | 204 |
| 223 | 3300026067 | Ga0207678_10146910 | Ga0207678_101469101 | 204 |
| 224 | 3300026067 | Ga0207678_10290017 | Ga0207678_102900172 | 204 |
| 225 | 3300026078 | Ga0207702_10018842 | Ga0207702_100188428 | 204 |
| 226 | 3300028379 | Ga0268266_10000004 | Ga0268266_10000004630 | 204 |
| 227 | 3300031250 | Ga0265331_10042041 | Ga0265331_100420412 | 204 |
| 228 | 3300031824 | Ga0307413_10370352 | Ga0307413_103703522 | 204 |
| 229 | 3300031852 | Ga0307410_10010051 | Ga0307410_100100513 | 204 |
| 230 | 3300032004 | Ga0307414_10066531 | Ga0307414_100665312 | 204 |
| 231 | 3300033180 | Ga0307510_10001742 | Ga0307510_100017427 | 204 |
| 232 | 3300037312 | Ga0395899_0000404 | Ga0395899_0000404_37454_38068 | 204 |
| 233 | 3300037312 | Ga0395899_0010991 | Ga0395899_0010991_2203_2820 | 204 |
| 234 | 3300037418 | Ga0395900_0000107 | Ga0395900_0000107_76989_77603 | 204 |
| 235 | 3300037466 | Ga0395898_0000078 | Ga0395898_0000078_42287_42904 | 204 |
| 236 | 3300037466 | Ga0395898_0000211 | Ga0395898_0000211_24779_25393 | 204 |
| 237 | 3300038443 | Ga0395901_0304485 | Ga0395901_0304485_997_1614 | 204 |
| 238 | 3300042184 | Ga0450908_002562 | Ga0450908_002562_545_1168 | 204 |
| 239 | 3300044656 | Ga0466969_0234492 | Ga0466969_0234492_144_758 | 204 |
| 240 | 3300044684 | Ga0466966_0016803 | Ga0466966_0016803_2253_2867 | 204 |
| 241 | 3300044693 | Ga0466961_0000906 | Ga0466961_0000906_9420_10037 | 204 |
| 242 | 3300044693 | Ga0466961_0002884 | Ga0466961_0002884_6679_7293 | 204 |
| 243 | 3300044693 | Ga0466961_0022546 | Ga0466961_0022546_3413_4027 | 204 |
| 244 | 3300044706 | Ga0466964_0008393 | Ga0466964_0008393_2249_2863 | 204 |
| 245 | 3300044735 | Ga0466968_0057910 | Ga0466968_0057910_538_1152 | 204 |
| 246 | 3300044765 | Ga0466970_0005775 | Ga0466970_0005775_3372_3986 | 204 |
| 247 | 3300044765 | Ga0466970_0006092 | Ga0466970_0006092_2172_2786 | 204 |
| 248 | 3300044842 | Ga0466957_0062767 | Ga0466957_0062767_1572_2186 | 204 |
| 249 | 3300045049 | Ga0466959_0000110 | Ga0466959_0000110_21572_22186 | 204 |
| 250 | 3300045049 | Ga0466959_0029071 | Ga0466959_0029071_3145_3759 | 204 |
| 251 | 3300045049 | Ga0466959_0102986 | Ga0466959_0102986_289_903 | 204 |
| 252 | 3300045836 | Ga0466958_0081242 | Ga0466958_0081242_148_765 | 204 |
| 253 | 3300046507 | Ga0495606_0070583 | Ga0495606_0070583_144_767 | 204 |
| 254 | 3300046660 | Ga0495625_0018610 | Ga0495625_0018610_780_1403 | 204 |
| 255 | 3300048928 | Ga0496125_0181577 | Ga0496125_0181577_696_1319 | 204 |
| 256 | 3300048929 | Ga0496126_0122272 | Ga0496126_0122272_803_1426 | 204 |
| 257 | 3300049568 | Ga0501031_0494147 | Ga0501031_0494147_65_697 | 204 |
| 258 | 3300049569 | Ga0501032_0007967 | Ga0501032_0007967_1251_1877 | 204 |
| 259 | 3300049570 | Ga0501033_0595315 | Ga0501033_0595315_10_639 | 204 |
| 260 | 3300049571 | Ga0501034_0069897 | Ga0501034_0069897_1695_2321 | 204 |
| 261 | 3300049572 | Ga0501036_0149290 | Ga0501036_0149290_540_1172 | 204 |
| 262 | 3300049572 | Ga0501036_0528173 | Ga0501036_0528173_230_853 | 204 |
| 263 | 3300049573 | Ga0501037_0025221 | Ga0501037_0025221_936_1562 | 204 |
| 264 | 3300049573 | Ga0501037_0343737 | Ga0501037_0343737_382_1014 | 204 |
| 265 | 3300049575 | Ga0501039_0148072 | Ga0501039_0148072_604_1227 | 204 |
| 266 | 3300049576 | Ga0501040_0001956 | Ga0501040_0001956_11756_12388 | 204 |
| 267 | 3300049576 | Ga0501040_0217152 | Ga0501040_0217152_12_635 | 204 |
| 268 | 3300049577 | Ga0501041_0025885 | Ga0501041_0025885_2419_3051 | 204 |
| 269 | 3300049577 | Ga0501041_0026419 | Ga0501041_0026419_2717_3340 | 204 |
| 270 | 3300049578 | Ga0501042_0021837 | Ga0501042_0021837_542_1174 | 204 |
| 271 | 3300049579 | Ga0501043_0022379 | Ga0501043_0022379_3493_4119 | 204 |
| 272 | 3300049579 | Ga0501043_0048142 | Ga0501043_0048142_1156_1788 | 204 |
| 273 | 3300049579 | Ga0501043_0623449 | Ga0501043_0623449_97_726 | 204 |
| 274 | 3300049580 | Ga0501046_0065029 | Ga0501046_0065029_1241_1867 | 204 |
| 275 | 3300049582 | Ga0501048_0033944 | Ga0501048_0033944_565_1194 | 204 |
| 276 | 3300049582 | Ga0501048_0063971 | Ga0501048_0063971_633_1265 | 204 |
| 277 | 3300049582 | Ga0501048_0437144 | Ga0501048_0437144_240_863 | 204 |
| 278 | 3300049584 | Ga0501068_0457041 | Ga0501068_0457041_141_773 | 204 |
| 279 | 3300049587 | Ga0501071_0080701 | Ga0501071_0080701_1525_2148 | 204 |
| 280 | 3300049587 | Ga0501071_0086219 | Ga0501071_0086219_848_1480 | 204 |
| 281 | 3300049588 | Ga0501072_0003566 | Ga0501072_0003566_8282_8914 | 204 |
| 282 | 3300049588 | Ga0501072_0181691 | Ga0501072_0181691_260_883 | 204 |
| 283 | 3300049590 | Ga0501074_0051752 | Ga0501074_0051752_435_1067 | 204 |
| 284 | 3300049591 | Ga0501075_0000204 | Ga0501075_0000204_278_910 | 204 |
| 285 | 3300049591 | Ga0501075_0047064 | Ga0501075_0047064_1525_2148 | 204 |
| 286 | 3300049592 | Ga0501076_0038593 | Ga0501076_0038593_526_1158 | 204 |
| 287 | 3300049592 | Ga0501076_0069475 | Ga0501076_0069475_1902_2525 | 204 |
| 288 | 3300049593 | Ga0501077_0019438 | Ga0501077_0019438_2212_2844 | 204 |
| 289 | 3300049593 | Ga0501077_0154333 | Ga0501077_0154333_543_1166 | 204 |
| 290 | 3300049741 | Ga0501079_0003175 | Ga0501079_0003175_3451_4083 | 204 |
| 291 | 3300049741 | Ga0501079_0109360 | Ga0501079_0109360_1351_1974 | 204 |
| 292 | 3300049742 | Ga0501080_0025780 | Ga0501080_0025780_3671_4303 | 204 |
| 293 | 3300049743 | Ga0501081_0173510 | Ga0501081_0173510_191_814 | 204 |
| 294 | 3300049743 | Ga0501081_0197484 | Ga0501081_0197484_206_838 | 204 |
| 295 | 3300049822 | Ga0501035_0434339 | Ga0501035_0434339_271_900 | 204 |
| 296 | 3300049822 | Ga0501035_0444388 | Ga0501035_0444388_150_803 | 204 |
| 297 | 3300049824 | Ga0501045_0002562 | Ga0501045_0002562_6876_7508 | 204 |
| 298 | 3300049824 | Ga0501045_0214051 | Ga0501045_0214051_572_1195 | 204 |
| 299 | 3300053119 | Ga0500595_026020 | Ga0500595_026020_351_983 | 204 |
| 300 | 3300054114 | Ga0501084_0008089 | Ga0501084_0008089_2032_2664 | 204 |
| 301 | 3300060353 | Ga0501082_0007651 | Ga0501082_0007651_5038_5670 | 204 |
| 302 | 3300060353 | Ga0501082_0219953 | Ga0501082_0219953_192_815 | 204 |
| 303 | 3300061719 | Ga0466962_0034403 | Ga0466962_0034403_656_1270 | 204 |
| 304 | 3300061719 | Ga0466962_0196859 | Ga0466962_0196859_275_892 | 204 |
| 305 | 3300061734 | Ga0530510_0023561 | Ga0530510_0023561_435_1067 | 204 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1dl3-assembly1.cif.gz_A | crystal structure of mutually generated monomers of dimeric phosphoribosylantranilate isomerase from thermotoga maritima | 0.9394 | 1 | 204 |
| 1dl3-assembly1.cif.gz_A | crystal structure of mutually generated monomers of dimeric phosphoribosylantranilate isomerase from thermotoga maritima | 0.9346 | 1 | 204 |
| 1dl3-assembly2.cif.gz_B | crystal structure of mutually generated monomers of dimeric phosphoribosylantranilate isomerase from thermotoga maritima | 0.9294 | 1 | 204 |
| 1dl3-assembly2.cif.gz_B | crystal structure of mutually generated monomers of dimeric phosphoribosylantranilate isomerase from thermotoga maritima | 0.9248 | 1 | 204 |
| 1lbm-assembly1.cif.gz_A | crystal structure of phosphoribosyl anthranilate isomerase (prai) in complex with reduced 1-(o-carboxyphenylamino)-1-deoxyribulose 5-phosphate (rcdrp) | 0.8916 | 1 | 204 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1dl3A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9394 | 1 | 204 | 3.20.20.70 |
| 1dl3A00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9346 | 1 | 204 | 3.20.20.70 |
| af_Q8LPI9_65_212_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9221 | 1 | 103 | 3.20.20.70 |
| af_Q2FYR5_1_206_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.8625 | 2 | 204 | 3.20.20.70 |
| 1v5xB00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.8596 | 2 | 203 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3C1AM95-F1-model_v4 | deleted | 0.9789 | 1 | 102 |
|
| AF-T1DD38-F1-model_v4 | phosphoribosylanthranilate isomerase (EC 5.3.1.24) | 0.9756 | 1 | 98 |
GO:0000162
GO:0004640 GO:0006568 |
| AF-A0A352FYC5-F1-model_v4 | deleted | 0.9746 | 1 | 85 |
|
| AF-A0A7R8WYD6-F1-model_v4 | phosphoribosylanthranilate isomerase (EC 5.3.1.24) | 0.9687 | 1 | 125 |
GO:0000162
GO:0004640 GO:0006568 |
| AF-B9TJ98-F1-model_v4 | phosphoribosylanthranilate isomerase (EC 5.3.1.24) | 0.9683 | 1 | 102 |
GO:0000162
GO:0004640 GO:0006568 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar