F368796

General Info

Members Datasets Scaffolds Average Seq Length
259 204 259 143

Family's Representative Sequence

Representative Sequence 3300009551|Ga0105238_10398992|Ga0105238_103989923
Length 158
Sequence MADKAVKADXXXKKTEGTTLKVHHLRPAPGARTAKTRVGRGEGSKGKTAGTKARYQVPERFEGGQMPLHMRLPKLRGFTNPFRVEYQVVNLDRLAALYPDGGDVTVDDLVAKGAVRDGRPVKVLGTGEIDVKVNVTVNKFSGSAKEKIEAAGGSATTV

Samples

Sample ID Description Type Environment
1 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
2 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
5 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
29 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
30 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
31 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
35 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300009988 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_233 metaG Metagenome Rhizosphere
40 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
41 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
42 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
43 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
46 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300013875 Rhizosphere microbial communities from switchgrass unharvested rhizosphere in Austin, TX, USA - RS_233 Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
52 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
60 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
94 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
95 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
96 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
97 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
98 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
99 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
100 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
101 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
102 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
103 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
104 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
105 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
106 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
107 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
108 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
109 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
110 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
111 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
112 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
113 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
114 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
115 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
116 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
117 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
118 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
119 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
120 3300041444 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaT Metatranscriptome Rhizoplane
121 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
122 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
123 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
124 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
125 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
126 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
127 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
128 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
129 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
130 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
131 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
132 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
133 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
134 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
135 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
136 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
137 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
138 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
139 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
140 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
141 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
142 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
143 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
144 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
145 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
146 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
147 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
148 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
149 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
150 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
151 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
152 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
153 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
154 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
155 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
156 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
157 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
158 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
159 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
160 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
161 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
162 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
163 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
164 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
165 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
166 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
167 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
168 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
169 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
170 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
171 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300049546 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_B_4_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
186 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
187 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
188 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
189 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
190 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
191 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
192 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
193 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
194 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
195 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
196 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
197 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.94
Metatranscriptomes 15.06
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.7
Nodule 0
Rhizoplane 11.2
Rhizosphere 79.15
Stem 0
Stem Tuber 0
Unclassified 6.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10175041 3300001990 Bacteria 633
2 Ga0006759J45824_1045259 3300003163 Bacteria 734
3 Ga0007416J51690_1046985 3300003577 Bacteria 1084
4 Ga0006562J51391_1025953 3300003578 Bacteria 3501
5 Ga0032354_1028635 3300003693 Bacteria 938
6 Ga0070658_10001764 3300005327 Bacteria 18213
7 Ga0070658_11467822 3300005327 Bacteria 591
8 Ga0070676_10738357 3300005328 Bacteria 722
9 Ga0068869_100266935 3300005334 Bacteria 1372
10 Ga0070666_10452019 3300005335 Bacteria 928
11 Ga0070666_10907473 3300005335 Bacteria 651
12 Ga0070680_100004398 3300005336 Bacteria 10606
13 Ga0070682_100189910 3300005337 Bacteria 1441
14 Ga0070660_100526773 3300005339 Bacteria 985
15 Ga0070667_100746660 3300005367 Bacteria 907
16 Ga0070714_100092034 3300005435 Bacteria 2658
17 Ga0070713_100037637 3300005436 Bacteria 3913
18 Ga0070711_100108381 3300005439 Bacteria 2035
19 Ga0070700_100490696 3300005441 Bacteria 943
20 Ga0070663_100484491 3300005455 Bacteria 1024
21 Ga0070681_10004293 3300005458 Bacteria 13527
22 Ga0070679_100006878 3300005530 Bacteria 10606
23 Ga0070693_100192589 3300005547 Bacteria 1319
24 Ga0070665_100311175 3300005548 Bacteria 1579
25 Ga0070665_101176861 3300005548 Bacteria 778
26 Ga0068859_101853507 3300005617 Bacteria 666
27 Ga0068866_10328975 3300005718 Bacteria 964
28 Ga0068861_100183906 3300005719 Bacteria 1742
29 Ga0068858_100000013 3300005842 Bacteria 216466
30 Ga0068860_100420082 3300005843 Bacteria 1325
31 Ga0075363_100056996 3300006048 Bacteria 2096
32 Ga0075364_10962549 3300006051 Bacteria 581
33 Ga0075430_100071301 3300006846 Bacteria 2915
34 Ga0075431_100563477 3300006847 Bacteria 1126
35 Ga0097620_101853521 3300006931 Bacteria 666
36 Ga0105245_10449770 3300009098 Bacteria 1296
37 Ga0105247_10898768 3300009101 Bacteria 684
38 Ga0114129_10000114 3300009147 Bacteria 80730
39 Ga0105242_10217228 3300009176 Bacteria 1707
40 Ga0105248_10000592 3300009177 Bacteria 41265
41 Ga0105238_10010490 3300009551 Bacteria 9300
42 Ga0105238_10258338 3300009551 Bacteria 1721
43 Ga0105238_10398992 3300009551 Bacteria 1368
44 Ga0105035_101271 3300009988 Bacteria 1719
45 Ga0105246_10097972 3300011119 Bacteria 2129
46 Ga0105246_10858489 3300011119 Bacteria 810
47 Ga0157341_1035886 3300012494 Bacteria 556
48 Ga0157373_10705476 3300013100 Bacteria 740
49 Ga0157371_10369078 3300013102 Bacteria 1047
50 Ga0157371_10532866 3300013102 Bacteria 869
51 Ga0157370_11040645 3300013104 Bacteria 740
52 Ga0157370_11755650 3300013104 Bacteria 557
53 Ga0157369_10116718 3300013105 Bacteria 2834
54 Ga0157369_11776185 3300013105 Bacteria 626
55 Ga0163162_10096826 3300013306 Bacteria 3039
56 Ga0157372_10830671 3300013307 Bacteria 1073
57 Ga0157372_12339899 3300013307 Bacteria 614
58 Ga0157375_10251615 3300013308 Bacteria 1928
59 Ga0157375_10875352 3300013308 Bacteria 1043
60 Ga0157375_11104329 3300013308 Bacteria 928
61 Ga0157515_119482 3300013875 Bacteria 1496
62 Ga0163163_10023608 3300014325 Bacteria 5838
63 Ga0157380_10188583 3300014326 Bacteria 1818
64 Ga0157377_10286816 3300014745 Bacteria 1081
65 Ga0157377_11609890 3300014745 Bacteria 520
66 Ga0157379_10000012 3300014968 Bacteria 110577
67 Ga0206356_10144764 3300020070 Bacteria 839
68 Ga0206349_1568563 3300020075 Bacteria 518
69 Ga0206352_11084786 3300020078 Bacteria 940
70 Ga0206354_10324951 3300020081 Bacteria 1945
71 Ga0206354_10397469 3300020081 Bacteria 910
72 Ga0206354_10832937 3300020081 Bacteria 1529
73 Ga0206353_10139934 3300020082 Bacteria 2073
74 Ga0206353_10558793 3300020082 Bacteria 6343
75 Ga0154015_1499110 3300020610 Bacteria 867
76 Ga0224712_10001920 3300022467 Bacteria 5006
77 Ga0224712_10035220 3300022467 Bacteria 1847
78 Ga0207710_10294864 3300025900 Bacteria 818
79 Ga0207680_10018574 3300025903 Bacteria 3700
80 Ga0207699_10031709 3300025906 Bacteria 2970
81 Ga0207645_10808543 3300025907 Bacteria 637
82 Ga0207643_10037760 3300025908 Bacteria 2710
83 Ga0207705_10000671 3300025909 Bacteria 28465
84 Ga0207705_10319697 3300025909 Bacteria 1192
85 Ga0207707_10001820 3300025912 Bacteria 19557
86 Ga0207693_10078402 3300025915 Bacteria 2586
87 Ga0207663_10074231 3300025916 Bacteria 2203
88 Ga0207660_10000562 3300025917 Bacteria 24961
89 Ga0207657_10115193 3300025919 Bacteria 2216
90 Ga0207652_10000632 3300025921 Bacteria 34827
91 Ga0207652_10749856 3300025921 Bacteria 869
92 Ga0207694_10178591 3300025924 Bacteria 1721
93 Ga0207700_10075028 3300025928 Bacteria 2619
94 Ga0207664_10145877 3300025929 Bacteria 2007
95 Ga0207706_10795017 3300025933 Bacteria 804
96 Ga0207686_10174357 3300025934 Bacteria 1519
97 Ga0207711_10000484 3300025941 Bacteria 41154
98 Ga0207689_10399764 3300025942 Bacteria 1145
99 Ga0207668_10638710 3300025972 Bacteria 931
100 Ga0207640_10140109 3300025981 Bacteria 1762
101 Ga0207658_10709960 3300025986 Bacteria 909
102 Ga0207703_10000009 3300026035 Bacteria 343983
103 Ga0207639_10012050 3300026041 Bacteria 6016
104 Ga0207678_10448057 3300026067 Bacteria 1122
105 Ga0207641_10000478 3300026088 Bacteria 45330
106 Ga0207641_10247162 3300026088 Bacteria 1665
107 Ga0207648_10661133 3300026089 Bacteria 966
108 Ga0207675_100043014 3300026118 Bacteria 4218
109 Ga0207675_101047228 3300026118 Bacteria 835
110 Ga0207683_10054374 3300026121 Bacteria 3511
111 Ga0207698_11922653 3300026142 Bacteria 606
112 Ga0268266_10001438 3300028379 Bacteria 28348
113 Ga0268266_10312713 3300028379 Bacteria 1468
114 Ga0268266_10589756 3300028379 Bacteria 1067
115 Ga0268264_10000097 3300028381 Bacteria 229722
116 Ga0268264_10908110 3300028381 Bacteria 884
117 Ga0268264_11233459 3300028381 Bacteria 757
118 Ga0307517_10282063 3300028786 Bacteria 946
119 Ga0307517_10664929 3300028786 Bacteria 505
120 Ga0307515_10001812 3300028794 Bacteria 47673
121 Ga0307515_10221566 3300028794 Bacteria 1708
122 Ga0265340_10001238 3300031247 Bacteria 14637
123 Ga0307509_10401613 3300031507 Bacteria 1077
124 Ga0307508_10214974 3300031616 Bacteria 1523
125 Ga0307514_10065601 3300031649 Bacteria 2749
126 Ga0307514_10527684 3300031649 Bacteria 552
127 Ga0307516_10039181 3300031730 Bacteria 4725
128 Ga0307516_10049250 3300031730 Bacteria 4142
129 Ga0307405_11220907 3300031731 Bacteria 651
130 Ga0307410_11416966 3300031852 Bacteria 610
131 Ga0307406_10260612 3300031901 Bacteria 1311
132 Ga0307409_100154885 3300031995 Bacteria 1995
133 Ga0307409_100283121 3300031995 Bacteria 1533
134 Ga0307409_100337125 3300031995 Bacteria 1417
135 Ga0307416_101009191 3300032002 Bacteria 935
136 Ga0307416_102110666 3300032002 Bacteria 665
137 Ga0307414_10766612 3300032004 Bacteria 878
138 Ga0307411_11484409 3300032005 Bacteria 623
139 Ga0307415_100017143 3300032126 Bacteria 4336
140 Ga0307415_101322120 3300032126 Bacteria 683
141 Ga0307507_10452631 3300033179 Bacteria 708
142 Ga0307510_10151763 3300033180 Bacteria 1934
143 Ga0373923_0700023 3300035111 Bacteria 503
144 Ga0373932_0151979 3300035112 Bacteria 795
145 Ga0373939_0184102 3300035114 Bacteria 781
146 Ga0373935_1030613 3300035692 Bacteria 612
147 Ga0373925_0388720 3300037068 Bacteria 1137
148 Ga0395899_0079065 3300037312 Bacteria 2396
149 Ga0395899_0383625 3300037312 Bacteria 933
150 Ga0395899_0407583 3300037312 Bacteria 898
151 Ga0395900_0109052 3300037418 Bacteria 2844
152 Ga0395900_0383789 3300037418 Bacteria 1372
153 Ga0395898_0024956 3300037466 Bacteria 6026
154 Ga0395905_0833108 3300037471 Bacteria 825
155 Ga0395901_0052959 3300038443 Bacteria 4217
156 Ga0395901_0107597 3300038443 Bacteria 2927
157 Ga0395901_0151546 3300038443 Bacteria 2436
158 Ga0395901_0482599 3300038443 Bacteria 1264
159 Ga0395901_0925579 3300038443 Bacteria 852
160 Ga0451790_44515 3300041444 Bacteria 555
161 Ga0451791_0635685 3300041451 Bacteria 1912
162 Ga0451802_0385948 3300041460 Bacteria 611
163 Ga0451805_122515 3300041461 Bacteria 560
164 Ga0451804_0953991 3300041463 Bacteria 819
165 Ga0451807_0859230 3300041486 Bacteria 724
166 Ga0451833_0613043 3300041491 Bacteria 596
167 Ga0451837_1302984 3300041494 Bacteria 601
168 Ga0451847_0380697 3300041503 Bacteria 1186
169 Ga0439458_0179004 3300042157 Bacteria 575
170 Ga0439464_0029215 3300042439 Bacteria 1540
171 Ga0466965_0003400 3300044683 Bacteria 6969
172 Ga0466963_0226982 3300044694 Bacteria 1308
173 Ga0466957_0313791 3300044842 Bacteria 1056
174 Ga0466960_0109127 3300044901 Bacteria 1435
175 Ga0466958_0505809 3300045836 Bacteria 784
176 Ga0495627_002860 3300046453 Bacteria 7966
177 Ga0495629_0180208 3300046459 Bacteria 1464
178 Ga0495651_0058308 3300046462 Bacteria 2962
179 Ga0495610_0017172 3300046512 Bacteria 4133
180 Ga0495616_0103001 3300046513 Bacteria 1337
181 Ga0495628_0016156 3300046516 Bacteria 6228
182 Ga0495663_0040005 3300046525 Bacteria 1422
183 Ga0495652_0024515 3300046529 Bacteria 5339
184 Ga0495587_0271733 3300046536 Bacteria 951
185 Ga0495645_0163291 3300046543 Bacteria 1538
186 Ga0495645_0528898 3300046543 Bacteria 733
187 Ga0495656_0171913 3300046615 Bacteria 1060
188 Ga0495657_0101767 3300046675 Bacteria 1830
189 Ga0495613_0202257 3300046689 Bacteria 1400
190 Ga0495589_0375454 3300046794 Bacteria 654
191 Ga0495600_0011482 3300046809 Bacteria 5520
192 Ga0495600_0478067 3300046809 Bacteria 768
193 Ga0495581_0490895 3300047315 Bacteria 714
194 Ga0495604_0481183 3300047317 Bacteria 807
195 Ga0495674_0695412 3300047319 Bacteria 798
196 Ga0495675_0102261 3300047444 Bacteria 1792
197 Ga0495615_0014403 3300048090 Bacteria 1671
198 Ga0496100_0136705 3300048903 Bacteria 1732
199 Ga0496102_0014656 3300048905 Bacteria 6814
200 Ga0496104_1613095 3300048907 Bacteria 551
201 Ga0496105_0105968 3300048908 Bacteria 2320
202 Ga0496105_0386083 3300048908 Bacteria 1114
203 Ga0496106_0337956 3300048909 Bacteria 1209
204 Ga0496107_0118276 3300048910 Bacteria 1951
205 Ga0496107_0215245 3300048910 Bacteria 1429
206 Ga0496108_0564511 3300048911 Bacteria 992
207 Ga0496109_0008096 3300048912 Bacteria 8910
208 Ga0496110_0079129 3300048913 Bacteria 2926
209 Ga0496110_0144447 3300048913 Bacteria 2151
210 Ga0496110_1033838 3300048913 Bacteria 729
211 Ga0496111_0031713 3300048914 Bacteria 3765
212 Ga0496111_0151399 3300048914 Bacteria 1720
213 Ga0496111_0833886 3300048914 Bacteria 666
214 Ga0496112_0389448 3300048915 Bacteria 1334
215 Ga0496114_0006424 3300048917 Bacteria 9254
216 Ga0496114_0087228 3300048917 Bacteria 2645
217 Ga0496114_0152544 3300048917 Bacteria 2005
218 Ga0496114_0396723 3300048917 Bacteria 1222
219 Ga0496115_0179852 3300048918 Bacteria 1749
220 Ga0496115_0212922 3300048918 Bacteria 1596
221 Ga0496119_0024498 3300048922 Bacteria 4244
222 Ga0496124_0704102 3300048927 Bacteria 640
223 Ga0501306_011905 3300049127 Bacteria 1115
224 Ga0501306_021270 3300049127 Bacteria 907
225 Ga0501304_011215 3300049160 Bacteria 794
226 Ga0501305_068012 3300049161 Bacteria 623
227 Ga0501311_010685 3300049527 Bacteria 1118
228 Ga0501315_090272 3300049531 Bacteria 530
229 Ga0501316_024923 3300049532 Bacteria 775
230 Ga0501316_040005 3300049532 Bacteria 651
231 Ga0501319_004060 3300049535 Bacteria 1006
232 Ga0501320_033301 3300049536 Bacteria 650
233 Ga0501321_005713 3300049537 Bacteria 1240
234 Ga0501324_009526 3300049540 Bacteria 872
235 Ga0501325_025319 3300049541 Bacteria 651
236 Ga0501330_006641 3300049546 Bacteria 761
237 Ga0501032_0039759 3300049569 Bacteria 3198
238 Ga0501034_0000079 3300049571 Bacteria 171105
239 Ga0501067_0445413 3300049583 Bacteria 723
240 Ga0501069_0381697 3300049585 Bacteria 832
241 Ga0501259_112285 3300049688 Bacteria 639
242 nmdc:mga03n38_86978_c1 3300050490 Bacteria 1480
243 nmdc:mga05p37_5679_c1 3300050507 Bacteria 14665
244 nmdc:mga0qj67_248954_c1 3300050509 Bacteria 1442
245 nmdc:mga06r32_1223537_c1 3300050510 Bacteria 697
246 Ga0495619_0230429 3300053085 Bacteria 1283
247 Ga0495619_0566005 3300053085 Bacteria 779
248 Ga0500651_0154366 3300053093 Bacteria 1377
249 Ga0500621_020965 3300053126 Bacteria 2501
250 Ga0500568_0007064 3300053139 Bacteria 5549
251 Ga0500573_0013689 3300053140 Bacteria 4576
252 Ga0587080_046756 3300059503 Bacteria 806
253 Ga0587086_009004 3300059507 Bacteria 1179
254 Ga0587106_030744 3300059605 Bacteria 860
255 Ga0587125_016908 3300059607 Bacteria 823
256 Ga0587101_026877 3300059623 Bacteria 872
257 Ga0587128_075978 3300059630 Bacteria 663
258 Ga0587072_020066 3300059643 Bacteria 1175
259 Ga0587111_0153678 3300060346 Bacteria 620

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037312 Ga0395899_0383625 Ga0395899_0383625_370_810 128
2 3300038443 Ga0395901_0151546 Ga0395901_0151546_1889_2329 128
3 3300049688 Ga0501259_112285 Ga0501259_112285_13_456 130
4 3300053126 Ga0500621_020965 Ga0500621_020965_383_799 130
5 3300031995 Ga0307409_100283121 Ga0307409_1002831212 131
6 3300032002 Ga0307416_101009191 Ga0307416_1010091911 131
7 3300032126 Ga0307415_100017143 Ga0307415_1000171432 131
8 3300046525 Ga0495663_0040005 Ga0495663_0040005_821_1264 131
9 3300046615 Ga0495656_0171913 Ga0495656_0171913_535_978 131
10 3300048090 Ga0495615_0014403 Ga0495615_0014403_224_667 131
11 3300049531 Ga0501315_090272 Ga0501315_090272_14_457 131
12 3300049532 Ga0501316_024923 Ga0501316_024923_209_652 131
13 3300005842 Ga0068858_100000013 Ga0068858_10000001375 133
14 3300009177 Ga0105248_10000592 Ga0105248_1000059237 133
15 3300014325 Ga0163163_10023608 Ga0163163_100236084 133
16 3300014968 Ga0157379_10000012 Ga0157379_1000001246 133
17 3300046513 Ga0495616_0103001 Ga0495616_0103001_484_927 133
18 3300025941 Ga0207711_10000484 Ga0207711_1000048439 134
19 3300026035 Ga0207703_10000009 Ga0207703_1000000975 134
20 3300003578 Ga0006562J51391_1025953 Ga0006562J51391_10259533 136
21 3300013105 Ga0157369_11776185 Ga0157369_117761851 136
22 3300013306 Ga0163162_10096826 Ga0163162_100968263 136
23 3300013308 Ga0157375_10251615 Ga0157375_102516152 136
24 3300014745 Ga0157377_10286816 Ga0157377_102868161 136
25 3300048905 Ga0496102_0014656 Ga0496102_0014656_5652_6128 136
26 3300048908 Ga0496105_0105968 Ga0496105_0105968_1657_2133 136
27 3300048910 Ga0496107_0118276 Ga0496107_0118276_1290_1766 136
28 3300048912 Ga0496109_0008096 Ga0496109_0008096_3488_3964 136
29 3300048913 Ga0496110_0144447 Ga0496110_0144447_25_501 136
30 3300048914 Ga0496111_0151399 Ga0496111_0151399_341_817 136
31 3300048915 Ga0496112_0389448 Ga0496112_0389448_811_1287 136
32 3300048917 Ga0496114_0006424 Ga0496114_0006424_8052_8528 136
33 3300048917 Ga0496114_0087228 Ga0496114_0087228_722_1198 136
34 3300048918 Ga0496115_0212922 Ga0496115_0212922_486_962 136
35 3300048922 Ga0496119_0024498 Ga0496119_0024498_3448_3924 136
36 3300049537 Ga0501321_005713 Ga0501321_005713_113_601 136
37 3300049541 Ga0501325_025319 Ga0501325_025319_11_487 136
38 3300049585 Ga0501069_0381697 Ga0501069_0381697_235_711 136
39 3300059507 Ga0587086_009004 Ga0587086_009004_687_1163 136
40 3300059623 Ga0587101_026877 Ga0587101_026877_274_750 136
41 3300059643 Ga0587072_020066 Ga0587072_020066_20_496 136
42 3300009551 Ga0105238_10258338 Ga0105238_102583382 137
43 3300025924 Ga0207694_10178591 Ga0207694_101785912 137
44 3300020081 Ga0206354_10324951 Ga0206354_103249515 138
45 3300020082 Ga0206353_10139934 Ga0206353_101399345 138
46 3300022467 Ga0224712_10001920 Ga0224712_100019203 138
47 3300005334 Ga0068869_100266935 Ga0068869_1002669351 139
48 3300049161 Ga0501305_068012 Ga0501305_068012_22_465 139
49 3300049535 Ga0501319_004060 Ga0501319_004060_27_470 139
50 3300005335 Ga0070666_10452019 Ga0070666_104520193 140
51 3300005367 Ga0070667_100746660 Ga0070667_1007466601 140
52 3300005441 Ga0070700_100490696 Ga0070700_1004906963 140
53 3300005548 Ga0070665_100311175 Ga0070665_1003111754 140
54 3300005617 Ga0068859_101853507 Ga0068859_1018535071 140
55 3300006931 Ga0097620_101853521 Ga0097620_1018535211 140
56 3300009988 Ga0105035_101271 Ga0105035_1012712 140
57 3300013875 Ga0157515_119482 Ga0157515_1194822 140
58 3300025986 Ga0207658_10709960 Ga0207658_107099601 140
59 3300026088 Ga0207641_10247162 Ga0207641_102471624 140
60 3300028381 Ga0268264_11233459 Ga0268264_112334592 140
61 3300041486 Ga0451807_0859230 Ga0451807_0859230_12_458 140
62 3300048927 Ga0496124_0704102 Ga0496124_0704102_118_564 140
63 3300005327 Ga0070658_10001764 Ga0070658_1000176427 141
64 3300005327 Ga0070658_11467822 Ga0070658_114678221 141
65 3300005328 Ga0070676_10738357 Ga0070676_107383572 141
66 3300005335 Ga0070666_10907473 Ga0070666_109074732 141
67 3300005336 Ga0070680_100004398 Ga0070680_1000043982 141
68 3300005455 Ga0070663_100484491 Ga0070663_1004844912 141
69 3300005458 Ga0070681_10004293 Ga0070681_100042932 141
70 3300005530 Ga0070679_100006878 Ga0070679_1000068782 141
71 3300005547 Ga0070693_100192589 Ga0070693_1001925893 141
72 3300005718 Ga0068866_10328975 Ga0068866_103289751 141
73 3300005719 Ga0068861_100183906 Ga0068861_1001839062 141
74 3300005843 Ga0068860_100420082 Ga0068860_1004200821 141
75 3300006048 Ga0075363_100056996 Ga0075363_1000569962 141
76 3300006051 Ga0075364_10962549 Ga0075364_109625491 141
77 3300006846 Ga0075430_100071301 Ga0075430_1000713012 141
78 3300006847 Ga0075431_100563477 Ga0075431_1005634773 141
79 3300009101 Ga0105247_10898768 Ga0105247_108987681 141
80 3300009147 Ga0114129_10000114 Ga0114129_1000011466 141
81 3300009176 Ga0105242_10217228 Ga0105242_102172283 141
82 3300009551 Ga0105238_10010490 Ga0105238_100104904 141
83 3300011119 Ga0105246_10858489 Ga0105246_108584892 141
84 3300012494 Ga0157341_1035886 Ga0157341_10358861 141
85 3300013102 Ga0157371_10369078 Ga0157371_103690783 141
86 3300013102 Ga0157371_10532866 Ga0157371_105328663 141
87 3300013104 Ga0157370_11040645 Ga0157370_110406452 141
88 3300013104 Ga0157370_11755650 Ga0157370_117556501 141
89 3300013105 Ga0157369_10116718 Ga0157369_101167186 141
90 3300013307 Ga0157372_10830671 Ga0157372_108306711 141
91 3300013308 Ga0157375_10875352 Ga0157375_108753522 141
92 3300014326 Ga0157380_10188583 Ga0157380_101885834 141
93 3300014745 Ga0157377_11609890 Ga0157377_116098901 141
94 3300020070 Ga0206356_10144764 Ga0206356_101447641 141
95 3300020075 Ga0206349_1568563 Ga0206349_15685631 141
96 3300020078 Ga0206352_11084786 Ga0206352_110847863 141
97 3300020081 Ga0206354_10832937 Ga0206354_108329372 141
98 3300020082 Ga0206353_10558793 Ga0206353_1055879314 141
99 3300020610 Ga0154015_1499110 Ga0154015_14991102 141
100 3300022467 Ga0224712_10035220 Ga0224712_100352202 141
101 3300025907 Ga0207645_10808543 Ga0207645_108085431 141
102 3300025908 Ga0207643_10037760 Ga0207643_100377603 141
103 3300025909 Ga0207705_10000671 Ga0207705_1000067116 141
104 3300025912 Ga0207707_10001820 Ga0207707_1000182019 141
105 3300025917 Ga0207660_10000562 Ga0207660_1000056217 141
106 3300025921 Ga0207652_10000632 Ga0207652_1000063227 141
107 3300025933 Ga0207706_10795017 Ga0207706_107950172 141
108 3300025934 Ga0207686_10174357 Ga0207686_101743572 141
109 3300025942 Ga0207689_10399764 Ga0207689_103997643 141
110 3300025972 Ga0207668_10638710 Ga0207668_106387103 141
111 3300025981 Ga0207640_10140109 Ga0207640_101401092 141
112 3300026041 Ga0207639_10012050 Ga0207639_100120502 141
113 3300026067 Ga0207678_10448057 Ga0207678_104480571 141
114 3300026089 Ga0207648_10661133 Ga0207648_106611333 141
115 3300026118 Ga0207675_100043014 Ga0207675_1000430148 141
116 3300026118 Ga0207675_101047228 Ga0207675_1010472281 141
117 3300026121 Ga0207683_10054374 Ga0207683_100543742 141
118 3300028379 Ga0268266_10589756 Ga0268266_105897563 141
119 3300028381 Ga0268264_10908110 Ga0268264_109081102 141
120 3300028786 Ga0307517_10664929 Ga0307517_106649291 141
121 3300028794 Ga0307515_10001812 Ga0307515_1000181241 141
122 3300028794 Ga0307515_10221566 Ga0307515_102215661 141
123 3300031507 Ga0307509_10401613 Ga0307509_104016133 141
124 3300031649 Ga0307514_10527684 Ga0307514_105276841 141
125 3300031730 Ga0307516_10039181 Ga0307516_100391819 141
126 3300031730 Ga0307516_10049250 Ga0307516_1004925010 141
127 3300031731 Ga0307405_11220907 Ga0307405_112209071 141
128 3300031852 Ga0307410_11416966 Ga0307410_114169661 141
129 3300031901 Ga0307406_10260612 Ga0307406_102606122 141
130 3300031995 Ga0307409_100337125 Ga0307409_1003371251 141
131 3300032002 Ga0307416_102110666 Ga0307416_1021106662 141
132 3300032005 Ga0307411_11484409 Ga0307411_114844091 141
133 3300032126 Ga0307415_101322120 Ga0307415_1013221202 141
134 3300033179 Ga0307507_10452631 Ga0307507_104526311 141
135 3300033180 Ga0307510_10151763 Ga0307510_101517632 141
136 3300035111 Ga0373923_0700023 Ga0373923_0700023_21_461 141
137 3300035112 Ga0373932_0151979 Ga0373932_0151979_80_523 141
138 3300037068 Ga0373925_0388720 Ga0373925_0388720_354_797 141
139 3300037471 Ga0395905_0833108 Ga0395905_0833108_141_581 141
140 3300038443 Ga0395901_0482599 Ga0395901_0482599_209_652 141
141 3300041444 Ga0451790_44515 Ga0451790_44515_11_454 141
142 3300041451 Ga0451791_0635685 Ga0451791_0635685_513_956 141
143 3300041460 Ga0451802_0385948 Ga0451802_0385948_17_457 141
144 3300041461 Ga0451805_122515 Ga0451805_122515_12_455 141
145 3300041463 Ga0451804_0953991 Ga0451804_0953991_346_786 141
146 3300041491 Ga0451833_0613043 Ga0451833_0613043_35_478 141
147 3300041494 Ga0451837_1302984 Ga0451837_1302984_84_527 141
148 3300041503 Ga0451847_0380697 Ga0451847_0380697_563_1003 141
149 3300042157 Ga0439458_0179004 Ga0439458_0179004_72_512 141
150 3300042439 Ga0439464_0029215 Ga0439464_0029215_335_775 141
151 3300044683 Ga0466965_0003400 Ga0466965_0003400_157_597 141
152 3300044842 Ga0466957_0313791 Ga0466957_0313791_519_959 141
153 3300046462 Ga0495651_0058308 Ga0495651_0058308_421_861 141
154 3300046516 Ga0495628_0016156 Ga0495628_0016156_5661_6101 141
155 3300046529 Ga0495652_0024515 Ga0495652_0024515_547_987 141
156 3300046536 Ga0495587_0271733 Ga0495587_0271733_360_800 141
157 3300046543 Ga0495645_0163291 Ga0495645_0163291_258_698 141
158 3300046675 Ga0495657_0101767 Ga0495657_0101767_798_1238 141
159 3300046689 Ga0495613_0202257 Ga0495613_0202257_154_594 141
160 3300046809 Ga0495600_0011482 Ga0495600_0011482_4977_5417 141
161 3300046809 Ga0495600_0478067 Ga0495600_0478067_165_605 141
162 3300047315 Ga0495581_0490895 Ga0495581_0490895_180_656 141
163 3300047317 Ga0495604_0481183 Ga0495604_0481183_255_695 141
164 3300047319 Ga0495674_0695412 Ga0495674_0695412_102_542 141
165 3300048910 Ga0496107_0215245 Ga0496107_0215245_550_990 141
166 3300048913 Ga0496110_0079129 Ga0496110_0079129_2125_2565 141
167 3300048913 Ga0496110_1033838 Ga0496110_1033838_92_532 141
168 3300048914 Ga0496111_0031713 Ga0496111_0031713_1803_2243 141
169 3300048917 Ga0496114_0396723 Ga0496114_0396723_749_1192 141
170 3300049127 Ga0501306_021270 Ga0501306_021270_12_452 141
171 3300050490 nmdc:mga03n38_86978_c1 nmdc:mga03n38_86978_c1_469_909 141
172 3300050507 nmdc:mga05p37_5679_c1 nmdc:mga05p37_5679_c1_6777_7220 141
173 3300050509 nmdc:mga0qj67_248954_c1 nmdc:mga0qj67_248954_c1_676_1122 141
174 3300050510 nmdc:mga06r32_1223537_c1 nmdc:mga06r32_1223537_c1_150_593 141
175 3300053093 Ga0500651_0154366 Ga0500651_0154366_89_532 141
176 3300053140 Ga0500573_0013689 Ga0500573_0013689_4056_4496 141
177 3300059605 Ga0587106_030744 Ga0587106_030744_285_725 141
178 3300044694 Ga0466963_0226982 Ga0466963_0226982_598_1050 142
179 3300059630 Ga0587128_075978 Ga0587128_075978_194_637 142
180 3300060346 Ga0587111_0153678 Ga0587111_0153678_115_561 142
181 3300005337 Ga0070682_100189910 Ga0070682_1001899102 143
182 3300013307 Ga0157372_12339899 Ga0157372_123398992 143
183 3300048911 Ga0496108_0564511 Ga0496108_0564511_291_767 143
184 3300049583 Ga0501067_0445413 Ga0501067_0445413_58_534 143
185 3300003163 Ga0006759J45824_1045259 Ga0006759J45824_10452592 144
186 3300003577 Ga0007416J51690_1046985 Ga0007416J51690_10469853 144
187 3300003693 Ga0032354_1028635 Ga0032354_10286353 144
188 3300005548 Ga0070665_101176861 Ga0070665_1011768612 144
189 3300009098 Ga0105245_10449770 Ga0105245_104497703 144
190 3300013100 Ga0157373_10705476 Ga0157373_107054762 144
191 3300013308 Ga0157375_11104329 Ga0157375_111043291 144
192 3300020081 Ga0206354_10397469 Ga0206354_103974692 144
193 3300025900 Ga0207710_10294864 Ga0207710_102948642 144
194 3300025903 Ga0207680_10018574 Ga0207680_100185748 144
195 3300025919 Ga0207657_10115193 Ga0207657_101151933 144
196 3300025921 Ga0207652_10749856 Ga0207652_107498562 144
197 3300026088 Ga0207641_10000478 Ga0207641_1000047836 144
198 3300028379 Ga0268266_10001438 Ga0268266_1000143824 144
199 3300028379 Ga0268266_10312713 Ga0268266_103127133 144
200 3300028381 Ga0268264_10000097 Ga0268264_10000097139 144
201 3300028786 Ga0307517_10282063 Ga0307517_102820633 144
202 3300031616 Ga0307508_10214974 Ga0307508_102149743 144
203 3300031649 Ga0307514_10065601 Ga0307514_100656013 144
204 3300031995 Ga0307409_100154885 Ga0307409_1001548855 144
205 3300035114 Ga0373939_0184102 Ga0373939_0184102_284_739 144
206 3300035692 Ga0373935_1030613 Ga0373935_1030613_73_528 144
207 3300038443 Ga0395901_0925579 Ga0395901_0925579_47_499 144
208 3300045836 Ga0466958_0505809 Ga0466958_0505809_316_768 144
209 3300046453 Ga0495627_002860 Ga0495627_002860_6895_7347 144
210 3300046512 Ga0495610_0017172 Ga0495610_0017172_2802_3254 144
211 3300046543 Ga0495645_0528898 Ga0495645_0528898_265_720 144
212 3300047444 Ga0495675_0102261 Ga0495675_0102261_1004_1459 144
213 3300048903 Ga0496100_0136705 Ga0496100_0136705_182_637 144
214 3300048907 Ga0496104_1613095 Ga0496104_1613095_31_483 144
215 3300048908 Ga0496105_0386083 Ga0496105_0386083_244_696 144
216 3300048909 Ga0496106_0337956 Ga0496106_0337956_166_621 144
217 3300048917 Ga0496114_0152544 Ga0496114_0152544_892_1344 144
218 3300048918 Ga0496115_0179852 Ga0496115_0179852_75_530 144
219 3300053085 Ga0495619_0566005 Ga0495619_0566005_143_613 144
220 3300053139 Ga0500568_0007064 Ga0500568_0007064_3178_3630 144
221 3300031247 Ga0265340_10001238 Ga0265340_100012385 146
222 3300037312 Ga0395899_0079065 Ga0395899_0079065_1377_1850 146
223 3300037418 Ga0395900_0109052 Ga0395900_0109052_1772_2245 146
224 3300038443 Ga0395901_0107597 Ga0395901_0107597_1422_1895 146
225 3300005435 Ga0070714_100092034 Ga0070714_1000920342 147
226 3300005436 Ga0070713_100037637 Ga0070713_1000376374 147
227 3300005439 Ga0070711_100108381 Ga0070711_1001083815 147
228 3300025906 Ga0207699_10031709 Ga0207699_100317096 147
229 3300025915 Ga0207693_10078402 Ga0207693_100784026 147
230 3300025916 Ga0207663_10074231 Ga0207663_100742315 147
231 3300025928 Ga0207700_10075028 Ga0207700_100750282 147
232 3300025929 Ga0207664_10145877 Ga0207664_101458772 147
233 3300032004 Ga0307414_10766612 Ga0307414_107666122 147
234 3300049127 Ga0501306_011905 Ga0501306_011905_20_508 149
235 3300049160 Ga0501304_011215 Ga0501304_011215_19_501 149
236 3300049527 Ga0501311_010685 Ga0501311_010685_586_1074 149
237 3300049532 Ga0501316_040005 Ga0501316_040005_144_632 149
238 3300049536 Ga0501320_033301 Ga0501320_033301_144_632 149
239 3300049540 Ga0501324_009526 Ga0501324_009526_19_501 149
240 3300049546 Ga0501330_006641 Ga0501330_006641_35_508 149
241 3300049569 Ga0501032_0039759 Ga0501032_0039759_822_1292 149
242 3300049571 Ga0501034_0000079 Ga0501034_0000079_140230_140700 149
243 3300059607 Ga0587125_016908 Ga0587125_016908_266_736 149
244 3300037312 Ga0395899_0407583 Ga0395899_0407583_88_579 155
245 3300037418 Ga0395900_0383789 Ga0395900_0383789_581_1072 155
246 3300037466 Ga0395898_0024956 Ga0395898_0024956_2542_3033 155
247 3300038443 Ga0395901_0052959 Ga0395901_0052959_808_1299 155
248 3300001990 JGI24737J22298_10175041 JGI24737J22298_101750411 156
249 3300005339 Ga0070660_100526773 Ga0070660_1005267732 156
250 3300009551 Ga0105238_10398992 Ga0105238_103989923 156
251 3300011119 Ga0105246_10097972 Ga0105246_100979723 156
252 3300025909 Ga0207705_10319697 Ga0207705_103196972 156
253 3300026142 Ga0207698_11922653 Ga0207698_119226532 156
254 3300044901 Ga0466960_0109127 Ga0466960_0109127_579_1070 156
255 3300046459 Ga0495629_0180208 Ga0495629_0180208_391_882 156
256 3300046794 Ga0495589_0375454 Ga0495589_0375454_37_528 156
257 3300048914 Ga0496111_0833886 Ga0496111_0833886_139_630 156
258 3300053085 Ga0495619_0230429 Ga0495619_0230429_143_634 156
259 3300059503 Ga0587080_046756 Ga0587080_046756_206_691 156

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00828

Ribosomal_L27A

Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A

37

156

0.88

Feature Viewer

pLDDT pTM Quality
72.97 0.49 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map