F496709

General Info

Members Datasets Scaffolds Average Seq Length
2346 463 2344 205

Family's Representative Sequence

Representative Sequence 3300005471|Ga0070698_100450474|Ga0070698_1004504742
Length 208
Sequence MARYNGPVCRLCRREGMKLFLKGERCYTEKCAIEKRNVPPGMHGRSRKAKMVGYAVQLREKQRVKRIYGVLEDQFRGYFEAAERTRGITGETLLQLLERRLDNAVYRLGFATSRPQARQLVRHGHFLVNGRKVDIPSYSVKVGDVVSVRENSRKNASILHAVEEVKGRGVPEWLSLDGEMGGRVVSVPTREQINLPVQEQLIVELYSK

Samples

Sample ID Description Type Environment
1 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
38 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
39 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
40 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
41 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
42 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
43 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
44 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
45 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
52 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
53 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
54 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
55 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
58 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
61 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
62 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
63 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
64 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
65 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
66 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
67 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
68 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
69 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
70 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
71 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
74 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
75 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
76 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
77 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
81 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
82 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
83 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
84 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
85 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
86 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
87 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
88 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
89 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
90 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
91 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
92 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
93 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
94 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
96 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
97 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
98 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
99 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
100 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
101 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
102 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
103 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
104 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
105 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
106 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
107 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
108 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
110 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
111 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
112 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
113 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
114 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
115 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
116 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
117 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
118 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
119 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
120 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
121 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
122 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
123 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
124 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
125 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
126 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
127 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
128 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
129 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
130 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
131 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
132 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
133 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
134 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
135 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
136 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
137 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
138 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
206 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
207 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
211 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
212 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
213 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
214 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
215 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
216 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
217 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
218 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
219 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
220 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
221 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
222 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
223 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
224 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
225 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
226 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
227 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
228 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
229 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
230 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
231 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
232 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
233 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
234 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
235 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
236 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
237 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
238 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
239 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
240 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
241 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
242 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
243 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
244 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
245 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
246 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
247 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
248 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
249 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
250 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
251 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
252 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
253 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
254 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
255 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
256 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
257 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
258 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
259 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
260 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
261 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
262 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
263 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
264 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
265 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
266 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
267 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
268 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
269 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
270 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
271 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
272 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
273 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
274 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
275 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
276 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
277 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
278 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
279 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
280 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
281 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
282 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
283 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
284 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
285 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
286 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
287 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
288 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
289 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
290 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
291 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
292 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
293 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
294 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
295 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
296 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
297 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
298 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
299 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
300 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
301 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
302 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
303 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
304 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
305 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
306 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
307 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
308 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
309 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
310 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
311 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
312 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
313 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
314 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
315 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
316 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
317 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
318 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
319 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
320 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
321 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
322 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
323 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
324 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
325 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
326 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
327 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
328 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
329 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
330 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
331 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
332 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
333 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
334 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
335 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
336 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
337 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
338 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
339 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
340 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
341 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
342 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
343 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
344 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
345 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
346 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
347 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
348 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
349 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
350 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
351 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
352 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
353 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
354 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
355 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
356 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
357 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
358 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
359 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
360 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
361 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
362 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
363 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
364 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
365 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
366 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
367 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
368 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
369 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
370 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
371 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
372 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
373 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
374 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
375 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
376 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
377 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
378 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
379 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
380 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
381 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
382 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
383 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
384 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
385 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
386 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
387 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
388 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
389 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
390 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
391 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
392 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
393 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
394 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
395 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
396 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
397 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
398 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
399 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
400 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
401 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
402 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
403 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
404 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
405 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
406 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
407 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
408 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
409 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
410 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
411 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
412 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
413 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
414 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
415 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
416 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
417 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
418 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
419 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
420 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
421 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
422 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
423 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
424 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
425 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
426 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
427 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
428 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
429 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
430 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
431 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
432 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
433 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
434 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
435 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
436 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
437 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
438 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
439 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
440 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
441 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
442 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
443 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
444 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
445 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
446 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
447 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
448 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
449 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
450 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
451 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
452 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
453 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
454 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
455 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
456 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
457 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
458 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
459 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
460 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
461 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
462 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
463 639633007 Azoarcus olearius BH72 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.53
Metatranscriptomes 0.38
Isolates 0.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.51
Nodule 0
Rhizoplane 3.37
Rhizosphere 93.82
Stem 0
Stem Tuber 0
Unclassified 0.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1000639 3300001977 Bacteria 5349
2 JGI24035J26624_1001305 3300002126 Bacteria 2365
3 JGI25406J46586_10003545 3300003203 Bacteria 7318
4 JGI25406J46586_10008229 3300003203 Bacteria 4732
5 Ga0058859_10004552 3300004798 Bacteria 1002
6 Ga0058863_11716119 3300004799 Bacteria 1238
7 Ga0065714_10171541 3300005288 Bacteria 1002
8 Ga0065712_10011165 3300005290 Bacteria 3490
9 Ga0065712_10015802 3300005290 Bacteria 2448
10 Ga0065712_10036809 3300005290 Bacteria 990
11 Ga0065712_10069045 3300005290 Bacteria 8171
12 Ga0065712_10185042 3300005290 Bacteria 1157
13 Ga0065712_10225534 3300005290 Bacteria 1027
14 Ga0065712_10337364 3300005290 Bacteria 805
15 Ga0065715_10001224 3300005293 Bacteria 10036
16 Ga0065715_10003819 3300005293 Bacteria 5966
17 Ga0065715_10011927 3300005293 Bacteria 3639
18 Ga0065715_10017614 3300005293 Bacteria 2417
19 Ga0065715_10055928 3300005293 Bacteria 829
20 Ga0065715_10094515 3300005293 Bacteria 4316
21 Ga0065715_10103421 3300005293 Bacteria 3036
22 Ga0065715_10203097 3300005293 Bacteria 1351
23 Ga0065715_10395076 3300005293 Bacteria 889
24 Ga0065715_10400275 3300005293 Bacteria 882
25 Ga0065715_10514309 3300005293 Bacteria 769
26 Ga0065707_10007282 3300005295 Bacteria 3713
27 Ga0065707_10012989 3300005295 Bacteria 1970
28 Ga0065707_10023963 3300005295 Bacteria 1407
29 Ga0065707_10033316 3300005295 Bacteria 1220
30 Ga0065707_10158407 3300005295 Bacteria 1587
31 Ga0070658_10174740 3300005327 Bacteria 1806
32 Ga0070658_10380639 3300005327 Bacteria 1210
33 Ga0070676_10004724 3300005328 Bacteria 7201
34 Ga0070676_10044770 3300005328 Bacteria 2576
35 Ga0070676_10083525 3300005328 Bacteria 1942
36 Ga0070676_10156745 3300005328 Bacteria 1462
37 Ga0070676_10272881 3300005328 Bacteria 1137
38 Ga0070676_10366108 3300005328 Bacteria 994
39 Ga0070683_100000726 3300005329 Bacteria 24102
40 Ga0070683_100182900 3300005329 Bacteria 1990
41 Ga0070683_100277717 3300005329 Bacteria 1594
42 Ga0070683_100292040 3300005329 Bacteria 1550
43 Ga0070683_100377985 3300005329 Bacteria 1350
44 Ga0070690_100006534 3300005330 Bacteria 6617
45 Ga0070690_100092383 3300005330 Bacteria 1995
46 Ga0070690_100230176 3300005330 Bacteria 1303
47 Ga0070670_100011113 3300005331 Bacteria 7693
48 Ga0070670_100025433 3300005331 Bacteria 5094
49 Ga0070670_100025576 3300005331 Bacteria 5078
50 Ga0070670_100035706 3300005331 Bacteria 4279
51 Ga0070670_100056329 3300005331 Bacteria 3374
52 Ga0070670_100067940 3300005331 Bacteria 3058
53 Ga0070670_100076304 3300005331 Bacteria 2880
54 Ga0070670_100084227 3300005331 Bacteria 2731
55 Ga0070670_100099932 3300005331 Bacteria 2497
56 Ga0070670_100140343 3300005331 Bacteria 2089
57 Ga0070670_100190313 3300005331 Bacteria 1782
58 Ga0070670_100314274 3300005331 Bacteria 1372
59 Ga0070677_10054052 3300005333 Bacteria 1634
60 Ga0070677_10083007 3300005333 Bacteria 1375
61 Ga0070677_10135147 3300005333 Bacteria 1130
62 Ga0070677_10147118 3300005333 Bacteria 1093
63 Ga0070677_10267549 3300005333 Bacteria 856
64 Ga0068869_100010773 3300005334 Bacteria 5973
65 Ga0068869_100038988 3300005334 Bacteria 3389
66 Ga0068869_100128068 3300005334 Bacteria 1949
67 Ga0068869_100170298 3300005334 Bacteria 1701
68 Ga0068869_100201192 3300005334 Bacteria 1571
69 Ga0068869_100212927 3300005334 Bacteria 1528
70 Ga0068869_100297858 3300005334 Bacteria 1301
71 Ga0068869_100386168 3300005334 Bacteria 1148
72 Ga0070666_10007809 3300005335 Bacteria 6607
73 Ga0070666_10142476 3300005335 Bacteria 1670
74 Ga0070666_10144630 3300005335 Bacteria 1657
75 Ga0070666_10165266 3300005335 Bacteria 1548
76 Ga0070666_10190047 3300005335 Bacteria 1443
77 Ga0070666_10405354 3300005335 Bacteria 981
78 Ga0070666_10494092 3300005335 Bacteria 887
79 Ga0070666_10508730 3300005335 Bacteria 873
80 Ga0070680_100071498 3300005336 Bacteria 2851
81 Ga0070682_100252251 3300005337 Bacteria 1273
82 Ga0070682_100323023 3300005337 Bacteria 1141
83 Ga0068868_100012961 3300005338 Bacteria 6099
84 Ga0068868_100038172 3300005338 Bacteria 3727
85 Ga0068868_100113481 3300005338 Bacteria 2203
86 Ga0068868_100123421 3300005338 Bacteria 2114
87 Ga0070660_100002987 3300005339 Bacteria 11642
88 Ga0070660_100074646 3300005339 Bacteria 2654
89 Ga0070660_100701133 3300005339 Bacteria 849
90 Ga0070689_100031044 3300005340 Bacteria 4059
91 Ga0070689_100043206 3300005340 Bacteria 3463
92 Ga0070689_100058156 3300005340 Bacteria 3002
93 Ga0070689_100116273 3300005340 Bacteria 2132
94 Ga0070689_100192605 3300005340 Bacteria 1661
95 Ga0070689_100234039 3300005340 Bacteria 1511
96 Ga0070689_100356182 3300005340 Bacteria 1228
97 Ga0070689_100494849 3300005340 Bacteria 1046
98 Ga0070689_100709649 3300005340 Bacteria 879
99 Ga0070691_10061523 3300005341 Bacteria 1806
100 Ga0070691_10218723 3300005341 Bacteria 1008
101 Ga0070687_100004424 3300005343 Bacteria 5602
102 Ga0070687_100010658 3300005343 Bacteria 3988
103 Ga0070687_100110693 3300005343 Bacteria 1553
104 Ga0070687_100200064 3300005343 Bacteria 1210
105 Ga0070687_100244436 3300005343 Bacteria 1111
106 Ga0070661_100245958 3300005344 Bacteria 1379
107 Ga0070661_100295058 3300005344 Bacteria 1261
108 Ga0070661_100394000 3300005344 Bacteria 1094
109 Ga0070661_100447326 3300005344 Bacteria 1028
110 Ga0070661_100552483 3300005344 Bacteria 926
111 Ga0070692_10039187 3300005345 Bacteria 2418
112 Ga0070692_10067419 3300005345 Bacteria 1899
113 Ga0070668_100095078 3300005347 Bacteria 2353
114 Ga0070668_100096147 3300005347 Bacteria 2341
115 Ga0070668_100128512 3300005347 Bacteria 2031
116 Ga0070668_100220321 3300005347 Bacteria 1565
117 Ga0070668_100701741 3300005347 Bacteria 892
118 Ga0070669_100003127 3300005353 Bacteria 11909
119 Ga0070669_100029266 3300005353 Bacteria 3970
120 Ga0070669_100052934 3300005353 Bacteria 2970
121 Ga0070669_100064611 3300005353 Bacteria 2695
122 Ga0070669_100076752 3300005353 Bacteria 2481
123 Ga0070669_100096240 3300005353 Bacteria 2227
124 Ga0070669_100121031 3300005353 Bacteria 1997
125 Ga0070669_100180131 3300005353 Bacteria 1652
126 Ga0070669_100192156 3300005353 Bacteria 1602
127 Ga0070669_100206332 3300005353 Bacteria 1548
128 Ga0070669_100246009 3300005353 Bacteria 1422
129 Ga0070669_100543890 3300005353 Bacteria 967
130 Ga0070669_100718309 3300005353 Bacteria 845
131 Ga0070675_100000056 3300005354 Bacteria 66985
132 Ga0070675_100002333 3300005354 Bacteria 14108
133 Ga0070675_100002788 3300005354 Bacteria 13157
134 Ga0070675_100015228 3300005354 Bacteria 6074
135 Ga0070675_100027751 3300005354 Bacteria 4552
136 Ga0070675_100071371 3300005354 Bacteria 2881
137 Ga0070675_100092044 3300005354 Bacteria 2541
138 Ga0070675_100094104 3300005354 Bacteria 2514
139 Ga0070675_100125358 3300005354 Bacteria 2184
140 Ga0070675_100144537 3300005354 Bacteria 2035
141 Ga0070675_100202354 3300005354 Bacteria 1724
142 Ga0070675_100207366 3300005354 Bacteria 1703
143 Ga0070675_100368125 3300005354 Bacteria 1277
144 Ga0070675_100406486 3300005354 Bacteria 1215
145 Ga0070675_100457381 3300005354 Bacteria 1145
146 Ga0070675_100602991 3300005354 Bacteria 996
147 Ga0070675_100663338 3300005354 Bacteria 948
148 Ga0070675_100668674 3300005354 Bacteria 944
149 Ga0070675_100730779 3300005354 Bacteria 903
150 Ga0070671_100003190 3300005355 Bacteria 12777
151 Ga0070671_100009894 3300005355 Bacteria 7658
152 Ga0070671_100012725 3300005355 Bacteria 6781
153 Ga0070671_100031409 3300005355 Bacteria 4387
154 Ga0070671_100105657 3300005355 Bacteria 2363
155 Ga0070671_100119794 3300005355 Bacteria 2214
156 Ga0070671_100760180 3300005355 Bacteria 843
157 Ga0070674_100006238 3300005356 Bacteria 6939
158 Ga0070674_100008546 3300005356 Bacteria 6104
159 Ga0070674_100013521 3300005356 Bacteria 5049
160 Ga0070674_100060115 3300005356 Bacteria 2648
161 Ga0070674_100063122 3300005356 Bacteria 2591
162 Ga0070674_100066289 3300005356 Bacteria 2537
163 Ga0070674_100072180 3300005356 Bacteria 2443
164 Ga0070674_100072936 3300005356 Bacteria 2432
165 Ga0070674_100117381 3300005356 Bacteria 1965
166 Ga0070674_100127256 3300005356 Bacteria 1894
167 Ga0070674_100199969 3300005356 Bacteria 1542
168 Ga0070674_100373049 3300005356 Bacteria 1159
169 Ga0070673_100001910 3300005364 Bacteria 12509
170 Ga0070673_100012871 3300005364 Bacteria 5761
171 Ga0070673_100050128 3300005364 Bacteria 3263
172 Ga0070673_100055781 3300005364 Bacteria 3114
173 Ga0070673_100226782 3300005364 Bacteria 1619
174 Ga0070673_100232822 3300005364 Bacteria 1599
175 Ga0070673_100375328 3300005364 Bacteria 1267
176 Ga0070673_100468291 3300005364 Bacteria 1136
177 Ga0070673_100476829 3300005364 Bacteria 1126
178 Ga0070673_100547902 3300005364 Bacteria 1050
179 Ga0070673_100562944 3300005364 Bacteria 1036
180 Ga0070673_100716701 3300005364 Bacteria 919
181 Ga0070688_100005572 3300005365 Bacteria 6645
182 Ga0070688_100038134 3300005365 Bacteria 2933
183 Ga0070688_100115702 3300005365 Bacteria 1790
184 Ga0070688_100160396 3300005365 Bacteria 1545
185 Ga0070688_100197090 3300005365 Bacteria 1407
186 Ga0070688_100245039 3300005365 Bacteria 1274
187 Ga0070688_100389084 3300005365 Bacteria 1030
188 Ga0070688_100442082 3300005365 Bacteria 970
189 Ga0070688_100472212 3300005365 Bacteria 941
190 Ga0070659_100346562 3300005366 Bacteria 1245
191 Ga0070667_100147919 3300005367 Bacteria 2061
192 Ga0070667_100365424 3300005367 Bacteria 1309
193 Ga0070667_100446998 3300005367 Bacteria 1181
194 Ga0070667_100465254 3300005367 Bacteria 1157
195 Ga0070667_100714663 3300005367 Bacteria 928
196 Ga0070667_101014212 3300005367 Bacteria 775
197 Ga0070703_10074949 3300005406 Bacteria 1139
198 Ga0070709_10201070 3300005434 Bacteria 1411
199 Ga0070714_100026258 3300005435 Bacteria 4812
200 Ga0070713_100365142 3300005436 Bacteria 1342
201 Ga0070701_10015865 3300005438 Bacteria 3490
202 Ga0070701_10017325 3300005438 Bacteria 3365
203 Ga0070701_10048517 3300005438 Bacteria 2192
204 Ga0070701_10065568 3300005438 Bacteria 1927
205 Ga0070711_100170188 3300005439 Bacteria 1660
206 Ga0070711_100546165 3300005439 Bacteria 961
207 Ga0070711_100558218 3300005439 Bacteria 951
208 Ga0070705_100060997 3300005440 Bacteria 2239
209 Ga0070705_100075401 3300005440 Bacteria 2053
210 Ga0070705_100140953 3300005440 Bacteria 1586
211 Ga0070705_100216068 3300005440 Bacteria 1325
212 Ga0070700_100017173 3300005441 Bacteria 4132
213 Ga0070700_100114296 3300005441 Bacteria 1800
214 Ga0070700_100189366 3300005441 Bacteria 1437
215 Ga0070700_100202100 3300005441 Bacteria 1396
216 Ga0070700_100366805 3300005441 Bacteria 1072
217 Ga0070694_100010997 3300005444 Bacteria 5598
218 Ga0070694_100020922 3300005444 Bacteria 4175
219 Ga0070694_100051301 3300005444 Bacteria 2784
220 Ga0070694_100159147 3300005444 Bacteria 1655
221 Ga0070694_100456582 3300005444 Bacteria 1010
222 Ga0070694_100615797 3300005444 Bacteria 876
223 Ga0070663_100037668 3300005455 Bacteria 3368
224 Ga0070663_100254556 3300005455 Bacteria 1391
225 Ga0070663_100299048 3300005455 Bacteria 1288
226 Ga0070663_100600364 3300005455 Bacteria 926
227 Ga0070663_100602805 3300005455 Bacteria 924
228 Ga0070678_100063335 3300005456 Bacteria 2735
229 Ga0070678_100078037 3300005456 Bacteria 2500
230 Ga0070678_100134712 3300005456 Bacteria 1968
231 Ga0070678_100136357 3300005456 Bacteria 1957
232 Ga0070678_100171245 3300005456 Bacteria 1769
233 Ga0070678_100223688 3300005456 Bacteria 1565
234 Ga0070678_100234216 3300005456 Bacteria 1532
235 Ga0070678_100451130 3300005456 Bacteria 1126
236 Ga0070678_100672169 3300005456 Bacteria 931
237 Ga0070662_100013312 3300005457 Bacteria 5473
238 Ga0070662_100071558 3300005457 Bacteria 2557
239 Ga0070662_100328584 3300005457 Bacteria 1249
240 Ga0070662_100431507 3300005457 Bacteria 1091
241 Ga0070681_10006387 3300005458 Bacteria 11462
242 Ga0070681_10170455 3300005458 Bacteria 2098
243 Ga0070681_10766058 3300005458 Bacteria 882
244 Ga0068867_100007649 3300005459 Bacteria 7645
245 Ga0068867_100053804 3300005459 Bacteria 2973
246 Ga0068867_100061925 3300005459 Bacteria 2779
247 Ga0068867_100074110 3300005459 Bacteria 2550
248 Ga0068867_100159183 3300005459 Bacteria 1779
249 Ga0068867_100166193 3300005459 Bacteria 1743
250 Ga0068867_100248822 3300005459 Bacteria 1445
251 Ga0068867_100275139 3300005459 Bacteria 1378
252 Ga0068867_100450157 3300005459 Bacteria 1097
253 Ga0068867_100478213 3300005459 Bacteria 1067
254 Ga0070685_10014991 3300005466 Bacteria 4114
255 Ga0070685_10232370 3300005466 Bacteria 1213
256 Ga0070685_10364285 3300005466 Bacteria 992
257 Ga0070685_10372480 3300005466 Bacteria 982
258 Ga0070706_100383649 3300005467 Bacteria 1308
259 Ga0070706_100482967 3300005467 Bacteria 1153
260 Ga0070706_100483723 3300005467 Bacteria 1152
261 Ga0070706_100820249 3300005467 Bacteria 861
262 Ga0070706_100853854 3300005467 Bacteria 842
263 Ga0070707_100123947 3300005468 Bacteria 2510
264 Ga0070707_100417307 3300005468 Bacteria 1302
265 Ga0070707_100518729 3300005468 Bacteria 1154
266 Ga0070707_100550818 3300005468 Bacteria 1116
267 Ga0070707_101048707 3300005468 Bacteria 781
268 Ga0070698_100003045 3300005471 Bacteria 18470
269 Ga0070698_100040017 3300005471 Bacteria 4820
270 Ga0070698_100113382 3300005471 Bacteria 2676
271 Ga0070698_100140206 3300005471 Bacteria 2369
272 Ga0070698_100142011 3300005471 Bacteria 2352
273 Ga0070698_100284549 3300005471 Bacteria 1585
274 Ga0070698_100327846 3300005471 Bacteria 1462
275 Ga0070698_100407209 3300005471 Bacteria 1294
276 Ga0070698_100450474 3300005471 Bacteria 1223
277 Ga0070698_100696509 3300005471 Bacteria 958
278 Ga0070699_100000410 3300005518 Bacteria 41278
279 Ga0070699_100006991 3300005518 Bacteria 9807
280 Ga0070699_100096384 3300005518 Bacteria 2591
281 Ga0070699_100193627 3300005518 Bacteria 1807
282 Ga0070699_100339085 3300005518 Bacteria 1353
283 Ga0070679_100029861 3300005530 Bacteria 5379
284 Ga0070679_100102192 3300005530 Bacteria 2853
285 Ga0070679_100641762 3300005530 Bacteria 1005
286 Ga0070684_100102316 3300005535 Bacteria 2561
287 Ga0070684_100142227 3300005535 Bacteria 2170
288 Ga0070684_101072578 3300005535 Bacteria 757
289 Ga0070697_100111646 3300005536 Bacteria 2279
290 Ga0070697_100242965 3300005536 Bacteria 1538
291 Ga0070697_100403330 3300005536 Bacteria 1187
292 Ga0070697_100482544 3300005536 Bacteria 1082
293 Ga0068853_100656523 3300005539 Bacteria 999
294 Ga0068853_100737900 3300005539 Bacteria 941
295 Ga0070672_100018264 3300005543 Bacteria 5064
296 Ga0070672_100019397 3300005543 Bacteria 4936
297 Ga0070672_100042201 3300005543 Bacteria 3511
298 Ga0070672_100069473 3300005543 Bacteria 2797
299 Ga0070672_100070493 3300005543 Bacteria 2777
300 Ga0070672_100112343 3300005543 Bacteria 2222
301 Ga0070672_100164949 3300005543 Bacteria 1840
302 Ga0070672_100189221 3300005543 Bacteria 1718
303 Ga0070672_100260072 3300005543 Bacteria 1463
304 Ga0070672_100261487 3300005543 Bacteria 1459
305 Ga0070672_100282108 3300005543 Bacteria 1405
306 Ga0070672_100403004 3300005543 Bacteria 1173
307 Ga0070672_100977090 3300005543 Bacteria 750
308 Ga0070686_100034495 3300005544 Bacteria 3118
309 Ga0070686_100044083 3300005544 Bacteria 2801
310 Ga0070686_100157598 3300005544 Bacteria 1596
311 Ga0070686_100259715 3300005544 Bacteria 1272
312 Ga0070686_100319194 3300005544 Bacteria 1158
313 Ga0070686_100377288 3300005544 Bacteria 1072
314 Ga0070686_100527251 3300005544 Bacteria 920
315 Ga0070686_100594052 3300005544 Bacteria 871
316 Ga0070695_100003541 3300005545 Bacteria 9119
317 Ga0070695_100006902 3300005545 Bacteria 6724
318 Ga0070695_100282823 3300005545 Bacteria 1219
319 Ga0070695_100299645 3300005545 Bacteria 1188
320 Ga0070695_100362037 3300005545 Bacteria 1089
321 Ga0070695_100371451 3300005545 Bacteria 1077
322 Ga0070696_100001074 3300005546 Bacteria 17644
323 Ga0070696_100081005 3300005546 Bacteria 2300
324 Ga0070696_100153904 3300005546 Bacteria 1690
325 Ga0070696_100231733 3300005546 Bacteria 1390
326 Ga0070696_100232717 3300005546 Bacteria 1387
327 Ga0070696_100531467 3300005546 Bacteria 940
328 Ga0070693_100056294 3300005547 Bacteria 2269
329 Ga0070693_100119202 3300005547 Bacteria 1634
330 Ga0070665_100004733 3300005548 Bacteria 14164
331 Ga0070665_100005447 3300005548 Bacteria 13122
332 Ga0070665_100010437 3300005548 Bacteria 9398
333 Ga0070665_100036449 3300005548 Bacteria 4947
334 Ga0070665_100116679 3300005548 Bacteria 2672
335 Ga0070665_100207591 3300005548 Bacteria 1959
336 Ga0070665_101238487 3300005548 Bacteria 757
337 Ga0070704_100000751 3300005549 Bacteria 15957
338 Ga0070704_100070909 3300005549 Bacteria 2530
339 Ga0070704_100229766 3300005549 Bacteria 1513
340 Ga0070704_100270148 3300005549 Bacteria 1405
341 Ga0070704_100482721 3300005549 Bacteria 1073
342 Ga0070704_100554092 3300005549 Bacteria 1005
343 Ga0070704_100589803 3300005549 Bacteria 975
344 Ga0068855_100019504 3300005563 Bacteria 8149
345 Ga0068855_100713833 3300005563 Bacteria 1072
346 Ga0068855_100808323 3300005563 Bacteria 996
347 Ga0068855_100898736 3300005563 Bacteria 936
348 Ga0070664_100004358 3300005564 Bacteria 11371
349 Ga0070664_100015643 3300005564 Bacteria 6208
350 Ga0070664_100035098 3300005564 Bacteria 4209
351 Ga0070664_100066973 3300005564 Bacteria 3068
352 Ga0070664_100200582 3300005564 Bacteria 1780
353 Ga0070664_100449690 3300005564 Bacteria 1183
354 Ga0070664_100465786 3300005564 Bacteria 1162
355 Ga0070664_100702033 3300005564 Bacteria 942
356 Ga0068857_100071289 3300005577 Bacteria 3095
357 Ga0068857_100095577 3300005577 Bacteria 2663
358 Ga0068857_100118951 3300005577 Bacteria 2378
359 Ga0068857_100638253 3300005577 Bacteria 1009
360 Ga0068857_100713347 3300005577 Bacteria 953
361 Ga0068857_100822763 3300005577 Bacteria 888
362 Ga0068857_100939157 3300005577 Bacteria 831
363 Ga0068854_100052842 3300005578 Bacteria 2915
364 Ga0068854_100574067 3300005578 Bacteria 959
365 Ga0070702_100002883 3300005615 Bacteria 7557
366 Ga0070702_100033168 3300005615 Bacteria 2837
367 Ga0070702_100221342 3300005615 Bacteria 1266
368 Ga0070702_100306617 3300005615 Bacteria 1101
369 Ga0068852_100045958 3300005616 Bacteria 3717
370 Ga0068852_100307649 3300005616 Bacteria 1536
371 Ga0068852_100311453 3300005616 Bacteria 1526
372 Ga0068852_100706167 3300005616 Bacteria 1019
373 Ga0068859_100012803 3300005617 Bacteria 8425
374 Ga0068859_100026110 3300005617 Bacteria 5859
375 Ga0068859_100029403 3300005617 Bacteria 5513
376 Ga0068859_100044148 3300005617 Bacteria 4479
377 Ga0068859_100077177 3300005617 Bacteria 3372
378 Ga0068859_100137523 3300005617 Bacteria 2517
379 Ga0068859_100151731 3300005617 Bacteria 2392
380 Ga0068859_100180046 3300005617 Bacteria 2196
381 Ga0068859_100219321 3300005617 Bacteria 1990
382 Ga0068859_100303333 3300005617 Bacteria 1690
383 Ga0068859_100525190 3300005617 Bacteria 1278
384 Ga0068859_100733134 3300005617 Bacteria 1078
385 Ga0068859_100770472 3300005617 Bacteria 1051
386 Ga0068859_100884173 3300005617 Bacteria 979
387 Ga0068859_101371855 3300005617 Bacteria 779
388 Ga0068864_100002899 3300005618 Bacteria 14178
389 Ga0068864_100030675 3300005618 Bacteria 4558
390 Ga0068864_100097802 3300005618 Bacteria 2599
391 Ga0068864_100158097 3300005618 Bacteria 2059
392 Ga0068864_100165321 3300005618 Bacteria 2014
393 Ga0068864_100307546 3300005618 Bacteria 1485
394 Ga0068864_100369220 3300005618 Bacteria 1358
395 Ga0068864_100494548 3300005618 Bacteria 1176
396 Ga0068864_100621984 3300005618 Bacteria 1049
397 Ga0068864_101211882 3300005618 Bacteria 754
398 Ga0068866_10186709 3300005718 Bacteria 1228
399 Ga0068866_10220712 3300005718 Bacteria 1143
400 Ga0068861_100005736 3300005719 Bacteria 8418
401 Ga0068861_100011547 3300005719 Bacteria 6146
402 Ga0068861_100011957 3300005719 Bacteria 6044
403 Ga0068861_100049408 3300005719 Bacteria 3184
404 Ga0068861_100058465 3300005719 Bacteria 2949
405 Ga0068861_100060382 3300005719 Bacteria 2905
406 Ga0068861_100178759 3300005719 Bacteria 1764
407 Ga0068861_100392221 3300005719 Bacteria 1230
408 Ga0068861_100614384 3300005719 Bacteria 999
409 Ga0068870_10000698 3300005840 Bacteria 12863
410 Ga0068870_10013554 3300005840 Bacteria 3834
411 Ga0068870_10077709 3300005840 Bacteria 1827
412 Ga0068870_10083424 3300005840 Bacteria 1771
413 Ga0068870_10251497 3300005840 Bacteria 1096
414 Ga0068870_10454997 3300005840 Bacteria 844
415 Ga0068870_10552274 3300005840 Bacteria 776
416 Ga0068863_100003338 3300005841 Bacteria 15848
417 Ga0068863_100029433 3300005841 Bacteria 5242
418 Ga0068863_100097734 3300005841 Bacteria 2788
419 Ga0068863_100101600 3300005841 Bacteria 2734
420 Ga0068863_100450855 3300005841 Bacteria 1263
421 Ga0068863_100562629 3300005841 Bacteria 1126
422 Ga0068858_100001254 3300005842 Bacteria 26256
423 Ga0068858_100009001 3300005842 Bacteria 9549
424 Ga0068858_100010513 3300005842 Bacteria 8764
425 Ga0068858_100064329 3300005842 Bacteria 3394
426 Ga0068858_100074105 3300005842 Bacteria 3160
427 Ga0068858_100075667 3300005842 Bacteria 3127
428 Ga0068858_100108577 3300005842 Bacteria 2590
429 Ga0068858_100245548 3300005842 Bacteria 1699
430 Ga0068858_100755058 3300005842 Bacteria 948
431 Ga0068858_100847557 3300005842 Bacteria 893
432 Ga0068858_101018898 3300005842 Bacteria 812
433 Ga0068860_100062492 3300005843 Bacteria 3538
434 Ga0068860_100173478 3300005843 Bacteria 2083
435 Ga0068860_100277898 3300005843 Bacteria 1636
436 Ga0068860_100307266 3300005843 Bacteria 1555
437 Ga0068860_100366749 3300005843 Bacteria 1420
438 Ga0068860_100372474 3300005843 Bacteria 1408
439 Ga0068860_100525924 3300005843 Bacteria 1183
440 Ga0068860_100613083 3300005843 Bacteria 1094
441 Ga0068860_100742462 3300005843 Bacteria 993
442 Ga0068860_100912110 3300005843 Bacteria 895
443 Ga0068862_100002296 3300005844 Bacteria 17092
444 Ga0068862_100003082 3300005844 Bacteria 14534
445 Ga0068862_100021021 3300005844 Bacteria 5453
446 Ga0068862_100026017 3300005844 Bacteria 4917
447 Ga0068862_100051237 3300005844 Bacteria 3530
448 Ga0068862_100082316 3300005844 Bacteria 2793
449 Ga0068862_100148298 3300005844 Bacteria 2086
450 Ga0068862_100185785 3300005844 Bacteria 1868
451 Ga0068862_100204294 3300005844 Bacteria 1783
452 Ga0068862_100268844 3300005844 Bacteria 1558
453 Ga0068862_100486800 3300005844 Bacteria 1169
454 Ga0068862_100658326 3300005844 Bacteria 1011
455 Ga0068862_101204989 3300005844 Bacteria 756
456 Ga0081455_10025866 3300005937 Bacteria 5409
457 Ga0081455_10312302 3300005937 Bacteria 1123
458 Ga0081538_10028271 3300005981 Bacteria 3861
459 Ga0081539_10000142 3300005985 Bacteria 165444
460 Ga0081539_10000215 3300005985 Bacteria 135054
461 Ga0081539_10003297 3300005985 Bacteria 20197
462 Ga0081539_10027389 3300005985 Bacteria 3611
463 Ga0070717_10296866 3300006028 Bacteria 1436
464 Ga0070717_10340644 3300006028 Bacteria 1339
465 Ga0075365_10042307 3300006038 Bacteria 2978
466 Ga0075365_10186510 3300006038 Bacteria 1451
467 Ga0075368_10009856 3300006042 Bacteria 3444
468 Ga0075368_10018531 3300006042 Bacteria 2616
469 Ga0075368_10168604 3300006042 Bacteria 919
470 Ga0075363_100006283 3300006048 Bacteria 5382
471 Ga0075364_10021843 3300006051 Bacteria 4035
472 Ga0075364_10110101 3300006051 Bacteria 1837
473 Ga0075364_10546881 3300006051 Bacteria 791
474 Ga0075362_10000151 3300006177 Bacteria 18803
475 Ga0075362_10093276 3300006177 Bacteria 1400
476 Ga0075362_10099004 3300006177 Bacteria 1361
477 Ga0075367_10005011 3300006178 Bacteria 6533
478 Ga0075367_10032966 3300006178 Bacteria 2983
479 Ga0075367_10035916 3300006178 Bacteria 2871
480 Ga0075367_10038906 3300006178 Bacteria 2771
481 Ga0075367_10056625 3300006178 Bacteria 2329
482 Ga0075367_10115498 3300006178 Bacteria 1650
483 Ga0075369_10075029 3300006186 Bacteria 1493
484 Ga0075366_10046946 3300006195 Bacteria 2559
485 Ga0075366_10056183 3300006195 Bacteria 2338
486 Ga0075366_10085628 3300006195 Bacteria 1885
487 Ga0075366_10211594 3300006195 Bacteria 1180
488 Ga0097621_100006061 3300006237 Bacteria 8549
489 Ga0097621_100011600 3300006237 Bacteria 6496
490 Ga0097621_100015176 3300006237 Bacteria 5787
491 Ga0097621_100082137 3300006237 Bacteria 2683
492 Ga0097621_100133656 3300006237 Bacteria 2114
493 Ga0097621_100150356 3300006237 Bacteria 1996
494 Ga0097621_100157380 3300006237 Bacteria 1951
495 Ga0097621_100201569 3300006237 Bacteria 1728
496 Ga0097621_100209453 3300006237 Bacteria 1696
497 Ga0097621_100631158 3300006237 Bacteria 981
498 Ga0097621_100657909 3300006237 Bacteria 962
499 Ga0097621_100691353 3300006237 Bacteria 938
500 Ga0097621_100697028 3300006237 Bacteria 935
501 Ga0075370_10028573 3300006353 Bacteria 3100
502 Ga0075370_10033472 3300006353 Bacteria 2878
503 Ga0068871_100001728 3300006358 Bacteria 14706
504 Ga0068871_100033665 3300006358 Bacteria 4060
505 Ga0068871_100060899 3300006358 Bacteria 3080
506 Ga0068871_100166415 3300006358 Bacteria 1888
507 Ga0068871_100172788 3300006358 Bacteria 1853
508 Ga0068871_100179700 3300006358 Bacteria 1818
509 Ga0068871_100223908 3300006358 Bacteria 1631
510 Ga0068871_100318158 3300006358 Bacteria 1369
511 Ga0068871_100341993 3300006358 Bacteria 1321
512 Ga0068871_100477892 3300006358 Bacteria 1120
513 Ga0068871_101083135 3300006358 Bacteria 749
514 Ga0075428_100000009 3300006844 Bacteria 266370
515 Ga0075428_100000566 3300006844 Bacteria 37713
516 Ga0075428_100002605 3300006844 Bacteria 19618
517 Ga0075428_100020626 3300006844 Bacteria 7298
518 Ga0075428_100061193 3300006844 Bacteria 4123
519 Ga0075428_100109163 3300006844 Bacteria 3015
520 Ga0075428_100122963 3300006844 Bacteria 2825
521 Ga0075428_100151125 3300006844 Bacteria 2522
522 Ga0075428_100239042 3300006844 Bacteria 1960
523 Ga0075428_100260481 3300006844 Bacteria 1867
524 Ga0075428_100278319 3300006844 Bacteria 1800
525 Ga0075428_100361705 3300006844 Bacteria 1556
526 Ga0075428_100366816 3300006844 Bacteria 1545
527 Ga0075428_100491896 3300006844 Bacteria 1313
528 Ga0075428_100586681 3300006844 Bacteria 1191
529 Ga0075428_100596605 3300006844 Bacteria 1180
530 Ga0075428_100670262 3300006844 Bacteria 1106
531 Ga0075428_101216672 3300006844 Bacteria 794
532 Ga0075430_100002725 3300006846 Bacteria 14742
533 Ga0075430_100005705 3300006846 Bacteria 10502
534 Ga0075430_100016624 3300006846 Bacteria 6265
535 Ga0075430_100018940 3300006846 Bacteria 5857
536 Ga0075430_100036424 3300006846 Bacteria 4172
537 Ga0075430_100068323 3300006846 Bacteria 2981
538 Ga0075430_100074719 3300006846 Bacteria 2841
539 Ga0075430_100075246 3300006846 Bacteria 2831
540 Ga0075430_100098382 3300006846 Bacteria 2444
541 Ga0075430_100163499 3300006846 Bacteria 1853
542 Ga0075430_100211384 3300006846 Bacteria 1610
543 Ga0075430_100215400 3300006846 Bacteria 1594
544 Ga0075430_100280815 3300006846 Bacteria 1378
545 Ga0075430_100315446 3300006846 Bacteria 1293
546 Ga0075430_100360347 3300006846 Bacteria 1201
547 Ga0075430_100387857 3300006846 Bacteria 1153
548 Ga0075431_100004450 3300006847 Bacteria 13743
549 Ga0075431_100007812 3300006847 Bacteria 10653
550 Ga0075431_100008247 3300006847 Bacteria 10416
551 Ga0075431_100040301 3300006847 Bacteria 4813
552 Ga0075431_100044056 3300006847 Bacteria 4602
553 Ga0075431_100044712 3300006847 Bacteria 4566
554 Ga0075431_100131276 3300006847 Bacteria 2583
555 Ga0075431_100228448 3300006847 Bacteria 1897
556 Ga0075431_100339157 3300006847 Bacteria 1513
557 Ga0075431_100449986 3300006847 Bacteria 1284
558 Ga0075431_100535297 3300006847 Bacteria 1160
559 Ga0075431_100699062 3300006847 Bacteria 992
560 Ga0075431_100940692 3300006847 Bacteria 833
561 Ga0075433_10002092 3300006852 Bacteria 15112
562 Ga0075433_10027605 3300006852 Bacteria 4817
563 Ga0075433_10030514 3300006852 Bacteria 4600
564 Ga0075433_10062553 3300006852 Bacteria 3259
565 Ga0075433_10076679 3300006852 Bacteria 2944
566 Ga0075433_10080852 3300006852 Bacteria 2865
567 Ga0075433_10082490 3300006852 Bacteria 2835
568 Ga0075433_10121284 3300006852 Bacteria 2321
569 Ga0075433_10164658 3300006852 Bacteria 1974
570 Ga0075433_10172495 3300006852 Bacteria 1925
571 Ga0075433_10199131 3300006852 Bacteria 1781
572 Ga0075433_10207128 3300006852 Bacteria 1743
573 Ga0075433_10435697 3300006852 Bacteria 1156
574 Ga0075433_10489055 3300006852 Bacteria 1084
575 Ga0075433_10677661 3300006852 Bacteria 904
576 Ga0075433_10729996 3300006852 Bacteria 867
577 Ga0075433_10838196 3300006852 Bacteria 803
578 Ga0075434_100004504 3300006871 Bacteria 12573
579 Ga0075434_100014563 3300006871 Bacteria 7521
580 Ga0075434_100017612 3300006871 Bacteria 6886
581 Ga0075434_100025368 3300006871 Bacteria 5799
582 Ga0075434_100030886 3300006871 Bacteria 5279
583 Ga0075434_100052143 3300006871 Bacteria 4064
584 Ga0075434_100059010 3300006871 Bacteria 3814
585 Ga0075434_100091137 3300006871 Bacteria 3050
586 Ga0075434_100134915 3300006871 Bacteria 2488
587 Ga0075434_100259181 3300006871 Bacteria 1758
588 Ga0075434_100266259 3300006871 Bacteria 1733
589 Ga0075434_100349562 3300006871 Bacteria 1499
590 Ga0075434_100377343 3300006871 Bacteria 1439
591 Ga0075434_100399406 3300006871 Bacteria 1395
592 Ga0075434_100610416 3300006871 Bacteria 1110
593 Ga0075429_100004639 3300006880 Bacteria 11815
594 Ga0075429_100011402 3300006880 Bacteria 7699
595 Ga0075429_100019533 3300006880 Bacteria 5871
596 Ga0075429_100075727 3300006880 Bacteria 2931
597 Ga0075429_100140556 3300006880 Bacteria 2113
598 Ga0075429_100193482 3300006880 Bacteria 1782
599 Ga0075429_100210111 3300006880 Bacteria 1705
600 Ga0075429_100227419 3300006880 Bacteria 1634
601 Ga0075429_100241442 3300006880 Bacteria 1582
602 Ga0075429_100438481 3300006880 Bacteria 1145
603 Ga0068865_100020558 3300006881 Bacteria 4282
604 Ga0068865_100185817 3300006881 Bacteria 1603
605 Ga0068865_100283596 3300006881 Bacteria 1319
606 Ga0068865_100366295 3300006881 Bacteria 1172
607 Ga0075436_100006359 3300006914 Bacteria 8095
608 Ga0075436_100014321 3300006914 Bacteria 5430
609 Ga0075436_100019702 3300006914 Bacteria 4625
610 Ga0075436_100047990 3300006914 Bacteria 2946
611 Ga0075436_100081470 3300006914 Bacteria 2244
612 Ga0075436_100411062 3300006914 Bacteria 981
613 Ga0075436_100419311 3300006914 Bacteria 972
614 Ga0097620_100012804 3300006931 Bacteria 8425
615 Ga0097620_100026110 3300006931 Bacteria 5859
616 Ga0097620_100029403 3300006931 Bacteria 5513
617 Ga0097620_100044150 3300006931 Bacteria 4479
618 Ga0097620_100077187 3300006931 Bacteria 3372
619 Ga0097620_100137524 3300006931 Bacteria 2517
620 Ga0097620_100151731 3300006931 Bacteria 2392
621 Ga0097620_100180043 3300006931 Bacteria 2196
622 Ga0097620_100219315 3300006931 Bacteria 1990
623 Ga0097620_100303335 3300006931 Bacteria 1690
624 Ga0097620_100525221 3300006931 Bacteria 1278
625 Ga0097620_100733057 3300006931 Bacteria 1078
626 Ga0097620_100770439 3300006931 Bacteria 1051
627 Ga0097620_100884158 3300006931 Bacteria 979
628 Ga0097620_101371826 3300006931 Bacteria 779
629 Ga0075435_100001248 3300007076 Bacteria 16274
630 Ga0075435_100001542 3300007076 Bacteria 14846
631 Ga0075435_100003200 3300007076 Bacteria 11085
632 Ga0075435_100004862 3300007076 Bacteria 9304
633 Ga0075435_100021902 3300007076 Bacteria 4925
634 Ga0075435_100029287 3300007076 Bacteria 4320
635 Ga0075435_100123551 3300007076 Bacteria 2162
636 Ga0075435_100486173 3300007076 Bacteria 1066
637 Ga0075435_100579052 3300007076 Bacteria 973
638 Ga0075435_100771933 3300007076 Bacteria 836
639 Ga0075435_100861508 3300007076 Bacteria 790
640 Ga0105240_10205626 3300009093 Bacteria 2305
641 Ga0105240_10239450 3300009093 Bacteria 2104
642 Ga0105240_10412419 3300009093 Bacteria 1519
643 Ga0105240_10494022 3300009093 Bacteria 1362
644 Ga0105240_10773992 3300009093 Bacteria 1042
645 Ga0105240_10911691 3300009093 Bacteria 945
646 Ga0111539_10000010 3300009094 Bacteria 366246
647 Ga0111539_10000566 3300009094 Bacteria 47366
648 Ga0111539_10000614 3300009094 Bacteria 46152
649 Ga0111539_10000976 3300009094 Bacteria 37564
650 Ga0111539_10005584 3300009094 Bacteria 16267
651 Ga0111539_10008096 3300009094 Bacteria 13396
652 Ga0111539_10035602 3300009094 Bacteria 6026
653 Ga0111539_10049617 3300009094 Bacteria 5003
654 Ga0111539_10053296 3300009094 Bacteria 4815
655 Ga0111539_10084764 3300009094 Bacteria 3725
656 Ga0111539_10136890 3300009094 Bacteria 2868
657 Ga0111539_10199637 3300009094 Bacteria 2332
658 Ga0111539_10357697 3300009094 Bacteria 1699
659 Ga0111539_10428152 3300009094 Bacteria 1541
660 Ga0111539_10452487 3300009094 Bacteria 1495
661 Ga0111539_10743188 3300009094 Bacteria 1142
662 Ga0111539_11062065 3300009094 Bacteria 941
663 Ga0111539_11149524 3300009094 Bacteria 902
664 Ga0105245_10386784 3300009098 Bacteria 1394
665 Ga0105245_10413220 3300009098 Bacteria 1351
666 Ga0105245_11464319 3300009098 Bacteria 733
667 Ga0105247_10028592 3300009101 Bacteria 3374
668 Ga0105247_10222250 3300009101 Bacteria 1279
669 Ga0105247_10342434 3300009101 Bacteria 1049
670 Ga0114129_10000347 3300009147 Bacteria 53984
671 Ga0114129_10004861 3300009147 Bacteria 18961
672 Ga0114129_10005044 3300009147 Bacteria 18585
673 Ga0114129_10006820 3300009147 Bacteria 16221
674 Ga0114129_10008264 3300009147 Bacteria 14846
675 Ga0114129_10020235 3300009147 Bacteria 9470
676 Ga0114129_10021566 3300009147 Bacteria 9144
677 Ga0114129_10023812 3300009147 Bacteria 8679
678 Ga0114129_10033059 3300009147 Bacteria 7309
679 Ga0114129_10047057 3300009147 Bacteria 6062
680 Ga0114129_10061796 3300009147 Bacteria 5235
681 Ga0114129_10078194 3300009147 Bacteria 4602
682 Ga0114129_10080394 3300009147 Bacteria 4530
683 Ga0114129_10081911 3300009147 Bacteria 4485
684 Ga0114129_10106586 3300009147 Bacteria 3871
685 Ga0114129_10220088 3300009147 Bacteria 2562
686 Ga0114129_10243133 3300009147 Bacteria 2419
687 Ga0114129_10687360 3300009147 Bacteria 1316
688 Ga0114129_10717618 3300009147 Bacteria 1283
689 Ga0114129_10825683 3300009147 Bacteria 1180
690 Ga0114129_11101258 3300009147 Bacteria 994
691 Ga0105243_10062233 3300009148 Bacteria 2987
692 Ga0105243_10127918 3300009148 Bacteria 2151
693 Ga0105243_10153454 3300009148 Bacteria 1978
694 Ga0105243_10335866 3300009148 Bacteria 1382
695 Ga0105243_10552195 3300009148 Bacteria 1101
696 Ga0105243_10663521 3300009148 Bacteria 1012
697 Ga0105243_10808353 3300009148 Bacteria 925
698 Ga0105241_10016312 3300009174 Bacteria 5445
699 Ga0105241_10168637 3300009174 Bacteria 1806
700 Ga0105241_10445234 3300009174 Bacteria 1145
701 Ga0105241_10506356 3300009174 Bacteria 1077
702 Ga0105241_10933045 3300009174 Bacteria 808
703 Ga0105242_10011214 3300009176 Bacteria 6887
704 Ga0105242_10062522 3300009176 Bacteria 3064
705 Ga0105242_10077034 3300009176 Bacteria 2781
706 Ga0105242_10175790 3300009176 Bacteria 1885
707 Ga0105242_10240060 3300009176 Bacteria 1628
708 Ga0105242_10266964 3300009176 Bacteria 1548
709 Ga0105242_10315923 3300009176 Bacteria 1431
710 Ga0105242_10388409 3300009176 Bacteria 1299
711 Ga0105242_10405498 3300009176 Bacteria 1273
712 Ga0105242_10855991 3300009176 Bacteria 905
713 Ga0105242_10876565 3300009176 Bacteria 895
714 Ga0105242_11415312 3300009176 Bacteria 723
715 Ga0105248_10015209 3300009177 Bacteria 8480
716 Ga0105248_10039983 3300009177 Bacteria 5256
717 Ga0105248_10041456 3300009177 Bacteria 5161
718 Ga0105248_10087502 3300009177 Bacteria 3506
719 Ga0105248_10152893 3300009177 Bacteria 2604
720 Ga0105248_10210393 3300009177 Bacteria 2191
721 Ga0105248_10233060 3300009177 Bacteria 2073
722 Ga0105248_10252060 3300009177 Bacteria 1987
723 Ga0105248_10374016 3300009177 Bacteria 1604
724 Ga0105248_10401159 3300009177 Bacteria 1544
725 Ga0105248_10539078 3300009177 Bacteria 1316
726 Ga0105248_10565314 3300009177 Bacteria 1283
727 Ga0105248_10595330 3300009177 Bacteria 1248
728 Ga0105248_10718574 3300009177 Bacteria 1127
729 Ga0105248_10984896 3300009177 Bacteria 952
730 Ga0105237_10574040 3300009545 Bacteria 1135
731 Ga0105238_10077035 3300009551 Bacteria 3327
732 Ga0105238_10256783 3300009551 Bacteria 1727
733 Ga0105238_10416165 3300009551 Bacteria 1338
734 Ga0105238_10436632 3300009551 Bacteria 1305
735 Ga0105238_10559588 3300009551 Bacteria 1148
736 Ga0105249_10000649 3300009553 Bacteria 31693
737 Ga0105249_10002497 3300009553 Bacteria 15920
738 Ga0105249_10130974 3300009553 Bacteria 2394
739 Ga0105249_10147090 3300009553 Bacteria 2265
740 Ga0105249_10184311 3300009553 Bacteria 2033
741 Ga0105249_10276733 3300009553 Bacteria 1674
742 Ga0105249_10414237 3300009553 Bacteria 1380
743 Ga0105249_10618952 3300009553 Bacteria 1138
744 Ga0105249_10790928 3300009553 Bacteria 1012
745 Ga0105249_11096106 3300009553 Bacteria 866
746 Ga0105239_10173046 3300010375 Bacteria 2415
747 Ga0105239_10884458 3300010375 Bacteria 1025
748 Ga0105239_11010096 3300010375 Bacteria 956
749 Ga0105246_10016712 3300011119 Bacteria 4651
750 Ga0105246_10188937 3300011119 Bacteria 1593
751 Ga0105246_10281155 3300011119 Bacteria 1335
752 Ga0105246_10507508 3300011119 Bacteria 1025
753 Ga0105246_10669311 3300011119 Bacteria 906
754 Ga0157371_10393477 3300013102 Bacteria 1013
755 Ga0157370_10224325 3300013104 Bacteria 1740
756 Ga0157370_10388874 3300013104 Bacteria 1284
757 Ga0157369_10569201 3300013105 Bacteria 1170
758 Ga0157369_11019181 3300013105 Bacteria 847
759 Ga0157374_10219870 3300013296 Bacteria 1864
760 Ga0157374_10253954 3300013296 Bacteria 1730
761 Ga0157374_10313892 3300013296 Bacteria 1552
762 Ga0157374_10735547 3300013296 Bacteria 1001
763 Ga0157374_10931190 3300013296 Bacteria 887
764 Ga0157378_10007877 3300013297 Bacteria 9298
765 Ga0157378_10248006 3300013297 Bacteria 1704
766 Ga0157378_10592204 3300013297 Bacteria 1119
767 Ga0157378_10629665 3300013297 Bacteria 1087
768 Ga0157378_10694255 3300013297 Bacteria 1037
769 Ga0157378_11076089 3300013297 Bacteria 840
770 Ga0157378_11114368 3300013297 Bacteria 827
771 Ga0157378_11252796 3300013297 Bacteria 782
772 Ga0163162_10012608 3300013306 Bacteria 8255
773 Ga0163162_10140385 3300013306 Bacteria 2529
774 Ga0163162_10230390 3300013306 Bacteria 1983
775 Ga0163162_10525549 3300013306 Bacteria 1312
776 Ga0163162_10699724 3300013306 Bacteria 1135
777 Ga0163162_10883103 3300013306 Bacteria 1008
778 Ga0163162_11044001 3300013306 Bacteria 925
779 Ga0163162_11270085 3300013306 Bacteria 836
780 Ga0163162_12046387 3300013306 Bacteria 656
781 Ga0157372_10042550 3300013307 Bacteria 5025
782 Ga0157375_10045095 3300013308 Bacteria 4290
783 Ga0157375_10118319 3300013308 Bacteria 2756
784 Ga0157375_10236510 3300013308 Bacteria 1986
785 Ga0157375_10267027 3300013308 Bacteria 1873
786 Ga0157375_10304235 3300013308 Bacteria 1758
787 Ga0157375_10326674 3300013308 Bacteria 1699
788 Ga0157375_10386601 3300013308 Bacteria 1566
789 Ga0157375_10450004 3300013308 Bacteria 1453
790 Ga0157375_10746745 3300013308 Bacteria 1130
791 Ga0157375_11047597 3300013308 Bacteria 953
792 Ga0157375_11087455 3300013308 Bacteria 936
793 Ga0163163_10000013 3300014325 Bacteria 242522
794 Ga0163163_10015096 3300014325 Bacteria 7127
795 Ga0163163_10058152 3300014325 Bacteria 3823
796 Ga0163163_10093796 3300014325 Bacteria 3018
797 Ga0163163_10267085 3300014325 Bacteria 1762
798 Ga0163163_10448466 3300014325 Bacteria 1350
799 Ga0163163_10628002 3300014325 Bacteria 1138
800 Ga0163163_10977004 3300014325 Bacteria 910
801 Ga0157380_10010930 3300014326 Bacteria 6546
802 Ga0157380_10012295 3300014326 Bacteria 6206
803 Ga0157380_10058189 3300014326 Bacteria 3081
804 Ga0157380_10084876 3300014326 Bacteria 2597
805 Ga0157380_10100753 3300014326 Bacteria 2405
806 Ga0157380_10223444 3300014326 Bacteria 1686
807 Ga0157380_10246917 3300014326 Bacteria 1613
808 Ga0157380_10255279 3300014326 Bacteria 1589
809 Ga0157380_10261243 3300014326 Bacteria 1573
810 Ga0157380_10306125 3300014326 Bacteria 1466
811 Ga0157380_10324159 3300014326 Bacteria 1429
812 Ga0157380_10405442 3300014326 Bacteria 1295
813 Ga0157380_11374831 3300014326 Bacteria 756
814 Ga0182008_10161661 3300014497 Bacteria 1127
815 Ga0157377_10099859 3300014745 Bacteria 1727
816 Ga0157377_10167795 3300014745 Bacteria 1370
817 Ga0157377_10233995 3300014745 Bacteria 1183
818 Ga0157377_10282677 3300014745 Bacteria 1088
819 Ga0157379_10059958 3300014968 Bacteria 3402
820 Ga0157379_10141606 3300014968 Bacteria 2168
821 Ga0157379_10278633 3300014968 Bacteria 1521
822 Ga0157379_10342777 3300014968 Bacteria 1367
823 Ga0157379_10350175 3300014968 Bacteria 1352
824 Ga0157379_10550813 3300014968 Bacteria 1073
825 Ga0157379_10630413 3300014968 Bacteria 1002
826 Ga0157379_10771290 3300014968 Bacteria 906
827 Ga0157379_10898171 3300014968 Bacteria 840
828 Ga0157376_10019471 3300014969 Bacteria 5233
829 Ga0157376_10030126 3300014969 Bacteria 4329
830 Ga0157376_10039952 3300014969 Bacteria 3831
831 Ga0157376_10073740 3300014969 Bacteria 2907
832 Ga0157376_10115848 3300014969 Bacteria 2367
833 Ga0157376_10295204 3300014969 Bacteria 1532
834 Ga0157376_10432503 3300014969 Bacteria 1279
835 Ga0157376_10657321 3300014969 Bacteria 1049
836 Ga0157376_11059331 3300014969 Bacteria 835
837 Ga0182007_10054418 3300015262 Bacteria 1316
838 Ga0163161_10019901 3300017792 Bacteria 4707
839 Ga0163161_10150504 3300017792 Bacteria 1768
840 Ga0163161_10275843 3300017792 Bacteria 1317
841 Ga0163161_10464529 3300017792 Bacteria 1025
842 Ga0163161_10474616 3300017792 Bacteria 1015
843 Ga0163161_10804541 3300017792 Bacteria 790
844 Ga0163161_10827789 3300017792 Bacteria 780
845 Ga0163161_10909969 3300017792 Bacteria 746
846 Ga0207673_1002316 3300025290 Bacteria 2162
847 Ga0207697_10002850 3300025315 Bacteria 8765
848 Ga0207697_10006327 3300025315 Bacteria 5378
849 Ga0207697_10016274 3300025315 Bacteria 3063
850 Ga0207697_10088238 3300025315 Bacteria 1313
851 Ga0207656_10341036 3300025321 Bacteria 747
852 Ga0207653_10066214 3300025885 Bacteria 1227
853 Ga0207682_10033624 3300025893 Bacteria 2065
854 Ga0207682_10038783 3300025893 Bacteria 1934
855 Ga0207682_10055593 3300025893 Bacteria 1646
856 Ga0207682_10145131 3300025893 Bacteria 1067
857 Ga0207682_10191066 3300025893 Bacteria 938
858 Ga0207682_10353869 3300025893 Bacteria 692
859 Ga0207642_10079220 3300025899 Bacteria 1590
860 Ga0207642_10351503 3300025899 Bacteria 870
861 Ga0207710_10014776 3300025900 Bacteria 3296
862 Ga0207710_10090900 3300025900 Bacteria 1428
863 Ga0207710_10161836 3300025900 Bacteria 1091
864 Ga0207688_10000138 3300025901 Bacteria 30845
865 Ga0207688_10079958 3300025901 Bacteria 1865
866 Ga0207688_10171212 3300025901 Bacteria 1291
867 Ga0207688_10202758 3300025901 Bacteria 1190
868 Ga0207688_10224971 3300025901 Bacteria 1131
869 Ga0207680_10006153 3300025903 Bacteria 5788
870 Ga0207680_10108757 3300025903 Bacteria 1794
871 Ga0207680_10113874 3300025903 Bacteria 1759
872 Ga0207680_10123316 3300025903 Bacteria 1698
873 Ga0207680_10256347 3300025903 Bacteria 1210
874 Ga0207680_10284142 3300025903 Bacteria 1150
875 Ga0207680_10410362 3300025903 Bacteria 958
876 Ga0207680_10758319 3300025903 Bacteria 696
877 Ga0207647_10284145 3300025904 Bacteria 944
878 Ga0207685_10020392 3300025905 Bacteria 2202
879 Ga0207699_10245485 3300025906 Bacteria 1232
880 Ga0207645_10006264 3300025907 Bacteria 8550
881 Ga0207645_10028448 3300025907 Bacteria 3608
882 Ga0207645_10100166 3300025907 Bacteria 1869
883 Ga0207645_10106234 3300025907 Bacteria 1815
884 Ga0207645_10121002 3300025907 Bacteria 1699
885 Ga0207645_10178848 3300025907 Bacteria 1391
886 Ga0207645_10183242 3300025907 Bacteria 1374
887 Ga0207645_10371564 3300025907 Bacteria 959
888 Ga0207645_10388926 3300025907 Bacteria 937
889 Ga0207643_10000779 3300025908 Bacteria 19421
890 Ga0207643_10011421 3300025908 Bacteria 4796
891 Ga0207643_10011763 3300025908 Bacteria 4724
892 Ga0207643_10033333 3300025908 Bacteria 2881
893 Ga0207643_10064040 3300025908 Bacteria 2104
894 Ga0207643_10075830 3300025908 Bacteria 1941
895 Ga0207643_10081711 3300025908 Bacteria 1873
896 Ga0207643_10084207 3300025908 Bacteria 1846
897 Ga0207643_10145911 3300025908 Bacteria 1416
898 Ga0207643_10277550 3300025908 Bacteria 1039
899 Ga0207643_10418521 3300025908 Bacteria 849
900 Ga0207643_10445340 3300025908 Bacteria 823
901 Ga0207705_10076279 3300025909 Bacteria 2437
902 Ga0207705_10254361 3300025909 Bacteria 1340
903 Ga0207684_10186261 3300025910 Bacteria 1790
904 Ga0207684_10329170 3300025910 Bacteria 1316
905 Ga0207684_10329901 3300025910 Bacteria 1315
906 Ga0207684_10379273 3300025910 Bacteria 1216
907 Ga0207684_10615358 3300025910 Bacteria 927
908 Ga0207684_10830722 3300025910 Bacteria 780
909 Ga0207654_10023501 3300025911 Bacteria 3303
910 Ga0207707_10006304 3300025912 Bacteria 10359
911 Ga0207707_10142691 3300025912 Bacteria 2094
912 Ga0207707_10235260 3300025912 Bacteria 1594
913 Ga0207707_10654814 3300025912 Bacteria 885
914 Ga0207695_10121319 3300025913 Bacteria 2581
915 Ga0207695_10203109 3300025913 Bacteria 1895
916 Ga0207695_10212826 3300025913 Bacteria 1843
917 Ga0207695_10349555 3300025913 Bacteria 1366
918 Ga0207671_10199022 3300025914 Bacteria 1564
919 Ga0207671_10200800 3300025914 Bacteria 1557
920 Ga0207693_10134355 3300025915 Bacteria 1945
921 Ga0207660_10033197 3300025917 Bacteria 3568
922 Ga0207660_10173624 3300025917 Bacteria 1670
923 Ga0207660_10215605 3300025917 Bacteria 1505
924 Ga0207660_10231860 3300025917 Bacteria 1452
925 Ga0207660_10749302 3300025917 Bacteria 797
926 Ga0207662_10000335 3300025918 Bacteria 21250
927 Ga0207662_10015295 3300025918 Bacteria 4317
928 Ga0207662_10025424 3300025918 Bacteria 3410
929 Ga0207662_10041797 3300025918 Bacteria 2700
930 Ga0207662_10072273 3300025918 Bacteria 2090
931 Ga0207662_10074449 3300025918 Bacteria 2061
932 Ga0207662_10097568 3300025918 Bacteria 1817
933 Ga0207662_10520980 3300025918 Bacteria 821
934 Ga0207657_10102302 3300025919 Bacteria 2376
935 Ga0207657_10235318 3300025919 Bacteria 1464
936 Ga0207657_10275916 3300025919 Bacteria 1335
937 Ga0207657_10280494 3300025919 Bacteria 1323
938 Ga0207657_10306610 3300025919 Bacteria 1257
939 Ga0207649_10016411 3300025920 Bacteria 4176
940 Ga0207649_10319014 3300025920 Bacteria 1141
941 Ga0207649_10391433 3300025920 Bacteria 1038
942 Ga0207649_10428778 3300025920 Bacteria 994
943 Ga0207652_10016976 3300025921 Bacteria 5954
944 Ga0207652_10017745 3300025921 Bacteria 5829
945 Ga0207646_10062037 3300025922 Bacteria 3337
946 Ga0207646_10110294 3300025922 Bacteria 2469
947 Ga0207646_10124334 3300025922 Bacteria 2319
948 Ga0207646_10144507 3300025922 Bacteria 2143
949 Ga0207646_10165914 3300025922 Bacteria 1994
950 Ga0207646_10483865 3300025922 Bacteria 1116
951 Ga0207646_10499389 3300025922 Bacteria 1096
952 Ga0207646_10725201 3300025922 Bacteria 888
953 Ga0207681_10002945 3300025923 Bacteria 10741
954 Ga0207681_10009404 3300025923 Bacteria 5972
955 Ga0207681_10013156 3300025923 Bacteria 5115
956 Ga0207681_10030392 3300025923 Bacteria 3521
957 Ga0207681_10040285 3300025923 Bacteria 3108
958 Ga0207681_10131761 3300025923 Bacteria 1849
959 Ga0207681_10207032 3300025923 Bacteria 1509
960 Ga0207681_10256561 3300025923 Bacteria 1367
961 Ga0207681_10304059 3300025923 Bacteria 1263
962 Ga0207681_10366736 3300025923 Bacteria 1156
963 Ga0207681_10630904 3300025923 Bacteria 887
964 Ga0207694_10019318 3300025924 Bacteria 5152
965 Ga0207694_10317166 3300025924 Bacteria 1286
966 Ga0207650_10029449 3300025925 Bacteria 3947
967 Ga0207650_10045711 3300025925 Bacteria 3222
968 Ga0207650_10074604 3300025925 Bacteria 2558
969 Ga0207650_10219327 3300025925 Bacteria 1530
970 Ga0207650_10245273 3300025925 Bacteria 1449
971 Ga0207650_10285687 3300025925 Bacteria 1344
972 Ga0207650_10305737 3300025925 Bacteria 1300
973 Ga0207650_10386615 3300025925 Bacteria 1156
974 Ga0207650_10465535 3300025925 Bacteria 1053
975 Ga0207650_10580100 3300025925 Bacteria 942
976 Ga0207659_10000672 3300025926 Bacteria 20255
977 Ga0207659_10001213 3300025926 Bacteria 15413
978 Ga0207659_10005611 3300025926 Bacteria 7622
979 Ga0207659_10007012 3300025926 Bacteria 6919
980 Ga0207659_10018460 3300025926 Bacteria 4574
981 Ga0207659_10024292 3300025926 Bacteria 4058
982 Ga0207659_10027044 3300025926 Bacteria 3879
983 Ga0207659_10069489 3300025926 Bacteria 2565
984 Ga0207659_10129063 3300025926 Bacteria 1948
985 Ga0207659_10145216 3300025926 Bacteria 1847
986 Ga0207659_10149928 3300025926 Bacteria 1820
987 Ga0207659_10169350 3300025926 Bacteria 1722
988 Ga0207659_10239628 3300025926 Bacteria 1467
989 Ga0207659_10370644 3300025926 Bacteria 1192
990 Ga0207659_10443731 3300025926 Bacteria 1092
991 Ga0207659_10498043 3300025926 Bacteria 1031
992 Ga0207659_10515786 3300025926 Bacteria 1013
993 Ga0207659_10633011 3300025926 Bacteria 913
994 Ga0207687_10033478 3300025927 Bacteria 3486
995 Ga0207687_10054268 3300025927 Bacteria 2803
996 Ga0207687_10148079 3300025927 Bacteria 1788
997 Ga0207687_10725615 3300025927 Bacteria 845
998 Ga0207687_10859710 3300025927 Bacteria 775
999 Ga0207700_10141551 3300025928 Bacteria 1977
1000 Ga0207644_10006450 3300025931 Bacteria 7646
1001 Ga0207644_10010037 3300025931 Bacteria 6233
1002 Ga0207644_10146245 3300025931 Bacteria 1825
1003 Ga0207644_10226427 3300025931 Bacteria 1484
1004 Ga0207644_10333789 3300025931 Bacteria 1228
1005 Ga0207644_10458478 3300025931 Bacteria 1048
1006 Ga0207644_10501258 3300025931 Bacteria 1001
1007 Ga0207690_10058058 3300025932 Bacteria 2616
1008 Ga0207690_10139335 3300025932 Bacteria 1786
1009 Ga0207690_10166938 3300025932 Bacteria 1646
1010 Ga0207690_10172458 3300025932 Bacteria 1622
1011 Ga0207690_10452293 3300025932 Bacteria 1032
1012 Ga0207690_10591292 3300025932 Bacteria 905
1013 Ga0207706_10003002 3300025933 Bacteria 16261
1014 Ga0207706_10020673 3300025933 Bacteria 5915
1015 Ga0207706_10039465 3300025933 Bacteria 4186
1016 Ga0207706_10068615 3300025933 Bacteria 3119
1017 Ga0207706_10130391 3300025933 Bacteria 2211
1018 Ga0207706_10178124 3300025933 Bacteria 1867
1019 Ga0207706_10229657 3300025933 Bacteria 1624
1020 Ga0207706_10238526 3300025933 Bacteria 1590
1021 Ga0207706_10428845 3300025933 Bacteria 1145
1022 Ga0207686_10004734 3300025934 Bacteria 7303
1023 Ga0207686_10075411 3300025934 Bacteria 2183
1024 Ga0207686_10192333 3300025934 Bacteria 1455
1025 Ga0207686_10824397 3300025934 Bacteria 745
1026 Ga0207686_10903687 3300025934 Bacteria 713
1027 Ga0207709_10011617 3300025935 Bacteria 4855
1028 Ga0207709_10041239 3300025935 Bacteria 2768
1029 Ga0207709_10081450 3300025935 Bacteria 2087
1030 Ga0207709_10721026 3300025935 Bacteria 799
1031 Ga0207670_10007706 3300025936 Bacteria 6033
1032 Ga0207670_10025883 3300025936 Bacteria 3690
1033 Ga0207670_10027007 3300025936 Bacteria 3624
1034 Ga0207670_10034333 3300025936 Bacteria 3277
1035 Ga0207670_10040477 3300025936 Bacteria 3059
1036 Ga0207670_10156809 3300025936 Bacteria 1695
1037 Ga0207670_10193955 3300025936 Bacteria 1539
1038 Ga0207670_10418309 3300025936 Bacteria 1075
1039 Ga0207670_10573462 3300025936 Bacteria 924
1040 Ga0207669_10001534 3300025937 Bacteria 9841
1041 Ga0207669_10005330 3300025937 Bacteria 5759
1042 Ga0207669_10006465 3300025937 Bacteria 5358
1043 Ga0207669_10026903 3300025937 Bacteria 3138
1044 Ga0207669_10057360 3300025937 Bacteria 2370
1045 Ga0207669_10060566 3300025937 Bacteria 2321
1046 Ga0207669_10073605 3300025937 Bacteria 2156
1047 Ga0207669_10085914 3300025937 Bacteria 2032
1048 Ga0207669_10087455 3300025937 Bacteria 2018
1049 Ga0207669_10185475 3300025937 Bacteria 1496
1050 Ga0207669_10210239 3300025937 Bacteria 1419
1051 Ga0207669_10240587 3300025937 Bacteria 1341
1052 Ga0207669_10399510 3300025937 Bacteria 1076
1053 Ga0207669_10609225 3300025937 Bacteria 888
1054 Ga0207704_10005824 3300025938 Bacteria 5702
1055 Ga0207704_10064595 3300025938 Bacteria 2287
1056 Ga0207704_10138888 3300025938 Bacteria 1696
1057 Ga0207704_10166456 3300025938 Bacteria 1575
1058 Ga0207704_10366218 3300025938 Bacteria 1127
1059 Ga0207704_10369154 3300025938 Bacteria 1123
1060 Ga0207704_10516050 3300025938 Bacteria 966
1061 Ga0207704_10717329 3300025938 Bacteria 829
1062 Ga0207704_10720062 3300025938 Bacteria 828
1063 Ga0207704_10805928 3300025938 Bacteria 784
1064 Ga0207704_10958899 3300025938 Bacteria 722
1065 Ga0207665_10288909 3300025939 Bacteria 1222
1066 Ga0207691_10002430 3300025940 Bacteria 18233
1067 Ga0207691_10024983 3300025940 Bacteria 5613
1068 Ga0207691_10049701 3300025940 Bacteria 3842
1069 Ga0207691_10072086 3300025940 Bacteria 3116
1070 Ga0207691_10083203 3300025940 Bacteria 2873
1071 Ga0207691_10086714 3300025940 Bacteria 2809
1072 Ga0207691_10087733 3300025940 Bacteria 2791
1073 Ga0207691_10124579 3300025940 Bacteria 2281
1074 Ga0207691_10125854 3300025940 Bacteria 2268
1075 Ga0207691_10138228 3300025940 Bacteria 2148
1076 Ga0207691_10144932 3300025940 Bacteria 2091
1077 Ga0207691_10238996 3300025940 Bacteria 1571
1078 Ga0207691_10268647 3300025940 Bacteria 1469
1079 Ga0207691_10556661 3300025940 Bacteria 972
1080 Ga0207691_10693218 3300025940 Bacteria 859
1081 Ga0207691_10713906 3300025940 Bacteria 845
1082 Ga0207691_10718283 3300025940 Bacteria 842
1083 Ga0207711_10007764 3300025941 Bacteria 8964
1084 Ga0207711_10039221 3300025941 Bacteria 4028
1085 Ga0207711_10052014 3300025941 Bacteria 3509
1086 Ga0207711_10057128 3300025941 Bacteria 3355
1087 Ga0207711_10060104 3300025941 Bacteria 3274
1088 Ga0207711_10107842 3300025941 Bacteria 2473
1089 Ga0207711_10133902 3300025941 Bacteria 2224
1090 Ga0207711_10178848 3300025941 Bacteria 1928
1091 Ga0207711_10180721 3300025941 Bacteria 1918
1092 Ga0207711_10229285 3300025941 Bacteria 1701
1093 Ga0207711_10270693 3300025941 Bacteria 1563
1094 Ga0207711_10751026 3300025941 Bacteria 909
1095 Ga0207711_10776574 3300025941 Bacteria 893
1096 Ga0207711_10998537 3300025941 Bacteria 776
1097 Ga0207689_10001000 3300025942 Bacteria 27148
1098 Ga0207689_10003297 3300025942 Bacteria 14779
1099 Ga0207689_10007360 3300025942 Bacteria 9653
1100 Ga0207689_10107704 3300025942 Bacteria 2290
1101 Ga0207689_10112798 3300025942 Bacteria 2234
1102 Ga0207689_10241757 3300025942 Bacteria 1492
1103 Ga0207689_10282291 3300025942 Bacteria 1375
1104 Ga0207689_10312222 3300025942 Bacteria 1304
1105 Ga0207689_10371375 3300025942 Bacteria 1190
1106 Ga0207689_10967386 3300025942 Bacteria 718
1107 Ga0207661_10044598 3300025944 Bacteria 3505
1108 Ga0207661_10221814 3300025944 Bacteria 1671
1109 Ga0207661_10589335 3300025944 Bacteria 1020
1110 Ga0207661_10708758 3300025944 Bacteria 926
1111 Ga0207679_10002463 3300025945 Bacteria 11399
1112 Ga0207679_10022489 3300025945 Bacteria 4295
1113 Ga0207679_10038904 3300025945 Bacteria 3394
1114 Ga0207679_10049285 3300025945 Bacteria 3072
1115 Ga0207679_10050973 3300025945 Bacteria 3028
1116 Ga0207679_10081178 3300025945 Bacteria 2479
1117 Ga0207679_10227628 3300025945 Bacteria 1572
1118 Ga0207667_10023790 3300025949 Bacteria 6741
1119 Ga0207667_10528120 3300025949 Bacteria 1195
1120 Ga0207667_10589147 3300025949 Bacteria 1122
1121 Ga0207667_11250966 3300025949 Bacteria 720
1122 Ga0207667_11282554 3300025949 Bacteria 709
1123 Ga0207651_10001161 3300025960 Bacteria 11777
1124 Ga0207651_10010560 3300025960 Bacteria 5123
1125 Ga0207651_10014879 3300025960 Bacteria 4505
1126 Ga0207651_10049553 3300025960 Bacteria 2846
1127 Ga0207651_10051978 3300025960 Bacteria 2791
1128 Ga0207651_10056124 3300025960 Bacteria 2709
1129 Ga0207651_10061960 3300025960 Bacteria 2604
1130 Ga0207651_10118554 3300025960 Bacteria 2002
1131 Ga0207651_10200522 3300025960 Bacteria 1599
1132 Ga0207651_10208035 3300025960 Bacteria 1573
1133 Ga0207651_10219115 3300025960 Bacteria 1537
1134 Ga0207651_10243820 3300025960 Bacteria 1466
1135 Ga0207651_10306787 3300025960 Bacteria 1322
1136 Ga0207651_10358372 3300025960 Bacteria 1230
1137 Ga0207651_10385662 3300025960 Bacteria 1188
1138 Ga0207651_10552714 3300025960 Bacteria 1001
1139 Ga0207712_10003381 3300025961 Bacteria 10086
1140 Ga0207712_10041160 3300025961 Bacteria 3174
1141 Ga0207712_10064313 3300025961 Bacteria 2615
1142 Ga0207668_10011279 3300025972 Bacteria 5424
1143 Ga0207668_10017365 3300025972 Bacteria 4508
1144 Ga0207668_10070697 3300025972 Bacteria 2490
1145 Ga0207668_10491701 3300025972 Bacteria 1054
1146 Ga0207668_10512985 3300025972 Bacteria 1033
1147 Ga0207668_10648811 3300025972 Bacteria 924
1148 Ga0207640_10067919 3300025981 Bacteria 2387
1149 Ga0207640_10591851 3300025981 Bacteria 938
1150 Ga0207640_10888155 3300025981 Bacteria 778
1151 Ga0207640_10904954 3300025981 Bacteria 771
1152 Ga0207658_10021688 3300025986 Bacteria 4463
1153 Ga0207658_10474099 3300025986 Bacteria 1111
1154 Ga0207658_10479323 3300025986 Bacteria 1105
1155 Ga0207658_10547644 3300025986 Bacteria 1035
1156 Ga0207658_10589751 3300025986 Bacteria 998
1157 Ga0207658_10591962 3300025986 Bacteria 996
1158 Ga0207658_10609549 3300025986 Bacteria 981
1159 Ga0207658_10723460 3300025986 Bacteria 900
1160 Ga0207677_10009480 3300026023 Bacteria 5479
1161 Ga0207677_10162940 3300026023 Bacteria 1735
1162 Ga0207677_10190377 3300026023 Bacteria 1622
1163 Ga0207677_10219585 3300026023 Bacteria 1524
1164 Ga0207677_10259950 3300026023 Bacteria 1415
1165 Ga0207677_10304354 3300026023 Bacteria 1318
1166 Ga0207677_10316333 3300026023 Bacteria 1295
1167 Ga0207703_10004804 3300026035 Bacteria 11002
1168 Ga0207703_10012018 3300026035 Bacteria 6743
1169 Ga0207703_10019080 3300026035 Bacteria 5357
1170 Ga0207703_10034788 3300026035 Bacteria 4000
1171 Ga0207703_10102085 3300026035 Bacteria 2433
1172 Ga0207703_10146564 3300026035 Bacteria 2054
1173 Ga0207703_10155443 3300026035 Bacteria 1998
1174 Ga0207703_10168528 3300026035 Bacteria 1924
1175 Ga0207703_10273055 3300026035 Bacteria 1532
1176 Ga0207703_10273631 3300026035 Bacteria 1531
1177 Ga0207703_10487739 3300026035 Bacteria 1155
1178 Ga0207639_10221698 3300026041 Bacteria 1634
1179 Ga0207639_11062593 3300026041 Bacteria 759
1180 Ga0207678_10066182 3300026067 Bacteria 3103
1181 Ga0207678_10102815 3300026067 Bacteria 2439
1182 Ga0207678_10117567 3300026067 Bacteria 2268
1183 Ga0207678_10117685 3300026067 Bacteria 2267
1184 Ga0207678_10178014 3300026067 Bacteria 1816
1185 Ga0207678_10272613 3300026067 Bacteria 1451
1186 Ga0207678_10336774 3300026067 Bacteria 1300
1187 Ga0207678_10582420 3300026067 Bacteria 980
1188 Ga0207708_10000882 3300026075 Bacteria 22535
1189 Ga0207708_10017896 3300026075 Bacteria 5333
1190 Ga0207708_10028812 3300026075 Bacteria 4204
1191 Ga0207708_10054200 3300026075 Bacteria 3057
1192 Ga0207708_10100853 3300026075 Bacteria 2234
1193 Ga0207708_10118060 3300026075 Bacteria 2065
1194 Ga0207708_10235248 3300026075 Bacteria 1472
1195 Ga0207708_10310096 3300026075 Bacteria 1285
1196 Ga0207708_10363396 3300026075 Bacteria 1190
1197 Ga0207708_10490040 3300026075 Bacteria 1029
1198 Ga0207708_10655105 3300026075 Bacteria 894
1199 Ga0207708_10660005 3300026075 Bacteria 891
1200 Ga0207708_10871570 3300026075 Bacteria 778
1201 Ga0207641_10001674 3300026088 Bacteria 21561
1202 Ga0207641_10070196 3300026088 Bacteria 3010
1203 Ga0207641_10109185 3300026088 Bacteria 2450
1204 Ga0207641_10156857 3300026088 Bacteria 2066
1205 Ga0207641_10178734 3300026088 Bacteria 1942
1206 Ga0207641_10295610 3300026088 Bacteria 1528
1207 Ga0207641_11049231 3300026088 Bacteria 813
1208 Ga0207648_10001325 3300026089 Bacteria 27526
1209 Ga0207648_10003371 3300026089 Bacteria 16779
1210 Ga0207648_10009527 3300026089 Bacteria 9295
1211 Ga0207648_10040376 3300026089 Bacteria 4101
1212 Ga0207648_10134536 3300026089 Bacteria 2177
1213 Ga0207648_10166669 3300026089 Bacteria 1947
1214 Ga0207648_10196263 3300026089 Bacteria 1790
1215 Ga0207648_10325878 3300026089 Bacteria 1381
1216 Ga0207648_10351156 3300026089 Bacteria 1329
1217 Ga0207648_10431657 3300026089 Bacteria 1197
1218 Ga0207648_10450294 3300026089 Bacteria 1172
1219 Ga0207676_10047359 3300026095 Bacteria 3331
1220 Ga0207676_10164389 3300026095 Bacteria 1926
1221 Ga0207676_10174037 3300026095 Bacteria 1878
1222 Ga0207676_10233180 3300026095 Bacteria 1647
1223 Ga0207676_10367426 3300026095 Bacteria 1335
1224 Ga0207676_10500977 3300026095 Bacteria 1153
1225 Ga0207676_10516642 3300026095 Bacteria 1136
1226 Ga0207676_10894980 3300026095 Bacteria 870
1227 Ga0207676_11155570 3300026095 Bacteria 766
1228 Ga0207676_11413216 3300026095 Bacteria 692
1229 Ga0207674_10009273 3300026116 Bacteria 11278
1230 Ga0207674_10124568 3300026116 Bacteria 2543
1231 Ga0207674_10156039 3300026116 Bacteria 2238
1232 Ga0207674_10168702 3300026116 Bacteria 2142
1233 Ga0207674_10199464 3300026116 Bacteria 1950
1234 Ga0207674_10326538 3300026116 Bacteria 1484
1235 Ga0207674_10434471 3300026116 Bacteria 1269
1236 Ga0207674_10798839 3300026116 Bacteria 911
1237 Ga0207675_100004079 3300026118 Bacteria 14140
1238 Ga0207675_100010469 3300026118 Bacteria 8686
1239 Ga0207675_100017733 3300026118 Bacteria 6641
1240 Ga0207675_100071117 3300026118 Bacteria 3252
1241 Ga0207675_100114552 3300026118 Bacteria 2547
1242 Ga0207675_100128637 3300026118 Bacteria 2401
1243 Ga0207675_100149477 3300026118 Bacteria 2222
1244 Ga0207675_100230290 3300026118 Bacteria 1788
1245 Ga0207675_100233268 3300026118 Bacteria 1776
1246 Ga0207675_100411430 3300026118 Bacteria 1334
1247 Ga0207675_100515784 3300026118 Bacteria 1191
1248 Ga0207675_100731252 3300026118 Bacteria 1000
1249 Ga0207683_10018689 3300026121 Bacteria 5912
1250 Ga0207683_10032201 3300026121 Bacteria 4554
1251 Ga0207683_10078796 3300026121 Bacteria 2920
1252 Ga0207683_10081692 3300026121 Bacteria 2869
1253 Ga0207683_10123021 3300026121 Bacteria 2330
1254 Ga0207683_10137533 3300026121 Bacteria 2199
1255 Ga0207683_10164745 3300026121 Bacteria 2005
1256 Ga0207683_10293815 3300026121 Bacteria 1486
1257 Ga0207683_10307296 3300026121 Bacteria 1451
1258 Ga0207683_10352379 3300026121 Bacteria 1351
1259 Ga0207683_10427339 3300026121 Bacteria 1220
1260 Ga0207683_10716274 3300026121 Bacteria 928
1261 Ga0207698_10486586 3300026142 Bacteria 1198
1262 Ga0207698_10586081 3300026142 Bacteria 1098
1263 Ga0207698_11174219 3300026142 Bacteria 781
1264 Ga0209982_1040490 3300027552 Bacteria 743
1265 Ga0209971_1008969 3300027682 Bacteria 2373
1266 Ga0209966_1027107 3300027695 Bacteria 1144
1267 Ga0209813_10013250 3300027866 Bacteria 2198
1268 Ga0207428_10000034 3300027907 Bacteria 231306
1269 Ga0207428_10000570 3300027907 Bacteria 43701
1270 Ga0207428_10001541 3300027907 Bacteria 24114
1271 Ga0207428_10002655 3300027907 Bacteria 17812
1272 Ga0207428_10003291 3300027907 Bacteria 15710
1273 Ga0207428_10004189 3300027907 Bacteria 13815
1274 Ga0207428_10008876 3300027907 Bacteria 9056
1275 Ga0207428_10018773 3300027907 Bacteria 5900
1276 Ga0207428_10045568 3300027907 Bacteria 3531
1277 Ga0207428_10074323 3300027907 Bacteria 2665
1278 Ga0207428_10084189 3300027907 Bacteria 2479
1279 Ga0207428_10255017 3300027907 Bacteria 1307
1280 Ga0207428_10255471 3300027907 Bacteria 1306
1281 Ga0207428_10262358 3300027907 Bacteria 1286
1282 Ga0268266_10005896 3300028379 Bacteria 11335
1283 Ga0268266_10049271 3300028379 Bacteria 3612
1284 Ga0268266_10056360 3300028379 Bacteria 3381
1285 Ga0268266_10057052 3300028379 Bacteria 3359
1286 Ga0268266_10209252 3300028379 Bacteria 1788
1287 Ga0268266_10407025 3300028379 Bacteria 1287
1288 Ga0268266_10544641 3300028379 Bacteria 1111
1289 Ga0268265_10008958 3300028380 Bacteria 6767
1290 Ga0268265_10019387 3300028380 Bacteria 4727
1291 Ga0268265_10127577 3300028380 Bacteria 2108
1292 Ga0268265_10142016 3300028380 Bacteria 2011
1293 Ga0268265_10158411 3300028380 Bacteria 1919
1294 Ga0268265_10174244 3300028380 Bacteria 1842
1295 Ga0268265_10269578 3300028380 Bacteria 1518
1296 Ga0268265_10475751 3300028380 Bacteria 1172
1297 Ga0268265_10600706 3300028380 Bacteria 1051
1298 Ga0268265_10949106 3300028380 Bacteria 847
1299 Ga0268265_11425686 3300028380 Bacteria 695
1300 Ga0268264_10027385 3300028381 Bacteria 4656
1301 Ga0268264_10037154 3300028381 Bacteria 4014
1302 Ga0268264_10244304 3300028381 Bacteria 1664
1303 Ga0268264_10363921 3300028381 Bacteria 1380
1304 Ga0268264_10479987 3300028381 Bacteria 1209
1305 Ga0268264_10542477 3300028381 Bacteria 1140
1306 Ga0268264_10630438 3300028381 Bacteria 1059
1307 Ga0268264_10712318 3300028381 Bacteria 997
1308 Ga0268264_10874931 3300028381 Bacteria 901
1309 Ga0268264_11064612 3300028381 Bacteria 816
1310 Ga0268264_11101091 3300028381 Bacteria 803
1311 Ga0265318_10025073 3300028577 Bacteria 2359
1312 Ga0307517_10126685 3300028786 Bacteria 1860
1313 Ga0265332_10052450 3300031238 Bacteria 1751
1314 Ga0265331_10026121 3300031250 Bacteria 2941
1315 Ga0265331_10026600 3300031250 Bacteria 2906
1316 Ga0265327_10006182 3300031251 Bacteria 9662
1317 Ga0307513_10217556 3300031456 Bacteria 1735
1318 Ga0307408_100009579 3300031548 Bacteria 6389
1319 Ga0307408_100011882 3300031548 Bacteria 5761
1320 Ga0307408_100041525 3300031548 Bacteria 3261
1321 Ga0307408_100081857 3300031548 Bacteria 2415
1322 Ga0307408_100104605 3300031548 Bacteria 2163
1323 Ga0307408_100337512 3300031548 Bacteria 1274
1324 Ga0307408_100412523 3300031548 Bacteria 1162
1325 Ga0307408_100418337 3300031548 Bacteria 1155
1326 Ga0307408_100517797 3300031548 Bacteria 1047
1327 Ga0265342_10097922 3300031712 Bacteria 1675
1328 Ga0307405_10000803 3300031731 Bacteria 12343
1329 Ga0307405_10016142 3300031731 Bacteria 4064
1330 Ga0307405_10074792 3300031731 Bacteria 2192
1331 Ga0307405_10165514 3300031731 Bacteria 1571
1332 Ga0307405_10195835 3300031731 Bacteria 1463
1333 Ga0307405_10345730 3300031731 Bacteria 1145
1334 Ga0307405_10583624 3300031731 Bacteria 909
1335 Ga0307413_10028200 3300031824 Bacteria 3123
1336 Ga0307413_10036034 3300031824 Bacteria 2844
1337 Ga0307413_10047131 3300031824 Bacteria 2568
1338 Ga0307413_10049240 3300031824 Bacteria 2524
1339 Ga0307413_10140127 3300031824 Bacteria 1670
1340 Ga0307413_10150474 3300031824 Bacteria 1621
1341 Ga0307413_10178118 3300031824 Bacteria 1512
1342 Ga0307413_10285364 3300031824 Bacteria 1244
1343 Ga0307413_10423355 3300031824 Bacteria 1049
1344 Ga0307413_10589175 3300031824 Bacteria 908
1345 Ga0307410_10012187 3300031852 Bacteria 4958
1346 Ga0307410_10033332 3300031852 Bacteria 3324
1347 Ga0307410_10053098 3300031852 Bacteria 2741
1348 Ga0307410_10065395 3300031852 Bacteria 2501
1349 Ga0307410_10078598 3300031852 Bacteria 2309
1350 Ga0307410_10148003 3300031852 Bacteria 1745
1351 Ga0307410_10156869 3300031852 Bacteria 1701
1352 Ga0307410_10223935 3300031852 Bacteria 1448
1353 Ga0307410_10244485 3300031852 Bacteria 1392
1354 Ga0307410_10263209 3300031852 Bacteria 1346
1355 Ga0307410_10408702 3300031852 Bacteria 1098
1356 Ga0307410_10534438 3300031852 Bacteria 969
1357 Ga0307410_10599838 3300031852 Bacteria 918
1358 Ga0307406_10032196 3300031901 Bacteria 3200
1359 Ga0307406_10116656 3300031901 Bacteria 1848
1360 Ga0307406_10319564 3300031901 Bacteria 1200
1361 Ga0307406_10622802 3300031901 Bacteria 892
1362 Ga0307406_10848375 3300031901 Bacteria 774
1363 Ga0307406_10880529 3300031901 Bacteria 761
1364 Ga0307407_10003307 3300031903 Bacteria 6582
1365 Ga0307407_10009357 3300031903 Bacteria 4558
1366 Ga0307407_10019704 3300031903 Bacteria 3440
1367 Ga0307407_10175408 3300031903 Bacteria 1416
1368 Ga0307407_10187634 3300031903 Bacteria 1375
1369 Ga0307407_10249565 3300031903 Bacteria 1215
1370 Ga0307407_10269117 3300031903 Bacteria 1175
1371 Ga0307412_10123960 3300031911 Bacteria 1865
1372 Ga0307412_10154023 3300031911 Bacteria 1699
1373 Ga0307412_10212886 3300031911 Bacteria 1476
1374 Ga0307412_10367567 3300031911 Bacteria 1160
1375 Ga0307412_10383252 3300031911 Bacteria 1139
1376 Ga0307412_10645491 3300031911 Bacteria 902
1377 Ga0307412_10762721 3300031911 Bacteria 836
1378 Ga0307412_10774637 3300031911 Bacteria 830
1379 Ga0307412_10881191 3300031911 Bacteria 783
1380 Ga0307409_100004378 3300031995 Bacteria 7926
1381 Ga0307409_100011421 3300031995 Bacteria 5599
1382 Ga0307409_100013659 3300031995 Bacteria 5241
1383 Ga0307409_100066518 3300031995 Bacteria 2842
1384 Ga0307409_100099397 3300031995 Bacteria 2409
1385 Ga0307409_100127852 3300031995 Bacteria 2165
1386 Ga0307409_100275881 3300031995 Bacteria 1551
1387 Ga0307409_100283001 3300031995 Bacteria 1534
1388 Ga0307409_100318748 3300031995 Bacteria 1454
1389 Ga0307409_100344953 3300031995 Bacteria 1403
1390 Ga0307409_100457587 3300031995 Bacteria 1233
1391 Ga0307409_100529815 3300031995 Bacteria 1152
1392 Ga0307409_100603894 3300031995 Bacteria 1085
1393 Ga0307416_100000919 3300032002 Bacteria 15561
1394 Ga0307416_100004359 3300032002 Bacteria 8515
1395 Ga0307416_100012158 3300032002 Bacteria 5782
1396 Ga0307416_100015366 3300032002 Bacteria 5286
1397 Ga0307416_100037206 3300032002 Bacteria 3742
1398 Ga0307416_100041323 3300032002 Bacteria 3590
1399 Ga0307416_100068724 3300032002 Bacteria 2928
1400 Ga0307416_100113353 3300032002 Bacteria 2396
1401 Ga0307416_100146102 3300032002 Bacteria 2159
1402 Ga0307416_100207558 3300032002 Bacteria 1865
1403 Ga0307416_100248436 3300032002 Bacteria 1729
1404 Ga0307416_100586557 3300032002 Bacteria 1193
1405 Ga0307416_100642378 3300032002 Bacteria 1145
1406 Ga0307416_100724505 3300032002 Bacteria 1085
1407 Ga0307416_101077550 3300032002 Bacteria 908
1408 Ga0307416_101142029 3300032002 Bacteria 884
1409 Ga0307414_10010619 3300032004 Bacteria 5355
1410 Ga0307414_10030537 3300032004 Bacteria 3522
1411 Ga0307414_10554132 3300032004 Bacteria 1025
1412 Ga0307411_10007963 3300032005 Bacteria 5449
1413 Ga0307411_10009190 3300032005 Bacteria 5178
1414 Ga0307411_10010242 3300032005 Bacteria 4985
1415 Ga0307411_10019886 3300032005 Bacteria 3890
1416 Ga0307411_10039621 3300032005 Bacteria 2982
1417 Ga0307411_10046370 3300032005 Bacteria 2801
1418 Ga0307411_10048801 3300032005 Bacteria 2746
1419 Ga0307411_10129421 3300032005 Bacteria 1842
1420 Ga0307411_10207252 3300032005 Bacteria 1511
1421 Ga0307411_10210949 3300032005 Bacteria 1500
1422 Ga0307411_10350560 3300032005 Bacteria 1203
1423 Ga0307411_10412824 3300032005 Bacteria 1119
1424 Ga0307411_10418645 3300032005 Bacteria 1112
1425 Ga0307411_10586462 3300032005 Bacteria 956
1426 Ga0307415_100014613 3300032126 Bacteria 4622
1427 Ga0307415_100056944 3300032126 Bacteria 2683
1428 Ga0307415_100085523 3300032126 Bacteria 2266
1429 Ga0307415_100116488 3300032126 Bacteria 1994
1430 Ga0307415_100118165 3300032126 Bacteria 1982
1431 Ga0307415_100448420 3300032126 Bacteria 1115
1432 Ga0307415_100519272 3300032126 Bacteria 1045
1433 Ga0373930_0003254 3300034816 Bacteria 2568
1434 Ga0373948_0001418 3300034817 Bacteria 3316
1435 Ga0373950_0004214 3300034818 Bacteria 2095
1436 Ga0373958_0009506 3300034819 Bacteria 1601
1437 Ga0373959_0000924 3300034820 Bacteria 4951
1438 Ga0373938_0069534 3300034957 Bacteria 839
1439 Ga0373926_0085811 3300035083 Bacteria 1168
1440 Ga0373926_0137504 3300035083 Bacteria 927
1441 Ga0373929_0000116 3300035085 Bacteria 13311
1442 Ga0373934_0003296 3300035086 Bacteria 5908
1443 Ga0373949_0006829 3300035090 Bacteria 2506
1444 Ga0373949_0152853 3300035090 Bacteria 668
1445 Ga0373951_0003755 3300035091 Bacteria 3661
1446 Ga0373952_0000263 3300035092 Bacteria 8637
1447 Ga0373923_0179827 3300035111 Bacteria 972
1448 Ga0373932_0000807 3300035112 Bacteria 9293
1449 Ga0373932_0067015 3300035112 Bacteria 1105
1450 Ga0373936_0079889 3300035113 Bacteria 1360
1451 Ga0373936_0095108 3300035113 Bacteria 1252
1452 Ga0373939_0000844 3300035114 Bacteria 7602
1453 Ga0373939_0036838 3300035114 Bacteria 1450
1454 Ga0373939_0050501 3300035114 Bacteria 1290
1455 Ga0373941_0000303 3300035115 Bacteria 9538
1456 Ga0373941_0002721 3300035115 Bacteria 3922
1457 Ga0373941_0005243 3300035115 Bacteria 3040
1458 Ga0373945_0109036 3300035116 Bacteria 1091
1459 Ga0373953_0127181 3300035117 Bacteria 1085
1460 Ga0373953_0164136 3300035117 Bacteria 955
1461 Ga0373953_0346462 3300035117 Bacteria 651
1462 Ga0373954_0167169 3300035118 Bacteria 1077
1463 Ga0373954_0440833 3300035118 Bacteria 645
1464 Ga0373956_0017520 3300035119 Bacteria 3021
1465 Ga0373956_0055436 3300035119 Bacteria 1788
1466 Ga0373956_0107377 3300035119 Bacteria 1298
1467 Ga0373960_0000753 3300035121 Bacteria 6755
1468 Ga0373943_0193570 3300035170 Bacteria 1123
1469 Ga0373946_0013812 3300035171 Bacteria 3040
1470 Ga0373946_0025750 3300035171 Bacteria 2315
1471 Ga0373946_0222289 3300035171 Bacteria 912
1472 Ga0373946_0248486 3300035171 Bacteria 867
1473 Ga0373955_0019684 3300035172 Bacteria 3378
1474 Ga0373955_0139330 3300035172 Bacteria 1421
1475 Ga0373942_0002319 3300035207 Bacteria 4649
1476 Ga0373942_0095668 3300035207 Bacteria 901
1477 Ga0373961_0001371 3300035241 Bacteria 7313
1478 Ga0373962_0035217 3300035242 Bacteria 1389
1479 Ga0373924_0013554 3300035410 Bacteria 3064
1480 Ga0373924_0086302 3300035410 Bacteria 1339
1481 Ga0373931_0004378 3300035691 Bacteria 6449
1482 Ga0373931_0173049 3300035691 Bacteria 1273
1483 Ga0373935_0184007 3300035692 Bacteria 1436
1484 Ga0373935_0432212 3300035692 Bacteria 949
1485 Ga0373927_0069174 3300035695 Bacteria 2285
1486 Ga0373933_0014154 3300035724 Bacteria 4430
1487 Ga0373933_0171422 3300035724 Bacteria 1381
1488 Ga0373933_0241118 3300035724 Bacteria 1163
1489 Ga0373933_0650806 3300035724 Bacteria 693
1490 Ga0373947_0157807 3300035725 Bacteria 1465
1491 Ga0373947_0207265 3300035725 Bacteria 1285
1492 Ga0373947_0306417 3300035725 Bacteria 1060
1493 Ga0373947_0768573 3300035725 Bacteria 657
1494 Ga0373937_0000078 3300036401 Bacteria 88688
1495 Ga0373937_0008713 3300036401 Bacteria 8812
1496 Ga0373937_0016952 3300036401 Bacteria 6478
1497 Ga0373937_0029266 3300036401 Bacteria 4988
1498 Ga0373937_0054670 3300036401 Bacteria 3664
1499 Ga0373937_0337020 3300036401 Bacteria 1428
1500 Ga0373937_0346455 3300036401 Bacteria 1407
1501 Ga0373937_0561079 3300036401 Bacteria 1085
1502 Ga0373937_0714099 3300036401 Bacteria 949
1503 Ga0373937_1034304 3300036401 Bacteria 770
1504 Ga0373937_1284152 3300036401 Bacteria 680
1505 Ga0373925_0002179 3300037068 Bacteria 15930
1506 Ga0373925_0017315 3300037068 Bacteria 5222
1507 Ga0373925_0086238 3300037068 Bacteria 2395
1508 Ga0373925_0103284 3300037068 Bacteria 2194
1509 Ga0373925_0165183 3300037068 Bacteria 1745
1510 Ga0373925_0249721 3300037068 Bacteria 1422
1511 Ga0373925_0511954 3300037068 Bacteria 986
1512 Ga0373925_0550235 3300037068 Bacteria 949
1513 Ga0395899_0573389 3300037312 Bacteria 722
1514 Ga0395905_0326438 3300037471 Bacteria 1425
1515 Ga0395905_1030267 3300037471 Bacteria 726
1516 Ga0439436_0037568 3300041404 Bacteria 1395
1517 Ga0439453_0001598 3300041408 Bacteria 2949
1518 Ga0439453_0007387 3300041408 Bacteria 1742
1519 Ga0439453_0026582 3300041408 Bacteria 1073
1520 Ga0439453_0046170 3300041408 Bacteria 868
1521 Ga0439461_0100250 3300041410 Bacteria 704
1522 Ga0451791_1031143 3300041451 Bacteria 1200
1523 Ga0451798_0436680 3300041458 Bacteria 912
1524 Ga0451833_0586875 3300041491 Bacteria 740
1525 Ga0451853_3514345 3300041512 Bacteria 1828
1526 Ga0439431_0027903 3300041997 Bacteria 1389
1527 Ga0439433_0002957 3300041999 Bacteria 3640
1528 Ga0439433_0043082 3300041999 Bacteria 1053
1529 Ga0439441_032614 3300042001 Bacteria 1016
1530 Ga0439441_041357 3300042001 Bacteria 925
1531 Ga0439443_058394 3300042003 Bacteria 687
1532 Ga0439445_0009196 3300042004 Bacteria 2325
1533 Ga0439445_0075444 3300042004 Bacteria 937
1534 Ga0439445_0124930 3300042004 Bacteria 740
1535 Ga0439449_0035701 3300042007 Bacteria 1850
1536 Ga0439449_0076022 3300042007 Bacteria 1238
1537 Ga0439449_0143465 3300042007 Bacteria 889
1538 Ga0439450_007369 3300042008 Bacteria 2013
1539 Ga0439450_041055 3300042008 Bacteria 1074
1540 Ga0439457_085890 3300042014 Bacteria 725
1541 Ga0439462_0018380 3300042015 Bacteria 1816
1542 Ga0450914_001705 3300042118 Bacteria 1442
1543 Ga0450920_010633 3300042122 Bacteria 1709
1544 Ga0450920_080427 3300042122 Bacteria 667
1545 Ga0450923_045000 3300042125 Bacteria 936
1546 Ga0450888_031554 3300042126 Bacteria 710
1547 Ga0450896_010372 3300042133 Bacteria 1307
1548 Ga0450898_030392 3300042134 Bacteria 989
1549 Ga0439446_0125160 3300042156 Bacteria 830
1550 Ga0439446_0158883 3300042156 Bacteria 747
1551 Ga0450908_001966 3300042184 Bacteria 4028
1552 Ga0450908_028546 3300042184 Bacteria 971
1553 Ga0439435_0032270 3300042436 Bacteria 1428
1554 Ga0439435_0040302 3300042436 Bacteria 1304
1555 Ga0439435_0107745 3300042436 Bacteria 862
1556 Ga0439435_0133639 3300042436 Bacteria 786
1557 Ga0439444_0040963 3300042437 Bacteria 909
1558 Ga0439444_0063346 3300042437 Bacteria 777
1559 Ga0439464_0006039 3300042439 Bacteria 3147
1560 Ga0439464_0023863 3300042439 Bacteria 1690
1561 Ga0439464_0058200 3300042439 Bacteria 1128
1562 Ga0439460_0021774 3300042461 Bacteria 1755
1563 Ga0439460_0157091 3300042461 Bacteria 761
1564 Ga0450916_002008 3300042530 Bacteria 2101
1565 Ga0450916_003234 3300042530 Bacteria 1778
1566 Ga0450918_005771 3300042531 Bacteria 2213
1567 Ga0450918_037665 3300042531 Bacteria 863
1568 Ga0450893_0039401 3300042532 Bacteria 862
1569 Ga0451577_0047045 3300042876 Bacteria 3858
1570 Ga0451577_0148370 3300042876 Bacteria 2109
1571 Ga0451577_0210621 3300042876 Bacteria 1756
1572 Ga0439440_0056842 3300042993 Bacteria 990
1573 Ga0439440_0121700 3300042993 Bacteria 727
1574 Ga0453683_0213507 3300044673 Bacteria 1226
1575 Ga0453684_0073154 3300044712 Bacteria 4323
1576 Ga0453684_0115398 3300044712 Bacteria 3254
1577 Ga0453684_0142955 3300044712 Bacteria 2854
1578 Ga0451576_0021918 3300045051 Bacteria 6935
1579 Ga0451576_0030890 3300045051 Bacteria 5715
1580 Ga0451576_0055322 3300045051 Bacteria 4152
1581 Ga0451576_0129817 3300045051 Bacteria 2626
1582 Ga0451576_0180853 3300045051 Bacteria 2202
1583 Ga0451576_0325554 3300045051 Bacteria 1608
1584 Ga0451576_0872049 3300045051 Bacteria 945
1585 Ga0451576_1906813 3300045051 Bacteria 613
1586 Ga0466967_0013058 3300045976 Bacteria 6395
1587 Ga0466967_0306619 3300045976 Bacteria 1529
1588 Ga0466967_0435178 3300045976 Bacteria 1280
1589 Ga0495592_0139849 3300046454 Bacteria 1685
1590 Ga0495592_0170652 3300046454 Bacteria 1490
1591 Ga0495592_0232506 3300046454 Bacteria 1227
1592 Ga0495603_0077947 3300046455 Bacteria 1944
1593 Ga0495603_0106594 3300046455 Bacteria 1635
1594 Ga0495603_0145060 3300046455 Bacteria 1380
1595 Ga0495603_0341028 3300046455 Bacteria 860
1596 Ga0495603_0479512 3300046455 Bacteria 712
1597 Ga0495629_0099600 3300046459 Bacteria 2028
1598 Ga0495629_0334215 3300046459 Bacteria 1035
1599 Ga0495638_0003145 3300046460 Bacteria 13062
1600 Ga0495638_0041961 3300046460 Bacteria 2892
1601 Ga0495641_0133018 3300046461 Bacteria 1110
1602 Ga0495651_0064887 3300046462 Bacteria 2790
1603 Ga0495651_0099555 3300046462 Bacteria 2168
1604 Ga0495653_0029166 3300046463 Bacteria 4409
1605 Ga0495580_0112799 3300046472 Bacteria 1888
1606 Ga0495580_0424779 3300046472 Bacteria 894
1607 Ga0495582_0136999 3300046473 Bacteria 1386
1608 Ga0495582_0139379 3300046473 Bacteria 1374
1609 Ga0495582_0606140 3300046473 Bacteria 634
1610 Ga0495639_0000121 3300046475 Bacteria 39571
1611 Ga0495639_0036679 3300046475 Bacteria 2197
1612 Ga0495639_0104325 3300046475 Bacteria 1341
1613 Ga0495639_0189425 3300046475 Bacteria 1004
1614 Ga0495662_0071453 3300046476 Bacteria 1682
1615 Ga0495664_0125493 3300046477 Bacteria 1553
1616 Ga0495584_0006905 3300046491 Bacteria 5932
1617 Ga0495584_0259149 3300046491 Bacteria 884
1618 Ga0495585_0024131 3300046492 Bacteria 3489
1619 Ga0495594_0030252 3300046499 Bacteria 2928
1620 Ga0495594_0351336 3300046499 Bacteria 839
1621 Ga0495594_0386705 3300046499 Bacteria 796
1622 Ga0495596_0114616 3300046500 Bacteria 1047
1623 Ga0495608_0004188 3300046511 Bacteria 10337
1624 Ga0495618_0107781 3300046514 Bacteria 1784
1625 Ga0495628_0124179 3300046516 Bacteria 1978
1626 Ga0495628_0148401 3300046516 Bacteria 1787
1627 Ga0495628_0177214 3300046516 Bacteria 1614
1628 Ga0495630_0010900 3300046517 Bacteria 6565
1629 Ga0495630_0073990 3300046517 Bacteria 2566
1630 Ga0495630_0092350 3300046517 Bacteria 2288
1631 Ga0495630_0320412 3300046517 Bacteria 1185
1632 Ga0495630_0569630 3300046517 Bacteria 868
1633 Ga0495643_0013652 3300046522 Bacteria 4854
1634 Ga0495644_0041046 3300046523 Bacteria 1743
1635 Ga0495644_0102606 3300046523 Bacteria 1083
1636 Ga0495663_0004241 3300046525 Bacteria 4045
1637 Ga0495663_0149044 3300046525 Bacteria 797
1638 Ga0495666_0019669 3300046526 Bacteria 3348
1639 Ga0495666_0174052 3300046526 Bacteria 995
1640 Ga0495642_0003089 3300046528 Bacteria 6619
1641 Ga0495642_0283570 3300046528 Bacteria 725
1642 Ga0495642_0361699 3300046528 Bacteria 638
1643 Ga0495652_0154812 3300046529 Bacteria 1786
1644 Ga0495652_0540062 3300046529 Bacteria 803
1645 Ga0495640_0028932 3300046533 Bacteria 3984
1646 Ga0495640_0576634 3300046533 Bacteria 681
1647 Ga0495598_0001995 3300046537 Bacteria 4146
1648 Ga0495598_0068961 3300046537 Bacteria 1109
1649 Ga0495609_0141899 3300046538 Bacteria 1025
1650 Ga0495609_0166831 3300046538 Bacteria 931
1651 Ga0495621_0004726 3300046539 Bacteria 3861
1652 Ga0495621_0007098 3300046539 Bacteria 3303
1653 Ga0495621_0020070 3300046539 Bacteria 2189
1654 Ga0495621_0086475 3300046539 Bacteria 1176
1655 Ga0495621_0096056 3300046539 Bacteria 1123
1656 Ga0495621_0106031 3300046539 Bacteria 1074
1657 Ga0495621_0233646 3300046539 Bacteria 747
1658 Ga0495597_0034317 3300046542 Bacteria 2293
1659 Ga0495645_0004427 3300046543 Bacteria 9593
1660 Ga0495645_0027506 3300046543 Bacteria 4132
1661 Ga0495645_0239926 3300046543 Bacteria 1210
1662 Ga0495645_0357036 3300046543 Bacteria 940
1663 Ga0495633_0069430 3300046558 Bacteria 1645
1664 Ga0495667_0495049 3300046559 Bacteria 766
1665 Ga0495667_0556509 3300046559 Bacteria 716
1666 Ga0495656_0030789 3300046615 Bacteria 2171
1667 Ga0495656_0098233 3300046615 Bacteria 1350
1668 Ga0495656_0178054 3300046615 Bacteria 1044
1669 Ga0495656_0400312 3300046615 Bacteria 718
1670 Ga0495634_0071356 3300046642 Bacteria 2287
1671 Ga0495634_0263198 3300046642 Bacteria 1051
1672 Ga0495634_0279618 3300046642 Bacteria 1014
1673 Ga0495635_0074135 3300046663 Bacteria 2331
1674 Ga0495635_0107921 3300046663 Bacteria 1902
1675 Ga0495659_0007665 3300046664 Bacteria 3421
1676 Ga0495659_0013424 3300046664 Bacteria 2668
1677 Ga0495659_0082805 3300046664 Bacteria 1220
1678 Ga0495588_0023942 3300046674 Bacteria 3029
1679 Ga0495588_0287210 3300046674 Bacteria 867
1680 Ga0495599_0188203 3300046678 Bacteria 1271
1681 Ga0495599_0596938 3300046678 Bacteria 643
1682 Ga0495647_0012912 3300046681 Bacteria 2884
1683 Ga0495647_0016102 3300046681 Bacteria 2629
1684 Ga0495647_0075336 3300046681 Bacteria 1358
1685 Ga0495647_0146656 3300046681 Bacteria 1009
1686 Ga0495647_0260412 3300046681 Bacteria 774
1687 Ga0495647_0285254 3300046681 Bacteria 741
1688 Ga0495658_0004909 3300046683 Bacteria 6562
1689 Ga0495658_0022257 3300046683 Bacteria 3349
1690 Ga0495658_0040929 3300046683 Bacteria 2578
1691 Ga0495658_0117527 3300046683 Bacteria 1605
1692 Ga0495658_0239807 3300046683 Bacteria 1138
1693 Ga0495658_0326653 3300046683 Bacteria 973
1694 Ga0495658_0635898 3300046683 Bacteria 683
1695 Ga0495669_0000560 3300046684 Bacteria 16456
1696 Ga0495669_0009749 3300046684 Bacteria 4054
1697 Ga0495669_0022821 3300046684 Bacteria 2720
1698 Ga0495669_0187461 3300046684 Bacteria 987
1699 Ga0495613_0041711 3300046689 Bacteria 3398
1700 Ga0495613_0305757 3300046689 Bacteria 1100
1701 Ga0495613_0715320 3300046689 Bacteria 658
1702 Ga0495624_0400843 3300046690 Bacteria 824
1703 Ga0495670_0239994 3300046691 Bacteria 965
1704 Ga0495670_0265736 3300046691 Bacteria 916
1705 Ga0495670_0417416 3300046691 Bacteria 726
1706 Ga0495589_0131816 3300046794 Bacteria 1200
1707 Ga0495600_0126382 3300046809 Bacteria 1663
1708 Ga0495600_0163605 3300046809 Bacteria 1438
1709 Ga0495600_0285496 3300046809 Bacteria 1044
1710 Ga0495581_0087957 3300047315 Bacteria 1801
1711 Ga0495604_0078473 3300047317 Bacteria 2478
1712 Ga0495636_0001627 3300047318 Bacteria 8550
1713 Ga0495636_0112995 3300047318 Bacteria 1196
1714 Ga0495636_0341503 3300047318 Bacteria 706
1715 Ga0495674_0046172 3300047319 Bacteria 3867
1716 Ga0495674_0114459 3300047319 Bacteria 2284
1717 Ga0495674_0172413 3300047319 Bacteria 1805
1718 Ga0495672_0242644 3300047320 Bacteria 879
1719 Ga0495676_0018893 3300047321 Bacteria 6073
1720 Ga0495676_0020676 3300047321 Bacteria 5767
1721 Ga0495680_0625781 3300047322 Bacteria 718
1722 Ga0495675_0065454 3300047444 Bacteria 2299
1723 Ga0495677_0063241 3300047445 Bacteria 1374
1724 Ga0495685_044247 3300047447 Bacteria 1518
1725 Ga0495684_0009393 3300047471 Bacteria 7549
1726 Ga0495684_0123898 3300047471 Bacteria 1945
1727 Ga0495684_0201826 3300047471 Bacteria 1466
1728 Ga0495684_0443569 3300047471 Unclassified 903
1729 Ga0495602_0177945 3300048088 Bacteria 1644
1730 Ga0496100_0010085 3300048903 Bacteria 5336
1731 Ga0496100_0282305 3300048903 Bacteria 1238
1732 Ga0496100_0310639 3300048903 Bacteria 1182
1733 Ga0496101_0016859 3300048904 Bacteria 4945
1734 Ga0496101_0266502 3300048904 Bacteria 1337
1735 Ga0496101_0707671 3300048904 Bacteria 795
1736 Ga0496102_0002334 3300048905 Bacteria 16195
1737 Ga0496102_0135592 3300048905 Bacteria 2307
1738 Ga0496102_0277207 3300048905 Bacteria 1581
1739 Ga0496102_0326231 3300048905 Bacteria 1446
1740 Ga0496102_0713563 3300048905 Bacteria 926
1741 Ga0496102_0955202 3300048905 Bacteria 778
1742 Ga0496103_0063248 3300048906 Bacteria 2305
1743 Ga0496103_0224961 3300048906 Bacteria 1207
1744 Ga0496103_0244001 3300048906 Bacteria 1156
1745 Ga0496104_0007555 3300048907 Bacteria 9614
1746 Ga0496104_0040982 3300048907 Bacteria 4342
1747 Ga0496104_0067592 3300048907 Bacteria 3395
1748 Ga0496104_0227549 3300048907 Bacteria 1777
1749 Ga0496104_0384419 3300048907 Bacteria 1316
1750 Ga0496104_0556906 3300048907 Bacteria 1057
1751 Ga0496105_0068336 3300048908 Bacteria 2935
1752 Ga0496105_0329159 3300048908 Bacteria 1223
1753 Ga0496106_0041654 3300048909 Bacteria 3442
1754 Ga0496106_0071722 3300048909 Bacteria 2648
1755 Ga0496106_0129635 3300048909 Bacteria 1977
1756 Ga0496106_0143911 3300048909 Bacteria 1876
1757 Ga0496106_0349430 3300048909 Bacteria 1188
1758 Ga0496106_0367990 3300048909 Bacteria 1155
1759 Ga0496106_0489609 3300048909 Bacteria 988
1760 Ga0496106_1119193 3300048909 Bacteria 616
1761 Ga0496107_0005187 3300048910 Bacteria 8902
1762 Ga0496107_0072973 3300048910 Bacteria 2496
1763 Ga0496107_0191376 3300048910 Bacteria 1520
1764 Ga0496107_0271221 3300048910 Bacteria 1263
1765 Ga0496107_0277259 3300048910 Bacteria 1248
1766 Ga0496108_0003558 3300048911 Bacteria 12496
1767 Ga0496108_0049568 3300048911 Bacteria 3512
1768 Ga0496108_0136632 3300048911 Bacteria 2110
1769 Ga0496108_0262973 3300048911 Bacteria 1501
1770 Ga0496108_0527558 3300048911 Bacteria 1031
1771 Ga0496108_0631616 3300048911 Bacteria 932
1772 Ga0496108_0799370 3300048911 Bacteria 814
1773 Ga0496109_0053560 3300048912 Bacteria 3680
1774 Ga0496109_0062051 3300048912 Bacteria 3418
1775 Ga0496109_0163620 3300048912 Bacteria 2085
1776 Ga0496109_0191062 3300048912 Bacteria 1924
1777 Ga0496109_0394985 3300048912 Bacteria 1307
1778 Ga0496109_0866347 3300048912 Bacteria 841
1779 Ga0496110_0002017 3300048913 Bacteria 15118
1780 Ga0496110_0084753 3300048913 Bacteria 2829
1781 Ga0496110_0201186 3300048913 Bacteria 1810
1782 Ga0496110_0650649 3300048913 Bacteria 954
1783 Ga0496110_0694166 3300048913 Bacteria 919
1784 Ga0496111_0013343 3300048914 Bacteria 5588
1785 Ga0496111_0081391 3300048914 Bacteria 2364
1786 Ga0496111_0162226 3300048914 Bacteria 1660
1787 Ga0496112_0016237 3300048915 Bacteria 6967
1788 Ga0496112_0023335 3300048915 Bacteria 5910
1789 Ga0496112_0055411 3300048915 Bacteria 3898
1790 Ga0496112_0131149 3300048915 Bacteria 2477
1791 Ga0496112_0137714 3300048915 Bacteria 2411
1792 Ga0496112_0982684 3300048915 Bacteria 764
1793 Ga0496112_1203737 3300048915 Bacteria 674
1794 Ga0496113_0041393 3300048916 Bacteria 3400
1795 Ga0496113_0081736 3300048916 Bacteria 2477
1796 Ga0496113_0111798 3300048916 Bacteria 2127
1797 Ga0496113_0370077 3300048916 Bacteria 1150
1798 Ga0496113_0553778 3300048916 Bacteria 922
1799 Ga0496113_0633572 3300048916 Bacteria 855
1800 Ga0496114_0000246 3300048917 Bacteria 39480
1801 Ga0496114_0072538 3300048917 Bacteria 2896
1802 Ga0496114_0226834 3300048917 Bacteria 1641
1803 Ga0496114_0249159 3300048917 Bacteria 1563
1804 Ga0496114_0365164 3300048917 Bacteria 1277
1805 Ga0496115_0038979 3300048918 Bacteria 3773
1806 Ga0496115_0132970 3300048918 Bacteria 2051
1807 Ga0496126_0067738 3300048929 Bacteria 3189
1808 Ga0501298_027622 3300049521 Bacteria 1098
1809 Ga0501298_049930 3300049521 Bacteria 866
1810 Ga0501303_021570 3300049526 Bacteria 690
1811 Ga0501316_028003 3300049532 Bacteria 743
1812 Ga0501031_0000508 3300049568 Bacteria 22747
1813 Ga0501031_0065255 3300049568 Bacteria 2371
1814 Ga0501031_0120424 3300049568 Bacteria 1714
1815 Ga0501031_0188713 3300049568 Bacteria 1346
1816 Ga0501031_0494822 3300049568 Bacteria 789
1817 Ga0501032_0009569 3300049569 Bacteria 7026
1818 Ga0501032_0101474 3300049569 Bacteria 1906
1819 Ga0501032_0103097 3300049569 Bacteria 1890
1820 Ga0501032_0342906 3300049569 Bacteria 963
1821 Ga0501032_0562471 3300049569 Bacteria 727
1822 Ga0501033_0003919 3300049570 Bacteria 12077
1823 Ga0501033_0025404 3300049570 Bacteria 4462
1824 Ga0501033_0070516 3300049570 Bacteria 2567
1825 Ga0501033_0234681 3300049570 Bacteria 1302
1826 Ga0501033_0511871 3300049570 Bacteria 830
1827 Ga0501034_0002859 3300049571 Bacteria 20118
1828 Ga0501034_0018524 3300049571 Bacteria 7137
1829 Ga0501034_0038818 3300049571 Bacteria 4823
1830 Ga0501034_0053026 3300049571 Bacteria 4085
1831 Ga0501034_0053308 3300049571 Bacteria 4073
1832 Ga0501034_0367561 3300049571 Bacteria 1365
1833 Ga0501036_0030112 3300049572 Bacteria 4585
1834 Ga0501036_0046868 3300049572 Bacteria 3660
1835 Ga0501036_0072464 3300049572 Bacteria 2912
1836 Ga0501036_0073084 3300049572 Bacteria 2900
1837 Ga0501036_0076211 3300049572 Bacteria 2837
1838 Ga0501036_0085002 3300049572 Bacteria 2674
1839 Ga0501036_0120060 3300049572 Bacteria 2220
1840 Ga0501036_0324451 3300049572 Bacteria 1286
1841 Ga0501036_0627074 3300049572 Bacteria 891
1842 Ga0501036_0750833 3300049572 Bacteria 805
1843 Ga0501037_0001323 3300049573 Bacteria 18182
1844 Ga0501037_0011706 3300049573 Bacteria 6458
1845 Ga0501037_0274000 3300049573 Bacteria 1177
1846 Ga0501037_0324779 3300049573 Bacteria 1065
1847 Ga0501037_0477823 3300049573 Bacteria 847
1848 Ga0501037_0501720 3300049573 Bacteria 823
1849 Ga0501038_0000812 3300049574 Bacteria 27742
1850 Ga0501038_0137030 3300049574 Bacteria 2004
1851 Ga0501038_0336133 3300049574 Bacteria 1179
1852 Ga0501038_0414294 3300049574 Bacteria 1040
1853 Ga0501038_0427174 3300049574 Bacteria 1021
1854 Ga0501038_0580222 3300049574 Bacteria 850
1855 Ga0501039_0013227 3300049575 Bacteria 6309
1856 Ga0501039_0022803 3300049575 Bacteria 4802
1857 Ga0501039_0035714 3300049575 Bacteria 3837
1858 Ga0501039_0039875 3300049575 Bacteria 3626
1859 Ga0501039_0055633 3300049575 Bacteria 3065
1860 Ga0501039_0071954 3300049575 Bacteria 2687
1861 Ga0501039_0407899 3300049575 Bacteria 1067
1862 Ga0501040_0002090 3300049576 Bacteria 12865
1863 Ga0501040_0008435 3300049576 Bacteria 6696
1864 Ga0501040_0068417 3300049576 Bacteria 2449
1865 Ga0501040_0109710 3300049576 Bacteria 1929
1866 Ga0501040_0158550 3300049576 Bacteria 1599
1867 Ga0501040_0404094 3300049576 Bacteria 981
1868 Ga0501040_0470727 3300049576 Bacteria 905
1869 Ga0501040_0476258 3300049576 Bacteria 899
1870 Ga0501041_0002009 3300049577 Bacteria 11440
1871 Ga0501041_0042471 3300049577 Bacteria 2763
1872 Ga0501041_0207102 3300049577 Bacteria 1230
1873 Ga0501041_0221973 3300049577 Bacteria 1186
1874 Ga0501041_0248495 3300049577 Bacteria 1118
1875 Ga0501041_0275170 3300049577 Bacteria 1059
1876 Ga0501041_0280821 3300049577 Bacteria 1048
1877 Ga0501042_0010868 3300049578 Bacteria 6124
1878 Ga0501042_0045229 3300049578 Bacteria 3137
1879 Ga0501042_0050614 3300049578 Bacteria 2963
1880 Ga0501042_0077990 3300049578 Bacteria 2372
1881 Ga0501042_0106806 3300049578 Bacteria 2015
1882 Ga0501042_0216664 3300049578 Bacteria 1381
1883 Ga0501042_0239841 3300049578 Bacteria 1308
1884 Ga0501042_0284572 3300049578 Bacteria 1194
1885 Ga0501042_0323720 3300049578 Bacteria 1114
1886 Ga0501042_0338134 3300049578 Bacteria 1088
1887 Ga0501042_0487064 3300049578 Bacteria 895
1888 Ga0501042_0506376 3300049578 Bacteria 877
1889 Ga0501042_0578849 3300049578 Bacteria 816
1890 Ga0501042_0669316 3300049578 Bacteria 755
1891 Ga0501043_0074869 3300049579 Bacteria 2659
1892 Ga0501043_0081877 3300049579 Bacteria 2536
1893 Ga0501043_0099932 3300049579 Bacteria 2280
1894 Ga0501043_0124054 3300049579 Bacteria 2025
1895 Ga0501043_0291008 3300049579 Bacteria 1250
1896 Ga0501046_0004536 3300049580 Bacteria 12581
1897 Ga0501046_0004921 3300049580 Bacteria 12012
1898 Ga0501046_0030417 3300049580 Bacteria 4382
1899 Ga0501046_0187020 3300049580 Bacteria 1546
1900 Ga0501046_0206346 3300049580 Bacteria 1460
1901 Ga0501046_0481618 3300049580 Bacteria 890
1902 Ga0501047_0003821 3300049581 Bacteria 14159
1903 Ga0501047_0007192 3300049581 Bacteria 10461
1904 Ga0501047_0015370 3300049581 Bacteria 7290
1905 Ga0501047_0247041 3300049581 Bacteria 1633
1906 Ga0501047_0249052 3300049581 Bacteria 1625
1907 Ga0501047_0480057 3300049581 Bacteria 1071
1908 Ga0501048_0020396 3300049582 Bacteria 4857
1909 Ga0501048_0021416 3300049582 Bacteria 4733
1910 Ga0501048_0021930 3300049582 Bacteria 4675
1911 Ga0501048_0023899 3300049582 Bacteria 4464
1912 Ga0501048_0058737 3300049582 Bacteria 2726
1913 Ga0501048_0103712 3300049582 Bacteria 2007
1914 Ga0501048_0123111 3300049582 Bacteria 1833
1915 Ga0501048_0138219 3300049582 Bacteria 1722
1916 Ga0501048_0146677 3300049582 Bacteria 1669
1917 Ga0501048_0178399 3300049582 Bacteria 1505
1918 Ga0501067_0000428 3300049583 Bacteria 22958
1919 Ga0501067_0016437 3300049583 Bacteria 4088
1920 Ga0501067_0078506 3300049583 Bacteria 1829
1921 Ga0501067_0103043 3300049583 Bacteria 1586
1922 Ga0501068_0007038 3300049584 Bacteria 6224
1923 Ga0501068_0020047 3300049584 Bacteria 3891
1924 Ga0501068_0331119 3300049584 Bacteria 977
1925 Ga0501068_0396588 3300049584 Bacteria 889
1926 Ga0501069_0001595 3300049585 Bacteria 11218
1927 Ga0501069_0009651 3300049585 Bacteria 5099
1928 Ga0501070_0025720 3300049586 Bacteria 4937
1929 Ga0501070_0103893 3300049586 Bacteria 2349
1930 Ga0501070_0259186 3300049586 Bacteria 1421
1931 Ga0501070_0264405 3300049586 Bacteria 1406
1932 Ga0501070_0436795 3300049586 Bacteria 1056
1933 Ga0501070_0765929 3300049586 Bacteria 760
1934 Ga0501071_0001152 3300049587 Bacteria 14801
1935 Ga0501071_0005094 3300049587 Bacteria 8413
1936 Ga0501071_0019590 3300049587 Bacteria 4696
1937 Ga0501071_0123517 3300049587 Bacteria 1920
1938 Ga0501071_0161159 3300049587 Bacteria 1677
1939 Ga0501071_0206513 3300049587 Bacteria 1476
1940 Ga0501071_0400893 3300049587 Bacteria 1047
1941 Ga0501071_0757813 3300049587 Bacteria 748
1942 Ga0501071_0800826 3300049587 Bacteria 726
1943 Ga0501071_0842562 3300049587 Bacteria 707
1944 Ga0501072_0039247 3300049588 Bacteria 3718
1945 Ga0501072_0051204 3300049588 Bacteria 3252
1946 Ga0501072_0114652 3300049588 Bacteria 2145
1947 Ga0501072_0121910 3300049588 Bacteria 2077
1948 Ga0501072_0132880 3300049588 Bacteria 1984
1949 Ga0501072_0153971 3300049588 Bacteria 1833
1950 Ga0501072_0233982 3300049588 Bacteria 1463
1951 Ga0501072_0247996 3300049588 Bacteria 1418
1952 Ga0501072_0340921 3300049588 Bacteria 1190
1953 Ga0501072_0439180 3300049588 Bacteria 1034
1954 Ga0501072_0541885 3300049588 Bacteria 919
1955 Ga0501072_0669416 3300049588 Bacteria 816
1956 Ga0501073_0001115 3300049589 Bacteria 19500
1957 Ga0501073_0004894 3300049589 Bacteria 10051
1958 Ga0501073_0025121 3300049589 Bacteria 4275
1959 Ga0501073_0111776 3300049589 Bacteria 1895
1960 Ga0501073_0149634 3300049589 Bacteria 1618
1961 Ga0501073_0600310 3300049589 Bacteria 760
1962 Ga0501074_0004181 3300049590 Bacteria 10314
1963 Ga0501074_0005932 3300049590 Bacteria 8807
1964 Ga0501074_0036054 3300049590 Bacteria 3584
1965 Ga0501074_0050250 3300049590 Bacteria 3010
1966 Ga0501074_0115955 3300049590 Bacteria 1916
1967 Ga0501074_0302337 3300049590 Bacteria 1136
1968 Ga0501074_0378273 3300049590 Bacteria 1005
1969 Ga0501074_0653856 3300049590 Bacteria 742
1970 Ga0501074_0768360 3300049590 Bacteria 679
1971 Ga0501074_0816332 3300049590 Bacteria 657
1972 Ga0501075_0007595 3300049591 Bacteria 7523
1973 Ga0501075_0013283 3300049591 Bacteria 5875
1974 Ga0501075_0014775 3300049591 Bacteria 5597
1975 Ga0501075_0028162 3300049591 Bacteria 4145
1976 Ga0501075_0055518 3300049591 Bacteria 2980
1977 Ga0501075_0056221 3300049591 Bacteria 2962
1978 Ga0501075_0136629 3300049591 Bacteria 1868
1979 Ga0501075_0173642 3300049591 Bacteria 1645
1980 Ga0501075_0249931 3300049591 Bacteria 1351
1981 Ga0501075_0547536 3300049591 Bacteria 883
1982 Ga0501075_0585877 3300049591 Bacteria 851
1983 Ga0501075_0696061 3300049591 Bacteria 774
1984 Ga0501076_0001670 3300049592 Bacteria 15004
1985 Ga0501076_0023216 3300049592 Bacteria 4779
1986 Ga0501076_0041428 3300049592 Bacteria 3623
1987 Ga0501076_0050757 3300049592 Bacteria 3282
1988 Ga0501076_0070268 3300049592 Bacteria 2799
1989 Ga0501076_0093870 3300049592 Bacteria 2415
1990 Ga0501076_0120931 3300049592 Bacteria 2120
1991 Ga0501076_0122224 3300049592 Bacteria 2108
1992 Ga0501076_0141290 3300049592 Bacteria 1956
1993 Ga0501076_0220681 3300049592 Bacteria 1549
1994 Ga0501076_0269452 3300049592 Bacteria 1394
1995 Ga0501076_0342624 3300049592 Bacteria 1227
1996 Ga0501076_1018005 3300049592 Bacteria 682
1997 Ga0501077_0008455 3300049593 Bacteria 6378
1998 Ga0501077_0067750 3300049593 Bacteria 2263
1999 Ga0501233_079729 3300049668 Bacteria 841
2000 Ga0501233_080034 3300049668 Bacteria 840
2001 Ga0501249_073533 3300049679 Bacteria 800
2002 Ga0501251_011448 3300049681 Bacteria 1058
2003 Ga0501259_014216 3300049688 Bacteria 1347
2004 Ga0501225_0028598 3300049705 Bacteria 1532
2005 Ga0501079_0049651 3300049741 Bacteria 3238
2006 Ga0501079_0054958 3300049741 Bacteria 3071
2007 Ga0501079_0077009 3300049741 Bacteria 2580
2008 Ga0501079_0077588 3300049741 Bacteria 2569
2009 Ga0501079_0107466 3300049741 Bacteria 2166
2010 Ga0501079_0135073 3300049741 Bacteria 1920
2011 Ga0501079_0224802 3300049741 Bacteria 1466
2012 Ga0501079_0320531 3300049741 Bacteria 1213
2013 Ga0501079_0330568 3300049741 Bacteria 1194
2014 Ga0501079_0474561 3300049741 Bacteria 983
2015 Ga0501079_0489817 3300049741 Bacteria 966
2016 Ga0501079_0518319 3300049741 Bacteria 937
2017 Ga0501079_0609882 3300049741 Bacteria 859
2018 Ga0501080_0024542 3300049742 Bacteria 5589
2019 Ga0501080_0047860 3300049742 Bacteria 3980
2020 Ga0501080_0154939 3300049742 Bacteria 2117
2021 Ga0501080_0174707 3300049742 Bacteria 1980
2022 Ga0501080_0378548 3300049742 Bacteria 1275
2023 Ga0501080_0412359 3300049742 Bacteria 1214
2024 Ga0501080_0664219 3300049742 Bacteria 921
2025 Ga0501080_0873846 3300049742 Bacteria 785
2026 Ga0501080_0976635 3300049742 Bacteria 735
2027 Ga0501081_0009031 3300049743 Bacteria 6482
2028 Ga0501081_0010179 3300049743 Bacteria 6136
2029 Ga0501081_0023666 3300049743 Bacteria 4119
2030 Ga0501081_0051309 3300049743 Bacteria 2845
2031 Ga0501081_0102497 3300049743 Bacteria 2024
2032 Ga0501081_0127034 3300049743 Bacteria 1820
2033 Ga0501081_0208700 3300049743 Bacteria 1418
2034 Ga0501081_0212479 3300049743 Bacteria 1405
2035 Ga0501081_0221980 3300049743 Bacteria 1374
2036 Ga0501081_0336777 3300049743 Bacteria 1111
2037 Ga0501081_0435689 3300049743 Bacteria 973
2038 Ga0501081_0442211 3300049743 Bacteria 965
2039 Ga0501083_0010888 3300049744 Bacteria 6398
2040 Ga0501083_0025755 3300049744 Bacteria 4071
2041 Ga0501083_0161193 3300049744 Bacteria 1467
2042 Ga0501083_0247847 3300049744 Bacteria 1160
2043 Ga0501083_0517647 3300049744 Bacteria 777
2044 Ga0501083_0528797 3300049744 Bacteria 767
2045 Ga0501083_0553449 3300049744 Bacteria 749
2046 Ga0501272_017119 3300049769 Bacteria 852
2047 Ga0501035_0007631 3300049822 Bacteria 10106
2048 Ga0501035_0073803 3300049822 Bacteria 3018
2049 Ga0501035_0105121 3300049822 Bacteria 2475
2050 Ga0501035_0404548 3300049822 Bacteria 1135
2051 Ga0501035_0505998 3300049822 Bacteria 994
2052 Ga0501035_0795751 3300049822 Bacteria 756
2053 Ga0501044_0001681 3300049823 Bacteria 25990
2054 Ga0501044_0003143 3300049823 Bacteria 18681
2055 Ga0501044_0017553 3300049823 Bacteria 7677
2056 Ga0501044_0502695 3300049823 Bacteria 1113
2057 Ga0501045_0012918 3300049824 Bacteria 5887
2058 Ga0501045_0015202 3300049824 Bacteria 5463
2059 Ga0501045_0028864 3300049824 Bacteria 4004
2060 Ga0501045_0056682 3300049824 Bacteria 2866
2061 Ga0501045_0074418 3300049824 Bacteria 2501
2062 Ga0501045_0093381 3300049824 Bacteria 2225
2063 Ga0501045_0134641 3300049824 Bacteria 1837
2064 Ga0501045_0164501 3300049824 Bacteria 1652
2065 Ga0501045_0226446 3300049824 Bacteria 1392
2066 Ga0501045_0313728 3300049824 Bacteria 1167
2067 Ga0501045_0561952 3300049824 Bacteria 846
2068 Ga0501045_0797858 3300049824 Bacteria 695
2069 nmdc:mga03683_1492_c1 3300050489 Bacteria 6697
2070 nmdc:mga03n38_42208_c1 3300050490 Bacteria 1992
2071 nmdc:mga00v17_10629_c1 3300050491 Bacteria 5033
2072 nmdc:mga00v17_112784_c1 3300050491 Bacteria 1726
2073 nmdc:mga00v17_1497_c1 3300050491 Bacteria 12197
2074 nmdc:mga0yw44_111831_c1 3300050492 Bacteria 1751
2075 nmdc:mga0yw44_20934_c1 3300050492 Bacteria 3640
2076 nmdc:mga0yw44_4257_c1 3300050492 Bacteria 6524
2077 nmdc:mga0k408_103102_c1 3300050493 Bacteria 1683
2078 nmdc:mga0k408_18585_c1 3300050493 Bacteria 2271
2079 nmdc:mga0k408_269847_c1 3300050493 Bacteria 1016
2080 nmdc:mga0k408_361459_c1 3300050493 Bacteria 865
2081 nmdc:mga0k408_47331_c1 3300050493 Bacteria 2486
2082 nmdc:mga0k408_6891_c1 3300050493 Bacteria 6065
2083 nmdc:mga0k408_70698_c1 3300050493 Bacteria 2037
2084 nmdc:mga0k408_92813_c1 3300050493 Bacteria 1775
2085 nmdc:mga06z11_103521_c1 3300050494 Bacteria 1566
2086 nmdc:mga06z11_310769_c1 3300050494 Bacteria 939
2087 nmdc:mga06z11_33810_c1 3300050494 Bacteria 2504
2088 nmdc:mga06z11_91435_c1 3300050494 Bacteria 1653
2089 nmdc:mga04h51_10889_c1 3300050495 Bacteria 2511
2090 nmdc:mga04h51_34549_c1 3300050495 Bacteria 1615
2091 nmdc:mga07m45_106791_c1 3300050496 Bacteria 1611
2092 nmdc:mga07m45_26772_c1 3300050496 Bacteria 3171
2093 nmdc:mga07m45_27947_c1 3300050496 Bacteria 3112
2094 nmdc:mga07m45_463639_c1 3300050496 Bacteria 734
2095 nmdc:mga05p37_104828_c1 3300050507 Bacteria 3479
2096 nmdc:mga05p37_1258743_c1 3300050507 Bacteria 758
2097 nmdc:mga05p37_14374_c1 3300050507 Bacteria 8615
2098 nmdc:mga05p37_15912_c1 3300050507 Bacteria 6518
2099 nmdc:mga05p37_170628_c1 3300050507 Bacteria 2653
2100 nmdc:mga05p37_19432_c1 3300050507 Bacteria 8219
2101 nmdc:mga05p37_19769_c1 3300050507 Bacteria 8148
2102 nmdc:mga05p37_203778_c1 3300050507 Bacteria 2394
2103 nmdc:mga05p37_20610_c1 3300050507 Bacteria 7977
2104 nmdc:mga05p37_25099_c1 3300050507 Bacteria 7247
2105 nmdc:mga05p37_27370_c1 3300050507 Bacteria 6941
2106 nmdc:mga05p37_30012_c1 3300050507 Bacteria 6635
2107 nmdc:mga05p37_301979_c1 3300050507 Bacteria 1902
2108 nmdc:mga05p37_3048_c1 3300050507 Bacteria 19460
2109 nmdc:mga05p37_408256_c1 3300050507 Bacteria 1584
2110 nmdc:mga05p37_41696_c1 3300050507 Bacteria 5637
2111 nmdc:mga05p37_4432_c1 3300050507 Bacteria 16406
2112 nmdc:mga05p37_468649_c1 3300050507 Bacteria 1454
2113 nmdc:mga05p37_469357_c1 3300050507 Bacteria 1452
2114 nmdc:mga05p37_595_c1 3300050507 Bacteria 25325
2115 nmdc:mga05p37_6378_c1 3300050507 Bacteria 13895
2116 nmdc:mga05p37_6561_c1 3300050507 Bacteria 13712
2117 nmdc:mga05p37_65_c1 3300050507 Bacteria 48888
2118 nmdc:mga05p37_67547_c1 3300050507 Bacteria 4398
2119 nmdc:mga05p37_71930_c1 3300050507 Bacteria 4255
2120 nmdc:mga05p37_724726_c1 3300050507 Bacteria 1101
2121 nmdc:mga05p37_91904_c1 3300050507 Bacteria 3739
2122 nmdc:mga05p37_919291_c1 3300050507 Bacteria 941
2123 nmdc:mga05p37_98220_c1 3300050507 Bacteria 3607
2124 nmdc:mga09592_12720_c1 3300050508 Bacteria 6859
2125 nmdc:mga09592_128760_c1 3300050508 Bacteria 2177
2126 nmdc:mga09592_131902_c1 3300050508 Bacteria 2150
2127 nmdc:mga09592_178808_c1 3300050508 Bacteria 1835
2128 nmdc:mga09592_180122_c1 3300050508 Bacteria 1828
2129 nmdc:mga09592_20274_c1 3300050508 Bacteria 5465
2130 nmdc:mga09592_27799_c1 3300050508 Bacteria 4695
2131 nmdc:mga09592_281707_c1 3300050508 Bacteria 1442
2132 nmdc:mga09592_362675_c1 3300050508 Bacteria 1254
2133 nmdc:mga09592_370814_c1 3300050508 Bacteria 1238
2134 nmdc:mga09592_424740_c1 3300050508 Bacteria 1148
2135 nmdc:mga09592_494445_c1 3300050508 Bacteria 1053
2136 nmdc:mga09592_5356_c1 3300050508 Bacteria 10429
2137 nmdc:mga09592_575367_c1 3300050508 Bacteria 966
2138 nmdc:mga09592_594123_c1 3300050508 Bacteria 949
2139 nmdc:mga09592_665321_c1 3300050508 Bacteria 888
2140 nmdc:mga09592_696053_c1 3300050508 Bacteria 865
2141 nmdc:mga09592_7680_c1 3300050508 Bacteria 8767
2142 nmdc:mga09592_770657_c1 3300050508 Bacteria 815
2143 nmdc:mga09592_82332_c1 3300050508 Bacteria 2743
2144 nmdc:mga09592_86154_c1 3300050508 Bacteria 2680
2145 nmdc:mga09592_921074_c1 3300050508 Bacteria 734
2146 nmdc:mga0qj67_12298_c1 3300050509 Bacteria 6444
2147 nmdc:mga0qj67_133757_c1 3300050509 Bacteria 2009
2148 nmdc:mga0qj67_17275_c1 3300050509 Bacteria 5484
2149 nmdc:mga0qj67_179857_c1 3300050509 Bacteria 1718
2150 nmdc:mga0qj67_25915_c1 3300050509 Bacteria 4535
2151 nmdc:mga0qj67_355290_c1 3300050509 Bacteria 1184
2152 nmdc:mga0qj67_4157_c1 3300050509 Bacteria 10490
2153 nmdc:mga0qj67_45792_c1 3300050509 Bacteria 3451
2154 nmdc:mga0qj67_49756_c1 3300050509 Bacteria 3312
2155 nmdc:mga0qj67_510180_c1 3300050509 Bacteria 966
2156 nmdc:mga0qj67_68069_c1 3300050509 Bacteria 2838
2157 nmdc:mga0qj67_71989_c1 3300050509 Bacteria 2759
2158 nmdc:mga0qj67_757375_c1 3300050509 Bacteria 770
2159 nmdc:mga0qj67_8629_c1 3300050509 Bacteria 7562
2160 nmdc:mga06r32_103147_c1 3300050510 Bacteria 2801
2161 nmdc:mga06r32_1034221_c1 3300050510 Bacteria 773
2162 nmdc:mga06r32_111109_c1 3300050510 Bacteria 2697
2163 nmdc:mga06r32_117458_c1 3300050510 Bacteria 2622
2164 nmdc:mga06r32_119149_c1 3300050510 Bacteria 2603
2165 nmdc:mga06r32_147065_c1 3300050510 Bacteria 2334
2166 nmdc:mga06r32_149240_c1 3300050510 Bacteria 2316
2167 nmdc:mga06r32_149566_c1 3300050510 Bacteria 2313
2168 nmdc:mga06r32_151299_c1 3300050510 Bacteria 2299
2169 nmdc:mga06r32_181680_c1 3300050510 Bacteria 2089
2170 nmdc:mga06r32_208123_c1 3300050510 Bacteria 1354
2171 nmdc:mga06r32_43313_c1 3300050510 Bacteria 4283
2172 nmdc:mga06r32_464009_c1 3300050510 Bacteria 1245
2173 nmdc:mga06r32_6769_c1 3300050510 Bacteria 10301
2174 nmdc:mga06r32_77561_c1 3300050510 Bacteria 3228
2175 nmdc:mga06r32_96117_c1 3300050510 Bacteria 2901
2176 nmdc:mga08y16_109482_c2 3300050511 Bacteria 1131
2177 nmdc:mga08y16_10_c1 3300050511 Bacteria 470512
2178 nmdc:mga08y16_11049_c1 3300050511 Bacteria 9482
2179 nmdc:mga08y16_14059_c1 3300050511 Bacteria 8425
2180 nmdc:mga08y16_155_c1 3300050511 Bacteria 31746
2181 nmdc:mga08y16_166791_c1 3300050511 Bacteria 2288
2182 nmdc:mga08y16_17177_c1 3300050511 Bacteria 7617
2183 nmdc:mga08y16_180782_c1 3300050511 Bacteria 2190
2184 nmdc:mga08y16_202_c1 3300050511 Bacteria 53486
2185 nmdc:mga08y16_238369_c1 3300050511 Bacteria 1881
2186 nmdc:mga08y16_30031_c1 3300050511 Bacteria 5724
2187 nmdc:mga08y16_34787_c1 3300050511 Bacteria 5293
2188 nmdc:mga08y16_359873_c1 3300050511 Bacteria 1494
2189 nmdc:mga08y16_360286_c1 3300050511 Bacteria 1493
2190 nmdc:mga08y16_381205_c1 3300050511 Bacteria 1445
2191 nmdc:mga08y16_384291_c1 3300050511 Bacteria 1439
2192 nmdc:mga08y16_43115_c1 3300050511 Bacteria 4727
2193 nmdc:mga08y16_43521_c1 3300050511 Bacteria 4706
2194 nmdc:mga08y16_59748_c1 3300050511 Bacteria 3982
2195 nmdc:mga08y16_63396_c1 3300050511 Bacteria 3860
2196 nmdc:mga08y16_708709_c1 3300050511 Bacteria 1005
2197 nmdc:mga08y16_735923_c1 3300050511 Bacteria 983
2198 nmdc:mga08y16_78791_c1 3300050511 Bacteria 3435
2199 nmdc:mga08y16_8873_c1 3300050511 Bacteria 10556
2200 nmdc:mga08y16_920_c1 3300050511 Bacteria 28551
2201 nmdc:mga0n895_10459_c1 3300050512 Bacteria 8200
2202 nmdc:mga0n895_1084569_c1 3300050512 Bacteria 779
2203 nmdc:mga0n895_127566_c1 3300050512 Bacteria 2568
2204 nmdc:mga0n895_12870_c1 3300050512 Bacteria 7518
2205 nmdc:mga0n895_148718_c1 3300050512 Bacteria 2371
2206 nmdc:mga0n895_15743_c1 3300050512 Bacteria 6912
2207 nmdc:mga0n895_192188_c1 3300050512 Bacteria 2072
2208 nmdc:mga0n895_207296_c1 3300050512 Bacteria 1991
2209 nmdc:mga0n895_20974_c1 3300050512 Bacteria 6103
2210 nmdc:mga0n895_229466_c1 3300050512 Bacteria 1885
2211 nmdc:mga0n895_31040_c1 3300050512 Bacteria 5112
2212 nmdc:mga0n895_317796_c1 3300050512 Bacteria 1578
2213 nmdc:mga0n895_40759_c1 3300050512 Bacteria 4512
2214 nmdc:mga0n895_45851_c1 3300050512 Bacteria 4268
2215 nmdc:mga0n895_71007_c1 3300050512 Bacteria 3452
2216 nmdc:mga0n895_7101_c1 3300050512 Bacteria 9574
2217 nmdc:mga0n895_721280_c1 3300050512 Bacteria 992
2218 nmdc:mga0n895_775990_c1 3300050512 Bacteria 950
2219 nmdc:mga0rr50_11083_c1 3300050513 Bacteria 5751
2220 nmdc:mga0rr50_152578_c1 3300050513 Bacteria 1868
2221 nmdc:mga0rr50_1983_c1 3300050513 Bacteria 11375
2222 nmdc:mga0rr50_28992_c1 3300050513 Bacteria 3897
2223 nmdc:mga0rr50_3252_c1 3300050513 Bacteria 9311
2224 nmdc:mga0rr50_330211_c1 3300050513 Bacteria 1280
2225 nmdc:mga0rr50_373_c1 3300050513 Bacteria 24506
2226 nmdc:mga0rr50_385702_c1 3300050513 Bacteria 1182
2227 nmdc:mga0rr50_447523_c1 3300050513 Bacteria 1095
2228 nmdc:mga0rr50_48987_c1 3300050513 Bacteria 3126
2229 nmdc:mga0rr50_90946_c1 3300050513 Bacteria 2376
2230 nmdc:mga0rr50_9864_c1 3300050513 Bacteria 6035
2231 nmdc:mga08x19_134734_c1 3300050514 Bacteria 1664
2232 nmdc:mga08x19_15605_c1 3300050514 Bacteria 4622
2233 nmdc:mga08x19_199896_c1 3300050514 Bacteria 1370
2234 nmdc:mga08x19_24673_c1 3300050514 Bacteria 3741
2235 nmdc:mga08x19_31009_c1 3300050514 Bacteria 3361
2236 nmdc:mga08x19_32434_c1 3300050514 Bacteria 3292
2237 nmdc:mga08x19_40962_c1 3300050514 Bacteria 2950
2238 nmdc:mga08x19_74085_c1 3300050514 Bacteria 2224
2239 nmdc:mga08x19_889026_c1 3300050514 Bacteria 633
2240 nmdc:mga0a205_10346_c1 3300050515 Bacteria 8575
2241 nmdc:mga0a205_124005_c1 3300050515 Bacteria 2483
2242 nmdc:mga0a205_176822_c1 3300050515 Bacteria 2030
2243 nmdc:mga0a205_192568_c1 3300050515 Bacteria 1931
2244 nmdc:mga0a205_203915_c1 3300050515 Bacteria 1867
2245 nmdc:mga0a205_208501_c1 3300050515 Bacteria 1843
2246 nmdc:mga0a205_2239_c1 3300050515 Bacteria 17045
2247 nmdc:mga0a205_233297_c1 3300050515 Bacteria 1723
2248 nmdc:mga0a205_25088_c1 3300050515 Bacteria 5676
2249 nmdc:mga0a205_3048_c1 3300050515 Bacteria 14858
2250 nmdc:mga0a205_322461_c1 3300050515 Bacteria 1416
2251 nmdc:mga0a205_47564_c1 3300050515 Bacteria 4140
2252 nmdc:mga0a205_51898_c1 3300050515 Bacteria 3958
2253 nmdc:mga0a205_613319_c1 3300050515 Bacteria 941
2254 nmdc:mga0a205_701695_c1 3300050515 Bacteria 862
2255 nmdc:mga0a205_70179_c1 3300050515 Bacteria 3382
2256 nmdc:mga0a205_720756_c1 3300050515 Bacteria 847
2257 nmdc:mga0a205_7364_c1 3300050515 Bacteria 9967
2258 nmdc:mga0a205_74968_c1 3300050515 Bacteria 3269
2259 nmdc:mga0a205_79422_c1 3300050515 Bacteria 3170
2260 nmdc:mga0a205_8091_c1 3300050515 Bacteria 9557
2261 Ga0495601_0026959 3300053077 Bacteria 3551
2262 Ga0495601_0093044 3300053077 Bacteria 1942
2263 Ga0495601_0095032 3300053077 Bacteria 1921
2264 Ga0495601_0176766 3300053077 Bacteria 1395
2265 Ga0495601_0201115 3300053077 Bacteria 1302
2266 Ga0495595_0095036 3300053084 Bacteria 1434
2267 Ga0495595_0161085 3300053084 Bacteria 1107
2268 Ga0495595_0362611 3300053084 Bacteria 732
2269 Ga0495595_0490309 3300053084 Bacteria 626
2270 Ga0495619_0004075 3300053085 Bacteria 9360
2271 Ga0495619_0029701 3300053085 Bacteria 3534
2272 Ga0495619_0054403 3300053085 Bacteria 2649
2273 Ga0495619_0065562 3300053085 Bacteria 2423
2274 Ga0495619_0109235 3300053085 Bacteria 1888
2275 Ga0495619_0274917 3300053085 Bacteria 1167
2276 Ga0500651_0212001 3300053093 Bacteria 1139
2277 Ga0500641_0022361 3300053096 Bacteria 2420
2278 Ga0500556_0001889 3300053104 Bacteria 7496
2279 Ga0500628_047896 3300053129 Bacteria 1003
2280 Ga0500568_0010726 3300053139 Bacteria 4278
2281 Ga0500616_0071032 3300053153 Bacteria 1775
2282 Ga0500611_003831 3300053727 Bacteria 1968
2283 Ga0501084_0012960 3300054114 Bacteria 6904
2284 Ga0501084_0039487 3300054114 Bacteria 3948
2285 Ga0501084_0047521 3300054114 Bacteria 3594
2286 Ga0501084_0083335 3300054114 Bacteria 2684
2287 Ga0501084_0177766 3300054114 Bacteria 1796
2288 Ga0501084_0208481 3300054114 Bacteria 1649
2289 Ga0501084_0211791 3300054114 Bacteria 1635
2290 Ga0501084_0215221 3300054114 Bacteria 1621
2291 Ga0501084_0424257 3300054114 Bacteria 1124
2292 Ga0501084_0727302 3300054114 Bacteria 836
2293 Ga0501084_0862015 3300054114 Bacteria 762
2294 Ga0590071_000004 3300059421 Bacteria 63957
2295 Ga0590071_000185 3300059421 Bacteria 18146
2296 Ga0590071_003474 3300059421 Bacteria 3866
2297 Ga0590071_010217 3300059421 Bacteria 2200
2298 Ga0590071_068351 3300059421 Bacteria 874
2299 Ga0590074_004491 3300059423 Bacteria 2308
2300 Ga0590074_005149 3300059423 Bacteria 2161
2301 Ga0590074_016136 3300059423 Bacteria 1271
2302 Ga0590075_000034 3300059424 Bacteria 36053
2303 Ga0590075_000204 3300059424 Bacteria 16569
2304 Ga0590075_001384 3300059424 Bacteria 6079
2305 Ga0590075_024492 3300059424 Bacteria 1515
2306 Ga0590075_078370 3300059424 Bacteria 855
2307 Ga0590077_002605 3300059426 Bacteria 3823
2308 Ga0590077_005617 3300059426 Bacteria 2565
2309 Ga0590077_010911 3300059426 Bacteria 1872
2310 Ga0590077_012490 3300059426 Bacteria 1762
2311 Ga0590077_027385 3300059426 Bacteria 1235
2312 Ga0587070_061259 3300059491 Bacteria 779
2313 Ga0587077_020571 3300059493 Bacteria 1162
2314 Ga0587090_049564 3300059510 Bacteria 766
2315 Ga0587091_044228 3300059511 Bacteria 891
2316 Ga0587125_029026 3300059607 Bacteria 697
2317 Ga0587067_052275 3300059640 Bacteria 831
2318 Ga0501082_0000274 3300060353 Bacteria 45495
2319 Ga0501082_0027282 3300060353 Bacteria 4917
2320 Ga0501082_0042306 3300060353 Bacteria 3928
2321 Ga0501082_0043927 3300060353 Bacteria 3854
2322 Ga0501082_0067328 3300060353 Bacteria 3084
2323 Ga0501082_0109969 3300060353 Bacteria 2386
2324 Ga0501082_0134537 3300060353 Bacteria 2145
2325 Ga0501082_0236092 3300060353 Bacteria 1591
2326 Ga0501082_0290467 3300060353 Bacteria 1424
2327 Ga0501082_0293631 3300060353 Bacteria 1415
2328 Ga0501082_0328584 3300060353 Bacteria 1332
2329 Ga0501082_0381162 3300060353 Bacteria 1230
2330 Ga0501082_0503366 3300060353 Bacteria 1059
2331 Ga0501082_0535685 3300060353 Bacteria 1024
2332 Ga0501082_0554118 3300060353 Bacteria 1005
2333 Ga0501082_0653253 3300060353 Bacteria 920
2334 Ga0501082_0883466 3300060353 Bacteria 782
2335 Ga0501082_1063678 3300060353 Bacteria 707
2336 Ga0530510_0030675 3300061734 Bacteria 3863
2337 Ga0530510_0035622 3300061734 Bacteria 3587
2338 Ga0530510_0045865 3300061734 Bacteria 3157
2339 Ga0530510_0085952 3300061734 Bacteria 2291
2340 Ga0530510_0099637 3300061734 Bacteria 2124
2341 Ga0530510_0102735 3300061734 Bacteria 2091
2342 Ga0530510_0284942 3300061734 Bacteria 1235
2343 Ga0530510_0698915 3300061734 Bacteria 773
2344 Ga0530510_0860412 3300061734 Bacteria 692

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049574 Ga0501038_0580222 Ga0501038_0580222_10_525 171
2 3300005328 Ga0070676_10083525 Ga0070676_100835253 191
3 3300005331 Ga0070670_100056329 Ga0070670_1000563295 191
4 3300005337 Ga0070682_100252251 Ga0070682_1002522512 191
5 3300005338 Ga0068868_100038172 Ga0068868_1000381725 191
6 3300005354 Ga0070675_100730779 Ga0070675_1007307791 191
7 3300005466 Ga0070685_10232370 Ga0070685_102323701 191
8 3300005544 Ga0070686_100319194 Ga0070686_1003191942 191
9 3300005546 Ga0070696_100232717 Ga0070696_1002327172 191
10 3300005548 Ga0070665_101238487 Ga0070665_1012384871 191
11 3300005616 Ga0068852_100045958 Ga0068852_1000459582 191
12 3300005841 Ga0068863_100097734 Ga0068863_1000977342 191
13 3300005841 Ga0068863_100101600 Ga0068863_1001016002 191
14 3300005844 Ga0068862_100486800 Ga0068862_1004868002 191
15 3300006237 Ga0097621_100082137 Ga0097621_1000821372 191
16 3300006358 Ga0068871_100223908 Ga0068871_1002239082 191
17 3300006358 Ga0068871_100341993 Ga0068871_1003419932 191
18 3300006881 Ga0068865_100283596 Ga0068865_1002835962 191
19 3300009148 Ga0105243_10663521 Ga0105243_106635212 191
20 3300009148 Ga0105243_10808353 Ga0105243_108083532 191
21 3300009174 Ga0105241_10445234 Ga0105241_104452342 191
22 3300009176 Ga0105242_10315923 Ga0105242_103159232 191
23 3300009176 Ga0105242_10388409 Ga0105242_103884091 191
24 3300009177 Ga0105248_10015209 Ga0105248_100152096 191
25 3300009177 Ga0105248_10539078 Ga0105248_105390781 191
26 3300009551 Ga0105238_10436632 Ga0105238_104366322 191
27 3300009553 Ga0105249_10147090 Ga0105249_101470902 191
28 3300011119 Ga0105246_10188937 Ga0105246_101889371 191
29 3300013296 Ga0157374_10219870 Ga0157374_102198702 191
30 3300013297 Ga0157378_10629665 Ga0157378_106296651 191
31 3300013308 Ga0157375_10236510 Ga0157375_102365102 191
32 3300013308 Ga0157375_10304235 Ga0157375_103042351 191
33 3300014968 Ga0157379_10278633 Ga0157379_102786332 191
34 3300014969 Ga0157376_10073740 Ga0157376_100737406 191
35 3300014326 Ga0157380_10324159 Ga0157380_103241591 192
36 3300026067 Ga0207678_10336774 Ga0207678_103367743 192
37 3300035083 Ga0373926_0085811 Ga0373926_0085811_300_878 192
38 3300035171 Ga0373946_0025750 Ga0373946_0025750_1700_2278 192
39 3300037068 Ga0373925_0002179 Ga0373925_0002179_9697_10275 192
40 3300041999 Ga0439433_0002957 Ga0439433_0002957_1723_2301 192
41 3300042126 Ga0450888_031554 Ga0450888_031554_44_622 192
42 3300042532 Ga0450893_0039401 Ga0450893_0039401_42_620 192
43 3300046475 Ga0495639_0000121 Ga0495639_0000121_8664_9242 192
44 3300046499 Ga0495594_0351336 Ga0495594_0351336_68_646 192
45 3300046517 Ga0495630_0320412 Ga0495630_0320412_232_810 192
46 3300046526 Ga0495666_0019669 Ga0495666_0019669_960_1538 192
47 3300046681 Ga0495647_0016102 Ga0495647_0016102_1744_2322 192
48 3300046683 Ga0495658_0004909 Ga0495658_0004909_3019_3597 192
49 3300046689 Ga0495613_0041711 Ga0495613_0041711_40_618 192
50 3300047315 Ga0495581_0087957 Ga0495581_0087957_892_1470 192
51 3300047321 Ga0495676_0020676 Ga0495676_0020676_1509_2087 192
52 3300049571 Ga0501034_0053308 Ga0501034_0053308_2190_2768 192
53 3300049572 Ga0501036_0627074 Ga0501036_0627074_272_850 192
54 3300049576 Ga0501040_0158550 Ga0501040_0158550_46_624 192
55 3300049577 Ga0501041_0221973 Ga0501041_0221973_557_1135 192
56 3300049582 Ga0501048_0123111 Ga0501048_0123111_846_1424 192
57 3300049582 Ga0501048_0146677 Ga0501048_0146677_17_595 192
58 3300049587 Ga0501071_0206513 Ga0501071_0206513_382_960 192
59 3300049587 Ga0501071_0842562 Ga0501071_0842562_55_633 192
60 3300049588 Ga0501072_0153971 Ga0501072_0153971_600_1178 192
61 3300049589 Ga0501073_0001115 Ga0501073_0001115_5044_5622 192
62 3300049590 Ga0501074_0302337 Ga0501074_0302337_464_1042 192
63 3300049592 Ga0501076_0141290 Ga0501076_0141290_1244_1822 192
64 3300049741 Ga0501079_0474561 Ga0501079_0474561_267_845 192
65 3300049741 Ga0501079_0489817 Ga0501079_0489817_299_877 192
66 3300049743 Ga0501081_0023666 Ga0501081_0023666_246_824 192
67 3300049743 Ga0501081_0212479 Ga0501081_0212479_358_936 192
68 3300049824 Ga0501045_0561952 Ga0501045_0561952_226_804 192
69 3300049824 Ga0501045_0797858 Ga0501045_0797858_57_635 192
70 3300050512 nmdc:mga0n895_1084569_c1 nmdc:mga0n895_1084569_c1_177_755 192
71 3300053104 Ga0500556_0001889 Ga0500556_0001889_6388_6966 192
72 3300054114 Ga0501084_0208481 Ga0501084_0208481_935_1513 192
73 3300060353 Ga0501082_0109969 Ga0501082_0109969_333_911 192
74 3300060353 Ga0501082_0290467 Ga0501082_0290467_376_954 192
75 3300060353 Ga0501082_0883466 Ga0501082_0883466_10_588 192
76 3300061734 Ga0530510_0284942 Ga0530510_0284942_599_1177 192
77 3300004799 Ga0058863_11716119 Ga0058863_117161192 193
78 3300005295 Ga0065707_10033316 Ga0065707_100333162 193
79 3300005327 Ga0070658_10380639 Ga0070658_103806391 193
80 3300005329 Ga0070683_100182900 Ga0070683_1001829002 193
81 3300005331 Ga0070670_100099932 Ga0070670_1000999324 193
82 3300005335 Ga0070666_10144630 Ga0070666_101446302 193
83 3300005340 Ga0070689_100058156 Ga0070689_1000581565 193
84 3300005354 Ga0070675_100002333 Ga0070675_10000233312 193
85 3300005365 Ga0070688_100005572 Ga0070688_1000055722 193
86 3300005367 Ga0070667_100714663 Ga0070667_1007146632 193
87 3300005367 Ga0070667_101014212 Ga0070667_1010142121 193
88 3300005530 Ga0070679_100641762 Ga0070679_1006417622 193
89 3300005539 Ga0068853_100737900 Ga0068853_1007379001 193
90 3300005543 Ga0070672_100019397 Ga0070672_1000193972 193
91 3300005543 Ga0070672_100164949 Ga0070672_1001649492 193
92 3300005544 Ga0070686_100259715 Ga0070686_1002597152 193
93 3300005564 Ga0070664_100200582 Ga0070664_1002005822 193
94 3300005841 Ga0068863_100003338 Ga0068863_1000033387 193
95 3300005842 Ga0068858_100074105 Ga0068858_1000741054 193
96 3300005843 Ga0068860_100062492 Ga0068860_1000624922 193
97 3300005844 Ga0068862_101204989 Ga0068862_1012049891 193
98 3300006042 Ga0075368_10018531 Ga0075368_100185315 193
99 3300006177 Ga0075362_10093276 Ga0075362_100932762 193
100 3300006358 Ga0068871_101083135 Ga0068871_1010831351 193
101 3300006844 Ga0075428_100151125 Ga0075428_1001511252 193
102 3300006852 Ga0075433_10729996 Ga0075433_107299961 193
103 3300006871 Ga0075434_100059010 Ga0075434_1000590101 193
104 3300009093 Ga0105240_10205626 Ga0105240_102056262 193
105 3300009094 Ga0111539_10000010 Ga0111539_1000001027 193
106 3300009094 Ga0111539_10000566 Ga0111539_1000056622 193
107 3300009094 Ga0111539_10000614 Ga0111539_1000061422 193
108 3300009094 Ga0111539_10000976 Ga0111539_1000097629 193
109 3300009094 Ga0111539_10035602 Ga0111539_100356025 193
110 3300009094 Ga0111539_10049617 Ga0111539_100496174 193
111 3300009094 Ga0111539_10136890 Ga0111539_101368903 193
112 3300009094 Ga0111539_10428152 Ga0111539_104281522 193
113 3300009094 Ga0111539_11062065 Ga0111539_110620651 193
114 3300009094 Ga0111539_11149524 Ga0111539_111495241 193
115 3300009098 Ga0105245_10386784 Ga0105245_103867842 193
116 3300009098 Ga0105245_10413220 Ga0105245_104132202 193
117 3300009101 Ga0105247_10028592 Ga0105247_100285927 193
118 3300009101 Ga0105247_10222250 Ga0105247_102222502 193
119 3300009147 Ga0114129_10000347 Ga0114129_1000034737 193
120 3300009147 Ga0114129_10005044 Ga0114129_100050443 193
121 3300009147 Ga0114129_10006820 Ga0114129_1000682030 193
122 3300009147 Ga0114129_10033059 Ga0114129_100330597 193
123 3300009147 Ga0114129_10047057 Ga0114129_100470573 193
124 3300009147 Ga0114129_10080394 Ga0114129_100803947 193
125 3300009147 Ga0114129_10081911 Ga0114129_100819116 193
126 3300009147 Ga0114129_10243133 Ga0114129_102431333 193
127 3300009147 Ga0114129_10687360 Ga0114129_106873602 193
128 3300009148 Ga0105243_10127918 Ga0105243_101279181 193
129 3300009148 Ga0105243_10153454 Ga0105243_101534541 193
130 3300009148 Ga0105243_10335866 Ga0105243_103358662 193
131 3300009148 Ga0105243_10552195 Ga0105243_105521952 193
132 3300009174 Ga0105241_10168637 Ga0105241_101686372 193
133 3300009174 Ga0105241_10506356 Ga0105241_105063561 193
134 3300009174 Ga0105241_10933045 Ga0105241_109330452 193
135 3300009176 Ga0105242_10175790 Ga0105242_101757903 193
136 3300009176 Ga0105242_10266964 Ga0105242_102669642 193
137 3300009176 Ga0105242_10405498 Ga0105242_104054982 193
138 3300009176 Ga0105242_10876565 Ga0105242_108765651 193
139 3300009177 Ga0105248_10039983 Ga0105248_100399835 193
140 3300009177 Ga0105248_10041456 Ga0105248_100414564 193
141 3300009177 Ga0105248_10210393 Ga0105248_102103931 193
142 3300009177 Ga0105248_10233060 Ga0105248_102330601 193
143 3300009177 Ga0105248_10595330 Ga0105248_105953302 193
144 3300009545 Ga0105237_10574040 Ga0105237_105740401 193
145 3300009551 Ga0105238_10077035 Ga0105238_100770354 193
146 3300009553 Ga0105249_10002497 Ga0105249_1000249725 193
147 3300009553 Ga0105249_10184311 Ga0105249_101843112 193
148 3300009553 Ga0105249_10276733 Ga0105249_102767333 193
149 3300009553 Ga0105249_10414237 Ga0105249_104142371 193
150 3300009553 Ga0105249_10618952 Ga0105249_106189522 193
151 3300009553 Ga0105249_10790928 Ga0105249_107909282 193
152 3300009553 Ga0105249_11096106 Ga0105249_110961061 193
153 3300010375 Ga0105239_10173046 Ga0105239_101730461 193
154 3300010375 Ga0105239_10884458 Ga0105239_108844582 193
155 3300010375 Ga0105239_11010096 Ga0105239_110100961 193
156 3300011119 Ga0105246_10281155 Ga0105246_102811552 193
157 3300011119 Ga0105246_10669311 Ga0105246_106693111 193
158 3300013102 Ga0157371_10393477 Ga0157371_103934772 193
159 3300013104 Ga0157370_10388874 Ga0157370_103888742 193
160 3300013105 Ga0157369_10569201 Ga0157369_105692012 193
161 3300013296 Ga0157374_10313892 Ga0157374_103138922 193
162 3300013297 Ga0157378_10248006 Ga0157378_102480062 193
163 3300013297 Ga0157378_10694255 Ga0157378_106942551 193
164 3300013297 Ga0157378_11076089 Ga0157378_110760892 193
165 3300013297 Ga0157378_11114368 Ga0157378_111143681 193
166 3300013306 Ga0163162_10699724 Ga0163162_106997242 193
167 3300013306 Ga0163162_11270085 Ga0163162_112700851 193
168 3300013307 Ga0157372_10042550 Ga0157372_100425504 193
169 3300013308 Ga0157375_10045095 Ga0157375_100450955 193
170 3300013308 Ga0157375_10326674 Ga0157375_103266742 193
171 3300013308 Ga0157375_10386601 Ga0157375_103866012 193
172 3300013308 Ga0157375_10450004 Ga0157375_104500042 193
173 3300013308 Ga0157375_11047597 Ga0157375_110475971 193
174 3300013308 Ga0157375_11087455 Ga0157375_110874551 193
175 3300014325 Ga0163163_10058152 Ga0163163_100581527 193
176 3300014325 Ga0163163_10267085 Ga0163163_102670851 193
177 3300014325 Ga0163163_10448466 Ga0163163_104484662 193
178 3300014325 Ga0163163_10977004 Ga0163163_109770042 193
179 3300014326 Ga0157380_10012295 Ga0157380_100122958 193
180 3300014326 Ga0157380_10058189 Ga0157380_100581892 193
181 3300014326 Ga0157380_10100753 Ga0157380_101007534 193
182 3300014326 Ga0157380_10246917 Ga0157380_102469172 193
183 3300014326 Ga0157380_10255279 Ga0157380_102552792 193
184 3300014326 Ga0157380_10261243 Ga0157380_102612432 193
185 3300014326 Ga0157380_10306125 Ga0157380_103061253 193
186 3300014326 Ga0157380_10405442 Ga0157380_104054422 193
187 3300014497 Ga0182008_10161661 Ga0182008_101616612 193
188 3300014745 Ga0157377_10099859 Ga0157377_100998593 193
189 3300014745 Ga0157377_10167795 Ga0157377_101677951 193
190 3300014745 Ga0157377_10233995 Ga0157377_102339952 193
191 3300014968 Ga0157379_10141606 Ga0157379_101416062 193
192 3300014968 Ga0157379_10342777 Ga0157379_103427772 193
193 3300014968 Ga0157379_10350175 Ga0157379_103501752 193
194 3300014968 Ga0157379_10550813 Ga0157379_105508131 193
195 3300014968 Ga0157379_10771290 Ga0157379_107712901 193
196 3300014969 Ga0157376_10432503 Ga0157376_104325032 193
197 3300014969 Ga0157376_10657321 Ga0157376_106573212 193
198 3300025900 Ga0207710_10161836 Ga0207710_101618361 193
199 3300025903 Ga0207680_10758319 Ga0207680_107583191 193
200 3300025908 Ga0207643_10277550 Ga0207643_102775502 193
201 3300025909 Ga0207705_10076279 Ga0207705_100762794 193
202 3300025910 Ga0207684_10379273 Ga0207684_103792731 193
203 3300025912 Ga0207707_10006304 Ga0207707_100063044 193
204 3300025913 Ga0207695_10349555 Ga0207695_103495551 193
205 3300025920 Ga0207649_10391433 Ga0207649_103914332 193
206 3300025922 Ga0207646_10144507 Ga0207646_101445073 193
207 3300025925 Ga0207650_10219327 Ga0207650_102193271 193
208 3300025926 Ga0207659_10000672 Ga0207659_1000067212 193
209 3300025931 Ga0207644_10006450 Ga0207644_1000645011 193
210 3300025932 Ga0207690_10452293 Ga0207690_104522931 193
211 3300025936 Ga0207670_10040477 Ga0207670_100404772 193
212 3300025937 Ga0207669_10005330 Ga0207669_100053308 193
213 3300025938 Ga0207704_10064595 Ga0207704_100645952 193
214 3300025940 Ga0207691_10072086 Ga0207691_100720862 193
215 3300025940 Ga0207691_10083203 Ga0207691_100832032 193
216 3300025960 Ga0207651_10243820 Ga0207651_102438203 193
217 3300025972 Ga0207668_10017365 Ga0207668_100173657 193
218 3300026023 Ga0207677_10316333 Ga0207677_103163331 193
219 3300026035 Ga0207703_10034788 Ga0207703_100347884 193
220 3300026088 Ga0207641_10109185 Ga0207641_101091851 193
221 3300026089 Ga0207648_10325878 Ga0207648_103258782 193
222 3300026116 Ga0207674_10434471 Ga0207674_104344711 193
223 3300026118 Ga0207675_100114552 Ga0207675_1001145524 193
224 3300027907 Ga0207428_10018773 Ga0207428_100187735 193
225 3300028379 Ga0268266_10407025 Ga0268266_104070251 193
226 3300028380 Ga0268265_10158411 Ga0268265_101584111 193
227 3300028381 Ga0268264_10027385 Ga0268264_100273852 193
228 3300028381 Ga0268264_10244304 Ga0268264_102443042 193
229 3300028381 Ga0268264_10874931 Ga0268264_108749312 193
230 3300031548 Ga0307408_100011882 Ga0307408_1000118828 193
231 3300031824 Ga0307413_10285364 Ga0307413_102853641 193
232 3300031901 Ga0307406_10032196 Ga0307406_100321964 193
233 3300031911 Ga0307412_10212886 Ga0307412_102128861 193
234 3300034816 Ga0373930_0003254 Ga0373930_0003254_478_1059 193
235 3300034817 Ga0373948_0001418 Ga0373948_0001418_2172_2753 193
236 3300034818 Ga0373950_0004214 Ga0373950_0004214_542_1123 193
237 3300034819 Ga0373958_0009506 Ga0373958_0009506_910_1491 193
238 3300034820 Ga0373959_0000924 Ga0373959_0000924_3763_4344 193
239 3300034957 Ga0373938_0069534 Ga0373938_0069534_118_699 193
240 3300035085 Ga0373929_0000116 Ga0373929_0000116_3344_3925 193
241 3300035090 Ga0373949_0006829 Ga0373949_0006829_967_1548 193
242 3300035090 Ga0373949_0152853 Ga0373949_0152853_56_637 193
243 3300035091 Ga0373951_0003755 Ga0373951_0003755_1252_1833 193
244 3300035092 Ga0373952_0000263 Ga0373952_0000263_879_1460 193
245 3300035112 Ga0373932_0000807 Ga0373932_0000807_3524_4105 193
246 3300035112 Ga0373932_0067015 Ga0373932_0067015_319_900 193
247 3300035113 Ga0373936_0095108 Ga0373936_0095108_599_1180 193
248 3300035114 Ga0373939_0000844 Ga0373939_0000844_1907_2488 193
249 3300035114 Ga0373939_0036838 Ga0373939_0036838_80_661 193
250 3300035115 Ga0373941_0005243 Ga0373941_0005243_1243_1824 193
251 3300035117 Ga0373953_0346462 Ga0373953_0346462_57_638 193
252 3300035118 Ga0373954_0440833 Ga0373954_0440833_31_612 193
253 3300035119 Ga0373956_0055436 Ga0373956_0055436_1164_1745 193
254 3300035121 Ga0373960_0000753 Ga0373960_0000753_1174_1755 193
255 3300035171 Ga0373946_0013812 Ga0373946_0013812_936_1517 193
256 3300035171 Ga0373946_0222289 Ga0373946_0222289_317_898 193
257 3300035171 Ga0373946_0248486 Ga0373946_0248486_181_762 193
258 3300035172 Ga0373955_0139330 Ga0373955_0139330_285_866 193
259 3300035207 Ga0373942_0002319 Ga0373942_0002319_2654_3235 193
260 3300035207 Ga0373942_0095668 Ga0373942_0095668_266_847 193
261 3300035241 Ga0373961_0001371 Ga0373961_0001371_3409_3990 193
262 3300035242 Ga0373962_0035217 Ga0373962_0035217_701_1282 193
263 3300035410 Ga0373924_0013554 Ga0373924_0013554_201_782 193
264 3300035691 Ga0373931_0004378 Ga0373931_0004378_3652_4233 193
265 3300035692 Ga0373935_0184007 Ga0373935_0184007_500_1081 193
266 3300035692 Ga0373935_0432212 Ga0373935_0432212_110_691 193
267 3300035724 Ga0373933_0241118 Ga0373933_0241118_225_806 193
268 3300035724 Ga0373933_0650806 Ga0373933_0650806_40_621 193
269 3300035725 Ga0373947_0306417 Ga0373947_0306417_461_1042 193
270 3300035725 Ga0373947_0768573 Ga0373947_0768573_28_609 193
271 3300036401 Ga0373937_0008713 Ga0373937_0008713_6156_6737 193
272 3300036401 Ga0373937_0016952 Ga0373937_0016952_2952_3533 193
273 3300036401 Ga0373937_0714099 Ga0373937_0714099_327_908 193
274 3300036401 Ga0373937_1284152 Ga0373937_1284152_42_623 193
275 3300037068 Ga0373925_0017315 Ga0373925_0017315_3304_3885 193
276 3300037068 Ga0373925_0249721 Ga0373925_0249721_358_939 193
277 3300037312 Ga0395899_0573389 Ga0395899_0573389_80_661 193
278 3300041404 Ga0439436_0037568 Ga0439436_0037568_171_752 193
279 3300041408 Ga0439453_0007387 Ga0439453_0007387_866_1447 193
280 3300041408 Ga0439453_0026582 Ga0439453_0026582_445_1026 193
281 3300041408 Ga0439453_0046170 Ga0439453_0046170_149_730 193
282 3300041410 Ga0439461_0100250 Ga0439461_0100250_89_670 193
283 3300041512 Ga0451853_3514345 Ga0451853_3514345_144_725 193
284 3300041999 Ga0439433_0043082 Ga0439433_0043082_441_1022 193
285 3300042001 Ga0439441_032614 Ga0439441_032614_349_930 193
286 3300042003 Ga0439443_058394 Ga0439443_058394_38_619 193
287 3300042004 Ga0439445_0075444 Ga0439445_0075444_25_606 193
288 3300042004 Ga0439445_0124930 Ga0439445_0124930_63_644 193
289 3300042007 Ga0439449_0035701 Ga0439449_0035701_717_1298 193
290 3300042007 Ga0439449_0076022 Ga0439449_0076022_453_1034 193
291 3300042008 Ga0439450_041055 Ga0439450_041055_460_1041 193
292 3300042014 Ga0439457_085890 Ga0439457_085890_102_683 193
293 3300042015 Ga0439462_0018380 Ga0439462_0018380_1060_1641 193
294 3300042118 Ga0450914_001705 Ga0450914_001705_654_1235 193
295 3300042122 Ga0450920_080427 Ga0450920_080427_47_628 193
296 3300042436 Ga0439435_0032270 Ga0439435_0032270_312_893 193
297 3300042530 Ga0450916_002008 Ga0450916_002008_1440_2021 193
298 3300042531 Ga0450918_005771 Ga0450918_005771_1601_2182 193
299 3300042876 Ga0451577_0148370 Ga0451577_0148370_1135_1716 193
300 3300044673 Ga0453683_0213507 Ga0453683_0213507_139_720 193
301 3300044712 Ga0453684_0115398 Ga0453684_0115398_2569_3150 193
302 3300044712 Ga0453684_0142955 Ga0453684_0142955_1942_2523 193
303 3300045051 Ga0451576_0021918 Ga0451576_0021918_1119_1700 193
304 3300045051 Ga0451576_0030890 Ga0451576_0030890_2397_2978 193
305 3300045051 Ga0451576_0325554 Ga0451576_0325554_957_1538 193
306 3300045051 Ga0451576_0872049 Ga0451576_0872049_18_599 193
307 3300045051 Ga0451576_1906813 Ga0451576_1906813_14_595 193
308 3300046454 Ga0495592_0170652 Ga0495592_0170652_740_1321 193
309 3300046455 Ga0495603_0077947 Ga0495603_0077947_251_832 193
310 3300046455 Ga0495603_0106594 Ga0495603_0106594_428_1009 193
311 3300046455 Ga0495603_0341028 Ga0495603_0341028_232_813 193
312 3300046455 Ga0495603_0479512 Ga0495603_0479512_113_694 193
313 3300046460 Ga0495638_0003145 Ga0495638_0003145_1641_2222 193
314 3300046460 Ga0495638_0041961 Ga0495638_0041961_1564_2145 193
315 3300046461 Ga0495641_0133018 Ga0495641_0133018_28_609 193
316 3300046462 Ga0495651_0099555 Ga0495651_0099555_1380_1961 193
317 3300046463 Ga0495653_0029166 Ga0495653_0029166_608_1189 193
318 3300046472 Ga0495580_0112799 Ga0495580_0112799_173_754 193
319 3300046472 Ga0495580_0424779 Ga0495580_0424779_236_817 193
320 3300046473 Ga0495582_0139379 Ga0495582_0139379_53_634 193
321 3300046473 Ga0495582_0606140 Ga0495582_0606140_33_614 193
322 3300046491 Ga0495584_0006905 Ga0495584_0006905_5091_5672 193
323 3300046491 Ga0495584_0259149 Ga0495584_0259149_32_613 193
324 3300046492 Ga0495585_0024131 Ga0495585_0024131_2744_3325 193
325 3300046499 Ga0495594_0386705 Ga0495594_0386705_205_786 193
326 3300046500 Ga0495596_0114616 Ga0495596_0114616_339_920 193
327 3300046511 Ga0495608_0004188 Ga0495608_0004188_5998_6579 193
328 3300046514 Ga0495618_0107781 Ga0495618_0107781_1046_1627 193
329 3300046516 Ga0495628_0124179 Ga0495628_0124179_75_656 193
330 3300046517 Ga0495630_0010900 Ga0495630_0010900_5572_6153 193
331 3300046523 Ga0495644_0041046 Ga0495644_0041046_715_1296 193
332 3300046523 Ga0495644_0102606 Ga0495644_0102606_294_875 193
333 3300046525 Ga0495663_0004241 Ga0495663_0004241_1397_1978 193
334 3300046525 Ga0495663_0149044 Ga0495663_0149044_101_682 193
335 3300046528 Ga0495642_0003089 Ga0495642_0003089_4415_4996 193
336 3300046528 Ga0495642_0361699 Ga0495642_0361699_29_610 193
337 3300046537 Ga0495598_0001995 Ga0495598_0001995_21_602 193
338 3300046537 Ga0495598_0068961 Ga0495598_0068961_12_593 193
339 3300046538 Ga0495609_0166831 Ga0495609_0166831_34_615 193
340 3300046539 Ga0495621_0004726 Ga0495621_0004726_1964_2545 193
341 3300046539 Ga0495621_0007098 Ga0495621_0007098_1248_1829 193
342 3300046539 Ga0495621_0020070 Ga0495621_0020070_1228_1809 193
343 3300046539 Ga0495621_0086475 Ga0495621_0086475_331_912 193
344 3300046539 Ga0495621_0106031 Ga0495621_0106031_308_889 193
345 3300046539 Ga0495621_0233646 Ga0495621_0233646_138_719 193
346 3300046542 Ga0495597_0034317 Ga0495597_0034317_101_682 193
347 3300046543 Ga0495645_0027506 Ga0495645_0027506_3390_3971 193
348 3300046543 Ga0495645_0239926 Ga0495645_0239926_173_754 193
349 3300046543 Ga0495645_0357036 Ga0495645_0357036_341_922 193
350 3300046558 Ga0495633_0069430 Ga0495633_0069430_457_1038 193
351 3300046559 Ga0495667_0556509 Ga0495667_0556509_27_608 193
352 3300046615 Ga0495656_0030789 Ga0495656_0030789_1525_2106 193
353 3300046615 Ga0495656_0178054 Ga0495656_0178054_165_746 193
354 3300046615 Ga0495656_0400312 Ga0495656_0400312_35_616 193
355 3300046642 Ga0495634_0071356 Ga0495634_0071356_786_1367 193
356 3300046664 Ga0495659_0007665 Ga0495659_0007665_2740_3321 193
357 3300046664 Ga0495659_0013424 Ga0495659_0013424_487_1068 193
358 3300046664 Ga0495659_0082805 Ga0495659_0082805_299_880 193
359 3300046674 Ga0495588_0023942 Ga0495588_0023942_1825_2406 193
360 3300046681 Ga0495647_0075336 Ga0495647_0075336_568_1149 193
361 3300046681 Ga0495647_0260412 Ga0495647_0260412_137_718 193
362 3300046683 Ga0495658_0326653 Ga0495658_0326653_43_624 193
363 3300046683 Ga0495658_0635898 Ga0495658_0635898_64_645 193
364 3300046684 Ga0495669_0009749 Ga0495669_0009749_2313_2894 193
365 3300046684 Ga0495669_0022821 Ga0495669_0022821_1142_1723 193
366 3300046684 Ga0495669_0187461 Ga0495669_0187461_111_692 193
367 3300046689 Ga0495613_0715320 Ga0495613_0715320_26_607 193
368 3300046691 Ga0495670_0417416 Ga0495670_0417416_60_641 193
369 3300046809 Ga0495600_0126382 Ga0495600_0126382_583_1164 193
370 3300047317 Ga0495604_0078473 Ga0495604_0078473_114_695 193
371 3300047318 Ga0495636_0001627 Ga0495636_0001627_2901_3482 193
372 3300047318 Ga0495636_0112995 Ga0495636_0112995_103_684 193
373 3300047318 Ga0495636_0341503 Ga0495636_0341503_41_622 193
374 3300047319 Ga0495674_0172413 Ga0495674_0172413_21_602 193
375 3300047321 Ga0495676_0018893 Ga0495676_0018893_4813_5394 193
376 3300047444 Ga0495675_0065454 Ga0495675_0065454_1221_1802 193
377 3300047445 Ga0495677_0063241 Ga0495677_0063241_64_645 193
378 3300047447 Ga0495685_044247 Ga0495685_044247_751_1332 193
379 3300047471 Ga0495684_0009393 Ga0495684_0009393_2181_2762 193
380 3300047471 Ga0495684_0443569 Ga0495684_0443569_161_742 193
381 3300048903 Ga0496100_0282305 Ga0496100_0282305_490_1071 193
382 3300048905 Ga0496102_0713563 Ga0496102_0713563_327_908 193
383 3300048906 Ga0496103_0063248 Ga0496103_0063248_834_1415 193
384 3300048907 Ga0496104_0040982 Ga0496104_0040982_2572_3153 193
385 3300048909 Ga0496106_0129635 Ga0496106_0129635_506_1087 193
386 3300048909 Ga0496106_0349430 Ga0496106_0349430_592_1173 193
387 3300048909 Ga0496106_1119193 Ga0496106_1119193_12_593 193
388 3300048910 Ga0496107_0072973 Ga0496107_0072973_163_744 193
389 3300048910 Ga0496107_0271221 Ga0496107_0271221_129_710 193
390 3300048911 Ga0496108_0527558 Ga0496108_0527558_47_628 193
391 3300048911 Ga0496108_0631616 Ga0496108_0631616_58_639 193
392 3300048911 Ga0496108_0799370 Ga0496108_0799370_114_695 193
393 3300048912 Ga0496109_0053560 Ga0496109_0053560_2201_2782 193
394 3300048912 Ga0496109_0062051 Ga0496109_0062051_496_1077 193
395 3300048912 Ga0496109_0866347 Ga0496109_0866347_230_811 193
396 3300048913 Ga0496110_0084753 Ga0496110_0084753_1953_2534 193
397 3300048913 Ga0496110_0650649 Ga0496110_0650649_330_911 193
398 3300048914 Ga0496111_0081391 Ga0496111_0081391_985_1566 193
399 3300048915 Ga0496112_0137714 Ga0496112_0137714_227_808 193
400 3300048915 Ga0496112_0982684 Ga0496112_0982684_89_670 193
401 3300048915 Ga0496112_1203737 Ga0496112_1203737_75_656 193
402 3300048916 Ga0496113_0111798 Ga0496113_0111798_1053_1634 193
403 3300048916 Ga0496113_0553778 Ga0496113_0553778_216_797 193
404 3300048916 Ga0496113_0633572 Ga0496113_0633572_143_724 193
405 3300048917 Ga0496114_0072538 Ga0496114_0072538_888_1469 193
406 3300048917 Ga0496114_0226834 Ga0496114_0226834_129_710 193
407 3300048917 Ga0496114_0365164 Ga0496114_0365164_169_750 193
408 3300048929 Ga0496126_0067738 Ga0496126_0067738_2330_2914 193
409 3300049521 Ga0501298_027622 Ga0501298_027622_176_757 193
410 3300049521 Ga0501298_049930 Ga0501298_049930_65_646 193
411 3300049526 Ga0501303_021570 Ga0501303_021570_28_609 193
412 3300049532 Ga0501316_028003 Ga0501316_028003_94_675 193
413 3300049569 Ga0501032_0342906 Ga0501032_0342906_207_788 193
414 3300049569 Ga0501032_0562471 Ga0501032_0562471_103_684 193
415 3300049570 Ga0501033_0234681 Ga0501033_0234681_49_630 193
416 3300049571 Ga0501034_0038818 Ga0501034_0038818_535_1116 193
417 3300049571 Ga0501034_0367561 Ga0501034_0367561_481_1065 193
418 3300049572 Ga0501036_0073084 Ga0501036_0073084_1170_1751 193
419 3300049572 Ga0501036_0324451 Ga0501036_0324451_78_659 193
420 3300049572 Ga0501036_0750833 Ga0501036_0750833_206_787 193
421 3300049573 Ga0501037_0274000 Ga0501037_0274000_39_620 193
422 3300049574 Ga0501038_0414294 Ga0501038_0414294_203_784 193
423 3300049575 Ga0501039_0055633 Ga0501039_0055633_1430_2011 193
424 3300049576 Ga0501040_0002090 Ga0501040_0002090_7360_7941 193
425 3300049576 Ga0501040_0470727 Ga0501040_0470727_209_790 193
426 3300049577 Ga0501041_0002009 Ga0501041_0002009_10601_11182 193
427 3300049577 Ga0501041_0280821 Ga0501041_0280821_119_700 193
428 3300049578 Ga0501042_0106806 Ga0501042_0106806_290_871 193
429 3300049578 Ga0501042_0216664 Ga0501042_0216664_354_935 193
430 3300049578 Ga0501042_0239841 Ga0501042_0239841_662_1243 193
431 3300049578 Ga0501042_0284572 Ga0501042_0284572_357_938 193
432 3300049578 Ga0501042_0323720 Ga0501042_0323720_20_601 193
433 3300049578 Ga0501042_0578849 Ga0501042_0578849_152_733 193
434 3300049579 Ga0501043_0124054 Ga0501043_0124054_775_1356 193
435 3300049580 Ga0501046_0004536 Ga0501046_0004536_10786_11367 193
436 3300049581 Ga0501047_0015370 Ga0501047_0015370_866_1447 193
437 3300049581 Ga0501047_0480057 Ga0501047_0480057_280_864 193
438 3300049582 Ga0501048_0103712 Ga0501048_0103712_717_1298 193
439 3300049582 Ga0501048_0138219 Ga0501048_0138219_914_1495 193
440 3300049583 Ga0501067_0016437 Ga0501067_0016437_2772_3353 193
441 3300049584 Ga0501068_0331119 Ga0501068_0331119_105_686 193
442 3300049584 Ga0501068_0396588 Ga0501068_0396588_126_707 193
443 3300049586 Ga0501070_0765929 Ga0501070_0765929_24_605 193
444 3300049587 Ga0501071_0005094 Ga0501071_0005094_3352_3933 193
445 3300049587 Ga0501071_0161159 Ga0501071_0161159_366_947 193
446 3300049587 Ga0501071_0400893 Ga0501071_0400893_349_930 193
447 3300049587 Ga0501071_0757813 Ga0501071_0757813_156_737 193
448 3300049588 Ga0501072_0039247 Ga0501072_0039247_1799_2380 193
449 3300049588 Ga0501072_0051204 Ga0501072_0051204_1452_2033 193
450 3300049588 Ga0501072_0247996 Ga0501072_0247996_84_665 193
451 3300049588 Ga0501072_0439180 Ga0501072_0439180_206_787 193
452 3300049588 Ga0501072_0669416 Ga0501072_0669416_162_743 193
453 3300049589 Ga0501073_0111776 Ga0501073_0111776_936_1517 193
454 3300049589 Ga0501073_0149634 Ga0501073_0149634_25_606 193
455 3300049590 Ga0501074_0816332 Ga0501074_0816332_47_628 193
456 3300049591 Ga0501075_0013283 Ga0501075_0013283_5036_5617 193
457 3300049591 Ga0501075_0055518 Ga0501075_0055518_1028_1609 193
458 3300049591 Ga0501075_0056221 Ga0501075_0056221_2291_2872 193
459 3300049591 Ga0501075_0136629 Ga0501075_0136629_148_729 193
460 3300049591 Ga0501075_0547536 Ga0501075_0547536_82_663 193
461 3300049592 Ga0501076_0001670 Ga0501076_0001670_6203_6784 193
462 3300049592 Ga0501076_0041428 Ga0501076_0041428_2782_3363 193
463 3300049592 Ga0501076_0093870 Ga0501076_0093870_1718_2299 193
464 3300049592 Ga0501076_1018005 Ga0501076_1018005_43_624 193
465 3300049593 Ga0501077_0008455 Ga0501077_0008455_5669_6250 193
466 3300049668 Ga0501233_079729 Ga0501233_079729_55_636 193
467 3300049668 Ga0501233_080034 Ga0501233_080034_165_746 193
468 3300049679 Ga0501249_073533 Ga0501249_073533_180_761 193
469 3300049688 Ga0501259_014216 Ga0501259_014216_250_840 193
470 3300049741 Ga0501079_0054958 Ga0501079_0054958_1126_1707 193
471 3300049741 Ga0501079_0077009 Ga0501079_0077009_1488_2069 193
472 3300049741 Ga0501079_0224802 Ga0501079_0224802_228_809 193
473 3300049741 Ga0501079_0320531 Ga0501079_0320531_299_880 193
474 3300049742 Ga0501080_0412359 Ga0501080_0412359_213_794 193
475 3300049742 Ga0501080_0976635 Ga0501080_0976635_11_592 193
476 3300049743 Ga0501081_0009031 Ga0501081_0009031_2093_2674 193
477 3300049743 Ga0501081_0010179 Ga0501081_0010179_5371_5952 193
478 3300049743 Ga0501081_0051309 Ga0501081_0051309_937_1518 193
479 3300049743 Ga0501081_0208700 Ga0501081_0208700_62_643 193
480 3300049743 Ga0501081_0336777 Ga0501081_0336777_249_830 193
481 3300049743 Ga0501081_0442211 Ga0501081_0442211_336_917 193
482 3300049744 Ga0501083_0247847 Ga0501083_0247847_37_618 193
483 3300049744 Ga0501083_0528797 Ga0501083_0528797_38_619 193
484 3300049822 Ga0501035_0795751 Ga0501035_0795751_70_651 193
485 3300049823 Ga0501044_0001681 Ga0501044_0001681_21956_22537 193
486 3300049823 Ga0501044_0003143 Ga0501044_0003143_4136_4720 193
487 3300049824 Ga0501045_0028864 Ga0501045_0028864_3354_3935 193
488 3300049824 Ga0501045_0056682 Ga0501045_0056682_555_1136 193
489 3300049824 Ga0501045_0226446 Ga0501045_0226446_72_653 193
490 3300050490 nmdc:mga03n38_42208_c1 nmdc:mga03n38_42208_c1_37_618 193
491 3300050491 nmdc:mga00v17_112784_c1 nmdc:mga00v17_112784_c1_452_1033 193
492 3300050492 nmdc:mga0yw44_20934_c1 nmdc:mga0yw44_20934_c1_2373_2954 193
493 3300050493 nmdc:mga0k408_18585_c1 nmdc:mga0k408_18585_c1_128_709 193
494 3300050493 nmdc:mga0k408_6891_c1 nmdc:mga0k408_6891_c1_2248_2829 193
495 3300050493 nmdc:mga0k408_70698_c1 nmdc:mga0k408_70698_c1_1210_1791 193
496 3300050493 nmdc:mga0k408_92813_c1 nmdc:mga0k408_92813_c1_1154_1735 193
497 3300050494 nmdc:mga06z11_103521_c1 nmdc:mga06z11_103521_c1_702_1283 193
498 3300050494 nmdc:mga06z11_310769_c1 nmdc:mga06z11_310769_c1_83_664 193
499 3300050495 nmdc:mga04h51_34549_c1 nmdc:mga04h51_34549_c1_484_1065 193
500 3300050496 nmdc:mga07m45_26772_c1 nmdc:mga07m45_26772_c1_2030_2611 193
501 3300050496 nmdc:mga07m45_463639_c1 nmdc:mga07m45_463639_c1_88_669 193
502 3300050507 nmdc:mga05p37_104828_c1 nmdc:mga05p37_104828_c1_2104_2685 193
503 3300050507 nmdc:mga05p37_170628_c1 nmdc:mga05p37_170628_c1_179_760 193
504 3300050507 nmdc:mga05p37_19432_c1 nmdc:mga05p37_19432_c1_7002_7583 193
505 3300050507 nmdc:mga05p37_20610_c1 nmdc:mga05p37_20610_c1_2940_3521 193
506 3300050507 nmdc:mga05p37_27370_c1 nmdc:mga05p37_27370_c1_5124_5705 193
507 3300050507 nmdc:mga05p37_30012_c1 nmdc:mga05p37_30012_c1_1376_1957 193
508 3300050507 nmdc:mga05p37_408256_c1 nmdc:mga05p37_408256_c1_137_718 193
509 3300050507 nmdc:mga05p37_468649_c1 nmdc:mga05p37_468649_c1_118_699 193
510 3300050507 nmdc:mga05p37_469357_c1 nmdc:mga05p37_469357_c1_158_739 193
511 3300050507 nmdc:mga05p37_6378_c1 nmdc:mga05p37_6378_c1_10130_10711 193
512 3300050507 nmdc:mga05p37_6561_c1 nmdc:mga05p37_6561_c1_7138_7719 193
513 3300050507 nmdc:mga05p37_65_c1 nmdc:mga05p37_65_c1_31652_32233 193
514 3300050507 nmdc:mga05p37_724726_c1 nmdc:mga05p37_724726_c1_45_626 193
515 3300050507 nmdc:mga05p37_91904_c1 nmdc:mga05p37_91904_c1_2934_3515 193
516 3300050507 nmdc:mga05p37_919291_c1 nmdc:mga05p37_919291_c1_287_868 193
517 3300050508 nmdc:mga09592_128760_c1 nmdc:mga09592_128760_c1_638_1219 193
518 3300050508 nmdc:mga09592_131902_c1 nmdc:mga09592_131902_c1_1345_1926 193
519 3300050508 nmdc:mga09592_178808_c1 nmdc:mga09592_178808_c1_647_1228 193
520 3300050508 nmdc:mga09592_180122_c1 nmdc:mga09592_180122_c1_1215_1796 193
521 3300050508 nmdc:mga09592_370814_c1 nmdc:mga09592_370814_c1_551_1132 193
522 3300050508 nmdc:mga09592_424740_c1 nmdc:mga09592_424740_c1_463_1044 193
523 3300050508 nmdc:mga09592_5356_c1 nmdc:mga09592_5356_c1_6440_7021 193
524 3300050508 nmdc:mga09592_575367_c1 nmdc:mga09592_575367_c1_349_930 193
525 3300050508 nmdc:mga09592_594123_c1 nmdc:mga09592_594123_c1_252_833 193
526 3300050508 nmdc:mga09592_665321_c1 nmdc:mga09592_665321_c1_45_626 193
527 3300050508 nmdc:mga09592_696053_c1 nmdc:mga09592_696053_c1_128_709 193
528 3300050508 nmdc:mga09592_770657_c1 nmdc:mga09592_770657_c1_86_667 193
529 3300050508 nmdc:mga09592_82332_c1 nmdc:mga09592_82332_c1_1420_2001 193
530 3300050509 nmdc:mga0qj67_133757_c1 nmdc:mga0qj67_133757_c1_138_719 193
531 3300050509 nmdc:mga0qj67_179857_c1 nmdc:mga0qj67_179857_c1_829_1410 193
532 3300050509 nmdc:mga0qj67_355290_c1 nmdc:mga0qj67_355290_c1_48_629 193
533 3300050509 nmdc:mga0qj67_4157_c1 nmdc:mga0qj67_4157_c1_8372_8953 193
534 3300050509 nmdc:mga0qj67_45792_c1 nmdc:mga0qj67_45792_c1_1417_1998 193
535 3300050509 nmdc:mga0qj67_49756_c1 nmdc:mga0qj67_49756_c1_915_1496 193
536 3300050509 nmdc:mga0qj67_68069_c1 nmdc:mga0qj67_68069_c1_2064_2645 193
537 3300050509 nmdc:mga0qj67_757375_c1 nmdc:mga0qj67_757375_c1_24_605 193
538 3300050510 nmdc:mga06r32_1034221_c1 nmdc:mga06r32_1034221_c1_68_649 193
539 3300050510 nmdc:mga06r32_117458_c1 nmdc:mga06r32_117458_c1_1297_1878 193
540 3300050510 nmdc:mga06r32_119149_c1 nmdc:mga06r32_119149_c1_702_1283 193
541 3300050510 nmdc:mga06r32_208123_c1 nmdc:mga06r32_208123_c1_624_1205 193
542 3300050510 nmdc:mga06r32_6769_c1 nmdc:mga06r32_6769_c1_5549_6130 193
543 3300050511 nmdc:mga08y16_10_c1 nmdc:mga08y16_10_c1_440538_441119 193
544 3300050511 nmdc:mga08y16_166791_c1 nmdc:mga08y16_166791_c1_557_1138 193
545 3300050511 nmdc:mga08y16_17177_c1 nmdc:mga08y16_17177_c1_3858_4439 193
546 3300050511 nmdc:mga08y16_238369_c1 nmdc:mga08y16_238369_c1_858_1439 193
547 3300050511 nmdc:mga08y16_384291_c1 nmdc:mga08y16_384291_c1_823_1404 193
548 3300050511 nmdc:mga08y16_43115_c1 nmdc:mga08y16_43115_c1_1766_2347 193
549 3300050511 nmdc:mga08y16_43521_c1 nmdc:mga08y16_43521_c1_2857_3438 193
550 3300050511 nmdc:mga08y16_63396_c1 nmdc:mga08y16_63396_c1_779_1360 193
551 3300050511 nmdc:mga08y16_708709_c1 nmdc:mga08y16_708709_c1_317_898 193
552 3300050511 nmdc:mga08y16_78791_c1 nmdc:mga08y16_78791_c1_209_790 193
553 3300050511 nmdc:mga08y16_920_c1 nmdc:mga08y16_920_c1_21115_21696 193
554 3300050512 nmdc:mga0n895_127566_c1 nmdc:mga0n895_127566_c1_1715_2296 193
555 3300050512 nmdc:mga0n895_12870_c1 nmdc:mga0n895_12870_c1_2824_3405 193
556 3300050512 nmdc:mga0n895_15743_c1 nmdc:mga0n895_15743_c1_1932_2513 193
557 3300050512 nmdc:mga0n895_229466_c1 nmdc:mga0n895_229466_c1_106_687 193
558 3300050512 nmdc:mga0n895_317796_c1 nmdc:mga0n895_317796_c1_413_994 193
559 3300050512 nmdc:mga0n895_45851_c1 nmdc:mga0n895_45851_c1_1816_2397 193
560 3300050512 nmdc:mga0n895_721280_c1 nmdc:mga0n895_721280_c1_342_923 193
561 3300050512 nmdc:mga0n895_775990_c1 nmdc:mga0n895_775990_c1_98_679 193
562 3300050513 nmdc:mga0rr50_152578_c1 nmdc:mga0rr50_152578_c1_1114_1695 193
563 3300050513 nmdc:mga0rr50_28992_c1 nmdc:mga0rr50_28992_c1_2080_2661 193
564 3300050513 nmdc:mga0rr50_3252_c1 nmdc:mga0rr50_3252_c1_4093_4674 193
565 3300050513 nmdc:mga0rr50_330211_c1 nmdc:mga0rr50_330211_c1_250_831 193
566 3300050513 nmdc:mga0rr50_48987_c1 nmdc:mga0rr50_48987_c1_1739_2320 193
567 3300050513 nmdc:mga0rr50_90946_c1 nmdc:mga0rr50_90946_c1_948_1529 193
568 3300050514 nmdc:mga08x19_134734_c1 nmdc:mga08x19_134734_c1_957_1538 193
569 3300050514 nmdc:mga08x19_15605_c1 nmdc:mga08x19_15605_c1_3205_3786 193
570 3300050514 nmdc:mga08x19_889026_c1 nmdc:mga08x19_889026_c1_30_611 193
571 3300050515 nmdc:mga0a205_124005_c1 nmdc:mga0a205_124005_c1_907_1488 193
572 3300050515 nmdc:mga0a205_176822_c1 nmdc:mga0a205_176822_c1_1258_1839 193
573 3300050515 nmdc:mga0a205_203915_c1 nmdc:mga0a205_203915_c1_824_1405 193
574 3300050515 nmdc:mga0a205_51898_c1 nmdc:mga0a205_51898_c1_3221_3802 193
575 3300050515 nmdc:mga0a205_613319_c1 nmdc:mga0a205_613319_c1_36_617 193
576 3300050515 nmdc:mga0a205_701695_c1 nmdc:mga0a205_701695_c1_101_682 193
577 3300050515 nmdc:mga0a205_70179_c1 nmdc:mga0a205_70179_c1_315_896 193
578 3300050515 nmdc:mga0a205_7364_c1 nmdc:mga0a205_7364_c1_8459_9040 193
579 3300050515 nmdc:mga0a205_79422_c1 nmdc:mga0a205_79422_c1_1590_2171 193
580 3300053077 Ga0495601_0093044 Ga0495601_0093044_1333_1914 193
581 3300053077 Ga0495601_0201115 Ga0495601_0201115_44_625 193
582 3300053084 Ga0495595_0161085 Ga0495595_0161085_484_1065 193
583 3300053084 Ga0495595_0362611 Ga0495595_0362611_37_618 193
584 3300053084 Ga0495595_0490309 Ga0495595_0490309_10_591 193
585 3300053085 Ga0495619_0004075 Ga0495619_0004075_4340_4921 193
586 3300053085 Ga0495619_0054403 Ga0495619_0054403_46_627 193
587 3300053085 Ga0495619_0274917 Ga0495619_0274917_62_643 193
588 3300053096 Ga0500641_0022361 Ga0500641_0022361_294_875 193
589 3300053129 Ga0500628_047896 Ga0500628_047896_233_814 193
590 3300053139 Ga0500568_0010726 Ga0500568_0010726_1695_2276 193
591 3300053727 Ga0500611_003831 Ga0500611_003831_594_1175 193
592 3300054114 Ga0501084_0083335 Ga0501084_0083335_672_1253 193
593 3300054114 Ga0501084_0177766 Ga0501084_0177766_1172_1753 193
594 3300054114 Ga0501084_0215221 Ga0501084_0215221_1015_1596 193
595 3300054114 Ga0501084_0862015 Ga0501084_0862015_79_660 193
596 3300059423 Ga0590074_016136 Ga0590074_016136_197_778 193
597 3300059424 Ga0590075_001384 Ga0590075_001384_3671_4252 193
598 3300060353 Ga0501082_0000274 Ga0501082_0000274_21293_21874 193
599 3300060353 Ga0501082_0535685 Ga0501082_0535685_136_717 193
600 3300060353 Ga0501082_0554118 Ga0501082_0554118_283_864 193
601 3300060353 Ga0501082_0653253 Ga0501082_0653253_268_849 193
602 3300060353 Ga0501082_1063678 Ga0501082_1063678_33_614 193
603 3300061734 Ga0530510_0030675 Ga0530510_0030675_2118_2699 193
604 3300061734 Ga0530510_0035622 Ga0530510_0035622_1892_2473 193
605 3300061734 Ga0530510_0099637 Ga0530510_0099637_278_859 193
606 3300061734 Ga0530510_0102735 Ga0530510_0102735_642_1223 193
607 3300005615 Ga0070702_100306617 Ga0070702_1003066172 195
608 3300042436 Ga0439435_0040302 Ga0439435_0040302_204_830 197
609 3300049769 Ga0501272_017119 Ga0501272_017119_83_709 197
610 3300009094 Ga0111539_10199637 Ga0111539_101996373 199
611 3300014326 Ga0157380_10084876 Ga0157380_100848762 199
612 3300036401 Ga0373937_1034304 Ga0373937_1034304_71_670 199
613 3300041458 Ga0451798_0436680 Ga0451798_0436680_169_768 199
614 3300046678 Ga0495599_0596938 Ga0495599_0596938_24_623 199
615 3300049568 Ga0501031_0188713 Ga0501031_0188713_127_726 199
616 3300050507 nmdc:mga05p37_595_c1 nmdc:mga05p37_595_c1_13955_14554 199
617 3300050511 nmdc:mga08y16_180782_c1 nmdc:mga08y16_180782_c1_1497_2096 199
618 3300050511 nmdc:mga08y16_202_c1 nmdc:mga08y16_202_c1_8222_8821 199
619 3300005406 Ga0070703_10074949 Ga0070703_100749492 200
620 3300005354 Ga0070675_100207366 Ga0070675_1002073662 201
621 3300005844 Ga0068862_100268844 Ga0068862_1002688441 201
622 3300025926 Ga0207659_10169350 Ga0207659_101693502 201
623 3300037471 Ga0395905_0326438 Ga0395905_0326438_166_810 201
624 3300042134 Ga0450898_030392 Ga0450898_030392_60_683 201
625 3300005543 Ga0070672_100261487 Ga0070672_1002614872 202
626 3300009147 Ga0114129_11101258 Ga0114129_111012581 202
627 3300025940 Ga0207691_10138228 Ga0207691_101382284 202
628 3300027682 Ga0209971_1008969 Ga0209971_10089693 202
629 3300031852 Ga0307410_10263209 Ga0307410_102632092 202
630 3300042439 Ga0439464_0058200 Ga0439464_0058200_130_759 202
631 3300042461 Ga0439460_0021774 Ga0439460_0021774_176_805 202
632 3300050511 nmdc:mga08y16_735923_c1 nmdc:mga08y16_735923_c1_151_759 202
633 3300053093 Ga0500651_0212001 Ga0500651_0212001_356_964 202
634 3300005340 Ga0070689_100043206 Ga0070689_1000432065 203
635 3300005353 Ga0070669_100121031 Ga0070669_1001210311 203
636 3300005364 Ga0070673_100375328 Ga0070673_1003753281 203
637 3300005365 Ga0070688_100197090 Ga0070688_1001970902 203
638 3300005435 Ga0070714_100026258 Ga0070714_1000262586 203
639 3300005439 Ga0070711_100546165 Ga0070711_1005461652 203
640 3300005444 Ga0070694_100456582 Ga0070694_1004565821 203
641 3300005543 Ga0070672_100403004 Ga0070672_1004030042 203
642 3300005618 Ga0068864_100369220 Ga0068864_1003692201 203
643 3300005843 Ga0068860_100277898 Ga0068860_1002778982 203
644 3300025907 Ga0207645_10106234 Ga0207645_101062342 203
645 3300025936 Ga0207670_10193955 Ga0207670_101939552 203
646 3300025940 Ga0207691_10124579 Ga0207691_101245793 203
647 3300025972 Ga0207668_10491701 Ga0207668_104917012 203
648 3300026095 Ga0207676_10516642 Ga0207676_105166422 203
649 3300013296 Ga0157374_10735547 Ga0157374_107355472 204
650 3300059640 Ga0587067_052275 Ga0587067_052275_113_736 205
651 iso_pu_bacteria 2891633521 2891635720 205
652 iso_pu_bacteria 639633007 639788554 205
653 3300054114 Ga0501084_0047521 Ga0501084_0047521_2921_3541 206
654 3300005290 Ga0065712_10069045 Ga0065712_1006904510 207
655 3300005293 Ga0065715_10103421 Ga0065715_101034212 207
656 3300005331 Ga0070670_100011113 Ga0070670_1000111133 207
657 3300005334 Ga0068869_100201192 Ga0068869_1002011922 207
658 3300005340 Ga0070689_100192605 Ga0070689_1001926052 207
659 3300005343 Ga0070687_100200064 Ga0070687_1002000642 207
660 3300005353 Ga0070669_100180131 Ga0070669_1001801312 207
661 3300005354 Ga0070675_100094104 Ga0070675_1000941041 207
662 3300005365 Ga0070688_100038134 Ga0070688_1000381345 207
663 3300005456 Ga0070678_100134712 Ga0070678_1001347122 207
664 3300005456 Ga0070678_100136357 Ga0070678_1001363573 207
665 3300005457 Ga0070662_100328584 Ga0070662_1003285842 207
666 3300005459 Ga0068867_100074110 Ga0068867_1000741101 207
667 3300005466 Ga0070685_10014991 Ga0070685_100149911 207
668 3300005539 Ga0068853_100656523 Ga0068853_1006565232 207
669 3300005544 Ga0070686_100044083 Ga0070686_1000440833 207
670 3300005618 Ga0068864_100002899 Ga0068864_10000289918 207
671 3300017792 Ga0163161_10464529 Ga0163161_104645292 207
672 3300025933 Ga0207706_10428845 Ga0207706_104288452 207
673 3300005471 Ga0070698_100450474 Ga0070698_1004504742 208
674 3300006846 Ga0075430_100215400 Ga0075430_1002154002 208
675 3300006846 Ga0075430_100387857 Ga0075430_1003878571 208
676 3300006847 Ga0075431_100228448 Ga0075431_1002284482 208
677 3300006847 Ga0075431_100449986 Ga0075431_1004499862 208
678 3300025917 Ga0207660_10231860 Ga0207660_102318602 208
679 3300026075 Ga0207708_10118060 Ga0207708_101180602 208
680 3300026075 Ga0207708_10363396 Ga0207708_103633961 208
681 3300026089 Ga0207648_10431657 Ga0207648_104316572 208
682 3300027907 Ga0207428_10004189 Ga0207428_100041892 208
683 3300031548 Ga0307408_100337512 Ga0307408_1003375122 208
684 3300031824 Ga0307413_10423355 Ga0307413_104233552 208
685 3300031852 Ga0307410_10053098 Ga0307410_100530985 208
686 3300031901 Ga0307406_10848375 Ga0307406_108483751 208
687 3300031903 Ga0307407_10269117 Ga0307407_102691172 208
688 3300031995 Ga0307409_100013659 Ga0307409_1000136592 208
689 3300031995 Ga0307409_100066518 Ga0307409_1000665182 208
690 3300031995 Ga0307409_100457587 Ga0307409_1004575872 208
691 3300032002 Ga0307416_100037206 Ga0307416_1000372062 208
692 3300032002 Ga0307416_100207558 Ga0307416_1002075584 208
693 3300032002 Ga0307416_100586557 Ga0307416_1005865571 208
694 3300032005 Ga0307411_10019886 Ga0307411_100198863 208
695 3300032005 Ga0307411_10210949 Ga0307411_102109492 208
696 3300032126 Ga0307415_100118165 Ga0307415_1001181654 208
697 3300042437 Ga0439444_0063346 Ga0439444_0063346_116_742 208
698 3300049572 Ga0501036_0120060 Ga0501036_0120060_1088_1714 208
699 3300049575 Ga0501039_0071954 Ga0501039_0071954_1011_1637 208
700 3300049580 Ga0501046_0481618 Ga0501046_0481618_203_829 208
701 3300049582 Ga0501048_0021930 Ga0501048_0021930_2982_3608 208
702 3300049587 Ga0501071_0019590 Ga0501071_0019590_1087_1713 208
703 3300049592 Ga0501076_0120931 Ga0501076_0120931_707_1333 208
704 3300049742 Ga0501080_0154939 Ga0501080_0154939_1053_1679 208
705 3300050507 nmdc:mga05p37_15912_c1 nmdc:mga05p37_15912_c1_1624_2250 208
706 3300050509 nmdc:mga0qj67_25915_c1 nmdc:mga0qj67_25915_c1_3712_4338 208
707 3300050510 nmdc:mga06r32_181680_c1 nmdc:mga06r32_181680_c1_57_683 208
708 3300050510 nmdc:mga06r32_464009_c1 nmdc:mga06r32_464009_c1_113_739 208
709 3300054114 Ga0501084_0039487 Ga0501084_0039487_1466_2092 208
710 3300059424 Ga0590075_078370 Ga0590075_078370_15_641 208
711 3300060353 Ga0501082_0134537 Ga0501082_0134537_1457_2083 208
712 3300001977 JGI24746J21847_1000639 JGI24746J21847_10006397 209
713 3300002126 JGI24035J26624_1001305 JGI24035J26624_10013053 209
714 3300003203 JGI25406J46586_10003545 JGI25406J46586_100035454 209
715 3300003203 JGI25406J46586_10008229 JGI25406J46586_100082292 209
716 3300004798 Ga0058859_10004552 Ga0058859_100045521 209
717 3300005288 Ga0065714_10171541 Ga0065714_101715412 209
718 3300005290 Ga0065712_10011165 Ga0065712_100111653 209
719 3300005290 Ga0065712_10015802 Ga0065712_100158022 209
720 3300005290 Ga0065712_10036809 Ga0065712_100368091 209
721 3300005290 Ga0065712_10185042 Ga0065712_101850422 209
722 3300005290 Ga0065712_10225534 Ga0065712_102255342 209
723 3300005290 Ga0065712_10337364 Ga0065712_103373641 209
724 3300005293 Ga0065715_10001224 Ga0065715_1000122420 209
725 3300005293 Ga0065715_10003819 Ga0065715_100038194 209
726 3300005293 Ga0065715_10011927 Ga0065715_100119273 209
727 3300005293 Ga0065715_10017614 Ga0065715_100176142 209
728 3300005293 Ga0065715_10055928 Ga0065715_100559281 209
729 3300005293 Ga0065715_10094515 Ga0065715_100945153 209
730 3300005293 Ga0065715_10203097 Ga0065715_102030972 209
731 3300005293 Ga0065715_10395076 Ga0065715_103950761 209
732 3300005293 Ga0065715_10400275 Ga0065715_104002751 209
733 3300005293 Ga0065715_10514309 Ga0065715_105143091 209
734 3300005295 Ga0065707_10007282 Ga0065707_100072825 209
735 3300005295 Ga0065707_10012989 Ga0065707_100129892 209
736 3300005295 Ga0065707_10023963 Ga0065707_100239633 209
737 3300005295 Ga0065707_10158407 Ga0065707_101584072 209
738 3300005327 Ga0070658_10174740 Ga0070658_101747403 209
739 3300005328 Ga0070676_10004724 Ga0070676_100047245 209
740 3300005328 Ga0070676_10044770 Ga0070676_100447703 209
741 3300005328 Ga0070676_10156745 Ga0070676_101567451 209
742 3300005328 Ga0070676_10272881 Ga0070676_102728812 209
743 3300005328 Ga0070676_10366108 Ga0070676_103661081 209
744 3300005329 Ga0070683_100000726 Ga0070683_10000072635 209
745 3300005329 Ga0070683_100277717 Ga0070683_1002777171 209
746 3300005329 Ga0070683_100292040 Ga0070683_1002920401 209
747 3300005329 Ga0070683_100377985 Ga0070683_1003779851 209
748 3300005330 Ga0070690_100006534 Ga0070690_1000065347 209
749 3300005330 Ga0070690_100092383 Ga0070690_1000923832 209
750 3300005330 Ga0070690_100230176 Ga0070690_1002301762 209
751 3300005331 Ga0070670_100025433 Ga0070670_1000254335 209
752 3300005331 Ga0070670_100025576 Ga0070670_1000255764 209
753 3300005331 Ga0070670_100035706 Ga0070670_1000357061 209
754 3300005331 Ga0070670_100067940 Ga0070670_1000679405 209
755 3300005331 Ga0070670_100076304 Ga0070670_1000763041 209
756 3300005331 Ga0070670_100084227 Ga0070670_1000842271 209
757 3300005331 Ga0070670_100140343 Ga0070670_1001403433 209
758 3300005331 Ga0070670_100190313 Ga0070670_1001903134 209
759 3300005331 Ga0070670_100314274 Ga0070670_1003142742 209
760 3300005333 Ga0070677_10054052 Ga0070677_100540521 209
761 3300005333 Ga0070677_10083007 Ga0070677_100830072 209
762 3300005333 Ga0070677_10135147 Ga0070677_101351472 209
763 3300005333 Ga0070677_10147118 Ga0070677_101471181 209
764 3300005333 Ga0070677_10267549 Ga0070677_102675491 209
765 3300005334 Ga0068869_100010773 Ga0068869_1000107737 209
766 3300005334 Ga0068869_100038988 Ga0068869_1000389883 209
767 3300005334 Ga0068869_100128068 Ga0068869_1001280683 209
768 3300005334 Ga0068869_100170298 Ga0068869_1001702982 209
769 3300005334 Ga0068869_100212927 Ga0068869_1002129272 209
770 3300005334 Ga0068869_100297858 Ga0068869_1002978581 209
771 3300005334 Ga0068869_100386168 Ga0068869_1003861682 209
772 3300005335 Ga0070666_10007809 Ga0070666_100078094 209
773 3300005335 Ga0070666_10142476 Ga0070666_101424762 209
774 3300005335 Ga0070666_10165266 Ga0070666_101652661 209
775 3300005335 Ga0070666_10190047 Ga0070666_101900471 209
776 3300005335 Ga0070666_10405354 Ga0070666_104053542 209
777 3300005335 Ga0070666_10494092 Ga0070666_104940921 209
778 3300005335 Ga0070666_10508730 Ga0070666_105087301 209
779 3300005336 Ga0070680_100071498 Ga0070680_1000714982 209
780 3300005337 Ga0070682_100323023 Ga0070682_1003230231 209
781 3300005338 Ga0068868_100012961 Ga0068868_1000129613 209
782 3300005338 Ga0068868_100113481 Ga0068868_1001134812 209
783 3300005338 Ga0068868_100123421 Ga0068868_1001234211 209
784 3300005339 Ga0070660_100002987 Ga0070660_1000029872 209
785 3300005339 Ga0070660_100074646 Ga0070660_1000746462 209
786 3300005339 Ga0070660_100701133 Ga0070660_1007011332 209
787 3300005340 Ga0070689_100031044 Ga0070689_1000310442 209
788 3300005340 Ga0070689_100116273 Ga0070689_1001162731 209
789 3300005340 Ga0070689_100234039 Ga0070689_1002340392 209
790 3300005340 Ga0070689_100356182 Ga0070689_1003561822 209
791 3300005340 Ga0070689_100494849 Ga0070689_1004948492 209
792 3300005340 Ga0070689_100709649 Ga0070689_1007096491 209
793 3300005341 Ga0070691_10061523 Ga0070691_100615232 209
794 3300005341 Ga0070691_10218723 Ga0070691_102187232 209
795 3300005343 Ga0070687_100004424 Ga0070687_1000044248 209
796 3300005343 Ga0070687_100010658 Ga0070687_1000106582 209
797 3300005343 Ga0070687_100110693 Ga0070687_1001106932 209
798 3300005343 Ga0070687_100244436 Ga0070687_1002444362 209
799 3300005344 Ga0070661_100245958 Ga0070661_1002459582 209
800 3300005344 Ga0070661_100295058 Ga0070661_1002950582 209
801 3300005344 Ga0070661_100394000 Ga0070661_1003940002 209
802 3300005344 Ga0070661_100447326 Ga0070661_1004473261 209
803 3300005344 Ga0070661_100552483 Ga0070661_1005524831 209
804 3300005345 Ga0070692_10039187 Ga0070692_100391872 209
805 3300005345 Ga0070692_10067419 Ga0070692_100674192 209
806 3300005347 Ga0070668_100095078 Ga0070668_1000950783 209
807 3300005347 Ga0070668_100096147 Ga0070668_1000961472 209
808 3300005347 Ga0070668_100128512 Ga0070668_1001285122 209
809 3300005347 Ga0070668_100220321 Ga0070668_1002203211 209
810 3300005347 Ga0070668_100701741 Ga0070668_1007017411 209
811 3300005353 Ga0070669_100003127 Ga0070669_1000031278 209
812 3300005353 Ga0070669_100029266 Ga0070669_1000292664 209
813 3300005353 Ga0070669_100052934 Ga0070669_1000529345 209
814 3300005353 Ga0070669_100064611 Ga0070669_1000646111 209
815 3300005353 Ga0070669_100076752 Ga0070669_1000767523 209
816 3300005353 Ga0070669_100096240 Ga0070669_1000962402 209
817 3300005353 Ga0070669_100192156 Ga0070669_1001921563 209
818 3300005353 Ga0070669_100206332 Ga0070669_1002063322 209
819 3300005353 Ga0070669_100246009 Ga0070669_1002460092 209
820 3300005353 Ga0070669_100543890 Ga0070669_1005438901 209
821 3300005353 Ga0070669_100718309 Ga0070669_1007183091 209
822 3300005354 Ga0070675_100000056 Ga0070675_10000005637 209
823 3300005354 Ga0070675_100002788 Ga0070675_10000278815 209
824 3300005354 Ga0070675_100015228 Ga0070675_1000152285 209
825 3300005354 Ga0070675_100027751 Ga0070675_1000277516 209
826 3300005354 Ga0070675_100071371 Ga0070675_1000713713 209
827 3300005354 Ga0070675_100092044 Ga0070675_1000920442 209
828 3300005354 Ga0070675_100125358 Ga0070675_1001253581 209
829 3300005354 Ga0070675_100144537 Ga0070675_1001445371 209
830 3300005354 Ga0070675_100202354 Ga0070675_1002023542 209
831 3300005354 Ga0070675_100368125 Ga0070675_1003681252 209
832 3300005354 Ga0070675_100406486 Ga0070675_1004064862 209
833 3300005354 Ga0070675_100457381 Ga0070675_1004573811 209
834 3300005354 Ga0070675_100602991 Ga0070675_1006029911 209
835 3300005354 Ga0070675_100663338 Ga0070675_1006633381 209
836 3300005354 Ga0070675_100668674 Ga0070675_1006686742 209
837 3300005355 Ga0070671_100003190 Ga0070671_1000031905 209
838 3300005355 Ga0070671_100009894 Ga0070671_1000098944 209
839 3300005355 Ga0070671_100012725 Ga0070671_1000127255 209
840 3300005355 Ga0070671_100031409 Ga0070671_1000314093 209
841 3300005355 Ga0070671_100105657 Ga0070671_1001056572 209
842 3300005355 Ga0070671_100119794 Ga0070671_1001197942 209
843 3300005355 Ga0070671_100760180 Ga0070671_1007601801 209
844 3300005356 Ga0070674_100006238 Ga0070674_1000062383 209
845 3300005356 Ga0070674_100008546 Ga0070674_1000085463 209
846 3300005356 Ga0070674_100013521 Ga0070674_1000135217 209
847 3300005356 Ga0070674_100060115 Ga0070674_1000601153 209
848 3300005356 Ga0070674_100063122 Ga0070674_1000631223 209
849 3300005356 Ga0070674_100066289 Ga0070674_1000662893 209
850 3300005356 Ga0070674_100072180 Ga0070674_1000721802 209
851 3300005356 Ga0070674_100072936 Ga0070674_1000729363 209
852 3300005356 Ga0070674_100117381 Ga0070674_1001173812 209
853 3300005356 Ga0070674_100127256 Ga0070674_1001272562 209
854 3300005356 Ga0070674_100199969 Ga0070674_1001999691 209
855 3300005356 Ga0070674_100373049 Ga0070674_1003730491 209
856 3300005364 Ga0070673_100001910 Ga0070673_1000019105 209
857 3300005364 Ga0070673_100012871 Ga0070673_1000128714 209
858 3300005364 Ga0070673_100050128 Ga0070673_1000501282 209
859 3300005364 Ga0070673_100055781 Ga0070673_1000557813 209
860 3300005364 Ga0070673_100226782 Ga0070673_1002267822 209
861 3300005364 Ga0070673_100232822 Ga0070673_1002328221 209
862 3300005364 Ga0070673_100468291 Ga0070673_1004682912 209
863 3300005364 Ga0070673_100476829 Ga0070673_1004768291 209
864 3300005364 Ga0070673_100547902 Ga0070673_1005479022 209
865 3300005364 Ga0070673_100562944 Ga0070673_1005629441 209
866 3300005364 Ga0070673_100716701 Ga0070673_1007167012 209
867 3300005365 Ga0070688_100115702 Ga0070688_1001157022 209
868 3300005365 Ga0070688_100160396 Ga0070688_1001603963 209
869 3300005365 Ga0070688_100245039 Ga0070688_1002450392 209
870 3300005365 Ga0070688_100389084 Ga0070688_1003890842 209
871 3300005365 Ga0070688_100442082 Ga0070688_1004420822 209
872 3300005365 Ga0070688_100472212 Ga0070688_1004722121 209
873 3300005366 Ga0070659_100346562 Ga0070659_1003465621 209
874 3300005367 Ga0070667_100147919 Ga0070667_1001479194 209
875 3300005367 Ga0070667_100365424 Ga0070667_1003654242 209
876 3300005367 Ga0070667_100446998 Ga0070667_1004469982 209
877 3300005367 Ga0070667_100465254 Ga0070667_1004652542 209
878 3300005434 Ga0070709_10201070 Ga0070709_102010702 209
879 3300005436 Ga0070713_100365142 Ga0070713_1003651421 209
880 3300005438 Ga0070701_10015865 Ga0070701_100158654 209
881 3300005438 Ga0070701_10017325 Ga0070701_100173256 209
882 3300005438 Ga0070701_10048517 Ga0070701_100485173 209
883 3300005438 Ga0070701_10065568 Ga0070701_100655684 209
884 3300005439 Ga0070711_100170188 Ga0070711_1001701881 209
885 3300005439 Ga0070711_100558218 Ga0070711_1005582181 209
886 3300005440 Ga0070705_100060997 Ga0070705_1000609972 209
887 3300005440 Ga0070705_100075401 Ga0070705_1000754012 209
888 3300005440 Ga0070705_100140953 Ga0070705_1001409532 209
889 3300005440 Ga0070705_100216068 Ga0070705_1002160682 209
890 3300005441 Ga0070700_100017173 Ga0070700_1000171733 209
891 3300005441 Ga0070700_100114296 Ga0070700_1001142961 209
892 3300005441 Ga0070700_100189366 Ga0070700_1001893662 209
893 3300005441 Ga0070700_100202100 Ga0070700_1002021002 209
894 3300005441 Ga0070700_100366805 Ga0070700_1003668052 209
895 3300005444 Ga0070694_100010997 Ga0070694_1000109974 209
896 3300005444 Ga0070694_100020922 Ga0070694_1000209224 209
897 3300005444 Ga0070694_100051301 Ga0070694_1000513013 209
898 3300005444 Ga0070694_100159147 Ga0070694_1001591471 209
899 3300005444 Ga0070694_100615797 Ga0070694_1006157971 209
900 3300005455 Ga0070663_100037668 Ga0070663_1000376683 209
901 3300005455 Ga0070663_100254556 Ga0070663_1002545562 209
902 3300005455 Ga0070663_100299048 Ga0070663_1002990482 209
903 3300005455 Ga0070663_100600364 Ga0070663_1006003641 209
904 3300005455 Ga0070663_100602805 Ga0070663_1006028051 209
905 3300005456 Ga0070678_100063335 Ga0070678_1000633355 209
906 3300005456 Ga0070678_100078037 Ga0070678_1000780375 209
907 3300005456 Ga0070678_100171245 Ga0070678_1001712452 209
908 3300005456 Ga0070678_100223688 Ga0070678_1002236883 209
909 3300005456 Ga0070678_100234216 Ga0070678_1002342161 209
910 3300005456 Ga0070678_100451130 Ga0070678_1004511302 209
911 3300005456 Ga0070678_100672169 Ga0070678_1006721691 209
912 3300005457 Ga0070662_100013312 Ga0070662_1000133122 209
913 3300005457 Ga0070662_100071558 Ga0070662_1000715582 209
914 3300005457 Ga0070662_100431507 Ga0070662_1004315072 209
915 3300005458 Ga0070681_10006387 Ga0070681_100063874 209
916 3300005458 Ga0070681_10170455 Ga0070681_101704553 209
917 3300005458 Ga0070681_10766058 Ga0070681_107660581 209
918 3300005459 Ga0068867_100007649 Ga0068867_1000076495 209
919 3300005459 Ga0068867_100053804 Ga0068867_1000538042 209
920 3300005459 Ga0068867_100061925 Ga0068867_1000619254 209
921 3300005459 Ga0068867_100159183 Ga0068867_1001591832 209
922 3300005459 Ga0068867_100166193 Ga0068867_1001661933 209
923 3300005459 Ga0068867_100248822 Ga0068867_1002488222 209
924 3300005459 Ga0068867_100275139 Ga0068867_1002751393 209
925 3300005459 Ga0068867_100450157 Ga0068867_1004501571 209
926 3300005459 Ga0068867_100478213 Ga0068867_1004782131 209
927 3300005466 Ga0070685_10364285 Ga0070685_103642852 209
928 3300005466 Ga0070685_10372480 Ga0070685_103724802 209
929 3300005467 Ga0070706_100383649 Ga0070706_1003836492 209
930 3300005467 Ga0070706_100482967 Ga0070706_1004829671 209
931 3300005467 Ga0070706_100483723 Ga0070706_1004837231 209
932 3300005467 Ga0070706_100820249 Ga0070706_1008202491 209
933 3300005467 Ga0070706_100853854 Ga0070706_1008538541 209
934 3300005468 Ga0070707_100123947 Ga0070707_1001239472 209
935 3300005468 Ga0070707_100417307 Ga0070707_1004173072 209
936 3300005468 Ga0070707_100518729 Ga0070707_1005187291 209
937 3300005468 Ga0070707_100550818 Ga0070707_1005508182 209
938 3300005468 Ga0070707_101048707 Ga0070707_1010487071 209
939 3300005471 Ga0070698_100003045 Ga0070698_10000304529 209
940 3300005471 Ga0070698_100040017 Ga0070698_1000400173 209
941 3300005471 Ga0070698_100113382 Ga0070698_1001133822 209
942 3300005471 Ga0070698_100140206 Ga0070698_1001402063 209
943 3300005471 Ga0070698_100142011 Ga0070698_1001420112 209
944 3300005471 Ga0070698_100284549 Ga0070698_1002845492 209
945 3300005471 Ga0070698_100327846 Ga0070698_1003278462 209
946 3300005471 Ga0070698_100407209 Ga0070698_1004072092 209
947 3300005471 Ga0070698_100696509 Ga0070698_1006965091 209
948 3300005518 Ga0070699_100000410 Ga0070699_10000041020 209
949 3300005518 Ga0070699_100006991 Ga0070699_1000069911 209
950 3300005518 Ga0070699_100096384 Ga0070699_1000963842 209
951 3300005518 Ga0070699_100193627 Ga0070699_1001936272 209
952 3300005518 Ga0070699_100339085 Ga0070699_1003390852 209
953 3300005530 Ga0070679_100029861 Ga0070679_1000298614 209
954 3300005530 Ga0070679_100102192 Ga0070679_1001021925 209
955 3300005535 Ga0070684_100102316 Ga0070684_1001023163 209
956 3300005535 Ga0070684_100142227 Ga0070684_1001422272 209
957 3300005535 Ga0070684_101072578 Ga0070684_1010725781 209
958 3300005536 Ga0070697_100111646 Ga0070697_1001116462 209
959 3300005536 Ga0070697_100242965 Ga0070697_1002429652 209
960 3300005536 Ga0070697_100403330 Ga0070697_1004033302 209
961 3300005536 Ga0070697_100482544 Ga0070697_1004825441 209
962 3300005543 Ga0070672_100018264 Ga0070672_1000182648 209
963 3300005543 Ga0070672_100042201 Ga0070672_1000422016 209
964 3300005543 Ga0070672_100069473 Ga0070672_1000694733 209
965 3300005543 Ga0070672_100070493 Ga0070672_1000704933 209
966 3300005543 Ga0070672_100112343 Ga0070672_1001123432 209
967 3300005543 Ga0070672_100189221 Ga0070672_1001892213 209
968 3300005543 Ga0070672_100260072 Ga0070672_1002600722 209
969 3300005543 Ga0070672_100282108 Ga0070672_1002821082 209
970 3300005543 Ga0070672_100977090 Ga0070672_1009770901 209
971 3300005544 Ga0070686_100034495 Ga0070686_1000344952 209
972 3300005544 Ga0070686_100157598 Ga0070686_1001575982 209
973 3300005544 Ga0070686_100377288 Ga0070686_1003772881 209
974 3300005544 Ga0070686_100527251 Ga0070686_1005272512 209
975 3300005544 Ga0070686_100594052 Ga0070686_1005940521 209
976 3300005545 Ga0070695_100003541 Ga0070695_1000035417 209
977 3300005545 Ga0070695_100006902 Ga0070695_1000069022 209
978 3300005545 Ga0070695_100282823 Ga0070695_1002828231 209
979 3300005545 Ga0070695_100299645 Ga0070695_1002996452 209
980 3300005545 Ga0070695_100362037 Ga0070695_1003620371 209
981 3300005545 Ga0070695_100371451 Ga0070695_1003714512 209
982 3300005546 Ga0070696_100001074 Ga0070696_1000010742 209
983 3300005546 Ga0070696_100081005 Ga0070696_1000810052 209
984 3300005546 Ga0070696_100153904 Ga0070696_1001539041 209
985 3300005546 Ga0070696_100231733 Ga0070696_1002317332 209
986 3300005546 Ga0070696_100531467 Ga0070696_1005314672 209
987 3300005547 Ga0070693_100056294 Ga0070693_1000562942 209
988 3300005547 Ga0070693_100119202 Ga0070693_1001192021 209
989 3300005548 Ga0070665_100004733 Ga0070665_1000047331 209
990 3300005548 Ga0070665_100005447 Ga0070665_10000544713 209
991 3300005548 Ga0070665_100010437 Ga0070665_10001043715 209
992 3300005548 Ga0070665_100036449 Ga0070665_1000364495 209
993 3300005548 Ga0070665_100116679 Ga0070665_1001166792 209
994 3300005548 Ga0070665_100207591 Ga0070665_1002075912 209
995 3300005549 Ga0070704_100000751 Ga0070704_1000007515 209
996 3300005549 Ga0070704_100070909 Ga0070704_1000709094 209
997 3300005549 Ga0070704_100229766 Ga0070704_1002297661 209
998 3300005549 Ga0070704_100270148 Ga0070704_1002701482 209
999 3300005549 Ga0070704_100482721 Ga0070704_1004827211 209
1000 3300005549 Ga0070704_100554092 Ga0070704_1005540921 209
1001 3300005549 Ga0070704_100589803 Ga0070704_1005898031 209
1002 3300005563 Ga0068855_100019504 Ga0068855_1000195049 209
1003 3300005563 Ga0068855_100713833 Ga0068855_1007138331 209
1004 3300005563 Ga0068855_100808323 Ga0068855_1008083231 209
1005 3300005563 Ga0068855_100898736 Ga0068855_1008987362 209
1006 3300005564 Ga0070664_100004358 Ga0070664_10000435812 209
1007 3300005564 Ga0070664_100015643 Ga0070664_1000156435 209
1008 3300005564 Ga0070664_100035098 Ga0070664_1000350984 209
1009 3300005564 Ga0070664_100066973 Ga0070664_1000669734 209
1010 3300005564 Ga0070664_100449690 Ga0070664_1004496902 209
1011 3300005564 Ga0070664_100465786 Ga0070664_1004657861 209
1012 3300005564 Ga0070664_100702033 Ga0070664_1007020331 209
1013 3300005577 Ga0068857_100071289 Ga0068857_1000712894 209
1014 3300005577 Ga0068857_100095577 Ga0068857_1000955774 209
1015 3300005577 Ga0068857_100118951 Ga0068857_1001189515 209
1016 3300005577 Ga0068857_100638253 Ga0068857_1006382532 209
1017 3300005577 Ga0068857_100713347 Ga0068857_1007133472 209
1018 3300005577 Ga0068857_100822763 Ga0068857_1008227632 209
1019 3300005577 Ga0068857_100939157 Ga0068857_1009391572 209
1020 3300005578 Ga0068854_100052842 Ga0068854_1000528423 209
1021 3300005578 Ga0068854_100574067 Ga0068854_1005740672 209
1022 3300005615 Ga0070702_100002883 Ga0070702_10000288314 209
1023 3300005615 Ga0070702_100033168 Ga0070702_1000331682 209
1024 3300005615 Ga0070702_100221342 Ga0070702_1002213422 209
1025 3300005616 Ga0068852_100307649 Ga0068852_1003076492 209
1026 3300005616 Ga0068852_100311453 Ga0068852_1003114531 209
1027 3300005616 Ga0068852_100706167 Ga0068852_1007061672 209
1028 3300005617 Ga0068859_100012803 Ga0068859_1000128037 209
1029 3300005617 Ga0068859_100026110 Ga0068859_1000261108 209
1030 3300005617 Ga0068859_100029403 Ga0068859_1000294034 209
1031 3300005617 Ga0068859_100044148 Ga0068859_1000441486 209
1032 3300005617 Ga0068859_100077177 Ga0068859_1000771774 209
1033 3300005617 Ga0068859_100137523 Ga0068859_1001375233 209
1034 3300005617 Ga0068859_100151731 Ga0068859_1001517314 209
1035 3300005617 Ga0068859_100180046 Ga0068859_1001800464 209
1036 3300005617 Ga0068859_100219321 Ga0068859_1002193213 209
1037 3300005617 Ga0068859_100303333 Ga0068859_1003033332 209
1038 3300005617 Ga0068859_100525190 Ga0068859_1005251902 209
1039 3300005617 Ga0068859_100733134 Ga0068859_1007331342 209
1040 3300005617 Ga0068859_100770472 Ga0068859_1007704722 209
1041 3300005617 Ga0068859_100884173 Ga0068859_1008841731 209
1042 3300005617 Ga0068859_101371855 Ga0068859_1013718551 209
1043 3300005618 Ga0068864_100030675 Ga0068864_1000306758 209
1044 3300005618 Ga0068864_100097802 Ga0068864_1000978023 209
1045 3300005618 Ga0068864_100158097 Ga0068864_1001580972 209
1046 3300005618 Ga0068864_100165321 Ga0068864_1001653213 209
1047 3300005618 Ga0068864_100307546 Ga0068864_1003075462 209
1048 3300005618 Ga0068864_100494548 Ga0068864_1004945482 209
1049 3300005618 Ga0068864_100621984 Ga0068864_1006219842 209
1050 3300005618 Ga0068864_101211882 Ga0068864_1012118821 209
1051 3300005718 Ga0068866_10186709 Ga0068866_101867091 209
1052 3300005718 Ga0068866_10220712 Ga0068866_102207122 209
1053 3300005719 Ga0068861_100005736 Ga0068861_1000057365 209
1054 3300005719 Ga0068861_100011547 Ga0068861_1000115475 209
1055 3300005719 Ga0068861_100011957 Ga0068861_1000119577 209
1056 3300005719 Ga0068861_100049408 Ga0068861_1000494083 209
1057 3300005719 Ga0068861_100058465 Ga0068861_1000584653 209
1058 3300005719 Ga0068861_100060382 Ga0068861_1000603823 209
1059 3300005719 Ga0068861_100178759 Ga0068861_1001787593 209
1060 3300005719 Ga0068861_100392221 Ga0068861_1003922211 209
1061 3300005719 Ga0068861_100614384 Ga0068861_1006143842 209
1062 3300005840 Ga0068870_10000698 Ga0068870_1000069824 209
1063 3300005840 Ga0068870_10013554 Ga0068870_100135541 209
1064 3300005840 Ga0068870_10077709 Ga0068870_100777092 209
1065 3300005840 Ga0068870_10083424 Ga0068870_100834242 209
1066 3300005840 Ga0068870_10251497 Ga0068870_102514971 209
1067 3300005840 Ga0068870_10454997 Ga0068870_104549971 209
1068 3300005840 Ga0068870_10552274 Ga0068870_105522741 209
1069 3300005841 Ga0068863_100029433 Ga0068863_1000294335 209
1070 3300005841 Ga0068863_100450855 Ga0068863_1004508552 209
1071 3300005841 Ga0068863_100562629 Ga0068863_1005626292 209
1072 3300005842 Ga0068858_100001254 Ga0068858_10000125437 209
1073 3300005842 Ga0068858_100009001 Ga0068858_1000090017 209
1074 3300005842 Ga0068858_100010513 Ga0068858_1000105133 209
1075 3300005842 Ga0068858_100064329 Ga0068858_1000643292 209
1076 3300005842 Ga0068858_100075667 Ga0068858_1000756672 209
1077 3300005842 Ga0068858_100108577 Ga0068858_1001085773 209
1078 3300005842 Ga0068858_100245548 Ga0068858_1002455482 209
1079 3300005842 Ga0068858_100755058 Ga0068858_1007550582 209
1080 3300005842 Ga0068858_100847557 Ga0068858_1008475572 209
1081 3300005842 Ga0068858_101018898 Ga0068858_1010188981 209
1082 3300005843 Ga0068860_100173478 Ga0068860_1001734784 209
1083 3300005843 Ga0068860_100307266 Ga0068860_1003072661 209
1084 3300005843 Ga0068860_100366749 Ga0068860_1003667492 209
1085 3300005843 Ga0068860_100372474 Ga0068860_1003724742 209
1086 3300005843 Ga0068860_100525924 Ga0068860_1005259242 209
1087 3300005843 Ga0068860_100613083 Ga0068860_1006130831 209
1088 3300005843 Ga0068860_100742462 Ga0068860_1007424621 209
1089 3300005843 Ga0068860_100912110 Ga0068860_1009121101 209
1090 3300005844 Ga0068862_100002296 Ga0068862_1000022967 209
1091 3300005844 Ga0068862_100003082 Ga0068862_1000030829 209
1092 3300005844 Ga0068862_100021021 Ga0068862_1000210218 209
1093 3300005844 Ga0068862_100026017 Ga0068862_1000260174 209
1094 3300005844 Ga0068862_100051237 Ga0068862_1000512376 209
1095 3300005844 Ga0068862_100082316 Ga0068862_1000823163 209
1096 3300005844 Ga0068862_100148298 Ga0068862_1001482983 209
1097 3300005844 Ga0068862_100185785 Ga0068862_1001857852 209
1098 3300005844 Ga0068862_100204294 Ga0068862_1002042943 209
1099 3300005844 Ga0068862_100658326 Ga0068862_1006583262 209
1100 3300005937 Ga0081455_10025866 Ga0081455_100258667 209
1101 3300005937 Ga0081455_10312302 Ga0081455_103123022 209
1102 3300005981 Ga0081538_10028271 Ga0081538_100282718 209
1103 3300005985 Ga0081539_10000142 Ga0081539_1000014281 209
1104 3300005985 Ga0081539_10000215 Ga0081539_10000215128 209
1105 3300005985 Ga0081539_10003297 Ga0081539_1000329710 209
1106 3300005985 Ga0081539_10027389 Ga0081539_100273892 209
1107 3300006028 Ga0070717_10296866 Ga0070717_102968662 209
1108 3300006028 Ga0070717_10340644 Ga0070717_103406441 209
1109 3300006038 Ga0075365_10042307 Ga0075365_100423072 209
1110 3300006038 Ga0075365_10186510 Ga0075365_101865102 209
1111 3300006042 Ga0075368_10009856 Ga0075368_100098565 209
1112 3300006042 Ga0075368_10168604 Ga0075368_101686041 209
1113 3300006048 Ga0075363_100006283 Ga0075363_1000062834 209
1114 3300006051 Ga0075364_10021843 Ga0075364_100218432 209
1115 3300006051 Ga0075364_10110101 Ga0075364_101101012 209
1116 3300006051 Ga0075364_10546881 Ga0075364_105468811 209
1117 3300006177 Ga0075362_10000151 Ga0075362_100001513 209
1118 3300006177 Ga0075362_10099004 Ga0075362_100990042 209
1119 3300006178 Ga0075367_10005011 Ga0075367_100050113 209
1120 3300006178 Ga0075367_10032966 Ga0075367_100329662 209
1121 3300006178 Ga0075367_10035916 Ga0075367_100359162 209
1122 3300006178 Ga0075367_10038906 Ga0075367_100389062 209
1123 3300006178 Ga0075367_10056625 Ga0075367_100566254 209
1124 3300006178 Ga0075367_10115498 Ga0075367_101154982 209
1125 3300006186 Ga0075369_10075029 Ga0075369_100750293 209
1126 3300006195 Ga0075366_10046946 Ga0075366_100469464 209
1127 3300006195 Ga0075366_10056183 Ga0075366_100561834 209
1128 3300006195 Ga0075366_10085628 Ga0075366_100856282 209
1129 3300006195 Ga0075366_10211594 Ga0075366_102115941 209
1130 3300006237 Ga0097621_100006061 Ga0097621_1000060614 209
1131 3300006237 Ga0097621_100011600 Ga0097621_1000116005 209
1132 3300006237 Ga0097621_100015176 Ga0097621_1000151768 209
1133 3300006237 Ga0097621_100133656 Ga0097621_1001336563 209
1134 3300006237 Ga0097621_100150356 Ga0097621_1001503564 209
1135 3300006237 Ga0097621_100157380 Ga0097621_1001573802 209
1136 3300006237 Ga0097621_100201569 Ga0097621_1002015692 209
1137 3300006237 Ga0097621_100209453 Ga0097621_1002094532 209
1138 3300006237 Ga0097621_100631158 Ga0097621_1006311581 209
1139 3300006237 Ga0097621_100657909 Ga0097621_1006579092 209
1140 3300006237 Ga0097621_100691353 Ga0097621_1006913531 209
1141 3300006237 Ga0097621_100697028 Ga0097621_1006970282 209
1142 3300006353 Ga0075370_10028573 Ga0075370_100285732 209
1143 3300006353 Ga0075370_10033472 Ga0075370_100334726 209
1144 3300006358 Ga0068871_100001728 Ga0068871_1000017289 209
1145 3300006358 Ga0068871_100033665 Ga0068871_1000336655 209
1146 3300006358 Ga0068871_100060899 Ga0068871_1000608994 209
1147 3300006358 Ga0068871_100166415 Ga0068871_1001664151 209
1148 3300006358 Ga0068871_100172788 Ga0068871_1001727882 209
1149 3300006358 Ga0068871_100179700 Ga0068871_1001797002 209
1150 3300006358 Ga0068871_100318158 Ga0068871_1003181583 209
1151 3300006358 Ga0068871_100477892 Ga0068871_1004778921 209
1152 3300006844 Ga0075428_100000009 Ga0075428_100000009211 209
1153 3300006844 Ga0075428_100000566 Ga0075428_10000056629 209
1154 3300006844 Ga0075428_100002605 Ga0075428_10000260525 209
1155 3300006844 Ga0075428_100020626 Ga0075428_1000206262 209
1156 3300006844 Ga0075428_100061193 Ga0075428_1000611933 209
1157 3300006844 Ga0075428_100109163 Ga0075428_1001091632 209
1158 3300006844 Ga0075428_100122963 Ga0075428_1001229633 209
1159 3300006844 Ga0075428_100239042 Ga0075428_1002390422 209
1160 3300006844 Ga0075428_100260481 Ga0075428_1002604813 209
1161 3300006844 Ga0075428_100278319 Ga0075428_1002783192 209
1162 3300006844 Ga0075428_100361705 Ga0075428_1003617053 209
1163 3300006844 Ga0075428_100366816 Ga0075428_1003668162 209
1164 3300006844 Ga0075428_100491896 Ga0075428_1004918962 209
1165 3300006844 Ga0075428_100586681 Ga0075428_1005866812 209
1166 3300006844 Ga0075428_100596605 Ga0075428_1005966052 209
1167 3300006844 Ga0075428_100670262 Ga0075428_1006702621 209
1168 3300006844 Ga0075428_101216672 Ga0075428_1012166721 209
1169 3300006846 Ga0075430_100002725 Ga0075430_1000027253 209
1170 3300006846 Ga0075430_100005705 Ga0075430_1000057055 209
1171 3300006846 Ga0075430_100016624 Ga0075430_1000166242 209
1172 3300006846 Ga0075430_100018940 Ga0075430_1000189401 209
1173 3300006846 Ga0075430_100036424 Ga0075430_1000364246 209
1174 3300006846 Ga0075430_100068323 Ga0075430_1000683232 209
1175 3300006846 Ga0075430_100074719 Ga0075430_1000747197 209
1176 3300006846 Ga0075430_100075246 Ga0075430_1000752462 209
1177 3300006846 Ga0075430_100098382 Ga0075430_1000983821 209
1178 3300006846 Ga0075430_100163499 Ga0075430_1001634992 209
1179 3300006846 Ga0075430_100211384 Ga0075430_1002113843 209
1180 3300006846 Ga0075430_100280815 Ga0075430_1002808152 209
1181 3300006846 Ga0075430_100315446 Ga0075430_1003154461 209
1182 3300006846 Ga0075430_100360347 Ga0075430_1003603472 209
1183 3300006847 Ga0075431_100004450 Ga0075431_10000445026 209
1184 3300006847 Ga0075431_100007812 Ga0075431_1000078125 209
1185 3300006847 Ga0075431_100008247 Ga0075431_1000082473 209
1186 3300006847 Ga0075431_100040301 Ga0075431_1000403013 209
1187 3300006847 Ga0075431_100044056 Ga0075431_1000440564 209
1188 3300006847 Ga0075431_100044712 Ga0075431_1000447124 209
1189 3300006847 Ga0075431_100131276 Ga0075431_1001312763 209
1190 3300006847 Ga0075431_100339157 Ga0075431_1003391571 209
1191 3300006847 Ga0075431_100535297 Ga0075431_1005352972 209
1192 3300006847 Ga0075431_100699062 Ga0075431_1006990621 209
1193 3300006847 Ga0075431_100940692 Ga0075431_1009406921 209
1194 3300006852 Ga0075433_10002092 Ga0075433_100020928 209
1195 3300006852 Ga0075433_10027605 Ga0075433_100276055 209
1196 3300006852 Ga0075433_10030514 Ga0075433_100305144 209
1197 3300006852 Ga0075433_10062553 Ga0075433_100625533 209
1198 3300006852 Ga0075433_10076679 Ga0075433_100766792 209
1199 3300006852 Ga0075433_10080852 Ga0075433_100808523 209
1200 3300006852 Ga0075433_10082490 Ga0075433_100824903 209
1201 3300006852 Ga0075433_10121284 Ga0075433_101212842 209
1202 3300006852 Ga0075433_10164658 Ga0075433_101646584 209
1203 3300006852 Ga0075433_10172495 Ga0075433_101724952 209
1204 3300006852 Ga0075433_10199131 Ga0075433_101991312 209
1205 3300006852 Ga0075433_10207128 Ga0075433_102071282 209
1206 3300006852 Ga0075433_10435697 Ga0075433_104356972 209
1207 3300006852 Ga0075433_10489055 Ga0075433_104890552 209
1208 3300006852 Ga0075433_10677661 Ga0075433_106776611 209
1209 3300006852 Ga0075433_10838196 Ga0075433_108381962 209
1210 3300006871 Ga0075434_100004504 Ga0075434_1000045047 209
1211 3300006871 Ga0075434_100014563 Ga0075434_1000145633 209
1212 3300006871 Ga0075434_100017612 Ga0075434_1000176123 209
1213 3300006871 Ga0075434_100025368 Ga0075434_1000253688 209
1214 3300006871 Ga0075434_100030886 Ga0075434_1000308864 209
1215 3300006871 Ga0075434_100052143 Ga0075434_1000521433 209
1216 3300006871 Ga0075434_100091137 Ga0075434_1000911376 209
1217 3300006871 Ga0075434_100134915 Ga0075434_1001349152 209
1218 3300006871 Ga0075434_100259181 Ga0075434_1002591812 209
1219 3300006871 Ga0075434_100266259 Ga0075434_1002662593 209
1220 3300006871 Ga0075434_100349562 Ga0075434_1003495622 209
1221 3300006871 Ga0075434_100377343 Ga0075434_1003773433 209
1222 3300006871 Ga0075434_100399406 Ga0075434_1003994062 209
1223 3300006871 Ga0075434_100610416 Ga0075434_1006104162 209
1224 3300006880 Ga0075429_100004639 Ga0075429_10000463913 209
1225 3300006880 Ga0075429_100011402 Ga0075429_1000114026 209
1226 3300006880 Ga0075429_100019533 Ga0075429_1000195334 209
1227 3300006880 Ga0075429_100075727 Ga0075429_1000757272 209
1228 3300006880 Ga0075429_100140556 Ga0075429_1001405563 209
1229 3300006880 Ga0075429_100193482 Ga0075429_1001934822 209
1230 3300006880 Ga0075429_100210111 Ga0075429_1002101112 209
1231 3300006880 Ga0075429_100227419 Ga0075429_1002274192 209
1232 3300006880 Ga0075429_100241442 Ga0075429_1002414423 209
1233 3300006880 Ga0075429_100438481 Ga0075429_1004384811 209
1234 3300006881 Ga0068865_100020558 Ga0068865_1000205584 209
1235 3300006881 Ga0068865_100185817 Ga0068865_1001858172 209
1236 3300006881 Ga0068865_100366295 Ga0068865_1003662952 209
1237 3300006914 Ga0075436_100006359 Ga0075436_1000063594 209
1238 3300006914 Ga0075436_100014321 Ga0075436_1000143218 209
1239 3300006914 Ga0075436_100019702 Ga0075436_1000197023 209
1240 3300006914 Ga0075436_100047990 Ga0075436_1000479906 209
1241 3300006914 Ga0075436_100081470 Ga0075436_1000814702 209
1242 3300006914 Ga0075436_100411062 Ga0075436_1004110621 209
1243 3300006914 Ga0075436_100419311 Ga0075436_1004193112 209
1244 3300006931 Ga0097620_100012804 Ga0097620_1000128047 209
1245 3300006931 Ga0097620_100026110 Ga0097620_1000261103 209
1246 3300006931 Ga0097620_100029403 Ga0097620_1000294034 209
1247 3300006931 Ga0097620_100044150 Ga0097620_1000441506 209
1248 3300006931 Ga0097620_100077187 Ga0097620_1000771872 209
1249 3300006931 Ga0097620_100137524 Ga0097620_1001375243 209
1250 3300006931 Ga0097620_100151731 Ga0097620_1001517314 209
1251 3300006931 Ga0097620_100180043 Ga0097620_1001800434 209
1252 3300006931 Ga0097620_100219315 Ga0097620_1002193153 209
1253 3300006931 Ga0097620_100303335 Ga0097620_1003033352 209
1254 3300006931 Ga0097620_100525221 Ga0097620_1005252212 209
1255 3300006931 Ga0097620_100733057 Ga0097620_1007330571 209
1256 3300006931 Ga0097620_100770439 Ga0097620_1007704392 209
1257 3300006931 Ga0097620_100884158 Ga0097620_1008841581 209
1258 3300006931 Ga0097620_101371826 Ga0097620_1013718261 209
1259 3300007076 Ga0075435_100001248 Ga0075435_1000012482 209
1260 3300007076 Ga0075435_100001542 Ga0075435_1000015425 209
1261 3300007076 Ga0075435_100003200 Ga0075435_1000032008 209
1262 3300007076 Ga0075435_100004862 Ga0075435_1000048626 209
1263 3300007076 Ga0075435_100021902 Ga0075435_1000219023 209
1264 3300007076 Ga0075435_100029287 Ga0075435_1000292876 209
1265 3300007076 Ga0075435_100123551 Ga0075435_1001235513 209
1266 3300007076 Ga0075435_100486173 Ga0075435_1004861732 209
1267 3300007076 Ga0075435_100579052 Ga0075435_1005790521 209
1268 3300007076 Ga0075435_100771933 Ga0075435_1007719331 209
1269 3300007076 Ga0075435_100861508 Ga0075435_1008615082 209
1270 3300009093 Ga0105240_10239450 Ga0105240_102394502 209
1271 3300009093 Ga0105240_10412419 Ga0105240_104124192 209
1272 3300009093 Ga0105240_10494022 Ga0105240_104940222 209
1273 3300009093 Ga0105240_10773992 Ga0105240_107739921 209
1274 3300009093 Ga0105240_10911691 Ga0105240_109116912 209
1275 3300009094 Ga0111539_10005584 Ga0111539_1000558410 209
1276 3300009094 Ga0111539_10008096 Ga0111539_1000809620 209
1277 3300009094 Ga0111539_10053296 Ga0111539_100532962 209
1278 3300009094 Ga0111539_10084764 Ga0111539_100847642 209
1279 3300009094 Ga0111539_10357697 Ga0111539_103576974 209
1280 3300009094 Ga0111539_10452487 Ga0111539_104524872 209
1281 3300009094 Ga0111539_10743188 Ga0111539_107431882 209
1282 3300009098 Ga0105245_11464319 Ga0105245_114643191 209
1283 3300009101 Ga0105247_10342434 Ga0105247_103424341 209
1284 3300009147 Ga0114129_10004861 Ga0114129_100048618 209
1285 3300009147 Ga0114129_10008264 Ga0114129_1000826421 209
1286 3300009147 Ga0114129_10020235 Ga0114129_1002023516 209
1287 3300009147 Ga0114129_10021566 Ga0114129_1002156618 209
1288 3300009147 Ga0114129_10023812 Ga0114129_100238122 209
1289 3300009147 Ga0114129_10061796 Ga0114129_100617965 209
1290 3300009147 Ga0114129_10078194 Ga0114129_100781942 209
1291 3300009147 Ga0114129_10106586 Ga0114129_101065868 209
1292 3300009147 Ga0114129_10220088 Ga0114129_102200883 209
1293 3300009147 Ga0114129_10717618 Ga0114129_107176182 209
1294 3300009147 Ga0114129_10825683 Ga0114129_108256831 209
1295 3300009148 Ga0105243_10062233 Ga0105243_100622333 209
1296 3300009174 Ga0105241_10016312 Ga0105241_100163125 209
1297 3300009176 Ga0105242_10011214 Ga0105242_100112146 209
1298 3300009176 Ga0105242_10062522 Ga0105242_100625224 209
1299 3300009176 Ga0105242_10077034 Ga0105242_100770343 209
1300 3300009176 Ga0105242_10240060 Ga0105242_102400603 209
1301 3300009176 Ga0105242_10855991 Ga0105242_108559911 209
1302 3300009176 Ga0105242_11415312 Ga0105242_114153121 209
1303 3300009177 Ga0105248_10087502 Ga0105248_100875022 209
1304 3300009177 Ga0105248_10152893 Ga0105248_101528932 209
1305 3300009177 Ga0105248_10252060 Ga0105248_102520601 209
1306 3300009177 Ga0105248_10374016 Ga0105248_103740163 209
1307 3300009177 Ga0105248_10401159 Ga0105248_104011592 209
1308 3300009177 Ga0105248_10565314 Ga0105248_105653143 209
1309 3300009177 Ga0105248_10718574 Ga0105248_107185741 209
1310 3300009177 Ga0105248_10984896 Ga0105248_109848962 209
1311 3300009551 Ga0105238_10256783 Ga0105238_102567831 209
1312 3300009551 Ga0105238_10416165 Ga0105238_104161651 209
1313 3300009551 Ga0105238_10559588 Ga0105238_105595882 209
1314 3300009553 Ga0105249_10000649 Ga0105249_1000064916 209
1315 3300009553 Ga0105249_10130974 Ga0105249_101309743 209
1316 3300011119 Ga0105246_10016712 Ga0105246_100167124 209
1317 3300011119 Ga0105246_10507508 Ga0105246_105075082 209
1318 3300013104 Ga0157370_10224325 Ga0157370_102243252 209
1319 3300013105 Ga0157369_11019181 Ga0157369_110191811 209
1320 3300013296 Ga0157374_10253954 Ga0157374_102539542 209
1321 3300013296 Ga0157374_10931190 Ga0157374_109311902 209
1322 3300013297 Ga0157378_10007877 Ga0157378_100078775 209
1323 3300013297 Ga0157378_10592204 Ga0157378_105922042 209
1324 3300013297 Ga0157378_11252796 Ga0157378_112527961 209
1325 3300013306 Ga0163162_10012608 Ga0163162_100126084 209
1326 3300013306 Ga0163162_10140385 Ga0163162_101403852 209
1327 3300013306 Ga0163162_10230390 Ga0163162_102303903 209
1328 3300013306 Ga0163162_10525549 Ga0163162_105255492 209
1329 3300013306 Ga0163162_10883103 Ga0163162_108831031 209
1330 3300013306 Ga0163162_11044001 Ga0163162_110440011 209
1331 3300013306 Ga0163162_12046387 Ga0163162_120463871 209
1332 3300013308 Ga0157375_10118319 Ga0157375_101183192 209
1333 3300013308 Ga0157375_10267027 Ga0157375_102670273 209
1334 3300013308 Ga0157375_10746745 Ga0157375_107467451 209
1335 3300014325 Ga0163163_10000013 Ga0163163_10000013150 209
1336 3300014325 Ga0163163_10015096 Ga0163163_100150962 209
1337 3300014325 Ga0163163_10093796 Ga0163163_100937963 209
1338 3300014325 Ga0163163_10628002 Ga0163163_106280022 209
1339 3300014326 Ga0157380_10010930 Ga0157380_100109307 209
1340 3300014326 Ga0157380_10223444 Ga0157380_102234442 209
1341 3300014326 Ga0157380_11374831 Ga0157380_113748311 209
1342 3300014745 Ga0157377_10282677 Ga0157377_102826771 209
1343 3300014968 Ga0157379_10059958 Ga0157379_100599583 209
1344 3300014968 Ga0157379_10630413 Ga0157379_106304131 209
1345 3300014968 Ga0157379_10898171 Ga0157379_108981711 209
1346 3300014969 Ga0157376_10019471 Ga0157376_100194718 209
1347 3300014969 Ga0157376_10030126 Ga0157376_100301267 209
1348 3300014969 Ga0157376_10039952 Ga0157376_100399523 209
1349 3300014969 Ga0157376_10115848 Ga0157376_101158485 209
1350 3300014969 Ga0157376_10295204 Ga0157376_102952041 209
1351 3300014969 Ga0157376_11059331 Ga0157376_110593312 209
1352 3300015262 Ga0182007_10054418 Ga0182007_100544182 209
1353 3300017792 Ga0163161_10019901 Ga0163161_100199018 209
1354 3300017792 Ga0163161_10150504 Ga0163161_101505042 209
1355 3300017792 Ga0163161_10275843 Ga0163161_102758432 209
1356 3300017792 Ga0163161_10474616 Ga0163161_104746162 209
1357 3300017792 Ga0163161_10804541 Ga0163161_108045411 209
1358 3300017792 Ga0163161_10827789 Ga0163161_108277891 209
1359 3300017792 Ga0163161_10909969 Ga0163161_109099691 209
1360 3300025290 Ga0207673_1002316 Ga0207673_10023162 209
1361 3300025315 Ga0207697_10002850 Ga0207697_100028505 209
1362 3300025315 Ga0207697_10006327 Ga0207697_100063278 209
1363 3300025315 Ga0207697_10016274 Ga0207697_100162742 209
1364 3300025315 Ga0207697_10088238 Ga0207697_100882381 209
1365 3300025321 Ga0207656_10341036 Ga0207656_103410361 209
1366 3300025885 Ga0207653_10066214 Ga0207653_100662142 209
1367 3300025893 Ga0207682_10033624 Ga0207682_100336243 209
1368 3300025893 Ga0207682_10038783 Ga0207682_100387832 209
1369 3300025893 Ga0207682_10055593 Ga0207682_100555933 209
1370 3300025893 Ga0207682_10145131 Ga0207682_101451312 209
1371 3300025893 Ga0207682_10191066 Ga0207682_101910661 209
1372 3300025893 Ga0207682_10353869 Ga0207682_103538691 209
1373 3300025899 Ga0207642_10079220 Ga0207642_100792201 209
1374 3300025899 Ga0207642_10351503 Ga0207642_103515031 209
1375 3300025900 Ga0207710_10014776 Ga0207710_100147761 209
1376 3300025900 Ga0207710_10090900 Ga0207710_100909003 209
1377 3300025901 Ga0207688_10000138 Ga0207688_1000013816 209
1378 3300025901 Ga0207688_10079958 Ga0207688_100799582 209
1379 3300025901 Ga0207688_10171212 Ga0207688_101712121 209
1380 3300025901 Ga0207688_10202758 Ga0207688_102027581 209
1381 3300025901 Ga0207688_10224971 Ga0207688_102249711 209
1382 3300025903 Ga0207680_10006153 Ga0207680_100061533 209
1383 3300025903 Ga0207680_10108757 Ga0207680_101087571 209
1384 3300025903 Ga0207680_10113874 Ga0207680_101138741 209
1385 3300025903 Ga0207680_10123316 Ga0207680_101233162 209
1386 3300025903 Ga0207680_10256347 Ga0207680_102563472 209
1387 3300025903 Ga0207680_10284142 Ga0207680_102841421 209
1388 3300025903 Ga0207680_10410362 Ga0207680_104103622 209
1389 3300025904 Ga0207647_10284145 Ga0207647_102841451 209
1390 3300025905 Ga0207685_10020392 Ga0207685_100203923 209
1391 3300025906 Ga0207699_10245485 Ga0207699_102454852 209
1392 3300025907 Ga0207645_10006264 Ga0207645_100062645 209
1393 3300025907 Ga0207645_10028448 Ga0207645_100284485 209
1394 3300025907 Ga0207645_10100166 Ga0207645_101001664 209
1395 3300025907 Ga0207645_10121002 Ga0207645_101210022 209
1396 3300025907 Ga0207645_10178848 Ga0207645_101788482 209
1397 3300025907 Ga0207645_10183242 Ga0207645_101832422 209
1398 3300025907 Ga0207645_10371564 Ga0207645_103715641 209
1399 3300025907 Ga0207645_10388926 Ga0207645_103889261 209
1400 3300025908 Ga0207643_10000779 Ga0207643_100007795 209
1401 3300025908 Ga0207643_10011421 Ga0207643_100114213 209
1402 3300025908 Ga0207643_10011763 Ga0207643_100117633 209
1403 3300025908 Ga0207643_10033333 Ga0207643_100333332 209
1404 3300025908 Ga0207643_10064040 Ga0207643_100640402 209
1405 3300025908 Ga0207643_10075830 Ga0207643_100758303 209
1406 3300025908 Ga0207643_10081711 Ga0207643_100817113 209
1407 3300025908 Ga0207643_10084207 Ga0207643_100842073 209
1408 3300025908 Ga0207643_10145911 Ga0207643_101459111 209
1409 3300025908 Ga0207643_10418521 Ga0207643_104185211 209
1410 3300025908 Ga0207643_10445340 Ga0207643_104453401 209
1411 3300025909 Ga0207705_10254361 Ga0207705_102543612 209
1412 3300025910 Ga0207684_10186261 Ga0207684_101862612 209
1413 3300025910 Ga0207684_10329170 Ga0207684_103291701 209
1414 3300025910 Ga0207684_10329901 Ga0207684_103299012 209
1415 3300025910 Ga0207684_10615358 Ga0207684_106153581 209
1416 3300025910 Ga0207684_10830722 Ga0207684_108307221 209
1417 3300025911 Ga0207654_10023501 Ga0207654_100235012 209
1418 3300025912 Ga0207707_10142691 Ga0207707_101426911 209
1419 3300025912 Ga0207707_10235260 Ga0207707_102352602 209
1420 3300025912 Ga0207707_10654814 Ga0207707_106548141 209
1421 3300025913 Ga0207695_10121319 Ga0207695_101213193 209
1422 3300025913 Ga0207695_10203109 Ga0207695_102031093 209
1423 3300025913 Ga0207695_10212826 Ga0207695_102128263 209
1424 3300025914 Ga0207671_10199022 Ga0207671_101990222 209
1425 3300025914 Ga0207671_10200800 Ga0207671_102008001 209
1426 3300025915 Ga0207693_10134355 Ga0207693_101343552 209
1427 3300025917 Ga0207660_10033197 Ga0207660_100331977 209
1428 3300025917 Ga0207660_10173624 Ga0207660_101736243 209
1429 3300025917 Ga0207660_10215605 Ga0207660_102156052 209
1430 3300025917 Ga0207660_10749302 Ga0207660_107493021 209
1431 3300025918 Ga0207662_10000335 Ga0207662_100003355 209
1432 3300025918 Ga0207662_10015295 Ga0207662_100152954 209
1433 3300025918 Ga0207662_10025424 Ga0207662_100254243 209
1434 3300025918 Ga0207662_10041797 Ga0207662_100417972 209
1435 3300025918 Ga0207662_10072273 Ga0207662_100722733 209
1436 3300025918 Ga0207662_10074449 Ga0207662_100744492 209
1437 3300025918 Ga0207662_10097568 Ga0207662_100975681 209
1438 3300025918 Ga0207662_10520980 Ga0207662_105209802 209
1439 3300025919 Ga0207657_10102302 Ga0207657_101023023 209
1440 3300025919 Ga0207657_10235318 Ga0207657_102353182 209
1441 3300025919 Ga0207657_10275916 Ga0207657_102759162 209
1442 3300025919 Ga0207657_10280494 Ga0207657_102804942 209
1443 3300025919 Ga0207657_10306610 Ga0207657_103066101 209
1444 3300025920 Ga0207649_10016411 Ga0207649_100164112 209
1445 3300025920 Ga0207649_10319014 Ga0207649_103190141 209
1446 3300025920 Ga0207649_10428778 Ga0207649_104287782 209
1447 3300025921 Ga0207652_10016976 Ga0207652_100169763 209
1448 3300025921 Ga0207652_10017745 Ga0207652_100177456 209
1449 3300025922 Ga0207646_10062037 Ga0207646_100620372 209
1450 3300025922 Ga0207646_10110294 Ga0207646_101102942 209
1451 3300025922 Ga0207646_10124334 Ga0207646_101243345 209
1452 3300025922 Ga0207646_10165914 Ga0207646_101659141 209
1453 3300025922 Ga0207646_10483865 Ga0207646_104838651 209
1454 3300025922 Ga0207646_10499389 Ga0207646_104993892 209
1455 3300025922 Ga0207646_10725201 Ga0207646_107252011 209
1456 3300025923 Ga0207681_10002945 Ga0207681_100029452 209
1457 3300025923 Ga0207681_10009404 Ga0207681_100094044 209
1458 3300025923 Ga0207681_10013156 Ga0207681_100131566 209
1459 3300025923 Ga0207681_10030392 Ga0207681_100303923 209
1460 3300025923 Ga0207681_10040285 Ga0207681_100402852 209
1461 3300025923 Ga0207681_10131761 Ga0207681_101317611 209
1462 3300025923 Ga0207681_10207032 Ga0207681_102070322 209
1463 3300025923 Ga0207681_10256561 Ga0207681_102565612 209
1464 3300025923 Ga0207681_10304059 Ga0207681_103040592 209
1465 3300025923 Ga0207681_10366736 Ga0207681_103667361 209
1466 3300025923 Ga0207681_10630904 Ga0207681_106309042 209
1467 3300025924 Ga0207694_10019318 Ga0207694_100193184 209
1468 3300025924 Ga0207694_10317166 Ga0207694_103171661 209
1469 3300025925 Ga0207650_10029449 Ga0207650_100294497 209
1470 3300025925 Ga0207650_10045711 Ga0207650_100457113 209
1471 3300025925 Ga0207650_10074604 Ga0207650_100746042 209
1472 3300025925 Ga0207650_10245273 Ga0207650_102452732 209
1473 3300025925 Ga0207650_10285687 Ga0207650_102856872 209
1474 3300025925 Ga0207650_10305737 Ga0207650_103057372 209
1475 3300025925 Ga0207650_10386615 Ga0207650_103866152 209
1476 3300025925 Ga0207650_10465535 Ga0207650_104655351 209
1477 3300025925 Ga0207650_10580100 Ga0207650_105801002 209
1478 3300025926 Ga0207659_10001213 Ga0207659_100012139 209
1479 3300025926 Ga0207659_10005611 Ga0207659_100056116 209
1480 3300025926 Ga0207659_10007012 Ga0207659_100070125 209
1481 3300025926 Ga0207659_10018460 Ga0207659_100184603 209
1482 3300025926 Ga0207659_10024292 Ga0207659_100242921 209
1483 3300025926 Ga0207659_10027044 Ga0207659_100270443 209
1484 3300025926 Ga0207659_10069489 Ga0207659_100694893 209
1485 3300025926 Ga0207659_10129063 Ga0207659_101290632 209
1486 3300025926 Ga0207659_10145216 Ga0207659_101452163 209
1487 3300025926 Ga0207659_10149928 Ga0207659_101499282 209
1488 3300025926 Ga0207659_10239628 Ga0207659_102396282 209
1489 3300025926 Ga0207659_10370644 Ga0207659_103706441 209
1490 3300025926 Ga0207659_10443731 Ga0207659_104437312 209
1491 3300025926 Ga0207659_10498043 Ga0207659_104980431 209
1492 3300025926 Ga0207659_10515786 Ga0207659_105157861 209
1493 3300025926 Ga0207659_10633011 Ga0207659_106330111 209
1494 3300025927 Ga0207687_10033478 Ga0207687_100334786 209
1495 3300025927 Ga0207687_10054268 Ga0207687_100542686 209
1496 3300025927 Ga0207687_10148079 Ga0207687_101480792 209
1497 3300025927 Ga0207687_10725615 Ga0207687_107256152 209
1498 3300025927 Ga0207687_10859710 Ga0207687_108597101 209
1499 3300025928 Ga0207700_10141551 Ga0207700_101415513 209
1500 3300025931 Ga0207644_10010037 Ga0207644_100100378 209
1501 3300025931 Ga0207644_10146245 Ga0207644_101462451 209
1502 3300025931 Ga0207644_10226427 Ga0207644_102264271 209
1503 3300025931 Ga0207644_10333789 Ga0207644_103337892 209
1504 3300025931 Ga0207644_10458478 Ga0207644_104584781 209
1505 3300025931 Ga0207644_10501258 Ga0207644_105012582 209
1506 3300025932 Ga0207690_10058058 Ga0207690_100580584 209
1507 3300025932 Ga0207690_10139335 Ga0207690_101393353 209
1508 3300025932 Ga0207690_10166938 Ga0207690_101669381 209
1509 3300025932 Ga0207690_10172458 Ga0207690_101724581 209
1510 3300025932 Ga0207690_10591292 Ga0207690_105912921 209
1511 3300025933 Ga0207706_10003002 Ga0207706_1000300222 209
1512 3300025933 Ga0207706_10020673 Ga0207706_100206732 209
1513 3300025933 Ga0207706_10039465 Ga0207706_100394655 209
1514 3300025933 Ga0207706_10068615 Ga0207706_100686156 209
1515 3300025933 Ga0207706_10130391 Ga0207706_101303912 209
1516 3300025933 Ga0207706_10178124 Ga0207706_101781242 209
1517 3300025933 Ga0207706_10229657 Ga0207706_102296572 209
1518 3300025933 Ga0207706_10238526 Ga0207706_102385261 209
1519 3300025934 Ga0207686_10004734 Ga0207686_1000473410 209
1520 3300025934 Ga0207686_10075411 Ga0207686_100754111 209
1521 3300025934 Ga0207686_10192333 Ga0207686_101923331 209
1522 3300025934 Ga0207686_10824397 Ga0207686_108243971 209
1523 3300025934 Ga0207686_10903687 Ga0207686_109036871 209
1524 3300025935 Ga0207709_10011617 Ga0207709_100116178 209
1525 3300025935 Ga0207709_10041239 Ga0207709_100412393 209
1526 3300025935 Ga0207709_10081450 Ga0207709_100814501 209
1527 3300025935 Ga0207709_10721026 Ga0207709_107210261 209
1528 3300025936 Ga0207670_10007706 Ga0207670_100077066 209
1529 3300025936 Ga0207670_10025883 Ga0207670_100258832 209
1530 3300025936 Ga0207670_10027007 Ga0207670_100270073 209
1531 3300025936 Ga0207670_10034333 Ga0207670_100343332 209
1532 3300025936 Ga0207670_10156809 Ga0207670_101568092 209
1533 3300025936 Ga0207670_10418309 Ga0207670_104183092 209
1534 3300025936 Ga0207670_10573462 Ga0207670_105734621 209
1535 3300025937 Ga0207669_10001534 Ga0207669_100015346 209
1536 3300025937 Ga0207669_10006465 Ga0207669_100064654 209
1537 3300025937 Ga0207669_10026903 Ga0207669_100269032 209
1538 3300025937 Ga0207669_10057360 Ga0207669_100573605 209
1539 3300025937 Ga0207669_10060566 Ga0207669_100605665 209
1540 3300025937 Ga0207669_10073605 Ga0207669_100736052 209
1541 3300025937 Ga0207669_10085914 Ga0207669_100859143 209
1542 3300025937 Ga0207669_10087455 Ga0207669_100874552 209
1543 3300025937 Ga0207669_10185475 Ga0207669_101854753 209
1544 3300025937 Ga0207669_10210239 Ga0207669_102102392 209
1545 3300025937 Ga0207669_10240587 Ga0207669_102405872 209
1546 3300025937 Ga0207669_10399510 Ga0207669_103995101 209
1547 3300025937 Ga0207669_10609225 Ga0207669_106092251 209
1548 3300025938 Ga0207704_10005824 Ga0207704_100058243 209
1549 3300025938 Ga0207704_10138888 Ga0207704_101388882 209
1550 3300025938 Ga0207704_10166456 Ga0207704_101664563 209
1551 3300025938 Ga0207704_10366218 Ga0207704_103662182 209
1552 3300025938 Ga0207704_10369154 Ga0207704_103691542 209
1553 3300025938 Ga0207704_10516050 Ga0207704_105160501 209
1554 3300025938 Ga0207704_10717329 Ga0207704_107173292 209
1555 3300025938 Ga0207704_10720062 Ga0207704_107200621 209
1556 3300025938 Ga0207704_10805928 Ga0207704_108059281 209
1557 3300025938 Ga0207704_10958899 Ga0207704_109588991 209
1558 3300025939 Ga0207665_10288909 Ga0207665_102889092 209
1559 3300025940 Ga0207691_10002430 Ga0207691_100024308 209
1560 3300025940 Ga0207691_10024983 Ga0207691_100249838 209
1561 3300025940 Ga0207691_10049701 Ga0207691_100497013 209
1562 3300025940 Ga0207691_10086714 Ga0207691_100867143 209
1563 3300025940 Ga0207691_10087733 Ga0207691_100877332 209
1564 3300025940 Ga0207691_10125854 Ga0207691_101258542 209
1565 3300025940 Ga0207691_10144932 Ga0207691_101449323 209
1566 3300025940 Ga0207691_10238996 Ga0207691_102389961 209
1567 3300025940 Ga0207691_10268647 Ga0207691_102686472 209
1568 3300025940 Ga0207691_10556661 Ga0207691_105566612 209
1569 3300025940 Ga0207691_10693218 Ga0207691_106932181 209
1570 3300025940 Ga0207691_10713906 Ga0207691_107139062 209
1571 3300025940 Ga0207691_10718283 Ga0207691_107182831 209
1572 3300025941 Ga0207711_10007764 Ga0207711_100077648 209
1573 3300025941 Ga0207711_10039221 Ga0207711_100392212 209
1574 3300025941 Ga0207711_10052014 Ga0207711_100520142 209
1575 3300025941 Ga0207711_10057128 Ga0207711_100571282 209
1576 3300025941 Ga0207711_10060104 Ga0207711_100601043 209
1577 3300025941 Ga0207711_10107842 Ga0207711_101078422 209
1578 3300025941 Ga0207711_10133902 Ga0207711_101339022 209
1579 3300025941 Ga0207711_10178848 Ga0207711_101788481 209
1580 3300025941 Ga0207711_10180721 Ga0207711_101807212 209
1581 3300025941 Ga0207711_10229285 Ga0207711_102292852 209
1582 3300025941 Ga0207711_10270693 Ga0207711_102706932 209
1583 3300025941 Ga0207711_10751026 Ga0207711_107510262 209
1584 3300025941 Ga0207711_10776574 Ga0207711_107765742 209
1585 3300025941 Ga0207711_10998537 Ga0207711_109985371 209
1586 3300025942 Ga0207689_10001000 Ga0207689_1000100021 209
1587 3300025942 Ga0207689_10003297 Ga0207689_100032972 209
1588 3300025942 Ga0207689_10007360 Ga0207689_1000736021 209
1589 3300025942 Ga0207689_10107704 Ga0207689_101077042 209
1590 3300025942 Ga0207689_10112798 Ga0207689_101127983 209
1591 3300025942 Ga0207689_10241757 Ga0207689_102417573 209
1592 3300025942 Ga0207689_10282291 Ga0207689_102822912 209
1593 3300025942 Ga0207689_10312222 Ga0207689_103122222 209
1594 3300025942 Ga0207689_10371375 Ga0207689_103713752 209
1595 3300025942 Ga0207689_10967386 Ga0207689_109673861 209
1596 3300025944 Ga0207661_10044598 Ga0207661_100445986 209
1597 3300025944 Ga0207661_10221814 Ga0207661_102218143 209
1598 3300025944 Ga0207661_10589335 Ga0207661_105893351 209
1599 3300025944 Ga0207661_10708758 Ga0207661_107087582 209
1600 3300025945 Ga0207679_10002463 Ga0207679_100024634 209
1601 3300025945 Ga0207679_10022489 Ga0207679_100224894 209
1602 3300025945 Ga0207679_10038904 Ga0207679_100389042 209
1603 3300025945 Ga0207679_10049285 Ga0207679_100492854 209
1604 3300025945 Ga0207679_10050973 Ga0207679_100509731 209
1605 3300025945 Ga0207679_10081178 Ga0207679_100811782 209
1606 3300025945 Ga0207679_10227628 Ga0207679_102276281 209
1607 3300025949 Ga0207667_10023790 Ga0207667_100237909 209
1608 3300025949 Ga0207667_10528120 Ga0207667_105281202 209
1609 3300025949 Ga0207667_10589147 Ga0207667_105891472 209
1610 3300025949 Ga0207667_11250966 Ga0207667_112509661 209
1611 3300025949 Ga0207667_11282554 Ga0207667_112825541 209
1612 3300025960 Ga0207651_10001161 Ga0207651_100011613 209
1613 3300025960 Ga0207651_10010560 Ga0207651_100105604 209
1614 3300025960 Ga0207651_10014879 Ga0207651_100148791 209
1615 3300025960 Ga0207651_10049553 Ga0207651_100495535 209
1616 3300025960 Ga0207651_10051978 Ga0207651_100519782 209
1617 3300025960 Ga0207651_10056124 Ga0207651_100561245 209
1618 3300025960 Ga0207651_10061960 Ga0207651_100619603 209
1619 3300025960 Ga0207651_10118554 Ga0207651_101185542 209
1620 3300025960 Ga0207651_10200522 Ga0207651_102005221 209
1621 3300025960 Ga0207651_10208035 Ga0207651_102080351 209
1622 3300025960 Ga0207651_10219115 Ga0207651_102191153 209
1623 3300025960 Ga0207651_10306787 Ga0207651_103067871 209
1624 3300025960 Ga0207651_10358372 Ga0207651_103583722 209
1625 3300025960 Ga0207651_10385662 Ga0207651_103856622 209
1626 3300025960 Ga0207651_10552714 Ga0207651_105527141 209
1627 3300025961 Ga0207712_10003381 Ga0207712_100033813 209
1628 3300025961 Ga0207712_10041160 Ga0207712_100411603 209
1629 3300025961 Ga0207712_10064313 Ga0207712_100643132 209
1630 3300025972 Ga0207668_10011279 Ga0207668_100112795 209
1631 3300025972 Ga0207668_10070697 Ga0207668_100706972 209
1632 3300025972 Ga0207668_10512985 Ga0207668_105129852 209
1633 3300025972 Ga0207668_10648811 Ga0207668_106488111 209
1634 3300025981 Ga0207640_10067919 Ga0207640_100679194 209
1635 3300025981 Ga0207640_10591851 Ga0207640_105918511 209
1636 3300025981 Ga0207640_10888155 Ga0207640_108881551 209
1637 3300025981 Ga0207640_10904954 Ga0207640_109049541 209
1638 3300025986 Ga0207658_10021688 Ga0207658_100216882 209
1639 3300025986 Ga0207658_10474099 Ga0207658_104740992 209
1640 3300025986 Ga0207658_10479323 Ga0207658_104793231 209
1641 3300025986 Ga0207658_10547644 Ga0207658_105476441 209
1642 3300025986 Ga0207658_10589751 Ga0207658_105897512 209
1643 3300025986 Ga0207658_10591962 Ga0207658_105919622 209
1644 3300025986 Ga0207658_10609549 Ga0207658_106095492 209
1645 3300025986 Ga0207658_10723460 Ga0207658_107234601 209
1646 3300026023 Ga0207677_10009480 Ga0207677_100094805 209
1647 3300026023 Ga0207677_10162940 Ga0207677_101629403 209
1648 3300026023 Ga0207677_10190377 Ga0207677_101903771 209
1649 3300026023 Ga0207677_10219585 Ga0207677_102195852 209
1650 3300026023 Ga0207677_10259950 Ga0207677_102599501 209
1651 3300026023 Ga0207677_10304354 Ga0207677_103043542 209
1652 3300026035 Ga0207703_10004804 Ga0207703_100048049 209
1653 3300026035 Ga0207703_10012018 Ga0207703_100120182 209
1654 3300026035 Ga0207703_10019080 Ga0207703_100190803 209
1655 3300026035 Ga0207703_10102085 Ga0207703_101020852 209
1656 3300026035 Ga0207703_10146564 Ga0207703_101465643 209
1657 3300026035 Ga0207703_10155443 Ga0207703_101554432 209
1658 3300026035 Ga0207703_10168528 Ga0207703_101685285 209
1659 3300026035 Ga0207703_10273055 Ga0207703_102730553 209
1660 3300026035 Ga0207703_10273631 Ga0207703_102736312 209
1661 3300026035 Ga0207703_10487739 Ga0207703_104877391 209
1662 3300026041 Ga0207639_10221698 Ga0207639_102216983 209
1663 3300026041 Ga0207639_11062593 Ga0207639_110625931 209
1664 3300026067 Ga0207678_10066182 Ga0207678_100661826 209
1665 3300026067 Ga0207678_10102815 Ga0207678_101028152 209
1666 3300026067 Ga0207678_10117567 Ga0207678_101175672 209
1667 3300026067 Ga0207678_10117685 Ga0207678_101176852 209
1668 3300026067 Ga0207678_10178014 Ga0207678_101780142 209
1669 3300026067 Ga0207678_10272613 Ga0207678_102726132 209
1670 3300026067 Ga0207678_10582420 Ga0207678_105824201 209
1671 3300026075 Ga0207708_10000882 Ga0207708_1000088216 209
1672 3300026075 Ga0207708_10017896 Ga0207708_100178964 209
1673 3300026075 Ga0207708_10028812 Ga0207708_100288122 209
1674 3300026075 Ga0207708_10054200 Ga0207708_100542002 209
1675 3300026075 Ga0207708_10100853 Ga0207708_101008534 209
1676 3300026075 Ga0207708_10235248 Ga0207708_102352481 209
1677 3300026075 Ga0207708_10310096 Ga0207708_103100962 209
1678 3300026075 Ga0207708_10490040 Ga0207708_104900402 209
1679 3300026075 Ga0207708_10655105 Ga0207708_106551051 209
1680 3300026075 Ga0207708_10660005 Ga0207708_106600051 209
1681 3300026075 Ga0207708_10871570 Ga0207708_108715701 209
1682 3300026088 Ga0207641_10001674 Ga0207641_1000167416 209
1683 3300026088 Ga0207641_10070196 Ga0207641_100701964 209
1684 3300026088 Ga0207641_10156857 Ga0207641_101568573 209
1685 3300026088 Ga0207641_10178734 Ga0207641_101787343 209
1686 3300026088 Ga0207641_10295610 Ga0207641_102956102 209
1687 3300026088 Ga0207641_11049231 Ga0207641_110492311 209
1688 3300026089 Ga0207648_10001325 Ga0207648_1000132516 209
1689 3300026089 Ga0207648_10003371 Ga0207648_1000337122 209
1690 3300026089 Ga0207648_10009527 Ga0207648_100095274 209
1691 3300026089 Ga0207648_10040376 Ga0207648_100403763 209
1692 3300026089 Ga0207648_10134536 Ga0207648_101345362 209
1693 3300026089 Ga0207648_10166669 Ga0207648_101666692 209
1694 3300026089 Ga0207648_10196263 Ga0207648_101962632 209
1695 3300026089 Ga0207648_10351156 Ga0207648_103511562 209
1696 3300026089 Ga0207648_10450294 Ga0207648_104502942 209
1697 3300026095 Ga0207676_10047359 Ga0207676_100473597 209
1698 3300026095 Ga0207676_10164389 Ga0207676_101643892 209
1699 3300026095 Ga0207676_10174037 Ga0207676_101740372 209
1700 3300026095 Ga0207676_10233180 Ga0207676_102331801 209
1701 3300026095 Ga0207676_10367426 Ga0207676_103674261 209
1702 3300026095 Ga0207676_10500977 Ga0207676_105009771 209
1703 3300026095 Ga0207676_10894980 Ga0207676_108949801 209
1704 3300026095 Ga0207676_11155570 Ga0207676_111555701 209
1705 3300026095 Ga0207676_11413216 Ga0207676_114132161 209
1706 3300026116 Ga0207674_10009273 Ga0207674_100092738 209
1707 3300026116 Ga0207674_10124568 Ga0207674_101245686 209
1708 3300026116 Ga0207674_10156039 Ga0207674_101560392 209
1709 3300026116 Ga0207674_10168702 Ga0207674_101687022 209
1710 3300026116 Ga0207674_10199464 Ga0207674_101994642 209
1711 3300026116 Ga0207674_10326538 Ga0207674_103265382 209
1712 3300026116 Ga0207674_10798839 Ga0207674_107988391 209
1713 3300026118 Ga0207675_100004079 Ga0207675_10000407912 209
1714 3300026118 Ga0207675_100010469 Ga0207675_1000104697 209
1715 3300026118 Ga0207675_100017733 Ga0207675_1000177338 209
1716 3300026118 Ga0207675_100071117 Ga0207675_1000711172 209
1717 3300026118 Ga0207675_100128637 Ga0207675_1001286372 209
1718 3300026118 Ga0207675_100149477 Ga0207675_1001494772 209
1719 3300026118 Ga0207675_100230290 Ga0207675_1002302903 209
1720 3300026118 Ga0207675_100233268 Ga0207675_1002332681 209
1721 3300026118 Ga0207675_100411430 Ga0207675_1004114302 209
1722 3300026118 Ga0207675_100515784 Ga0207675_1005157841 209
1723 3300026118 Ga0207675_100731252 Ga0207675_1007312521 209
1724 3300026121 Ga0207683_10018689 Ga0207683_100186894 209
1725 3300026121 Ga0207683_10032201 Ga0207683_100322011 209
1726 3300026121 Ga0207683_10078796 Ga0207683_100787963 209
1727 3300026121 Ga0207683_10081692 Ga0207683_100816922 209
1728 3300026121 Ga0207683_10123021 Ga0207683_101230212 209
1729 3300026121 Ga0207683_10137533 Ga0207683_101375331 209
1730 3300026121 Ga0207683_10164745 Ga0207683_101647452 209
1731 3300026121 Ga0207683_10293815 Ga0207683_102938152 209
1732 3300026121 Ga0207683_10307296 Ga0207683_103072962 209
1733 3300026121 Ga0207683_10352379 Ga0207683_103523791 209
1734 3300026121 Ga0207683_10427339 Ga0207683_104273392 209
1735 3300026121 Ga0207683_10716274 Ga0207683_107162742 209
1736 3300026142 Ga0207698_10486586 Ga0207698_104865862 209
1737 3300026142 Ga0207698_10586081 Ga0207698_105860812 209
1738 3300026142 Ga0207698_11174219 Ga0207698_111742191 209
1739 3300027552 Ga0209982_1040490 Ga0209982_10404901 209
1740 3300027695 Ga0209966_1027107 Ga0209966_10271071 209
1741 3300027866 Ga0209813_10013250 Ga0209813_100132501 209
1742 3300027907 Ga0207428_10000034 Ga0207428_10000034193 209
1743 3300027907 Ga0207428_10000570 Ga0207428_1000057028 209
1744 3300027907 Ga0207428_10001541 Ga0207428_100015418 209
1745 3300027907 Ga0207428_10002655 Ga0207428_100026554 209
1746 3300027907 Ga0207428_10003291 Ga0207428_100032915 209
1747 3300027907 Ga0207428_10008876 Ga0207428_100088768 209
1748 3300027907 Ga0207428_10045568 Ga0207428_100455681 209
1749 3300027907 Ga0207428_10074323 Ga0207428_100743232 209
1750 3300027907 Ga0207428_10084189 Ga0207428_100841892 209
1751 3300027907 Ga0207428_10255017 Ga0207428_102550172 209
1752 3300027907 Ga0207428_10255471 Ga0207428_102554712 209
1753 3300027907 Ga0207428_10262358 Ga0207428_102623582 209
1754 3300028379 Ga0268266_10005896 Ga0268266_1000589620 209
1755 3300028379 Ga0268266_10049271 Ga0268266_100492713 209
1756 3300028379 Ga0268266_10056360 Ga0268266_100563604 209
1757 3300028379 Ga0268266_10057052 Ga0268266_100570526 209
1758 3300028379 Ga0268266_10209252 Ga0268266_102092522 209
1759 3300028379 Ga0268266_10544641 Ga0268266_105446412 209
1760 3300028380 Ga0268265_10008958 Ga0268265_100089583 209
1761 3300028380 Ga0268265_10019387 Ga0268265_100193874 209
1762 3300028380 Ga0268265_10127577 Ga0268265_101275773 209
1763 3300028380 Ga0268265_10142016 Ga0268265_101420161 209
1764 3300028380 Ga0268265_10174244 Ga0268265_101742441 209
1765 3300028380 Ga0268265_10269578 Ga0268265_102695781 209
1766 3300028380 Ga0268265_10475751 Ga0268265_104757512 209
1767 3300028380 Ga0268265_10600706 Ga0268265_106007062 209
1768 3300028380 Ga0268265_10949106 Ga0268265_109491061 209
1769 3300028380 Ga0268265_11425686 Ga0268265_114256861 209
1770 3300028381 Ga0268264_10037154 Ga0268264_100371544 209
1771 3300028381 Ga0268264_10363921 Ga0268264_103639211 209
1772 3300028381 Ga0268264_10479987 Ga0268264_104799872 209
1773 3300028381 Ga0268264_10542477 Ga0268264_105424771 209
1774 3300028381 Ga0268264_10630438 Ga0268264_106304382 209
1775 3300028381 Ga0268264_10712318 Ga0268264_107123181 209
1776 3300028381 Ga0268264_11064612 Ga0268264_110646121 209
1777 3300028381 Ga0268264_11101091 Ga0268264_111010911 209
1778 3300028577 Ga0265318_10025073 Ga0265318_100250732 209
1779 3300028786 Ga0307517_10126685 Ga0307517_101266852 209
1780 3300031238 Ga0265332_10052450 Ga0265332_100524504 209
1781 3300031250 Ga0265331_10026121 Ga0265331_100261212 209
1782 3300031250 Ga0265331_10026600 Ga0265331_100266002 209
1783 3300031251 Ga0265327_10006182 Ga0265327_1000618211 209
1784 3300031456 Ga0307513_10217556 Ga0307513_102175562 209
1785 3300031548 Ga0307408_100009579 Ga0307408_10000957910 209
1786 3300031548 Ga0307408_100041525 Ga0307408_1000415254 209
1787 3300031548 Ga0307408_100081857 Ga0307408_1000818572 209
1788 3300031548 Ga0307408_100104605 Ga0307408_1001046053 209
1789 3300031548 Ga0307408_100412523 Ga0307408_1004125232 209
1790 3300031548 Ga0307408_100418337 Ga0307408_1004183371 209
1791 3300031548 Ga0307408_100517797 Ga0307408_1005177972 209
1792 3300031712 Ga0265342_10097922 Ga0265342_100979222 209
1793 3300031731 Ga0307405_10000803 Ga0307405_100008032 209
1794 3300031731 Ga0307405_10016142 Ga0307405_100161422 209
1795 3300031731 Ga0307405_10074792 Ga0307405_100747923 209
1796 3300031731 Ga0307405_10165514 Ga0307405_101655143 209
1797 3300031731 Ga0307405_10195835 Ga0307405_101958352 209
1798 3300031731 Ga0307405_10345730 Ga0307405_103457301 209
1799 3300031731 Ga0307405_10583624 Ga0307405_105836241 209
1800 3300031824 Ga0307413_10028200 Ga0307413_100282004 209
1801 3300031824 Ga0307413_10036034 Ga0307413_100360343 209
1802 3300031824 Ga0307413_10047131 Ga0307413_100471311 209
1803 3300031824 Ga0307413_10049240 Ga0307413_100492402 209
1804 3300031824 Ga0307413_10140127 Ga0307413_101401272 209
1805 3300031824 Ga0307413_10150474 Ga0307413_101504741 209
1806 3300031824 Ga0307413_10178118 Ga0307413_101781182 209
1807 3300031824 Ga0307413_10589175 Ga0307413_105891751 209
1808 3300031852 Ga0307410_10012187 Ga0307410_100121877 209
1809 3300031852 Ga0307410_10033332 Ga0307410_100333322 209
1810 3300031852 Ga0307410_10065395 Ga0307410_100653953 209
1811 3300031852 Ga0307410_10078598 Ga0307410_100785982 209
1812 3300031852 Ga0307410_10148003 Ga0307410_101480032 209
1813 3300031852 Ga0307410_10156869 Ga0307410_101568692 209
1814 3300031852 Ga0307410_10223935 Ga0307410_102239352 209
1815 3300031852 Ga0307410_10244485 Ga0307410_102444852 209
1816 3300031852 Ga0307410_10408702 Ga0307410_104087022 209
1817 3300031852 Ga0307410_10534438 Ga0307410_105344381 209
1818 3300031852 Ga0307410_10599838 Ga0307410_105998381 209
1819 3300031901 Ga0307406_10116656 Ga0307406_101166562 209
1820 3300031901 Ga0307406_10319564 Ga0307406_103195642 209
1821 3300031901 Ga0307406_10622802 Ga0307406_106228021 209
1822 3300031901 Ga0307406_10880529 Ga0307406_108805291 209
1823 3300031903 Ga0307407_10003307 Ga0307407_1000330711 209
1824 3300031903 Ga0307407_10009357 Ga0307407_100093573 209
1825 3300031903 Ga0307407_10019704 Ga0307407_100197045 209
1826 3300031903 Ga0307407_10175408 Ga0307407_101754082 209
1827 3300031903 Ga0307407_10187634 Ga0307407_101876341 209
1828 3300031903 Ga0307407_10249565 Ga0307407_102495651 209
1829 3300031911 Ga0307412_10123960 Ga0307412_101239601 209
1830 3300031911 Ga0307412_10154023 Ga0307412_101540231 209
1831 3300031911 Ga0307412_10367567 Ga0307412_103675672 209
1832 3300031911 Ga0307412_10383252 Ga0307412_103832521 209
1833 3300031911 Ga0307412_10645491 Ga0307412_106454911 209
1834 3300031911 Ga0307412_10762721 Ga0307412_107627211 209
1835 3300031911 Ga0307412_10774637 Ga0307412_107746371 209
1836 3300031911 Ga0307412_10881191 Ga0307412_108811911 209
1837 3300031995 Ga0307409_100004378 Ga0307409_1000043785 209
1838 3300031995 Ga0307409_100011421 Ga0307409_1000114217 209
1839 3300031995 Ga0307409_100099397 Ga0307409_1000993973 209
1840 3300031995 Ga0307409_100127852 Ga0307409_1001278523 209
1841 3300031995 Ga0307409_100275881 Ga0307409_1002758811 209
1842 3300031995 Ga0307409_100283001 Ga0307409_1002830011 209
1843 3300031995 Ga0307409_100318748 Ga0307409_1003187483 209
1844 3300031995 Ga0307409_100344953 Ga0307409_1003449532 209
1845 3300031995 Ga0307409_100529815 Ga0307409_1005298152 209
1846 3300031995 Ga0307409_100603894 Ga0307409_1006038942 209
1847 3300032002 Ga0307416_100000919 Ga0307416_1000009192 209
1848 3300032002 Ga0307416_100004359 Ga0307416_1000043594 209
1849 3300032002 Ga0307416_100012158 Ga0307416_1000121586 209
1850 3300032002 Ga0307416_100015366 Ga0307416_1000153664 209
1851 3300032002 Ga0307416_100041323 Ga0307416_1000413232 209
1852 3300032002 Ga0307416_100068724 Ga0307416_1000687243 209
1853 3300032002 Ga0307416_100113353 Ga0307416_1001133532 209
1854 3300032002 Ga0307416_100146102 Ga0307416_1001461022 209
1855 3300032002 Ga0307416_100248436 Ga0307416_1002484362 209
1856 3300032002 Ga0307416_100642378 Ga0307416_1006423782 209
1857 3300032002 Ga0307416_100724505 Ga0307416_1007245052 209
1858 3300032002 Ga0307416_101077550 Ga0307416_1010775502 209
1859 3300032002 Ga0307416_101142029 Ga0307416_1011420291 209
1860 3300032004 Ga0307414_10010619 Ga0307414_100106192 209
1861 3300032004 Ga0307414_10030537 Ga0307414_100305374 209
1862 3300032004 Ga0307414_10554132 Ga0307414_105541321 209
1863 3300032005 Ga0307411_10007963 Ga0307411_100079637 209
1864 3300032005 Ga0307411_10009190 Ga0307411_100091905 209
1865 3300032005 Ga0307411_10010242 Ga0307411_100102423 209
1866 3300032005 Ga0307411_10039621 Ga0307411_100396213 209
1867 3300032005 Ga0307411_10046370 Ga0307411_100463703 209
1868 3300032005 Ga0307411_10048801 Ga0307411_100488015 209
1869 3300032005 Ga0307411_10129421 Ga0307411_101294212 209
1870 3300032005 Ga0307411_10207252 Ga0307411_102072523 209
1871 3300032005 Ga0307411_10350560 Ga0307411_103505602 209
1872 3300032005 Ga0307411_10412824 Ga0307411_104128242 209
1873 3300032005 Ga0307411_10418645 Ga0307411_104186451 209
1874 3300032005 Ga0307411_10586462 Ga0307411_105864621 209
1875 3300032126 Ga0307415_100014613 Ga0307415_1000146137 209
1876 3300032126 Ga0307415_100056944 Ga0307415_1000569442 209
1877 3300032126 Ga0307415_100085523 Ga0307415_1000855231 209
1878 3300032126 Ga0307415_100116488 Ga0307415_1001164882 209
1879 3300032126 Ga0307415_100448420 Ga0307415_1004484202 209
1880 3300032126 Ga0307415_100519272 Ga0307415_1005192722 209
1881 3300035083 Ga0373926_0137504 Ga0373926_0137504_165_794 209
1882 3300035086 Ga0373934_0003296 Ga0373934_0003296_2811_3440 209
1883 3300035111 Ga0373923_0179827 Ga0373923_0179827_283_912 209
1884 3300035113 Ga0373936_0079889 Ga0373936_0079889_110_739 209
1885 3300035114 Ga0373939_0050501 Ga0373939_0050501_635_1264 209
1886 3300035115 Ga0373941_0000303 Ga0373941_0000303_8281_8910 209
1887 3300035115 Ga0373941_0002721 Ga0373941_0002721_352_981 209
1888 3300035116 Ga0373945_0109036 Ga0373945_0109036_415_1044 209
1889 3300035117 Ga0373953_0127181 Ga0373953_0127181_27_656 209
1890 3300035117 Ga0373953_0164136 Ga0373953_0164136_96_725 209
1891 3300035118 Ga0373954_0167169 Ga0373954_0167169_92_721 209
1892 3300035119 Ga0373956_0017520 Ga0373956_0017520_1089_1718 209
1893 3300035119 Ga0373956_0107377 Ga0373956_0107377_59_688 209
1894 3300035170 Ga0373943_0193570 Ga0373943_0193570_334_963 209
1895 3300035172 Ga0373955_0019684 Ga0373955_0019684_1239_1868 209
1896 3300035410 Ga0373924_0086302 Ga0373924_0086302_67_696 209
1897 3300035691 Ga0373931_0173049 Ga0373931_0173049_552_1181 209
1898 3300035695 Ga0373927_0069174 Ga0373927_0069174_910_1539 209
1899 3300035724 Ga0373933_0014154 Ga0373933_0014154_3464_4093 209
1900 3300035724 Ga0373933_0171422 Ga0373933_0171422_199_828 209
1901 3300035725 Ga0373947_0157807 Ga0373947_0157807_617_1246 209
1902 3300035725 Ga0373947_0207265 Ga0373947_0207265_110_739 209
1903 3300036401 Ga0373937_0000078 Ga0373937_0000078_2740_3369 209
1904 3300036401 Ga0373937_0029266 Ga0373937_0029266_3661_4290 209
1905 3300036401 Ga0373937_0054670 Ga0373937_0054670_2038_2667 209
1906 3300036401 Ga0373937_0337020 Ga0373937_0337020_163_792 209
1907 3300036401 Ga0373937_0346455 Ga0373937_0346455_633_1262 209
1908 3300036401 Ga0373937_0561079 Ga0373937_0561079_288_917 209
1909 3300037068 Ga0373925_0086238 Ga0373925_0086238_1322_1951 209
1910 3300037068 Ga0373925_0103284 Ga0373925_0103284_733_1362 209
1911 3300037068 Ga0373925_0165183 Ga0373925_0165183_1001_1630 209
1912 3300037068 Ga0373925_0511954 Ga0373925_0511954_60_689 209
1913 3300037068 Ga0373925_0550235 Ga0373925_0550235_104_733 209
1914 3300037471 Ga0395905_1030267 Ga0395905_1030267_36_665 209
1915 3300041408 Ga0439453_0001598 Ga0439453_0001598_894_1523 209
1916 3300041451 Ga0451791_1031143 Ga0451791_1031143_117_746 209
1917 3300041491 Ga0451833_0586875 Ga0451833_0586875_98_727 209
1918 3300041997 Ga0439431_0027903 Ga0439431_0027903_366_995 209
1919 3300042001 Ga0439441_041357 Ga0439441_041357_65_694 209
1920 3300042004 Ga0439445_0009196 Ga0439445_0009196_411_1040 209
1921 3300042007 Ga0439449_0143465 Ga0439449_0143465_193_822 209
1922 3300042008 Ga0439450_007369 Ga0439450_007369_503_1132 209
1923 3300042122 Ga0450920_010633 Ga0450920_010633_442_1071 209
1924 3300042125 Ga0450923_045000 Ga0450923_045000_160_789 209
1925 3300042133 Ga0450896_010372 Ga0450896_010372_520_1149 209
1926 3300042156 Ga0439446_0125160 Ga0439446_0125160_12_641 209
1927 3300042156 Ga0439446_0158883 Ga0439446_0158883_54_683 209
1928 3300042184 Ga0450908_001966 Ga0450908_001966_2922_3551 209
1929 3300042184 Ga0450908_028546 Ga0450908_028546_211_840 209
1930 3300042436 Ga0439435_0107745 Ga0439435_0107745_123_752 209
1931 3300042436 Ga0439435_0133639 Ga0439435_0133639_84_713 209
1932 3300042437 Ga0439444_0040963 Ga0439444_0040963_145_774 209
1933 3300042439 Ga0439464_0006039 Ga0439464_0006039_1281_1910 209
1934 3300042439 Ga0439464_0023863 Ga0439464_0023863_731_1360 209
1935 3300042461 Ga0439460_0157091 Ga0439460_0157091_117_746 209
1936 3300042530 Ga0450916_003234 Ga0450916_003234_966_1595 209
1937 3300042531 Ga0450918_037665 Ga0450918_037665_127_756 209
1938 3300042876 Ga0451577_0047045 Ga0451577_0047045_2720_3349 209
1939 3300042876 Ga0451577_0210621 Ga0451577_0210621_126_755 209
1940 3300042993 Ga0439440_0056842 Ga0439440_0056842_82_711 209
1941 3300042993 Ga0439440_0121700 Ga0439440_0121700_88_717 209
1942 3300044712 Ga0453684_0073154 Ga0453684_0073154_2093_2722 209
1943 3300045051 Ga0451576_0055322 Ga0451576_0055322_2664_3293 209
1944 3300045051 Ga0451576_0129817 Ga0451576_0129817_1516_2145 209
1945 3300045051 Ga0451576_0180853 Ga0451576_0180853_277_906 209
1946 3300045976 Ga0466967_0013058 Ga0466967_0013058_68_697 209
1947 3300045976 Ga0466967_0306619 Ga0466967_0306619_376_1005 209
1948 3300045976 Ga0466967_0435178 Ga0466967_0435178_634_1263 209
1949 3300046454 Ga0495592_0139849 Ga0495592_0139849_647_1276 209
1950 3300046454 Ga0495592_0232506 Ga0495592_0232506_280_909 209
1951 3300046455 Ga0495603_0145060 Ga0495603_0145060_16_645 209
1952 3300046459 Ga0495629_0099600 Ga0495629_0099600_384_1013 209
1953 3300046459 Ga0495629_0334215 Ga0495629_0334215_351_980 209
1954 3300046462 Ga0495651_0064887 Ga0495651_0064887_1073_1702 209
1955 3300046473 Ga0495582_0136999 Ga0495582_0136999_238_867 209
1956 3300046475 Ga0495639_0036679 Ga0495639_0036679_164_793 209
1957 3300046475 Ga0495639_0104325 Ga0495639_0104325_322_951 209
1958 3300046475 Ga0495639_0189425 Ga0495639_0189425_259_888 209
1959 3300046476 Ga0495662_0071453 Ga0495662_0071453_162_791 209
1960 3300046477 Ga0495664_0125493 Ga0495664_0125493_410_1039 209
1961 3300046499 Ga0495594_0030252 Ga0495594_0030252_2268_2897 209
1962 3300046516 Ga0495628_0148401 Ga0495628_0148401_868_1497 209
1963 3300046516 Ga0495628_0177214 Ga0495628_0177214_197_826 209
1964 3300046517 Ga0495630_0073990 Ga0495630_0073990_1655_2284 209
1965 3300046517 Ga0495630_0092350 Ga0495630_0092350_206_835 209
1966 3300046517 Ga0495630_0569630 Ga0495630_0569630_67_696 209
1967 3300046522 Ga0495643_0013652 Ga0495643_0013652_29_658 209
1968 3300046526 Ga0495666_0174052 Ga0495666_0174052_78_707 209
1969 3300046528 Ga0495642_0283570 Ga0495642_0283570_70_699 209
1970 3300046529 Ga0495652_0154812 Ga0495652_0154812_798_1427 209
1971 3300046529 Ga0495652_0540062 Ga0495652_0540062_36_665 209
1972 3300046533 Ga0495640_0028932 Ga0495640_0028932_3079_3708 209
1973 3300046533 Ga0495640_0576634 Ga0495640_0576634_20_649 209
1974 3300046538 Ga0495609_0141899 Ga0495609_0141899_261_890 209
1975 3300046539 Ga0495621_0096056 Ga0495621_0096056_67_696 209
1976 3300046543 Ga0495645_0004427 Ga0495645_0004427_8824_9453 209
1977 3300046559 Ga0495667_0495049 Ga0495667_0495049_74_703 209
1978 3300046615 Ga0495656_0098233 Ga0495656_0098233_449_1078 209
1979 3300046642 Ga0495634_0263198 Ga0495634_0263198_211_840 209
1980 3300046642 Ga0495634_0279618 Ga0495634_0279618_373_1002 209
1981 3300046663 Ga0495635_0074135 Ga0495635_0074135_1337_1966 209
1982 3300046663 Ga0495635_0107921 Ga0495635_0107921_1169_1798 209
1983 3300046674 Ga0495588_0287210 Ga0495588_0287210_223_852 209
1984 3300046678 Ga0495599_0188203 Ga0495599_0188203_87_716 209
1985 3300046681 Ga0495647_0012912 Ga0495647_0012912_964_1593 209
1986 3300046681 Ga0495647_0146656 Ga0495647_0146656_265_894 209
1987 3300046681 Ga0495647_0285254 Ga0495647_0285254_91_720 209
1988 3300046683 Ga0495658_0022257 Ga0495658_0022257_209_838 209
1989 3300046683 Ga0495658_0040929 Ga0495658_0040929_214_843 209
1990 3300046683 Ga0495658_0117527 Ga0495658_0117527_117_746 209
1991 3300046683 Ga0495658_0239807 Ga0495658_0239807_28_657 209
1992 3300046684 Ga0495669_0000560 Ga0495669_0000560_12014_12643 209
1993 3300046689 Ga0495613_0305757 Ga0495613_0305757_413_1042 209
1994 3300046690 Ga0495624_0400843 Ga0495624_0400843_113_742 209
1995 3300046691 Ga0495670_0239994 Ga0495670_0239994_14_643 209
1996 3300046691 Ga0495670_0265736 Ga0495670_0265736_138_767 209
1997 3300046794 Ga0495589_0131816 Ga0495589_0131816_319_948 209
1998 3300046809 Ga0495600_0163605 Ga0495600_0163605_503_1132 209
1999 3300046809 Ga0495600_0285496 Ga0495600_0285496_44_673 209
2000 3300047319 Ga0495674_0046172 Ga0495674_0046172_123_752 209
2001 3300047319 Ga0495674_0114459 Ga0495674_0114459_1475_2104 209
2002 3300047320 Ga0495672_0242644 Ga0495672_0242644_124_753 209
2003 3300047322 Ga0495680_0625781 Ga0495680_0625781_51_680 209
2004 3300047471 Ga0495684_0123898 Ga0495684_0123898_305_934 209
2005 3300047471 Ga0495684_0201826 Ga0495684_0201826_278_907 209
2006 3300048088 Ga0495602_0177945 Ga0495602_0177945_999_1628 209
2007 3300048903 Ga0496100_0010085 Ga0496100_0010085_1274_1903 209
2008 3300048903 Ga0496100_0310639 Ga0496100_0310639_28_657 209
2009 3300048904 Ga0496101_0016859 Ga0496101_0016859_2480_3109 209
2010 3300048904 Ga0496101_0266502 Ga0496101_0266502_583_1212 209
2011 3300048904 Ga0496101_0707671 Ga0496101_0707671_78_707 209
2012 3300048905 Ga0496102_0002334 Ga0496102_0002334_2164_2793 209
2013 3300048905 Ga0496102_0135592 Ga0496102_0135592_946_1575 209
2014 3300048905 Ga0496102_0277207 Ga0496102_0277207_442_1071 209
2015 3300048905 Ga0496102_0326231 Ga0496102_0326231_217_846 209
2016 3300048905 Ga0496102_0955202 Ga0496102_0955202_29_658 209
2017 3300048906 Ga0496103_0224961 Ga0496103_0224961_27_656 209
2018 3300048906 Ga0496103_0244001 Ga0496103_0244001_438_1067 209
2019 3300048907 Ga0496104_0007555 Ga0496104_0007555_6032_6661 209
2020 3300048907 Ga0496104_0067592 Ga0496104_0067592_1724_2353 209
2021 3300048907 Ga0496104_0227549 Ga0496104_0227549_1004_1633 209
2022 3300048907 Ga0496104_0384419 Ga0496104_0384419_617_1246 209
2023 3300048907 Ga0496104_0556906 Ga0496104_0556906_26_655 209
2024 3300048908 Ga0496105_0068336 Ga0496105_0068336_1042_1671 209
2025 3300048908 Ga0496105_0329159 Ga0496105_0329159_461_1090 209
2026 3300048909 Ga0496106_0041654 Ga0496106_0041654_2117_2746 209
2027 3300048909 Ga0496106_0071722 Ga0496106_0071722_885_1514 209
2028 3300048909 Ga0496106_0143911 Ga0496106_0143911_1073_1702 209
2029 3300048909 Ga0496106_0367990 Ga0496106_0367990_19_648 209
2030 3300048909 Ga0496106_0489609 Ga0496106_0489609_245_874 209
2031 3300048910 Ga0496107_0005187 Ga0496107_0005187_535_1164 209
2032 3300048910 Ga0496107_0191376 Ga0496107_0191376_291_920 209
2033 3300048910 Ga0496107_0277259 Ga0496107_0277259_83_712 209
2034 3300048911 Ga0496108_0003558 Ga0496108_0003558_4143_4772 209
2035 3300048911 Ga0496108_0049568 Ga0496108_0049568_1008_1637 209
2036 3300048911 Ga0496108_0136632 Ga0496108_0136632_707_1336 209
2037 3300048911 Ga0496108_0262973 Ga0496108_0262973_592_1221 209
2038 3300048912 Ga0496109_0163620 Ga0496109_0163620_652_1281 209
2039 3300048912 Ga0496109_0191062 Ga0496109_0191062_990_1619 209
2040 3300048912 Ga0496109_0394985 Ga0496109_0394985_575_1204 209
2041 3300048913 Ga0496110_0002017 Ga0496110_0002017_5019_5648 209
2042 3300048913 Ga0496110_0201186 Ga0496110_0201186_105_734 209
2043 3300048913 Ga0496110_0694166 Ga0496110_0694166_218_847 209
2044 3300048914 Ga0496111_0013343 Ga0496111_0013343_3446_4075 209
2045 3300048914 Ga0496111_0162226 Ga0496111_0162226_757_1386 209
2046 3300048915 Ga0496112_0016237 Ga0496112_0016237_867_1496 209
2047 3300048915 Ga0496112_0023335 Ga0496112_0023335_74_703 209
2048 3300048915 Ga0496112_0055411 Ga0496112_0055411_62_691 209
2049 3300048915 Ga0496112_0131149 Ga0496112_0131149_1147_1776 209
2050 3300048916 Ga0496113_0041393 Ga0496113_0041393_1196_1825 209
2051 3300048916 Ga0496113_0081736 Ga0496113_0081736_1002_1631 209
2052 3300048916 Ga0496113_0370077 Ga0496113_0370077_425_1054 209
2053 3300048917 Ga0496114_0000246 Ga0496114_0000246_6314_6943 209
2054 3300048917 Ga0496114_0249159 Ga0496114_0249159_44_673 209
2055 3300048918 Ga0496115_0038979 Ga0496115_0038979_1904_2533 209
2056 3300048918 Ga0496115_0132970 Ga0496115_0132970_965_1594 209
2057 3300049568 Ga0501031_0000508 Ga0501031_0000508_21286_21915 209
2058 3300049568 Ga0501031_0065255 Ga0501031_0065255_580_1209 209
2059 3300049568 Ga0501031_0120424 Ga0501031_0120424_928_1557 209
2060 3300049568 Ga0501031_0494822 Ga0501031_0494822_30_659 209
2061 3300049569 Ga0501032_0009569 Ga0501032_0009569_1466_2095 209
2062 3300049569 Ga0501032_0101474 Ga0501032_0101474_360_989 209
2063 3300049569 Ga0501032_0103097 Ga0501032_0103097_900_1529 209
2064 3300049570 Ga0501033_0003919 Ga0501033_0003919_261_890 209
2065 3300049570 Ga0501033_0025404 Ga0501033_0025404_3448_4077 209
2066 3300049570 Ga0501033_0070516 Ga0501033_0070516_263_892 209
2067 3300049570 Ga0501033_0511871 Ga0501033_0511871_142_771 209
2068 3300049571 Ga0501034_0002859 Ga0501034_0002859_17372_18001 209
2069 3300049571 Ga0501034_0018524 Ga0501034_0018524_1317_1946 209
2070 3300049571 Ga0501034_0053026 Ga0501034_0053026_671_1300 209
2071 3300049572 Ga0501036_0030112 Ga0501036_0030112_447_1076 209
2072 3300049572 Ga0501036_0046868 Ga0501036_0046868_834_1463 209
2073 3300049572 Ga0501036_0072464 Ga0501036_0072464_1532_2161 209
2074 3300049572 Ga0501036_0076211 Ga0501036_0076211_1867_2496 209
2075 3300049572 Ga0501036_0085002 Ga0501036_0085002_1213_1842 209
2076 3300049573 Ga0501037_0001323 Ga0501037_0001323_13047_13676 209
2077 3300049573 Ga0501037_0011706 Ga0501037_0011706_671_1300 209
2078 3300049573 Ga0501037_0324779 Ga0501037_0324779_151_780 209
2079 3300049573 Ga0501037_0477823 Ga0501037_0477823_84_713 209
2080 3300049573 Ga0501037_0501720 Ga0501037_0501720_150_779 209
2081 3300049574 Ga0501038_0000812 Ga0501038_0000812_5192_5821 209
2082 3300049574 Ga0501038_0137030 Ga0501038_0137030_375_1004 209
2083 3300049574 Ga0501038_0336133 Ga0501038_0336133_268_897 209
2084 3300049574 Ga0501038_0427174 Ga0501038_0427174_135_764 209
2085 3300049575 Ga0501039_0013227 Ga0501039_0013227_5029_5658 209
2086 3300049575 Ga0501039_0022803 Ga0501039_0022803_3063_3692 209
2087 3300049575 Ga0501039_0035714 Ga0501039_0035714_2279_2908 209
2088 3300049575 Ga0501039_0039875 Ga0501039_0039875_515_1144 209
2089 3300049575 Ga0501039_0407899 Ga0501039_0407899_390_1019 209
2090 3300049576 Ga0501040_0008435 Ga0501040_0008435_43_672 209
2091 3300049576 Ga0501040_0068417 Ga0501040_0068417_1199_1828 209
2092 3300049576 Ga0501040_0109710 Ga0501040_0109710_432_1061 209
2093 3300049576 Ga0501040_0404094 Ga0501040_0404094_342_971 209
2094 3300049576 Ga0501040_0476258 Ga0501040_0476258_99_728 209
2095 3300049577 Ga0501041_0042471 Ga0501041_0042471_2087_2716 209
2096 3300049577 Ga0501041_0207102 Ga0501041_0207102_118_747 209
2097 3300049577 Ga0501041_0248495 Ga0501041_0248495_425_1054 209
2098 3300049577 Ga0501041_0275170 Ga0501041_0275170_239_868 209
2099 3300049578 Ga0501042_0010868 Ga0501042_0010868_829_1458 209
2100 3300049578 Ga0501042_0045229 Ga0501042_0045229_2482_3111 209
2101 3300049578 Ga0501042_0050614 Ga0501042_0050614_224_853 209
2102 3300049578 Ga0501042_0077990 Ga0501042_0077990_589_1218 209
2103 3300049578 Ga0501042_0338134 Ga0501042_0338134_30_659 209
2104 3300049578 Ga0501042_0487064 Ga0501042_0487064_220_849 209
2105 3300049578 Ga0501042_0506376 Ga0501042_0506376_73_702 209
2106 3300049578 Ga0501042_0669316 Ga0501042_0669316_61_690 209
2107 3300049579 Ga0501043_0074869 Ga0501043_0074869_1454_2083 209
2108 3300049579 Ga0501043_0081877 Ga0501043_0081877_1748_2377 209
2109 3300049579 Ga0501043_0099932 Ga0501043_0099932_1301_1930 209
2110 3300049579 Ga0501043_0291008 Ga0501043_0291008_31_660 209
2111 3300049580 Ga0501046_0004921 Ga0501046_0004921_10905_11534 209
2112 3300049580 Ga0501046_0030417 Ga0501046_0030417_137_766 209
2113 3300049580 Ga0501046_0187020 Ga0501046_0187020_135_764 209
2114 3300049580 Ga0501046_0206346 Ga0501046_0206346_697_1326 209
2115 3300049581 Ga0501047_0003821 Ga0501047_0003821_9116_9745 209
2116 3300049581 Ga0501047_0007192 Ga0501047_0007192_672_1301 209
2117 3300049581 Ga0501047_0247041 Ga0501047_0247041_654_1283 209
2118 3300049581 Ga0501047_0249052 Ga0501047_0249052_480_1109 209
2119 3300049582 Ga0501048_0020396 Ga0501048_0020396_1411_2040 209
2120 3300049582 Ga0501048_0021416 Ga0501048_0021416_135_764 209
2121 3300049582 Ga0501048_0023899 Ga0501048_0023899_833_1462 209
2122 3300049582 Ga0501048_0058737 Ga0501048_0058737_1722_2351 209
2123 3300049582 Ga0501048_0178399 Ga0501048_0178399_740_1369 209
2124 3300049583 Ga0501067_0000428 Ga0501067_0000428_5660_6289 209
2125 3300049583 Ga0501067_0078506 Ga0501067_0078506_904_1533 209
2126 3300049583 Ga0501067_0103043 Ga0501067_0103043_291_920 209
2127 3300049584 Ga0501068_0007038 Ga0501068_0007038_1624_2253 209
2128 3300049584 Ga0501068_0020047 Ga0501068_0020047_1839_2468 209
2129 3300049585 Ga0501069_0001595 Ga0501069_0001595_1362_1991 209
2130 3300049585 Ga0501069_0009651 Ga0501069_0009651_911_1540 209
2131 3300049586 Ga0501070_0025720 Ga0501070_0025720_3638_4267 209
2132 3300049586 Ga0501070_0103893 Ga0501070_0103893_1466_2095 209
2133 3300049586 Ga0501070_0259186 Ga0501070_0259186_135_764 209
2134 3300049586 Ga0501070_0264405 Ga0501070_0264405_316_945 209
2135 3300049586 Ga0501070_0436795 Ga0501070_0436795_175_804 209
2136 3300049587 Ga0501071_0001152 Ga0501071_0001152_1535_2164 209
2137 3300049587 Ga0501071_0123517 Ga0501071_0123517_1194_1823 209
2138 3300049587 Ga0501071_0800826 Ga0501071_0800826_24_653 209
2139 3300049588 Ga0501072_0114652 Ga0501072_0114652_587_1216 209
2140 3300049588 Ga0501072_0121910 Ga0501072_0121910_317_946 209
2141 3300049588 Ga0501072_0132880 Ga0501072_0132880_348_977 209
2142 3300049588 Ga0501072_0233982 Ga0501072_0233982_592_1221 209
2143 3300049588 Ga0501072_0340921 Ga0501072_0340921_249_878 209
2144 3300049588 Ga0501072_0541885 Ga0501072_0541885_107_736 209
2145 3300049589 Ga0501073_0004894 Ga0501073_0004894_8122_8751 209
2146 3300049589 Ga0501073_0025121 Ga0501073_0025121_3510_4139 209
2147 3300049589 Ga0501073_0600310 Ga0501073_0600310_74_703 209
2148 3300049590 Ga0501074_0004181 Ga0501074_0004181_9324_9953 209
2149 3300049590 Ga0501074_0005932 Ga0501074_0005932_3672_4301 209
2150 3300049590 Ga0501074_0036054 Ga0501074_0036054_1968_2597 209
2151 3300049590 Ga0501074_0050250 Ga0501074_0050250_1076_1705 209
2152 3300049590 Ga0501074_0115955 Ga0501074_0115955_964_1593 209
2153 3300049590 Ga0501074_0378273 Ga0501074_0378273_69_698 209
2154 3300049590 Ga0501074_0653856 Ga0501074_0653856_60_689 209
2155 3300049590 Ga0501074_0768360 Ga0501074_0768360_17_646 209
2156 3300049591 Ga0501075_0007595 Ga0501075_0007595_6629_7258 209
2157 3300049591 Ga0501075_0014775 Ga0501075_0014775_535_1164 209
2158 3300049591 Ga0501075_0028162 Ga0501075_0028162_240_869 209
2159 3300049591 Ga0501075_0173642 Ga0501075_0173642_424_1053 209
2160 3300049591 Ga0501075_0249931 Ga0501075_0249931_17_646 209
2161 3300049591 Ga0501075_0585877 Ga0501075_0585877_184_813 209
2162 3300049591 Ga0501075_0696061 Ga0501075_0696061_70_699 209
2163 3300049592 Ga0501076_0023216 Ga0501076_0023216_211_840 209
2164 3300049592 Ga0501076_0050757 Ga0501076_0050757_1323_1952 209
2165 3300049592 Ga0501076_0070268 Ga0501076_0070268_2150_2779 209
2166 3300049592 Ga0501076_0122224 Ga0501076_0122224_1317_1946 209
2167 3300049592 Ga0501076_0220681 Ga0501076_0220681_105_734 209
2168 3300049592 Ga0501076_0269452 Ga0501076_0269452_438_1067 209
2169 3300049592 Ga0501076_0342624 Ga0501076_0342624_154_783 209
2170 3300049593 Ga0501077_0067750 Ga0501077_0067750_1023_1652 209
2171 3300049681 Ga0501251_011448 Ga0501251_011448_207_836 209
2172 3300049705 Ga0501225_0028598 Ga0501225_0028598_717_1346 209
2173 3300049741 Ga0501079_0049651 Ga0501079_0049651_2017_2646 209
2174 3300049741 Ga0501079_0077588 Ga0501079_0077588_1108_1737 209
2175 3300049741 Ga0501079_0107466 Ga0501079_0107466_215_844 209
2176 3300049741 Ga0501079_0135073 Ga0501079_0135073_1102_1731 209
2177 3300049741 Ga0501079_0330568 Ga0501079_0330568_108_737 209
2178 3300049741 Ga0501079_0518319 Ga0501079_0518319_133_762 209
2179 3300049741 Ga0501079_0609882 Ga0501079_0609882_203_832 209
2180 3300049742 Ga0501080_0024542 Ga0501080_0024542_672_1301 209
2181 3300049742 Ga0501080_0047860 Ga0501080_0047860_1875_2504 209
2182 3300049742 Ga0501080_0174707 Ga0501080_0174707_796_1425 209
2183 3300049742 Ga0501080_0378548 Ga0501080_0378548_135_764 209
2184 3300049742 Ga0501080_0664219 Ga0501080_0664219_243_872 209
2185 3300049742 Ga0501080_0873846 Ga0501080_0873846_39_668 209
2186 3300049743 Ga0501081_0102497 Ga0501081_0102497_312_941 209
2187 3300049743 Ga0501081_0127034 Ga0501081_0127034_94_723 209
2188 3300049743 Ga0501081_0221980 Ga0501081_0221980_291_920 209
2189 3300049743 Ga0501081_0435689 Ga0501081_0435689_318_947 209
2190 3300049744 Ga0501083_0010888 Ga0501083_0010888_756_1385 209
2191 3300049744 Ga0501083_0025755 Ga0501083_0025755_137_766 209
2192 3300049744 Ga0501083_0161193 Ga0501083_0161193_278_907 209
2193 3300049744 Ga0501083_0517647 Ga0501083_0517647_130_759 209
2194 3300049744 Ga0501083_0553449 Ga0501083_0553449_78_707 209
2195 3300049822 Ga0501035_0007631 Ga0501035_0007631_362_991 209
2196 3300049822 Ga0501035_0073803 Ga0501035_0073803_1466_2095 209
2197 3300049822 Ga0501035_0105121 Ga0501035_0105121_804_1433 209
2198 3300049822 Ga0501035_0404548 Ga0501035_0404548_245_874 209
2199 3300049822 Ga0501035_0505998 Ga0501035_0505998_290_919 209
2200 3300049823 Ga0501044_0017553 Ga0501044_0017553_6821_7450 209
2201 3300049823 Ga0501044_0502695 Ga0501044_0502695_399_1028 209
2202 3300049824 Ga0501045_0012918 Ga0501045_0012918_544_1173 209
2203 3300049824 Ga0501045_0015202 Ga0501045_0015202_799_1428 209
2204 3300049824 Ga0501045_0074418 Ga0501045_0074418_1211_1840 209
2205 3300049824 Ga0501045_0093381 Ga0501045_0093381_879_1508 209
2206 3300049824 Ga0501045_0134641 Ga0501045_0134641_946_1575 209
2207 3300049824 Ga0501045_0164501 Ga0501045_0164501_426_1055 209
2208 3300049824 Ga0501045_0313728 Ga0501045_0313728_52_681 209
2209 3300050489 nmdc:mga03683_1492_c1 nmdc:mga03683_1492_c1_4663_5292 209
2210 3300050491 nmdc:mga00v17_10629_c1 nmdc:mga00v17_10629_c1_488_1117 209
2211 3300050491 nmdc:mga00v17_1497_c1 nmdc:mga00v17_1497_c1_9974_10603 209
2212 3300050492 nmdc:mga0yw44_111831_c1 nmdc:mga0yw44_111831_c1_705_1334 209
2213 3300050492 nmdc:mga0yw44_4257_c1 nmdc:mga0yw44_4257_c1_4352_4981 209
2214 3300050493 nmdc:mga0k408_103102_c1 nmdc:mga0k408_103102_c1_391_1020 209
2215 3300050493 nmdc:mga0k408_269847_c1 nmdc:mga0k408_269847_c1_94_723 209
2216 3300050493 nmdc:mga0k408_361459_c1 nmdc:mga0k408_361459_c1_65_694 209
2217 3300050493 nmdc:mga0k408_47331_c1 nmdc:mga0k408_47331_c1_239_868 209
2218 3300050494 nmdc:mga06z11_33810_c1 nmdc:mga06z11_33810_c1_431_1060 209
2219 3300050494 nmdc:mga06z11_91435_c1 nmdc:mga06z11_91435_c1_13_642 209
2220 3300050495 nmdc:mga04h51_10889_c1 nmdc:mga04h51_10889_c1_485_1114 209
2221 3300050496 nmdc:mga07m45_106791_c1 nmdc:mga07m45_106791_c1_575_1297 209
2222 3300050496 nmdc:mga07m45_27947_c1 nmdc:mga07m45_27947_c1_1376_2005 209
2223 3300050507 nmdc:mga05p37_1258743_c1 nmdc:mga05p37_1258743_c1_28_657 209
2224 3300050507 nmdc:mga05p37_14374_c1 nmdc:mga05p37_14374_c1_2925_3554 209
2225 3300050507 nmdc:mga05p37_19769_c1 nmdc:mga05p37_19769_c1_3858_4487 209
2226 3300050507 nmdc:mga05p37_203778_c1 nmdc:mga05p37_203778_c1_1014_1643 209
2227 3300050507 nmdc:mga05p37_25099_c1 nmdc:mga05p37_25099_c1_3929_4558 209
2228 3300050507 nmdc:mga05p37_301979_c1 nmdc:mga05p37_301979_c1_494_1123 209
2229 3300050507 nmdc:mga05p37_3048_c1 nmdc:mga05p37_3048_c1_15629_16258 209
2230 3300050507 nmdc:mga05p37_41696_c1 nmdc:mga05p37_41696_c1_3834_4463 209
2231 3300050507 nmdc:mga05p37_4432_c1 nmdc:mga05p37_4432_c1_6890_7519 209
2232 3300050507 nmdc:mga05p37_67547_c1 nmdc:mga05p37_67547_c1_2826_3455 209
2233 3300050507 nmdc:mga05p37_71930_c1 nmdc:mga05p37_71930_c1_1614_2243 209
2234 3300050507 nmdc:mga05p37_98220_c1 nmdc:mga05p37_98220_c1_1603_2232 209
2235 3300050508 nmdc:mga09592_12720_c1 nmdc:mga09592_12720_c1_3804_4433 209
2236 3300050508 nmdc:mga09592_20274_c1 nmdc:mga09592_20274_c1_3145_3774 209
2237 3300050508 nmdc:mga09592_27799_c1 nmdc:mga09592_27799_c1_1809_2438 209
2238 3300050508 nmdc:mga09592_281707_c1 nmdc:mga09592_281707_c1_22_651 209
2239 3300050508 nmdc:mga09592_362675_c1 nmdc:mga09592_362675_c1_89_718 209
2240 3300050508 nmdc:mga09592_494445_c1 nmdc:mga09592_494445_c1_392_1021 209
2241 3300050508 nmdc:mga09592_7680_c1 nmdc:mga09592_7680_c1_3735_4364 209
2242 3300050508 nmdc:mga09592_86154_c1 nmdc:mga09592_86154_c1_1347_1976 209
2243 3300050508 nmdc:mga09592_921074_c1 nmdc:mga09592_921074_c1_75_704 209
2244 3300050509 nmdc:mga0qj67_12298_c1 nmdc:mga0qj67_12298_c1_2225_2854 209
2245 3300050509 nmdc:mga0qj67_17275_c1 nmdc:mga0qj67_17275_c1_793_1422 209
2246 3300050509 nmdc:mga0qj67_510180_c1 nmdc:mga0qj67_510180_c1_272_901 209
2247 3300050509 nmdc:mga0qj67_71989_c1 nmdc:mga0qj67_71989_c1_1008_1637 209
2248 3300050509 nmdc:mga0qj67_8629_c1 nmdc:mga0qj67_8629_c1_5575_6204 209
2249 3300050510 nmdc:mga06r32_103147_c1 nmdc:mga06r32_103147_c1_1353_1982 209
2250 3300050510 nmdc:mga06r32_111109_c1 nmdc:mga06r32_111109_c1_164_793 209
2251 3300050510 nmdc:mga06r32_147065_c1 nmdc:mga06r32_147065_c1_1431_2060 209
2252 3300050510 nmdc:mga06r32_149240_c1 nmdc:mga06r32_149240_c1_171_800 209
2253 3300050510 nmdc:mga06r32_149566_c1 nmdc:mga06r32_149566_c1_1225_1854 209
2254 3300050510 nmdc:mga06r32_151299_c1 nmdc:mga06r32_151299_c1_1565_2194 209
2255 3300050510 nmdc:mga06r32_43313_c1 nmdc:mga06r32_43313_c1_3583_4212 209
2256 3300050510 nmdc:mga06r32_77561_c1 nmdc:mga06r32_77561_c1_43_672 209
2257 3300050510 nmdc:mga06r32_96117_c1 nmdc:mga06r32_96117_c1_389_1018 209
2258 3300050511 nmdc:mga08y16_109482_c2 nmdc:mga08y16_109482_c2_169_798 209
2259 3300050511 nmdc:mga08y16_11049_c1 nmdc:mga08y16_11049_c1_4218_4847 209
2260 3300050511 nmdc:mga08y16_14059_c1 nmdc:mga08y16_14059_c1_393_1022 209
2261 3300050511 nmdc:mga08y16_155_c1 nmdc:mga08y16_155_c1_14899_15528 209
2262 3300050511 nmdc:mga08y16_30031_c1 nmdc:mga08y16_30031_c1_3305_3934 209
2263 3300050511 nmdc:mga08y16_34787_c1 nmdc:mga08y16_34787_c1_4583_5212 209
2264 3300050511 nmdc:mga08y16_359873_c1 nmdc:mga08y16_359873_c1_349_978 209
2265 3300050511 nmdc:mga08y16_360286_c1 nmdc:mga08y16_360286_c1_740_1369 209
2266 3300050511 nmdc:mga08y16_381205_c1 nmdc:mga08y16_381205_c1_35_664 209
2267 3300050511 nmdc:mga08y16_59748_c1 nmdc:mga08y16_59748_c1_3254_3883 209
2268 3300050511 nmdc:mga08y16_8873_c1 nmdc:mga08y16_8873_c1_8006_8635 209
2269 3300050512 nmdc:mga0n895_10459_c1 nmdc:mga0n895_10459_c1_1327_1956 209
2270 3300050512 nmdc:mga0n895_148718_c1 nmdc:mga0n895_148718_c1_1608_2237 209
2271 3300050512 nmdc:mga0n895_192188_c1 nmdc:mga0n895_192188_c1_1155_1784 209
2272 3300050512 nmdc:mga0n895_207296_c1 nmdc:mga0n895_207296_c1_56_685 209
2273 3300050512 nmdc:mga0n895_20974_c1 nmdc:mga0n895_20974_c1_3015_3644 209
2274 3300050512 nmdc:mga0n895_31040_c1 nmdc:mga0n895_31040_c1_4308_4937 209
2275 3300050512 nmdc:mga0n895_40759_c1 nmdc:mga0n895_40759_c1_1962_2591 209
2276 3300050512 nmdc:mga0n895_71007_c1 nmdc:mga0n895_71007_c1_2176_2805 209
2277 3300050512 nmdc:mga0n895_7101_c1 nmdc:mga0n895_7101_c1_8566_9195 209
2278 3300050513 nmdc:mga0rr50_11083_c1 nmdc:mga0rr50_11083_c1_12_641 209
2279 3300050513 nmdc:mga0rr50_1983_c1 nmdc:mga0rr50_1983_c1_7788_8417 209
2280 3300050513 nmdc:mga0rr50_373_c1 nmdc:mga0rr50_373_c1_13118_13747 209
2281 3300050513 nmdc:mga0rr50_385702_c1 nmdc:mga0rr50_385702_c1_494_1123 209
2282 3300050513 nmdc:mga0rr50_447523_c1 nmdc:mga0rr50_447523_c1_414_1043 209
2283 3300050513 nmdc:mga0rr50_9864_c1 nmdc:mga0rr50_9864_c1_3029_3658 209
2284 3300050514 nmdc:mga08x19_199896_c1 nmdc:mga08x19_199896_c1_730_1359 209
2285 3300050514 nmdc:mga08x19_24673_c1 nmdc:mga08x19_24673_c1_1322_1951 209
2286 3300050514 nmdc:mga08x19_31009_c1 nmdc:mga08x19_31009_c1_453_1082 209
2287 3300050514 nmdc:mga08x19_32434_c1 nmdc:mga08x19_32434_c1_2336_2965 209
2288 3300050514 nmdc:mga08x19_40962_c1 nmdc:mga08x19_40962_c1_642_1271 209
2289 3300050514 nmdc:mga08x19_74085_c1 nmdc:mga08x19_74085_c1_423_1052 209
2290 3300050515 nmdc:mga0a205_10346_c1 nmdc:mga0a205_10346_c1_436_1065 209
2291 3300050515 nmdc:mga0a205_192568_c1 nmdc:mga0a205_192568_c1_627_1256 209
2292 3300050515 nmdc:mga0a205_208501_c1 nmdc:mga0a205_208501_c1_806_1435 209
2293 3300050515 nmdc:mga0a205_2239_c1 nmdc:mga0a205_2239_c1_8278_8907 209
2294 3300050515 nmdc:mga0a205_233297_c1 nmdc:mga0a205_233297_c1_903_1532 209
2295 3300050515 nmdc:mga0a205_25088_c1 nmdc:mga0a205_25088_c1_4575_5204 209
2296 3300050515 nmdc:mga0a205_3048_c1 nmdc:mga0a205_3048_c1_359_988 209
2297 3300050515 nmdc:mga0a205_322461_c1 nmdc:mga0a205_322461_c1_469_1098 209
2298 3300050515 nmdc:mga0a205_47564_c1 nmdc:mga0a205_47564_c1_193_822 209
2299 3300050515 nmdc:mga0a205_720756_c1 nmdc:mga0a205_720756_c1_195_824 209
2300 3300050515 nmdc:mga0a205_74968_c1 nmdc:mga0a205_74968_c1_131_760 209
2301 3300050515 nmdc:mga0a205_8091_c1 nmdc:mga0a205_8091_c1_4173_4802 209
2302 3300053077 Ga0495601_0026959 Ga0495601_0026959_947_1576 209
2303 3300053077 Ga0495601_0095032 Ga0495601_0095032_81_710 209
2304 3300053077 Ga0495601_0176766 Ga0495601_0176766_179_808 209
2305 3300053084 Ga0495595_0095036 Ga0495595_0095036_442_1071 209
2306 3300053085 Ga0495619_0029701 Ga0495619_0029701_327_956 209
2307 3300053085 Ga0495619_0065562 Ga0495619_0065562_706_1335 209
2308 3300053085 Ga0495619_0109235 Ga0495619_0109235_457_1086 209
2309 3300053153 Ga0500616_0071032 Ga0500616_0071032_115_747 209
2310 3300054114 Ga0501084_0012960 Ga0501084_0012960_137_766 209
2311 3300054114 Ga0501084_0211791 Ga0501084_0211791_626_1255 209
2312 3300054114 Ga0501084_0424257 Ga0501084_0424257_466_1095 209
2313 3300054114 Ga0501084_0727302 Ga0501084_0727302_135_764 209
2314 3300059421 Ga0590071_000004 Ga0590071_000004_19825_20454 209
2315 3300059421 Ga0590071_000185 Ga0590071_000185_3023_3652 209
2316 3300059421 Ga0590071_003474 Ga0590071_003474_92_721 209
2317 3300059421 Ga0590071_010217 Ga0590071_010217_1175_1804 209
2318 3300059421 Ga0590071_068351 Ga0590071_068351_47_676 209
2319 3300059423 Ga0590074_004491 Ga0590074_004491_1391_2020 209
2320 3300059423 Ga0590074_005149 Ga0590074_005149_654_1283 209
2321 3300059424 Ga0590075_000034 Ga0590075_000034_4855_5484 209
2322 3300059424 Ga0590075_000204 Ga0590075_000204_4743_5372 209
2323 3300059424 Ga0590075_024492 Ga0590075_024492_666_1295 209
2324 3300059426 Ga0590077_002605 Ga0590077_002605_1165_1794 209
2325 3300059426 Ga0590077_005617 Ga0590077_005617_1886_2515 209
2326 3300059426 Ga0590077_010911 Ga0590077_010911_1207_1836 209
2327 3300059426 Ga0590077_012490 Ga0590077_012490_490_1119 209
2328 3300059426 Ga0590077_027385 Ga0590077_027385_39_668 209
2329 3300059491 Ga0587070_061259 Ga0587070_061259_15_644 209
2330 3300059493 Ga0587077_020571 Ga0587077_020571_382_1011 209
2331 3300059510 Ga0587090_049564 Ga0587090_049564_19_648 209
2332 3300059511 Ga0587091_044228 Ga0587091_044228_141_770 209
2333 3300059607 Ga0587125_029026 Ga0587125_029026_43_672 209
2334 3300060353 Ga0501082_0027282 Ga0501082_0027282_1838_2467 209
2335 3300060353 Ga0501082_0042306 Ga0501082_0042306_3118_3747 209
2336 3300060353 Ga0501082_0043927 Ga0501082_0043927_1966_2595 209
2337 3300060353 Ga0501082_0067328 Ga0501082_0067328_917_1546 209
2338 3300060353 Ga0501082_0236092 Ga0501082_0236092_484_1113 209
2339 3300060353 Ga0501082_0293631 Ga0501082_0293631_12_641 209
2340 3300060353 Ga0501082_0328584 Ga0501082_0328584_290_919 209
2341 3300060353 Ga0501082_0381162 Ga0501082_0381162_269_898 209
2342 3300060353 Ga0501082_0503366 Ga0501082_0503366_95_724 209
2343 3300061734 Ga0530510_0045865 Ga0530510_0045865_1935_2564 209
2344 3300061734 Ga0530510_0085952 Ga0530510_0085952_11_640 209
2345 3300061734 Ga0530510_0698915 Ga0530510_0698915_50_679 209
2346 3300061734 Ga0530510_0860412 Ga0530510_0860412_43_672 209

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00163

Ribosomal_S4

Ribosomal protein S4/S9 N-terminal domain

3

98

0.99

PF01479

S4

S4 domain

99

146

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
8r6f-assembly1.cif.gz_J cryoem structure of wheat 40s ribosomal subunit, body domain 0.9907 96 140
6zj3-assembly1.cif.gz_SD cryo-em structure of the highly atypical cytoplasmic ribosome of euglena gracilis 0.9889 96 140
6okk-assembly1.cif.gz_E cryo-em structure of the plasmodium falciparum 80s ribosome bound to the anti-protozoan drug emetine, small subunit 0.9888 96 140
8b2l-assembly1.cif.gz_b1 cryo-em structure of the plant 80s ribosome 0.9863 96 140
8d8l-assembly1.cif.gz_D yeast mitochondrial small subunit assembly intermediate (state 3) 0.9851 97 148
ID Description Score Start End Superfamily
af_A0A0P0Y445_123_179_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9853 99 141 3.10.290.10
af_C6TBL4_107_182_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9686 99 141 3.10.290.10
4nvwD02 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9622 98 193 3.10.290.10
2qalD02 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9617 101 193 3.10.290.10
af_Q9XPI8_145_195_3.10.290.10 Alpha Beta;Roll;Structural Genomics Hypothetical 15.5 Kd Protein In mrcA-pckA Intergenic Region; Chain A;RNA-binding S4 domain 0.9585 98 147 3.10.290.10
ID Description Score Start End GO Terms
AF-X1H5I2-F1-model_v4 RNA-binding S4 domain-containing protein 0.9651 92 209 GO:0003735
GO:0015935
GO:0019843
GO:0042274
AF-R5LDU4-F1-model_v4 deleted 0.9604 109 208
AF-A0A377VWL4-F1-model_v4 30S ribosomal protein S4 0.9557 96 190 GO:0003735
GO:0015935
GO:0019843
GO:0042274
AF-A0A350NMT9-F1-model_v4 30S ribosomal protein S4 0.9541 97 209 GO:0003735
GO:0015935
GO:0019843
GO:0042274
AF-X1H5I2-F1-model_v4 RNA-binding S4 domain-containing protein 0.9495 92 209 GO:0003735
GO:0015935
GO:0019843
GO:0042274

Feature Viewer

pLDDT pTM Quality
74.91 0.55 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map