F398174

General Info

Members Datasets Scaffolds Average Seq Length
305 216 300 208

Family's Representative Sequence

Representative Sequence 3300028577|Ga0265318_10143310|Ga0265318_101433102
Length 239
Sequence MQAPLHRTRIKICGLTREQDIDAAVHAGADAVGFVMYRASPRHVTVARAAELARRLPPFVTPVLLFVNETAPTVIAARAAVAGAVIQFHGDETPEQCNAVGPSFIRAARIPLDAAAAGFDLVKYAQAYRQAQAILLDAHVEGYGGGGKTFNWSLISKSLTSDPAPTGAGLCPLVLSGGLTAANVIDGILQIRPWAVDVSSGVEASKGIKDPEKIHQFVAAVRLADERIAGLKNVRLPAT

Samples

Sample ID Description Type Environment
1 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
2 2643221577 Rhodanobacter sp. Root627 Isolate Unclassified
3 2643221685 Rhodanobacter sp. Root480 Isolate Unclassified
4 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
5 2831864461 Roseateles noduli HZ7 Isolate Nodule
6 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
7 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
8 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
9 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
10 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
11 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
12 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
16 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
17 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
18 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
19 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
20 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
21 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
22 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
23 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
24 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
25 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
26 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
27 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
28 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
29 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
30 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
31 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
53 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
60 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
77 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
81 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
82 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
84 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
85 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
88 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
89 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
114 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
115 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
120 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
121 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
122 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
123 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
124 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
125 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
126 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
127 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
128 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
129 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
130 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
131 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
132 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
133 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
134 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
135 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
136 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
137 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
138 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
139 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
140 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
141 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
142 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
143 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
144 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
145 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
146 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
147 3300044536 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E Metagenome Unclassified
148 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
149 3300044663 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA2E_TR Metagenome Unclassified
150 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
151 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
152 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
153 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
154 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
155 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
156 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
157 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
158 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
159 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
160 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
161 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
162 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
163 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
164 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
165 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
166 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
167 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
168 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
169 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
170 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
171 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
172 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
173 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
174 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
175 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
176 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
191 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
192 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
193 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
194 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
195 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
196 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
197 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
198 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
199 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
200 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
201 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
203 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
204 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
205 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
206 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
207 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
208 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
209 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
210 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
211 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
212 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
213 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
214 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
215 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
216 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.7
Metatranscriptomes 0.33
Isolates 1.97

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 24.59
Nodule 1.31
Rhizoplane 0.98
Rhizosphere 63.28
Stem 0
Stem Tuber 0
Unclassified 9.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1016013 3300002705 Bacteria 1476
2 JGI25162J39368_1006056 3300002737 Bacteria 2178
3 JGI25154J39366_1004852 3300002738 Bacteria 2284
4 JGI25157J39369_1001473 3300002741 Bacteria 8720
5 JGI25157J39369_1003405 3300002741 Bacteria 3270
6 JGI25164J39214_1000587 3300002772 Bacteria 16308
7 JGI25165J46597_1001159 3300003214 Bacteria 16326
8 rootL2_10006461 3300003322 Bacteria 12808
9 rootH1_10024766 3300003316 Bacteria 5634
10 rootH1_10024766 3300003323 Bacteria 6031
11 Ga0055539_1005625 3300003752 Bacteria 1622
12 Ga0055539_1016633 3300003752 Bacteria 892
13 Ga0055533_1006060 3300003756 Bacteria 1840
14 Ga0055525_1000233 3300003759 Bacteria 58310
15 Ga0055525_1000346 3300003759 Bacteria 33587
16 Ga0055527_1000149 3300003760 Bacteria 49224
17 Ga0055527_1000259 3300003760 Bacteria 32195
18 Ga0055527_1000266 3300003760 Bacteria 31574
19 Ga0055527_1006338 3300003760 Bacteria 1485
20 Ga0055535_1000395 3300003761 Bacteria 41210
21 Ga0055535_1000606 3300003761 Bacteria 29564
22 Ga0055535_1000651 3300003761 Bacteria 27644
23 Ga0055535_1001113 3300003761 Bacteria 16309
24 Ga0055542_1000167 3300003762 Bacteria 83068
25 Ga0055542_1000264 3300003762 Bacteria 58581
26 Ga0055542_1000364 3300003762 Bacteria 47003
27 Ga0055542_1008129 3300003762 Bacteria 2071
28 Ga0055529_1000416 3300003763 Bacteria 43929
29 Ga0055529_1000640 3300003763 Bacteria 25655
30 Ga0055529_1000908 3300003763 Bacteria 16313
31 Ga0055526_1001331 3300003771 Bacteria 17689
32 Ga0055540_1018447 3300003792 Bacteria 1912
33 Ga0055531_10005778 3300003794 Bacteria 7163
34 Ga0055543_1002541 3300004625 Bacteria 5953
35 Ga0058859_10043507 3300004798 Bacteria 1526
36 Ga0065165_1000395 3300005262 Bacteria 70688
37 Ga0065165_1000995 3300005262 Bacteria 34985
38 Ga0070658_10235109 3300005327 Bacteria 1552
39 Ga0070658_10372803 3300005327 Bacteria 1224
40 Ga0070676_10024179 3300005328 Bacteria 3419
41 Ga0070666_10000007 3300005335 Bacteria 293732
42 Ga0070687_100331020 3300005343 Bacteria 976
43 Ga0070661_100090668 3300005344 Bacteria 2264
44 Ga0070668_100151328 3300005347 Bacteria 1877
45 Ga0070668_100762213 3300005347 Bacteria 857
46 Ga0070671_100020110 3300005355 Bacteria 5440
47 Ga0070674_100080320 3300005356 Bacteria 2328
48 Ga0070688_100611785 3300005365 Bacteria 835
49 Ga0070667_100037500 3300005367 Bacteria 4063
50 Ga0070700_100035822 3300005441 Bacteria 3006
51 Ga0070663_100582984 3300005455 Bacteria 938
52 Ga0070678_101017214 3300005456 Bacteria 762
53 Ga0068867_100000005 3300005459 Bacteria 174097
54 Ga0068853_100826189 3300005539 Bacteria 888
55 Ga0070665_100000817 3300005548 Bacteria 40729
56 Ga0068854_100020103 3300005578 Bacteria 4511
57 Ga0068856_100002593 3300005614 Bacteria 18615
58 Ga0068852_100003098 3300005616 Bacteria 11576
59 Ga0068859_100083583 3300005617 Bacteria 3236
60 Ga0068870_10022163 3300005840 Bacteria 3118
61 Ga0068862_100260597 3300005844 Bacteria 1582
62 Ga0081455_10103511 3300005937 Bacteria 2279
63 Ga0081539_10003782 3300005985 Bacteria 17888
64 Ga0075362_10033677 3300006177 Bacteria 2229
65 Ga0075362_10060236 3300006177 Bacteria 1715
66 Ga0075367_10093105 3300006178 Bacteria 1835
67 Ga0075366_10017777 3300006195 Bacteria 4099
68 Ga0097621_100075175 3300006237 Bacteria 2799
69 Ga0075370_10007774 3300006353 Bacteria 5477
70 Ga0075370_10044698 3300006353 Bacteria 2504
71 Ga0068871_100066264 3300006358 Bacteria 2960
72 Ga0097620_100083588 3300006931 Bacteria 3236
73 Ga0099824_1043770 3300006942 Bacteria 987
74 Ga0099823_1000985 3300006944 Bacteria 21888
75 Ga0111539_10005820 3300009094 Bacteria 15939
76 Ga0111539_10231417 3300009094 Bacteria 2152
77 Ga0105247_10059414 3300009101 Bacteria 2367
78 Ga0114129_10847373 3300009147 Bacteria 1162
79 Ga0105243_10006176 3300009148 Bacteria 9263
80 Ga0105237_10000595 3300009545 Bacteria 50470
81 Ga0105238_10001931 3300009551 Bacteria 20819
82 Ga0105238_10216353 3300009551 Bacteria 1892
83 Ga0105249_10819678 3300009553 Bacteria 995
84 Ga0105249_11377201 3300009553 Unclassified 777
85 Ga0105246_10059714 3300011119 Bacteria 2646
86 Ga0157319_1000006 3300012497 Bacteria 361506
87 Ga0157370_10006616 3300013104 Bacteria 12736
88 Ga0163162_10001668 3300013306 Bacteria 20833
89 Ga0157375_11149778 3300013308 Bacteria 909
90 Ga0157377_10000244 3300014745 Bacteria 27334
91 Ga0183369_1009 3300015685 Bacteria 346348
92 Ga0163161_10113330 3300017792 Bacteria 2029
93 Ga0213872_10000647 3300021361 Bacteria 26348
94 Ga0209674_100523 3300025226 Bacteria 15570
95 Ga0209672_100007 3300025228 Bacteria 959482
96 Ga0209672_100018 3300025228 Bacteria 432924
97 Ga0209672_100198 3300025228 Bacteria 47906
98 Ga0209672_100599 3300025228 Bacteria 18942
99 Ga0209563_100071 3300025230 Bacteria 232653
100 Ga0207427_100036 3300025231 Bacteria 309540
101 Ga0209437_101013 3300025233 Bacteria 9710
102 Ga0209258_100017 3300025242 Bacteria 590785
103 Ga0209258_100024 3300025242 Bacteria 542096
104 Ga0209258_100035 3300025242 Bacteria 430864
105 Ga0209258_100379 3300025242 Bacteria 57256
106 Ga0209258_112615 3300025242 Bacteria 1031
107 Ga0209646_1001471 3300025246 Bacteria 6278
108 Ga0209646_1005067 3300025246 Bacteria 2335
109 Ga0209026_1000056 3300025250 Bacteria 236450
110 Ga0209026_1000162 3300025250 Bacteria 102867
111 Ga0209026_1000513 3300025250 Bacteria 27282
112 Ga0209677_101331 3300025253 Bacteria 10857
113 Ga0209677_106509 3300025253 Bacteria 2747
114 Ga0209148_1000009 3300025254 Bacteria 1395625
115 Ga0209148_1000044 3300025254 Bacteria 458417
116 Ga0209148_1000045 3300025254 Bacteria 448076
117 Ga0209148_1000048 3300025254 Bacteria 430913
118 Ga0209759_1000166 3300025256 Bacteria 113080
119 Ga0209759_1000670 3300025256 Bacteria 31566
120 Ga0209233_1000101 3300025261 Bacteria 286063
121 Ga0209455_1000010 3300025272 Bacteria 959482
122 Ga0209455_1000029 3300025272 Bacteria 542096
123 Ga0209455_1000035 3300025272 Bacteria 479071
124 Ga0209455_1000560 3300025272 Bacteria 25084
125 Ga0209673_1010710 3300025273 Bacteria 3843
126 Ga0209564_1000003 3300025295 Bacteria 1585848
127 Ga0209050_1012336 3300025298 Bacteria 3930
128 Ga0209256_1002401 3300025299 Bacteria 15389
129 Ga0209051_1003352 3300025303 Bacteria 10557
130 Ga0209257_1001931 3300025304 Bacteria 22372
131 Ga0207680_10000002 3300025903 Bacteria 1018646
132 Ga0207705_10032332 3300025909 Bacteria 3738
133 Ga0207671_10010424 3300025914 Bacteria 7668
134 Ga0207662_10400316 3300025918 Bacteria 931
135 Ga0207649_10062885 3300025920 Bacteria 2341
136 Ga0207694_10000177 3300025924 Bacteria 65875
137 Ga0207694_10133598 3300025924 Bacteria 1991
138 Ga0207709_10003666 3300025935 Bacteria 9044
139 Ga0207667_10317081 3300025949 Bacteria 1592
140 Ga0207640_10015853 3300025981 Bacteria 4373
141 Ga0207658_10108538 3300025986 Bacteria 2189
142 Ga0207703_10556671 3300026035 Bacteria 1082
143 Ga0207639_10464967 3300026041 Bacteria 1151
144 Ga0207678_10146910 3300026067 Bacteria 2012
145 Ga0207678_10290017 3300026067 Bacteria 1405
146 Ga0207708_10062788 3300026075 Bacteria 2838
147 Ga0207702_10018842 3300026078 Bacteria 5709
148 Ga0207648_10000541 3300026089 Bacteria 42157
149 Ga0207698_10366601 3300026142 Bacteria 1366
150 Ga0209389_1010870 3300027296 Bacteria 8227
151 Ga0209813_10101827 3300027866 Bacteria 978
152 Ga0209974_10001160 3300027876 Bacteria 9386
153 Ga0207428_10013975 3300027907 Bacteria 6992
154 Ga0207428_10106898 3300027907 Bacteria 2156
155 Ga0268266_10000004 3300028379 Bacteria 1495817
156 Ga0268265_10211370 3300028380 Bacteria 1691
157 Ga0265318_10143310 3300028577 Bacteria 877
158 Ga0307515_10002409 3300028794 Bacteria 40792
159 Ga0265331_10042041 3300031250 Bacteria 2219
160 Ga0307513_10137312 3300031456 Bacteria 2378
161 Ga0307513_10464561 3300031456 Bacteria 988
162 Ga0316578_10000202 3300031728 Bacteria 16966
163 Ga0307516_10001303 3300031730 Bacteria 34698
164 Ga0316577_10013725 3300031733 Bacteria 4438
165 Ga0307413_10370352 3300031824 Bacteria 1112
166 Ga0307410_10010051 3300031852 Bacteria 5342
167 Ga0307414_10066531 3300032004 Bacteria 2577
168 Ga0307411_10199788 3300032005 Bacteria 1534
169 Ga0307510_10001742 3300033180 Bacteria 24237
170 Ga0373947_0466735 3300035725 Bacteria 856
171 Ga0373925_0069518 3300037068 Bacteria 2660
172 Ga0395899_0000404 3300037312 Bacteria 50522
173 Ga0395899_0010991 3300037312 Bacteria 6934
174 Ga0395900_0000107 3300037418 Bacteria 149024
175 Ga0395898_0000078 3300037466 Bacteria 244514
176 Ga0395898_0000211 3300037466 Bacteria 149301
177 Ga0395905_0029070 3300037471 Bacteria 5208
178 Ga0395905_0044723 3300037471 Bacteria 4154
179 Ga0395901_0146934 3300038443 Bacteria 2478
180 Ga0395901_0304485 3300038443 Bacteria 1652
181 Ga0436361_0882487 3300039447 Bacteria 26486
182 Ga0436361_0969151 3300039447 Bacteria 1099
183 Ga0451793_0466386 3300041452 Bacteria 1499
184 Ga0451800_0410668 3300041459 Bacteria 2378
185 Ga0439431_0001183 3300041997 Bacteria 5703
186 Ga0450890_004141 3300042127 Bacteria 1903
187 Ga0450898_029761 3300042134 Bacteria 997
188 Ga0450908_002562 3300042184 Bacteria 3565
189 Ga0439459_0002812 3300042438 Bacteria 2715
190 Ga0451577_0027444 3300042876 Bacteria 5154
191 Ga0451577_0637187 3300042876 Bacteria 967
192 Ga0466988_0066541 3300044536 Bacteria 2126
193 Ga0466969_0002513 3300044656 Bacteria 9807
194 Ga0466969_0234492 3300044656 Bacteria 833
195 Ga0466989_0182326 3300044663 Bacteria 1247
196 Ga0466966_0016803 3300044684 Bacteria 4834
197 Ga0466966_0061311 3300044684 Bacteria 2372
198 Ga0466961_0000906 3300044693 Bacteria 18402
199 Ga0466961_0002884 3300044693 Bacteria 10664
200 Ga0466961_0022546 3300044693 Bacteria 4050
201 Ga0466961_0139611 3300044693 Bacteria 1517
202 Ga0466963_0149236 3300044694 Bacteria 1623
203 Ga0466964_0008393 3300044706 Bacteria 3881
204 Ga0453684_0665103 3300044712 Bacteria 1135
205 Ga0466968_0057910 3300044735 Bacteria 1667
206 Ga0466970_0005775 3300044765 Bacteria 6151
207 Ga0466970_0006092 3300044765 Bacteria 6011
208 Ga0466957_0062767 3300044842 Bacteria 2282
209 Ga0466959_0000110 3300045049 Bacteria 52740
210 Ga0466959_0029071 3300045049 Bacteria 4094
211 Ga0466959_0102986 3300045049 Bacteria 2042
212 Ga0451576_0820558 3300045051 Bacteria 976
213 Ga0466958_0081242 3300045836 Bacteria 1994
214 Ga0466967_0011210 3300045976 Bacteria 6776
215 Ga0495594_0219075 3300046499 Bacteria 1085
216 Ga0495606_0070583 3300046507 Bacteria 2202
217 Ga0495610_0063981 3300046512 Bacteria 1740
218 Ga0495620_0010812 3300046515 Bacteria 4799
219 Ga0495632_0240399 3300046519 Bacteria 814
220 Ga0495643_0174248 3300046522 Bacteria 1050
221 Ga0495625_0009603 3300046660 Bacteria 8075
222 Ga0495625_0018610 3300046660 Bacteria 5415
223 Ga0495686_0081747 3300047472 Bacteria 1972
224 Ga0496102_0114266 3300048905 Bacteria 2519
225 Ga0496117_0191253 3300048920 Bacteria 1165
226 Ga0496124_0024076 3300048927 Bacteria 5543
227 Ga0496125_0181577 3300048928 Bacteria 1401
228 Ga0496126_0122272 3300048929 Bacteria 2256
229 Ga0496126_0849715 3300048929 Bacteria 696
230 Ga0501299_064850 3300049522 Bacteria 781
231 Ga0501031_0494147 3300049568 Bacteria 789
232 Ga0501032_0007967 3300049569 Bacteria 7722
233 Ga0501033_0595315 3300049570 Bacteria 759
234 Ga0501034_0069897 3300049571 Bacteria 3522
235 Ga0501036_0149290 3300049572 Bacteria 1971
236 Ga0501036_0528173 3300049572 Bacteria 981
237 Ga0501037_0025221 3300049573 Bacteria 4393
238 Ga0501037_0343737 3300049573 Unclassified 1030
239 Ga0501039_0148072 3300049575 Bacteria 1845
240 Ga0501040_0001956 3300049576 Bacteria 13274
241 Ga0501040_0217152 3300049576 Bacteria 1360
242 Ga0501041_0025885 3300049577 Bacteria 3528
243 Ga0501041_0026419 3300049577 Bacteria 3493
244 Ga0501042_0021837 3300049578 Bacteria 4466
245 Ga0501043_0000108 3300049579 Bacteria 77329
246 Ga0501043_0022379 3300049579 Bacteria 4958
247 Ga0501043_0048142 3300049579 Bacteria 3352
248 Ga0501043_0623449 3300049579 Bacteria 795
249 Ga0501046_0000050 3300049580 Bacteria 134922
250 Ga0501046_0065029 3300049580 Bacteria 2846
251 Ga0501047_0000012 3300049581 Bacteria 368824
252 Ga0501048_0001920 3300049582 Bacteria 15783
253 Ga0501048_0033944 3300049582 Bacteria 3684
254 Ga0501048_0063971 3300049582 Bacteria 2601
255 Ga0501048_0437144 3300049582 Bacteria 936
256 Ga0501068_0457041 3300049584 Bacteria 826
257 Ga0501071_0080701 3300049587 Bacteria 2379
258 Ga0501071_0086219 3300049587 Bacteria 2303
259 Ga0501072_0003566 3300049588 Bacteria 11705
260 Ga0501072_0181691 3300049588 Bacteria 1678
261 Ga0501074_0051752 3300049590 Bacteria 2964
262 Ga0501075_0000204 3300049591 Bacteria 31579
263 Ga0501075_0047064 3300049591 Bacteria 3241
264 Ga0501076_0038593 3300049592 Bacteria 3749
265 Ga0501076_0069475 3300049592 Bacteria 2814
266 Ga0501077_0019438 3300049593 Bacteria 4297
267 Ga0501077_0154333 3300049593 Bacteria 1457
268 Ga0501077_0351021 3300049593 Unclassified 941
269 Ga0501222_002144 3300049662 Bacteria 2737
270 Ga0501079_0003175 3300049741 Bacteria 12037
271 Ga0501079_0109360 3300049741 Bacteria 2147
272 Ga0501080_0025780 3300049742 Bacteria 5461
273 Ga0501081_0173510 3300049743 Bacteria 1557
274 Ga0501081_0197484 3300049743 Unclassified 1458
275 Ga0501035_0343415 3300049822 Bacteria 1250
276 Ga0501035_0434339 3300049822 Bacteria 1088
277 Ga0501035_0444388 3300049822 Bacteria 1073
278 Ga0501045_0002562 3300049824 Bacteria 12390
279 Ga0501045_0005119 3300049824 Bacteria 9072
280 Ga0501045_0214051 3300049824 Bacteria 1435
281 nmdc:mga03683_36049_c1 3300050489 Bacteria 2010
282 nmdc:mga0k408_27041_c1 3300050493 Bacteria 3256
283 nmdc:mga0k408_27087_c1 3300050493 Bacteria 3253
284 nmdc:mga0k408_483312_c1 3300050493 Bacteria 735
285 nmdc:mga04h51_149383_c1 3300050495 Bacteria 892
286 nmdc:mga05p37_693041_c2 3300050507 Unclassified 817
287 nmdc:mga08y16_284465_c1 3300050511 Bacteria 1705
288 nmdc:mga08y16_481_c1 3300050511 Bacteria 36847
289 Ga0500595_026020 3300053119 Bacteria 2021
290 Ga0500658_0010715 3300053134 Bacteria 3382
291 Ga0500622_0018928 3300053156 Bacteria 3659
292 Ga0500587_001782 3300053739 Bacteria 3059
293 Ga0501084_0008089 3300054114 Bacteria 8661
294 Ga0590075_018267 3300059424 Bacteria 1733
295 Ga0501082_0007651 3300060353 Bacteria 9320
296 Ga0501082_0219953 3300060353 Bacteria 1652
297 Ga0466962_0002526 3300061719 Bacteria 8691
298 Ga0466962_0034403 3300061719 Bacteria 2426
299 Ga0466962_0196859 3300061719 Bacteria 984
300 Ga0530510_0023561 3300061734 Bacteria 4388

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049522 Ga0501299_064850 Ga0501299_064850_16_543 166
2 3300048929 Ga0496126_0849715 Ga0496126_0849715_13_537 174
3 3300050493 nmdc:mga0k408_27087_c1 nmdc:mga0k408_27087_c1_1780_2334 175
4 3300031728 Ga0316578_10000202 Ga0316578_100002022 179
5 3300031733 Ga0316577_10013725 Ga0316577_100137253 179
6 3300048905 Ga0496102_0114266 Ga0496102_0114266_34_594 183
7 3300006177 Ga0075362_10033677 Ga0075362_100336772 184
8 3300006195 Ga0075366_10017777 Ga0075366_100177772 184
9 3300050489 nmdc:mga03683_36049_c1 nmdc:mga03683_36049_c1_927_1574 184
10 3300050493 nmdc:mga0k408_27041_c1 nmdc:mga0k408_27041_c1_702_1349 184
11 3300048920 Ga0496117_0191253 Ga0496117_0191253_572_1147 188
12 3300005937 Ga0081455_10103511 Ga0081455_101035112 189
13 3300009553 Ga0105249_11377201 Ga0105249_113772012 190
14 3300025246 Ga0209646_1001471 Ga0209646_10014717 190
15 3300025250 Ga0209026_1000162 Ga0209026_100016231 190
16 iso_pu_bacteria 2687453130 2687582457 192
17 3300005365 Ga0070688_100611785 Ga0070688_1006117851 195
18 3300044536 Ga0466988_0066541 Ga0466988_0066541_372_962 196
19 3300044656 Ga0466969_0002513 Ga0466969_0002513_486_1076 196
20 3300044663 Ga0466989_0182326 Ga0466989_0182326_604_1194 196
21 3300044684 Ga0466966_0061311 Ga0466966_0061311_1405_1995 196
22 3300044693 Ga0466961_0139611 Ga0466961_0139611_29_619 196
23 3300045976 Ga0466967_0011210 Ga0466967_0011210_6125_6730 196
24 3300049822 Ga0501035_0343415 Ga0501035_0343415_510_1121 196
25 3300061719 Ga0466962_0002526 Ga0466962_0002526_3991_4581 196
26 3300049593 Ga0501077_0351021 Ga0501077_0351021_101_766 198
27 iso_pu_bacteria 2643221577 2643894210 200
28 iso_pu_bacteria 2643221685 2644476412 200
29 3300004798 Ga0058859_10043507 Ga0058859_100435072 201
30 3300005347 Ga0070668_100151328 Ga0070668_1001513282 201
31 3300005441 Ga0070700_100035822 Ga0070700_1000358222 201
32 3300005617 Ga0068859_100083583 Ga0068859_1000835832 201
33 3300005844 Ga0068862_100260597 Ga0068862_1002605973 201
34 3300005985 Ga0081539_10003782 Ga0081539_1000378216 201
35 3300006931 Ga0097620_100083588 Ga0097620_1000835884 201
36 3300009094 Ga0111539_10231417 Ga0111539_102314173 201
37 3300009101 Ga0105247_10059414 Ga0105247_100594143 201
38 3300009147 Ga0114129_10847373 Ga0114129_108473732 201
39 3300011119 Ga0105246_10059714 Ga0105246_100597142 201
40 3300013308 Ga0157375_11149778 Ga0157375_111497781 201
41 3300017792 Ga0163161_10113330 Ga0163161_101133303 201
42 3300026035 Ga0207703_10556671 Ga0207703_105566712 201
43 3300026075 Ga0207708_10062788 Ga0207708_100627883 201
44 3300027907 Ga0207428_10106898 Ga0207428_101068982 201
45 3300028380 Ga0268265_10211370 Ga0268265_102113702 201
46 3300050507 nmdc:mga05p37_693041_c2 nmdc:mga05p37_693041_c2_154_774 201
47 3300050511 nmdc:mga08y16_284465_c1 nmdc:mga08y16_284465_c1_557_1177 201
48 iso_pu_bacteria 2886848708 2886854429 201
49 3300005343 Ga0070687_100331020 Ga0070687_1003310202 202
50 3300009094 Ga0111539_10005820 Ga0111539_100058204 202
51 3300025918 Ga0207662_10400316 Ga0207662_104003162 202
52 3300027907 Ga0207428_10013975 Ga0207428_100139752 202
53 3300050511 nmdc:mga08y16_481_c1 nmdc:mga08y16_481_c1_23328_23984 202
54 iso_pu_bacteria 2585428062 2587757634 202
55 3300003322 rootL2_10006461 rootL2_100064618 203
56 3300003323 rootH1_10024766 rootH1_100247664 203
57 3300003771 Ga0055526_1001331 Ga0055526_100133110 203
58 3300003792 Ga0055540_1018447 Ga0055540_10184472 203
59 3300003794 Ga0055531_10005778 Ga0055531_100057785 203
60 3300004625 Ga0055543_1002541 Ga0055543_10025415 203
61 3300005262 Ga0065165_1000395 Ga0065165_100039556 203
62 3300005262 Ga0065165_1000995 Ga0065165_100099530 203
63 3300005327 Ga0070658_10372803 Ga0070658_103728032 203
64 3300005328 Ga0070676_10024179 Ga0070676_100241792 203
65 3300005355 Ga0070671_100020110 Ga0070671_1000201103 203
66 3300005356 Ga0070674_100080320 Ga0070674_1000803202 203
67 3300005459 Ga0068867_100000005 Ga0068867_10000000522 203
68 3300005840 Ga0068870_10022163 Ga0068870_100221633 203
69 3300006177 Ga0075362_10060236 Ga0075362_100602362 203
70 3300006178 Ga0075367_10093105 Ga0075367_100931052 203
71 3300006353 Ga0075370_10007774 Ga0075370_100077743 203
72 3300006353 Ga0075370_10044698 Ga0075370_100446982 203
73 3300006942 Ga0099824_1043770 Ga0099824_10437701 203
74 3300006944 Ga0099823_1000985 Ga0099823_100098514 203
75 3300009148 Ga0105243_10006176 Ga0105243_100061769 203
76 3300012497 Ga0157319_1000006 Ga0157319_100000696 203
77 3300014745 Ga0157377_10000244 Ga0157377_1000024423 203
78 3300021361 Ga0213872_10000647 Ga0213872_1000064720 203
79 3300025242 Ga0209258_112615 Ga0209258_1126152 203
80 3300025273 Ga0209673_1010710 Ga0209673_10107104 203
81 3300025295 Ga0209564_1000003 Ga0209564_10000031350 203
82 3300025298 Ga0209050_1012336 Ga0209050_10123362 203
83 3300025299 Ga0209256_1002401 Ga0209256_10024017 203
84 3300025303 Ga0209051_1003352 Ga0209051_100335210 203
85 3300025304 Ga0209257_1001931 Ga0209257_10019316 203
86 3300025935 Ga0207709_10003666 Ga0207709_100036662 203
87 3300026089 Ga0207648_10000541 Ga0207648_1000054116 203
88 3300026142 Ga0207698_10366601 Ga0207698_103666012 203
89 3300027296 Ga0209389_1010870 Ga0209389_10108704 203
90 3300027866 Ga0209813_10101827 Ga0209813_101018272 203
91 3300027876 Ga0209974_10001160 Ga0209974_100011603 203
92 3300028577 Ga0265318_10143310 Ga0265318_101433102 203
93 3300028794 Ga0307515_10002409 Ga0307515_1000240910 203
94 3300031456 Ga0307513_10137312 Ga0307513_101373122 203
95 3300031456 Ga0307513_10464561 Ga0307513_104645612 203
96 3300031730 Ga0307516_10001303 Ga0307516_1000130318 203
97 3300032005 Ga0307411_10199788 Ga0307411_101997882 203
98 3300035725 Ga0373947_0466735 Ga0373947_0466735_134_760 203
99 3300037068 Ga0373925_0069518 Ga0373925_0069518_1193_1819 203
100 3300037471 Ga0395905_0029070 Ga0395905_0029070_2889_3548 203
101 3300037471 Ga0395905_0044723 Ga0395905_0044723_2060_2710 203
102 3300038443 Ga0395901_0146934 Ga0395901_0146934_1520_2179 203
103 3300039447 Ga0436361_0882487 Ga0436361_0882487_25289_25918 203
104 3300039447 Ga0436361_0969151 Ga0436361_0969151_408_1049 203
105 3300041452 Ga0451793_0466386 Ga0451793_0466386_363_1010 203
106 3300041459 Ga0451800_0410668 Ga0451800_0410668_422_1069 203
107 3300041997 Ga0439431_0001183 Ga0439431_0001183_524_1171 203
108 3300042127 Ga0450890_004141 Ga0450890_004141_237_872 203
109 3300042134 Ga0450898_029761 Ga0450898_029761_341_982 203
110 3300042438 Ga0439459_0002812 Ga0439459_0002812_1104_1739 203
111 3300042876 Ga0451577_0027444 Ga0451577_0027444_672_1301 203
112 3300042876 Ga0451577_0637187 Ga0451577_0637187_73_690 203
113 3300044694 Ga0466963_0149236 Ga0466963_0149236_576_1211 203
114 3300044712 Ga0453684_0665103 Ga0453684_0665103_133_780 203
115 3300045051 Ga0451576_0820558 Ga0451576_0820558_62_712 203
116 3300046499 Ga0495594_0219075 Ga0495594_0219075_32_679 203
117 3300046512 Ga0495610_0063981 Ga0495610_0063981_743_1390 203
118 3300046515 Ga0495620_0010812 Ga0495620_0010812_3535_4182 203
119 3300046519 Ga0495632_0240399 Ga0495632_0240399_123_770 203
120 3300046522 Ga0495643_0174248 Ga0495643_0174248_177_824 203
121 3300046660 Ga0495625_0009603 Ga0495625_0009603_2175_2822 203
122 3300047472 Ga0495686_0081747 Ga0495686_0081747_46_693 203
123 3300048927 Ga0496124_0024076 Ga0496124_0024076_663_1298 203
124 3300049579 Ga0501043_0000108 Ga0501043_0000108_11705_12352 203
125 3300049580 Ga0501046_0000050 Ga0501046_0000050_65016_65663 203
126 3300049581 Ga0501047_0000012 Ga0501047_0000012_303169_303816 203
127 3300049582 Ga0501048_0001920 Ga0501048_0001920_9282_9929 203
128 3300049662 Ga0501222_002144 Ga0501222_002144_1921_2559 203
129 3300049824 Ga0501045_0005119 Ga0501045_0005119_6777_7424 203
130 3300050493 nmdc:mga0k408_483312_c1 nmdc:mga0k408_483312_c1_65_712 203
131 3300050495 nmdc:mga04h51_149383_c1 nmdc:mga04h51_149383_c1_43_690 203
132 3300053134 Ga0500658_0010715 Ga0500658_0010715_2285_2932 203
133 3300053156 Ga0500622_0018928 Ga0500622_0018928_2266_2901 203
134 3300053739 Ga0500587_001782 Ga0500587_001782_277_924 203
135 3300059424 Ga0590075_018267 Ga0590075_018267_660_1307 203
136 iso_pu_bacteria 2831864461 2831869958 203
137 3300002705 JGI25156J39149_1016013 JGI25156J39149_10160132 204
138 3300002737 JGI25162J39368_1006056 JGI25162J39368_10060563 204
139 3300002738 JGI25154J39366_1004852 JGI25154J39366_10048521 204
140 3300002741 JGI25157J39369_1001473 JGI25157J39369_10014732 204
141 3300002741 JGI25157J39369_1003405 JGI25157J39369_10034053 204
142 3300002772 JGI25164J39214_1000587 JGI25164J39214_10005873 204
143 3300003214 JGI25165J46597_1001159 JGI25165J46597_10011593 204
144 3300003752 Ga0055539_1005625 Ga0055539_10056251 204
145 3300003752 Ga0055539_1016633 Ga0055539_10166332 204
146 3300003756 Ga0055533_1006060 Ga0055533_10060602 204
147 3300003759 Ga0055525_1000233 Ga0055525_100023328 204
148 3300003759 Ga0055525_1000346 Ga0055525_10003465 204
149 3300003760 Ga0055527_1000149 Ga0055527_100014941 204
150 3300003760 Ga0055527_1000259 Ga0055527_100025920 204
151 3300003760 Ga0055527_1000266 Ga0055527_100026611 204
152 3300003760 Ga0055527_1006338 Ga0055527_10063383 204
153 3300003761 Ga0055535_1000395 Ga0055535_10003953 204
154 3300003761 Ga0055535_1000606 Ga0055535_10006069 204
155 3300003761 Ga0055535_1000651 Ga0055535_100065115 204
156 3300003761 Ga0055535_1001113 Ga0055535_100111314 204
157 3300003762 Ga0055542_1000167 Ga0055542_100016741 204
158 3300003762 Ga0055542_1000264 Ga0055542_100026420 204
159 3300003762 Ga0055542_1000364 Ga0055542_10003643 204
160 3300003762 Ga0055542_1008129 Ga0055542_10081292 204
161 3300003763 Ga0055529_1000416 Ga0055529_100041632 204
162 3300003763 Ga0055529_1000640 Ga0055529_100064022 204
163 3300003763 Ga0055529_1000908 Ga0055529_10009082 204
164 3300005327 Ga0070658_10235109 Ga0070658_102351091 204
165 3300005335 Ga0070666_10000007 Ga0070666_10000007192 204
166 3300005344 Ga0070661_100090668 Ga0070661_1000906682 204
167 3300005347 Ga0070668_100762213 Ga0070668_1007622131 204
168 3300005367 Ga0070667_100037500 Ga0070667_1000375002 204
169 3300005455 Ga0070663_100582984 Ga0070663_1005829841 204
170 3300005456 Ga0070678_101017214 Ga0070678_1010172141 204
171 3300005539 Ga0068853_100826189 Ga0068853_1008261892 204
172 3300005548 Ga0070665_100000817 Ga0070665_10000081723 204
173 3300005578 Ga0068854_100020103 Ga0068854_1000201033 204
174 3300005614 Ga0068856_100002593 Ga0068856_1000025939 204
175 3300005616 Ga0068852_100003098 Ga0068852_1000030987 204
176 3300006237 Ga0097621_100075175 Ga0097621_1000751753 204
177 3300006358 Ga0068871_100066264 Ga0068871_1000662643 204
178 3300009545 Ga0105237_10000595 Ga0105237_1000059531 204
179 3300009551 Ga0105238_10001931 Ga0105238_1000193117 204
180 3300009551 Ga0105238_10216353 Ga0105238_102163533 204
181 3300009553 Ga0105249_10819678 Ga0105249_108196782 204
182 3300013104 Ga0157370_10006616 Ga0157370_100066164 204
183 3300013306 Ga0163162_10001668 Ga0163162_100016685 204
184 3300015685 Ga0183369_1009 Ga0183369_1009189 204
185 3300025226 Ga0209674_100523 Ga0209674_1005239 204
186 3300025228 Ga0209672_100007 Ga0209672_100007468 204
187 3300025228 Ga0209672_100018 Ga0209672_100018271 204
188 3300025228 Ga0209672_100198 Ga0209672_10019842 204
189 3300025228 Ga0209672_100599 Ga0209672_10059920 204
190 3300025230 Ga0209563_100071 Ga0209563_100071136 204
191 3300025231 Ga0207427_100036 Ga0207427_100036248 204
192 3300025233 Ga0209437_101013 Ga0209437_1010138 204
193 3300025242 Ga0209258_100017 Ga0209258_100017350 204
194 3300025242 Ga0209258_100024 Ga0209258_100024377 204
195 3300025242 Ga0209258_100035 Ga0209258_100035197 204
196 3300025242 Ga0209258_100379 Ga0209258_10037914 204
197 3300025246 Ga0209646_1005067 Ga0209646_10050672 204
198 3300025250 Ga0209026_1000056 Ga0209026_1000056156 204
199 3300025250 Ga0209026_1000513 Ga0209026_100051315 204
200 3300025253 Ga0209677_101331 Ga0209677_10133110 204
201 3300025253 Ga0209677_106509 Ga0209677_1065093 204
202 3300025254 Ga0209148_1000009 Ga0209148_1000009705 204
203 3300025254 Ga0209148_1000044 Ga0209148_1000044352 204
204 3300025254 Ga0209148_1000045 Ga0209148_100004542 204
205 3300025254 Ga0209148_1000048 Ga0209148_1000048165 204
206 3300025256 Ga0209759_1000166 Ga0209759_100016637 204
207 3300025256 Ga0209759_1000670 Ga0209759_10006703 204
208 3300025261 Ga0209233_1000101 Ga0209233_1000101248 204
209 3300025272 Ga0209455_1000010 Ga0209455_1000010468 204
210 3300025272 Ga0209455_1000029 Ga0209455_1000029377 204
211 3300025272 Ga0209455_1000035 Ga0209455_100003542 204
212 3300025272 Ga0209455_1000560 Ga0209455_100056027 204
213 3300025903 Ga0207680_10000002 Ga0207680_10000002634 204
214 3300025909 Ga0207705_10032332 Ga0207705_100323321 204
215 3300025914 Ga0207671_10010424 Ga0207671_100104244 204
216 3300025920 Ga0207649_10062885 Ga0207649_100628852 204
217 3300025924 Ga0207694_10000177 Ga0207694_1000017724 204
218 3300025924 Ga0207694_10133598 Ga0207694_101335983 204
219 3300025949 Ga0207667_10317081 Ga0207667_103170812 204
220 3300025981 Ga0207640_10015853 Ga0207640_100158534 204
221 3300025986 Ga0207658_10108538 Ga0207658_101085383 204
222 3300026041 Ga0207639_10464967 Ga0207639_104649671 204
223 3300026067 Ga0207678_10146910 Ga0207678_101469101 204
224 3300026067 Ga0207678_10290017 Ga0207678_102900172 204
225 3300026078 Ga0207702_10018842 Ga0207702_100188428 204
226 3300028379 Ga0268266_10000004 Ga0268266_10000004630 204
227 3300031250 Ga0265331_10042041 Ga0265331_100420412 204
228 3300031824 Ga0307413_10370352 Ga0307413_103703522 204
229 3300031852 Ga0307410_10010051 Ga0307410_100100513 204
230 3300032004 Ga0307414_10066531 Ga0307414_100665312 204
231 3300033180 Ga0307510_10001742 Ga0307510_100017427 204
232 3300037312 Ga0395899_0000404 Ga0395899_0000404_37454_38068 204
233 3300037312 Ga0395899_0010991 Ga0395899_0010991_2203_2820 204
234 3300037418 Ga0395900_0000107 Ga0395900_0000107_76989_77603 204
235 3300037466 Ga0395898_0000078 Ga0395898_0000078_42287_42904 204
236 3300037466 Ga0395898_0000211 Ga0395898_0000211_24779_25393 204
237 3300038443 Ga0395901_0304485 Ga0395901_0304485_997_1614 204
238 3300042184 Ga0450908_002562 Ga0450908_002562_545_1168 204
239 3300044656 Ga0466969_0234492 Ga0466969_0234492_144_758 204
240 3300044684 Ga0466966_0016803 Ga0466966_0016803_2253_2867 204
241 3300044693 Ga0466961_0000906 Ga0466961_0000906_9420_10037 204
242 3300044693 Ga0466961_0002884 Ga0466961_0002884_6679_7293 204
243 3300044693 Ga0466961_0022546 Ga0466961_0022546_3413_4027 204
244 3300044706 Ga0466964_0008393 Ga0466964_0008393_2249_2863 204
245 3300044735 Ga0466968_0057910 Ga0466968_0057910_538_1152 204
246 3300044765 Ga0466970_0005775 Ga0466970_0005775_3372_3986 204
247 3300044765 Ga0466970_0006092 Ga0466970_0006092_2172_2786 204
248 3300044842 Ga0466957_0062767 Ga0466957_0062767_1572_2186 204
249 3300045049 Ga0466959_0000110 Ga0466959_0000110_21572_22186 204
250 3300045049 Ga0466959_0029071 Ga0466959_0029071_3145_3759 204
251 3300045049 Ga0466959_0102986 Ga0466959_0102986_289_903 204
252 3300045836 Ga0466958_0081242 Ga0466958_0081242_148_765 204
253 3300046507 Ga0495606_0070583 Ga0495606_0070583_144_767 204
254 3300046660 Ga0495625_0018610 Ga0495625_0018610_780_1403 204
255 3300048928 Ga0496125_0181577 Ga0496125_0181577_696_1319 204
256 3300048929 Ga0496126_0122272 Ga0496126_0122272_803_1426 204
257 3300049568 Ga0501031_0494147 Ga0501031_0494147_65_697 204
258 3300049569 Ga0501032_0007967 Ga0501032_0007967_1251_1877 204
259 3300049570 Ga0501033_0595315 Ga0501033_0595315_10_639 204
260 3300049571 Ga0501034_0069897 Ga0501034_0069897_1695_2321 204
261 3300049572 Ga0501036_0149290 Ga0501036_0149290_540_1172 204
262 3300049572 Ga0501036_0528173 Ga0501036_0528173_230_853 204
263 3300049573 Ga0501037_0025221 Ga0501037_0025221_936_1562 204
264 3300049573 Ga0501037_0343737 Ga0501037_0343737_382_1014 204
265 3300049575 Ga0501039_0148072 Ga0501039_0148072_604_1227 204
266 3300049576 Ga0501040_0001956 Ga0501040_0001956_11756_12388 204
267 3300049576 Ga0501040_0217152 Ga0501040_0217152_12_635 204
268 3300049577 Ga0501041_0025885 Ga0501041_0025885_2419_3051 204
269 3300049577 Ga0501041_0026419 Ga0501041_0026419_2717_3340 204
270 3300049578 Ga0501042_0021837 Ga0501042_0021837_542_1174 204
271 3300049579 Ga0501043_0022379 Ga0501043_0022379_3493_4119 204
272 3300049579 Ga0501043_0048142 Ga0501043_0048142_1156_1788 204
273 3300049579 Ga0501043_0623449 Ga0501043_0623449_97_726 204
274 3300049580 Ga0501046_0065029 Ga0501046_0065029_1241_1867 204
275 3300049582 Ga0501048_0033944 Ga0501048_0033944_565_1194 204
276 3300049582 Ga0501048_0063971 Ga0501048_0063971_633_1265 204
277 3300049582 Ga0501048_0437144 Ga0501048_0437144_240_863 204
278 3300049584 Ga0501068_0457041 Ga0501068_0457041_141_773 204
279 3300049587 Ga0501071_0080701 Ga0501071_0080701_1525_2148 204
280 3300049587 Ga0501071_0086219 Ga0501071_0086219_848_1480 204
281 3300049588 Ga0501072_0003566 Ga0501072_0003566_8282_8914 204
282 3300049588 Ga0501072_0181691 Ga0501072_0181691_260_883 204
283 3300049590 Ga0501074_0051752 Ga0501074_0051752_435_1067 204
284 3300049591 Ga0501075_0000204 Ga0501075_0000204_278_910 204
285 3300049591 Ga0501075_0047064 Ga0501075_0047064_1525_2148 204
286 3300049592 Ga0501076_0038593 Ga0501076_0038593_526_1158 204
287 3300049592 Ga0501076_0069475 Ga0501076_0069475_1902_2525 204
288 3300049593 Ga0501077_0019438 Ga0501077_0019438_2212_2844 204
289 3300049593 Ga0501077_0154333 Ga0501077_0154333_543_1166 204
290 3300049741 Ga0501079_0003175 Ga0501079_0003175_3451_4083 204
291 3300049741 Ga0501079_0109360 Ga0501079_0109360_1351_1974 204
292 3300049742 Ga0501080_0025780 Ga0501080_0025780_3671_4303 204
293 3300049743 Ga0501081_0173510 Ga0501081_0173510_191_814 204
294 3300049743 Ga0501081_0197484 Ga0501081_0197484_206_838 204
295 3300049822 Ga0501035_0434339 Ga0501035_0434339_271_900 204
296 3300049822 Ga0501035_0444388 Ga0501035_0444388_150_803 204
297 3300049824 Ga0501045_0002562 Ga0501045_0002562_6876_7508 204
298 3300049824 Ga0501045_0214051 Ga0501045_0214051_572_1195 204
299 3300053119 Ga0500595_026020 Ga0500595_026020_351_983 204
300 3300054114 Ga0501084_0008089 Ga0501084_0008089_2032_2664 204
301 3300060353 Ga0501082_0007651 Ga0501082_0007651_5038_5670 204
302 3300060353 Ga0501082_0219953 Ga0501082_0219953_192_815 204
303 3300061719 Ga0466962_0034403 Ga0466962_0034403_656_1270 204
304 3300061719 Ga0466962_0196859 Ga0466962_0196859_275_892 204
305 3300061734 Ga0530510_0023561 Ga0530510_0023561_435_1067 204

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00697

PRAI

N-(5'phosphoribosyl)anthranilate (PRA) isomerase

10

220

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1dl3-assembly1.cif.gz_A crystal structure of mutually generated monomers of dimeric phosphoribosylantranilate isomerase from thermotoga maritima 0.9394 1 204
1dl3-assembly1.cif.gz_A crystal structure of mutually generated monomers of dimeric phosphoribosylantranilate isomerase from thermotoga maritima 0.9346 1 204
1dl3-assembly2.cif.gz_B crystal structure of mutually generated monomers of dimeric phosphoribosylantranilate isomerase from thermotoga maritima 0.9294 1 204
1dl3-assembly2.cif.gz_B crystal structure of mutually generated monomers of dimeric phosphoribosylantranilate isomerase from thermotoga maritima 0.9248 1 204
1lbm-assembly1.cif.gz_A crystal structure of phosphoribosyl anthranilate isomerase (prai) in complex with reduced 1-(o-carboxyphenylamino)-1-deoxyribulose 5-phosphate (rcdrp) 0.8916 1 204
ID Description Score Start End Superfamily
1dl3A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9394 1 204 3.20.20.70
1dl3A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9346 1 204 3.20.20.70
af_Q8LPI9_65_212_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9221 1 103 3.20.20.70
af_Q2FYR5_1_206_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8625 2 204 3.20.20.70
1v5xB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8596 2 203 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A3C1AM95-F1-model_v4 deleted 0.9789 1 102
AF-T1DD38-F1-model_v4 phosphoribosylanthranilate isomerase (EC 5.3.1.24) 0.9756 1 98 GO:0000162
GO:0004640
GO:0006568
AF-A0A352FYC5-F1-model_v4 deleted 0.9746 1 85
AF-A0A7R8WYD6-F1-model_v4 phosphoribosylanthranilate isomerase (EC 5.3.1.24) 0.9687 1 125 GO:0000162
GO:0004640
GO:0006568
AF-B9TJ98-F1-model_v4 phosphoribosylanthranilate isomerase (EC 5.3.1.24) 0.9683 1 102 GO:0000162
GO:0004640
GO:0006568

Feature Viewer

pLDDT pTM Quality
90.37 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map