F496499

General Info

Members Datasets Scaffolds Average Seq Length
2169 692 2014 217

Family's Representative Sequence

Representative Sequence 3300036401|Ga0373937_0043521|Ga0373937_0043521_2418_3137
Length 239
Sequence MMMLSRLKHDLTMAEAARMPGGARVDLVVVADMVEHGAKVLDVGCGDGELLRLLAETRNVDGRGIELSREGVNECVAKGLAVIQGDADTDLADYPNDAFDYVILSQTLQATRAPRVVLEHMLRIGRRAIVSFPNFGHWRIRMQVMFRGRMPRTDNLPYAWYDSPNIHFCTIKDFRELCVAAGAKMEKAVALNPWGSPLRLNAPWWFWNMLGEQAVFRLSRDQESVIRIQKSKGSTNSDS

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
3 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
4 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
5 2512875024 Mesorhizobium loti R88b Isolate Nodule
6 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
7 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
8 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
9 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
10 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
11 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
12 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
13 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
14 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
15 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
16 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
17 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
18 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
19 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
20 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
21 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
22 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
23 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
24 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
25 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
26 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
27 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
28 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
29 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
30 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
31 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
32 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
33 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
34 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
35 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
36 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
37 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
38 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
39 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
40 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
41 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
42 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
43 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
44 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
45 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
46 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
47 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
48 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
49 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
50 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
51 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
52 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
53 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
54 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
55 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
56 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
57 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
58 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
59 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
60 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
61 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
62 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
63 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
64 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
65 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
66 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
67 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
68 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
69 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
70 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
71 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
72 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
73 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
74 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
75 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
76 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
77 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
78 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
79 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
80 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
81 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
82 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
83 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
84 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
85 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
86 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
87 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
88 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
89 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
90 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
91 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
92 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
93 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
94 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
95 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
96 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
97 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
98 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
99 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
100 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
101 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
102 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
103 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
104 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
105 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
106 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
107 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
108 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
109 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
110 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
111 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
112 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
113 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
114 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
115 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
116 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
117 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
118 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
119 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
120 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
121 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
122 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
123 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
124 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
125 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
126 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
127 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
128 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
129 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
130 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
131 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
132 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
133 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
134 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
135 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
136 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
137 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
138 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
139 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
140 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
141 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
142 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
143 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
144 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
145 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
146 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
147 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
148 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
149 3300000045 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere Metagenome Rhizosphere
150 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
151 3300001430 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 Metagenome Rhizosphere
152 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
153 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
154 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
155 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
156 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
157 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
158 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
159 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
160 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
161 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
162 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
163 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
164 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
165 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
166 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
167 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
168 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
169 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
170 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
171 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
172 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
173 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
174 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
175 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
176 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
177 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
178 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
179 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
180 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
181 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
182 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
183 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
184 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
185 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
186 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
187 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
188 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
189 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
190 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
191 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
192 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
193 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
194 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
195 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
196 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
197 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
198 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
199 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
200 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
201 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
202 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
203 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
204 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
205 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
206 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
207 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
208 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
209 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
210 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
211 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
212 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
213 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
214 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
215 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
216 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
217 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
218 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
219 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
220 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
221 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
222 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
223 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
224 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
225 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
226 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
227 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
228 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
229 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
230 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
231 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
232 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
233 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
234 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
235 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
236 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
237 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
238 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
239 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
240 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
241 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
242 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
243 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
244 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
245 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
246 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
247 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
248 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
249 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
250 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
251 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
252 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
253 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
254 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
255 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
256 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
257 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
258 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
259 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
260 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
261 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
262 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
263 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
264 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
265 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
266 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
267 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
268 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
269 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
270 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
271 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
272 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
273 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
274 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
275 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
276 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
277 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
278 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
279 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
280 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
281 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
282 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
283 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
284 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
285 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
286 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
287 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
288 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
289 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
290 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
291 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
292 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
293 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
294 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
295 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
296 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
297 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
298 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
299 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
300 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
301 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
302 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
303 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
304 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
305 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
306 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
307 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
308 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
309 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
310 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
311 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
312 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
313 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
314 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
315 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
316 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
317 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
319 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
320 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
321 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
347 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
348 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
349 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
350 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
351 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
352 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
353 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
354 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
355 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
356 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
357 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
358 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
359 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
360 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
361 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
362 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
363 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
364 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
365 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
366 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
367 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
368 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
369 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
370 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
371 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
372 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
373 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
374 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
375 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
376 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
377 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
378 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
379 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
380 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
381 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
382 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
383 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
384 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
385 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
386 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
387 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
388 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
389 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
390 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
391 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
392 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
393 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
394 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
395 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
396 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
397 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
398 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
399 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
400 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
401 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
402 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
403 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
404 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
405 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
406 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
407 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
408 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
409 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
410 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
411 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
412 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
413 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
414 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
415 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
416 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
417 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
418 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
419 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
420 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
421 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
422 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
423 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
424 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
425 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
426 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
427 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
428 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
429 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
430 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
431 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
432 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
433 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
434 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
435 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
436 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
437 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
438 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
439 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
440 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
441 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
442 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
443 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
444 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
445 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
446 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
447 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
448 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
449 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
450 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
451 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
452 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
453 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
454 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
455 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
456 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
457 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
458 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
459 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
460 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
461 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
462 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
463 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
464 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
465 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
466 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
467 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
468 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
469 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
470 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
471 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
472 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
473 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
474 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
475 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
476 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
477 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
478 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
479 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
480 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
481 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
482 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
483 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
484 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
485 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
486 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
487 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
488 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
489 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
490 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
491 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
492 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
493 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
494 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
495 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
496 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
497 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
498 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
499 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
500 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
501 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
502 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
503 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
504 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
505 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
506 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
507 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
508 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
509 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
510 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
511 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
512 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
513 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
514 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
515 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
516 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
517 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
518 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
519 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
520 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
521 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
522 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
523 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
524 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
525 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
526 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
527 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
528 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
529 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
530 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
531 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
532 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
533 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
534 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
535 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
536 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
537 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
538 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
539 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
540 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
541 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
542 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
543 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
544 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
545 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
546 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
547 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
548 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
549 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
550 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
551 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
552 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
553 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
554 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
555 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
556 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
557 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
558 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
559 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
560 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
561 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
562 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
563 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
564 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
565 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
566 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
567 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
568 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
569 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
570 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
571 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
572 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
573 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
574 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
575 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
576 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
577 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
578 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
579 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
580 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
581 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
582 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
583 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
584 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
585 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
586 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
587 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
588 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
589 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
590 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
591 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
592 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
593 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
594 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
595 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
596 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
597 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
598 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
599 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
600 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
601 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
602 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
603 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
604 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
605 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
606 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
607 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
608 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
609 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
610 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
611 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
612 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
613 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
614 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
615 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
616 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
617 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
618 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
619 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
620 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
621 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
622 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
623 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
624 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
625 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
626 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
627 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
628 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
629 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
630 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
631 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
632 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
633 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
634 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
635 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
636 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
637 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
638 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
639 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
640 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
641 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
642 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
643 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
644 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
645 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
646 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
647 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
648 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
649 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
650 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
651 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
652 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
653 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
654 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
655 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
656 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
657 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
658 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
659 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
660 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
661 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
662 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
663 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
664 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
665 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
666 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
667 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
668 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
669 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
670 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
671 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
672 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
673 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
674 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
675 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
676 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
677 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
678 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
679 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
680 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
681 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
682 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
683 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
684 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
685 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
686 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
687 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
688 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
689 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
690 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
691 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
692 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.81
Metatranscriptomes 0.05
Isolates 7.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.98
Nodule 6.18
Rhizoplane 6.22
Rhizosphere 80.64
Stem 0
Stem Tuber 0
Unclassified 1.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214814668 2209111006 Bacteria 1935
2 ARSoilYngRDRAFT_c00083 3300000042 Bacteria 15786
3 ARCol0oldRDRAFT_c00760 3300000045 Bacteria 2716
4 ARCol0yngRDRAFT_1000133 3300000652 Bacteria 13255
5 JGI24032J14994_100385 3300001430 Bacteria 2331
6 JGI24740J21852_10002310 3300001979 Bacteria 8674
7 JGI24739J22299_10007522 3300001989 Bacteria 4083
8 JGI24739J22299_10009248 3300001989 Bacteria 3678
9 JGI24737J22298_10004387 3300001990 Bacteria 4923
10 JGI24737J22298_10009881 3300001990 Bacteria 3159
11 JGI24735J21928_10031051 3300002067 Bacteria 1584
12 JGI24735J21928_10061987 3300002067 Bacteria 1074
13 JGI24750J21931_1001004 3300002070 Bacteria 3702
14 JGI24750J21931_1001354 3300002070 Bacteria 3077
15 JGI24748J21848_1001287 3300002074 Bacteria 2745
16 JGI24748J21848_1003899 3300002074 Bacteria 1708
17 JGI24738J21930_10009485 3300002075 Bacteria 2189
18 JGI24738J21930_10040800 3300002075 Bacteria 943
19 JGI24744J21845_10001579 3300002077 Bacteria 4551
20 JGI24744J21845_10002586 3300002077 Bacteria 3696
21 JGI24033J26618_1001352 3300002155 Bacteria 2427
22 JGI24033J26618_1005685 3300002155 Bacteria 1383
23 JGI24034J26672_10004052 3300002239 Bacteria 2064
24 JGI24742J22300_10000237 3300002244 Bacteria 8199
25 JGI24742J22300_10002773 3300002244 Bacteria 2823
26 JGI24751J29686_10014171 3300002459 Bacteria 1646
27 JGI25165J46597_1000097 3300003214 Bacteria 161115
28 JGI25153J46596_10009912 3300003215 Bacteria 4364
29 Ga0055542_1000343 3300003762 Bacteria 49207
30 JGI25405J52794_10006793 3300003911 Bacteria 2095
31 Ga0065717_1004432 3300005276 Bacteria 1039
32 Ga0065704_10006262 3300005289 Bacteria 5135
33 Ga0065715_10005360 3300005293 Bacteria 4338
34 Ga0065715_10114903 3300005293 Bacteria 2434
35 Ga0070658_10108492 3300005327 Bacteria 2298
36 Ga0070676_10003368 3300005328 Bacteria 8322
37 Ga0070683_100018166 3300005329 Bacteria 6223
38 Ga0070683_100086994 3300005329 Bacteria 2930
39 Ga0070683_100121334 3300005329 Bacteria 2469
40 Ga0070683_100172776 3300005329 Bacteria 2051
41 Ga0070683_100481433 3300005329 Bacteria 1185
42 Ga0070690_100015741 3300005330 Bacteria 4518
43 Ga0070690_100070408 3300005330 Bacteria 2271
44 Ga0070690_100072393 3300005330 Bacteria 2241
45 Ga0070690_100079724 3300005330 Bacteria 2141
46 Ga0070690_100271967 3300005330 Bacteria 1205
47 Ga0070670_100017688 3300005331 Bacteria 6115
48 Ga0070670_100021799 3300005331 Bacteria 5509
49 Ga0070670_100023742 3300005331 Bacteria 5278
50 Ga0070670_100067293 3300005331 Bacteria 3074
51 Ga0070670_100068383 3300005331 Bacteria 3048
52 Ga0070677_10000267 3300005333 Bacteria 18125
53 Ga0070677_10001103 3300005333 Bacteria 8672
54 Ga0068869_100000991 3300005334 Bacteria 16479
55 Ga0068869_100142155 3300005334 Bacteria 1854
56 Ga0070666_10026799 3300005335 Bacteria 3769
57 Ga0070666_10043212 3300005335 Bacteria 3016
58 Ga0070680_100117122 3300005336 Bacteria 2221
59 Ga0070680_100391858 3300005336 Bacteria 1183
60 Ga0070680_100434201 3300005336 Bacteria 1121
61 Ga0070682_100002951 3300005337 Bacteria 9443
62 Ga0070682_100069804 3300005337 Bacteria 2244
63 Ga0070682_100082454 3300005337 Bacteria 2084
64 Ga0070682_100605939 3300005337 Bacteria 866
65 Ga0068868_100002944 3300005338 Bacteria 11817
66 Ga0070660_100038138 3300005339 Bacteria 3646
67 Ga0070660_100074311 3300005339 Bacteria 2659
68 Ga0070660_100076652 3300005339 Bacteria 2619
69 Ga0070660_100175196 3300005339 Bacteria 1734
70 Ga0070660_100301569 3300005339 Bacteria 1313
71 Ga0070689_100030426 3300005340 Bacteria 4098
72 Ga0070689_100031004 3300005340 Bacteria 4061
73 Ga0070689_100054488 3300005340 Bacteria 3096
74 Ga0070689_100067780 3300005340 Bacteria 2782
75 Ga0070689_100072676 3300005340 Bacteria 2688
76 Ga0070689_100189918 3300005340 Bacteria 1672
77 Ga0070689_100368837 3300005340 Bacteria 1208
78 Ga0070691_10009416 3300005341 Bacteria 4459
79 Ga0070691_10164886 3300005341 Bacteria 1145
80 Ga0070687_100000779 3300005343 Bacteria 10598
81 Ga0070687_100000879 3300005343 Bacteria 10108
82 Ga0070687_100001496 3300005343 Bacteria 8244
83 Ga0070687_100256713 3300005343 Bacteria 1089
84 Ga0070661_100046215 3300005344 Bacteria 3184
85 Ga0070661_100107598 3300005344 Bacteria 2080
86 Ga0070661_100142355 3300005344 Bacteria 1808
87 Ga0070661_100656259 3300005344 Bacteria 852
88 Ga0070692_10001248 3300005345 Bacteria 9081
89 Ga0070692_10046232 3300005345 Bacteria 2249
90 Ga0070668_100186104 3300005347 Bacteria 1698
91 Ga0070668_100187018 3300005347 Bacteria 1695
92 Ga0070669_100039772 3300005353 Bacteria 3417
93 Ga0070669_100269713 3300005353 Bacteria 1360
94 Ga0070669_100317202 3300005353 Bacteria 1258
95 Ga0070669_100955736 3300005353 Bacteria 734
96 Ga0070675_100010374 3300005354 Bacteria 7277
97 Ga0070675_100102178 3300005354 Bacteria 2415
98 Ga0070675_100114679 3300005354 Bacteria 2283
99 Ga0070675_100120816 3300005354 Bacteria 2226
100 Ga0070675_100242675 3300005354 Bacteria 1574
101 Ga0070675_100396972 3300005354 Bacteria 1230
102 Ga0070675_100514825 3300005354 Bacteria 1079
103 Ga0070671_100000307 3300005355 Bacteria 33302
104 Ga0070671_100007159 3300005355 Bacteria 8919
105 Ga0070671_100012646 3300005355 Bacteria 6802
106 Ga0070671_100026558 3300005355 Bacteria 4759
107 Ga0070671_100089670 3300005355 Bacteria 2574
108 Ga0070671_100107838 3300005355 Bacteria 2339
109 Ga0070671_100519946 3300005355 Bacteria 1025
110 Ga0070674_100002115 3300005356 Bacteria 10902
111 Ga0070674_100006828 3300005356 Bacteria 6689
112 Ga0070674_100307809 3300005356 Bacteria 1265
113 Ga0070674_100355354 3300005356 Bacteria 1185
114 Ga0070674_100384571 3300005356 Bacteria 1142
115 Ga0070673_100001635 3300005364 Bacteria 13265
116 Ga0070673_100013588 3300005364 Bacteria 5640
117 Ga0070673_100134111 3300005364 Bacteria 2082
118 Ga0070688_100003323 3300005365 Bacteria 8245
119 Ga0070688_100009701 3300005365 Bacteria 5281
120 Ga0070688_100065251 3300005365 Bacteria 2313
121 Ga0070688_100146918 3300005365 Bacteria 1607
122 Ga0070688_100216466 3300005365 Bacteria 1348
123 Ga0070688_100417516 3300005365 Bacteria 996
124 Ga0070659_100090422 3300005366 Bacteria 2453
125 Ga0070659_100113439 3300005366 Bacteria 2189
126 Ga0070667_100007017 3300005367 Bacteria 9363
127 Ga0070667_100009571 3300005367 Bacteria 8033
128 Ga0070667_100124252 3300005367 Bacteria 2248
129 Ga0070667_100190110 3300005367 Bacteria 1818
130 Ga0070667_100318081 3300005367 Bacteria 1404
131 Ga0070703_10016156 3300005406 Bacteria 2140
132 Ga0070709_10000722 3300005434 Bacteria 18707
133 Ga0070709_10003844 3300005434 Bacteria 8089
134 Ga0070709_10028926 3300005434 Bacteria 3309
135 Ga0070709_10177616 3300005434 Bacteria 1493
136 Ga0070709_10276944 3300005434 Bacteria 1218
137 Ga0070709_10549388 3300005434 Bacteria 883
138 Ga0070714_100008512 3300005435 Bacteria 8018
139 Ga0070714_100031272 3300005435 Bacteria 4440
140 Ga0070714_100115077 3300005435 Bacteria 2387
141 Ga0070714_100154877 3300005435 Bacteria 2068
142 Ga0070714_100869445 3300005435 Bacteria 875
143 Ga0070713_100000642 3300005436 Bacteria 22311
144 Ga0070713_100002545 3300005436 Bacteria 11915
145 Ga0070713_100002655 3300005436 Bacteria 11651
146 Ga0070713_100044640 3300005436 Bacteria 3629
147 Ga0070713_100064209 3300005436 Bacteria 3081
148 Ga0070713_100073863 3300005436 Bacteria 2888
149 Ga0070713_100091170 3300005436 Bacteria 2621
150 Ga0070713_100103829 3300005436 Bacteria 2467
151 Ga0070713_100112430 3300005436 Bacteria 2376
152 Ga0070713_100208308 3300005436 Bacteria 1769
153 Ga0070710_10005698 3300005437 Bacteria 5928
154 Ga0070710_10013642 3300005437 Bacteria 4076
155 Ga0070710_10073348 3300005437 Bacteria 1979
156 Ga0070710_10191503 3300005437 Bacteria 1286
157 Ga0070710_10224435 3300005437 Bacteria 1197
158 Ga0070701_10001029 3300005438 Bacteria 10152
159 Ga0070701_10022674 3300005438 Bacteria 3012
160 Ga0070701_10067404 3300005438 Bacteria 1904
161 Ga0070711_100016884 3300005439 Bacteria 4641
162 Ga0070711_100026093 3300005439 Bacteria 3827
163 Ga0070711_100052196 3300005439 Bacteria 2813
164 Ga0070711_100121796 3300005439 Bacteria 1930
165 Ga0070711_100162010 3300005439 Bacteria 1696
166 Ga0070711_100191037 3300005439 Bacteria 1574
167 Ga0070711_100303892 3300005439 Bacteria 1269
168 Ga0070711_100356500 3300005439 Bacteria 1177
169 Ga0070711_100540433 3300005439 Bacteria 965
170 Ga0070705_100176094 3300005440 Bacteria 1444
171 Ga0070700_100050223 3300005441 Bacteria 2592
172 Ga0070700_100060010 3300005441 Bacteria 2396
173 Ga0070694_100091536 3300005444 Bacteria 2135
174 Ga0070694_100125882 3300005444 Bacteria 1845
175 Ga0070708_100092171 3300005445 Bacteria 2760
176 Ga0070708_100866050 3300005445 Bacteria 849
177 Ga0070663_100033061 3300005455 Bacteria 3570
178 Ga0070663_100054484 3300005455 Bacteria 2858
179 Ga0070663_100057764 3300005455 Bacteria 2785
180 Ga0070663_100203305 3300005455 Bacteria 1547
181 Ga0070663_100270908 3300005455 Bacteria 1350
182 Ga0070663_100820542 3300005455 Bacteria 799
183 Ga0070678_100011394 3300005456 Bacteria 5483
184 Ga0070678_100039475 3300005456 Bacteria 3331
185 Ga0070678_100106198 3300005456 Bacteria 2188
186 Ga0070678_100169360 3300005456 Bacteria 1777
187 Ga0070678_100194954 3300005456 Bacteria 1668
188 Ga0070678_100331604 3300005456 Bacteria 1302
189 Ga0070678_100698663 3300005456 Bacteria 914
190 Ga0070662_100011788 3300005457 Bacteria 5775
191 Ga0070662_100072588 3300005457 Bacteria 2541
192 Ga0070662_100074481 3300005457 Bacteria 2511
193 Ga0070662_100144169 3300005457 Bacteria 1849
194 Ga0070662_100192610 3300005457 Bacteria 1613
195 Ga0070681_10011227 3300005458 Bacteria 8859
196 Ga0070681_10035216 3300005458 Bacteria 5028
197 Ga0070681_10068116 3300005458 Bacteria 3526
198 Ga0070681_10361045 3300005458 Bacteria 1363
199 Ga0070681_10667078 3300005458 Bacteria 955
200 Ga0068867_100035269 3300005459 Bacteria 3628
201 Ga0068867_100131533 3300005459 Bacteria 1945
202 Ga0070685_10006394 3300005466 Bacteria 6005
203 Ga0070685_10017813 3300005466 Bacteria 3809
204 Ga0070685_10141155 3300005466 Bacteria 1517
205 Ga0070685_10314256 3300005466 Bacteria 1060
206 Ga0070685_10353901 3300005466 Bacteria 1005
207 Ga0070679_100024102 3300005530 Bacteria 5962
208 Ga0070679_100026568 3300005530 Bacteria 5690
209 Ga0070679_100079593 3300005530 Bacteria 3266
210 Ga0070679_100095548 3300005530 Bacteria 2960
211 Ga0070679_100223239 3300005530 Bacteria 1845
212 Ga0070679_100433825 3300005530 Bacteria 1259
213 Ga0070679_100480497 3300005530 Bacteria 1187
214 Ga0070679_100534521 3300005530 Bacteria 1116
215 Ga0070684_100008016 3300005535 Bacteria 8247
216 Ga0070684_100053621 3300005535 Bacteria 3511
217 Ga0070684_100149487 3300005535 Bacteria 2115
218 Ga0070684_100158332 3300005535 Bacteria 2053
219 Ga0070684_100514699 3300005535 Bacteria 1109
220 Ga0070684_100739148 3300005535 Bacteria 918
221 Ga0070684_100844934 3300005535 Bacteria 857
222 Ga0070697_100450787 3300005536 Bacteria 1121
223 Ga0070697_100484933 3300005536 Bacteria 1080
224 Ga0070697_100673619 3300005536 Bacteria 912
225 Ga0068853_100006686 3300005539 Bacteria 9182
226 Ga0068853_100020941 3300005539 Bacteria 5442
227 Ga0068853_100103523 3300005539 Bacteria 2520
228 Ga0068853_100108358 3300005539 Bacteria 2464
229 Ga0070672_100005449 3300005543 Bacteria 8435
230 Ga0070672_100013949 3300005543 Bacteria 5685
231 Ga0070672_100100603 3300005543 Bacteria 2344
232 Ga0070672_100181347 3300005543 Bacteria 1755
233 Ga0070686_100009616 3300005544 Bacteria 5436
234 Ga0070686_100013100 3300005544 Bacteria 4733
235 Ga0070686_100039047 3300005544 Bacteria 2956
236 Ga0070686_100331686 3300005544 Bacteria 1137
237 Ga0070695_100003989 3300005545 Bacteria 8623
238 Ga0070695_100328761 3300005545 Bacteria 1139
239 Ga0070695_100538099 3300005545 Bacteria 909
240 Ga0070696_100026156 3300005546 Bacteria 3970
241 Ga0070696_100159303 3300005546 Bacteria 1662
242 Ga0070696_100327009 3300005546 Bacteria 1181
243 Ga0070693_100047839 3300005547 Bacteria 2434
244 Ga0070693_100094030 3300005547 Bacteria 1813
245 Ga0070693_100113938 3300005547 Bacteria 1668
246 Ga0070693_100162926 3300005547 Bacteria 1422
247 Ga0070693_100688932 3300005547 Bacteria 747
248 Ga0070665_100074437 3300005548 Bacteria 3402
249 Ga0070665_100110374 3300005548 Bacteria 2753
250 Ga0070665_100114489 3300005548 Bacteria 2700
251 Ga0070665_100115130 3300005548 Bacteria 2691
252 Ga0070665_100428927 3300005548 Bacteria 1331
253 Ga0070704_100153246 3300005549 Bacteria 1814
254 Ga0068855_100015824 3300005563 Bacteria 9074
255 Ga0068855_100230418 3300005563 Bacteria 2075
256 Ga0068855_100271524 3300005563 Bacteria 1886
257 Ga0068855_100356747 3300005563 Bacteria 1610
258 Ga0068855_100612759 3300005563 Bacteria 1173
259 Ga0070664_100027449 3300005564 Bacteria 4731
260 Ga0070664_100053843 3300005564 Bacteria 3412
261 Ga0070664_100148523 3300005564 Bacteria 2068
262 Ga0070664_100213137 3300005564 Bacteria 1726
263 Ga0070664_100229448 3300005564 Bacteria 1664
264 Ga0070664_100546047 3300005564 Bacteria 1071
265 Ga0070664_100585386 3300005564 Bacteria 1034
266 Ga0068857_100006755 3300005577 Bacteria 9869
267 Ga0068857_100422674 3300005577 Bacteria 1243
268 Ga0068854_100036578 3300005578 Bacteria 3443
269 Ga0068854_100148080 3300005578 Bacteria 1807
270 Ga0068856_100011342 3300005614 Bacteria 8645
271 Ga0068856_100129438 3300005614 Bacteria 2528
272 Ga0068856_100149603 3300005614 Bacteria 2343
273 Ga0068856_100227753 3300005614 Bacteria 1879
274 Ga0068856_100298025 3300005614 Bacteria 1630
275 Ga0070702_100005409 3300005615 Bacteria 5942
276 Ga0070702_100143643 3300005615 Bacteria 1523
277 Ga0070702_100285706 3300005615 Bacteria 1134
278 Ga0068852_100025247 3300005616 Bacteria 4812
279 Ga0068852_100043739 3300005616 Bacteria 3799
280 Ga0068859_100013470 3300005617 Bacteria 8199
281 Ga0068859_100177397 3300005617 Bacteria 2213
282 Ga0068864_100146322 3300005618 Bacteria 2136
283 Ga0068866_10001677 3300005718 Bacteria 9334
284 Ga0068866_10067685 3300005718 Bacteria 1875
285 Ga0068861_100006572 3300005719 Bacteria 7932
286 Ga0068861_100295945 3300005719 Bacteria 1400
287 Ga0068861_100351108 3300005719 Bacteria 1294
288 Ga0068870_10000323 3300005840 Bacteria 17781
289 Ga0068863_100003905 3300005841 Bacteria 14721
290 Ga0068863_100008410 3300005841 Bacteria 10077
291 Ga0068858_100012534 3300005842 Bacteria 7995
292 Ga0068858_100054648 3300005842 Bacteria 3692
293 Ga0068858_100469571 3300005842 Bacteria 1214
294 Ga0068858_100482460 3300005842 Bacteria 1197
295 Ga0068860_100020097 3300005843 Bacteria 6470
296 Ga0068860_100078579 3300005843 Bacteria 3137
297 Ga0068860_100090029 3300005843 Bacteria 2922
298 Ga0068860_100242980 3300005843 Bacteria 1751
299 Ga0068860_100726026 3300005843 Bacteria 1004
300 Ga0068860_100776091 3300005843 Bacteria 971
301 Ga0068862_100391366 3300005844 Bacteria 1298
302 Ga0068862_100412650 3300005844 Bacteria 1265
303 Ga0081455_10000313 3300005937 Bacteria 63616
304 Ga0081455_10007840 3300005937 Bacteria 11179
305 Ga0081455_10008306 3300005937 Bacteria 10814
306 Ga0081455_10020646 3300005937 Bacteria 6195
307 Ga0081455_10074773 3300005937 Bacteria 2797
308 Ga0081455_10164909 3300005937 Bacteria 1694
309 Ga0081538_10012044 3300005981 Bacteria 6962
310 Ga0081538_10029159 3300005981 Bacteria 3777
311 Ga0081538_10063138 3300005981 Bacteria 2105
312 Ga0081540_1001997 3300005983 Bacteria 17014
313 Ga0081540_1002834 3300005983 Bacteria 14044
314 Ga0081540_1059337 3300005983 Bacteria 1837
315 Ga0081540_1065424 3300005983 Bacteria 1709
316 Ga0081539_10000619 3300005985 Bacteria 71899
317 Ga0081539_10011677 3300005985 Bacteria 6905
318 Ga0070717_10001127 3300006028 Bacteria 18067
319 Ga0070717_10052459 3300006028 Bacteria 3360
320 Ga0070717_10069777 3300006028 Bacteria 2927
321 Ga0070717_10157104 3300006028 Bacteria 1971
322 Ga0070717_10254261 3300006028 Bacteria 1553
323 Ga0070717_10271335 3300006028 Bacteria 1503
324 Ga0070717_10368532 3300006028 Bacteria 1287
325 Ga0075365_10010251 3300006038 Bacteria 5446
326 Ga0075365_10010892 3300006038 Bacteria 5324
327 Ga0075365_10060792 3300006038 Bacteria 2521
328 Ga0075365_10071419 3300006038 Bacteria 2337
329 Ga0075365_10271708 3300006038 Bacteria 1192
330 Ga0075365_10295320 3300006038 Bacteria 1140
331 Ga0075365_10303469 3300006038 Bacteria 1124
332 Ga0075368_10025010 3300006042 Bacteria 2290
333 Ga0075363_100051285 3300006048 Bacteria 2200
334 Ga0075363_100087914 3300006048 Bacteria 1708
335 Ga0075364_10024491 3300006051 Bacteria 3834
336 Ga0075364_10155574 3300006051 Bacteria 1542
337 Ga0075364_10230577 3300006051 Bacteria 1257
338 Ga0075364_10241520 3300006051 Bacteria 1227
339 Ga0075364_10243870 3300006051 Bacteria 1221
340 Ga0075364_10260417 3300006051 Bacteria 1179
341 Ga0075432_10010899 3300006058 Bacteria 3086
342 Ga0075432_10029716 3300006058 Bacteria 1888
343 Ga0075432_10039521 3300006058 Bacteria 1646
344 Ga0070715_10011765 3300006163 Bacteria 3160
345 Ga0070715_10038256 3300006163 Bacteria 1991
346 Ga0070716_100006514 3300006173 Bacteria 5706
347 Ga0070716_100041037 3300006173 Bacteria 2576
348 Ga0070716_100063387 3300006173 Bacteria 2146
349 Ga0070712_100000510 3300006175 Bacteria 22271
350 Ga0070712_100002937 3300006175 Bacteria 10561
351 Ga0070712_100139071 3300006175 Bacteria 1850
352 Ga0070712_100247001 3300006175 Bacteria 1424
353 Ga0070712_100523101 3300006175 Bacteria 997
354 Ga0070712_100548443 3300006175 Bacteria 974
355 Ga0075362_10027431 3300006177 Bacteria 2439
356 Ga0075362_10031586 3300006177 Bacteria 2293
357 Ga0075362_10031766 3300006177 Bacteria 2287
358 Ga0075362_10088404 3300006177 Bacteria 1435
359 Ga0075362_10144249 3300006177 Bacteria 1139
360 Ga0075367_10005934 3300006178 Bacteria 6127
361 Ga0075367_10008343 3300006178 Bacteria 5368
362 Ga0075367_10015374 3300006178 Bacteria 4159
363 Ga0075367_10038620 3300006178 Bacteria 2780
364 Ga0075367_10189243 3300006178 Bacteria 1284
365 Ga0075427_10000408 3300006194 Bacteria 4853
366 Ga0075366_10016643 3300006195 Bacteria 4227
367 Ga0075366_10201921 3300006195 Bacteria 1209
368 Ga0097621_100024744 3300006237 Bacteria 4692
369 Ga0097621_100025426 3300006237 Bacteria 4633
370 Ga0097621_100058963 3300006237 Bacteria 3141
371 Ga0097621_100063668 3300006237 Bacteria 3031
372 Ga0097621_100172663 3300006237 Bacteria 1864
373 Ga0075370_10017435 3300006353 Bacteria 3881
374 Ga0075370_10131055 3300006353 Bacteria 1463
375 Ga0075370_10169918 3300006353 Bacteria 1281
376 Ga0075370_10170196 3300006353 Bacteria 1280
377 Ga0068871_100004355 3300006358 Bacteria 9840
378 Ga0068871_100005719 3300006358 Bacteria 8729
379 Ga0068871_100121747 3300006358 Bacteria 2204
380 Ga0068871_100144440 3300006358 Bacteria 2025
381 Ga0068871_100428758 3300006358 Bacteria 1182
382 Ga0075428_100046803 3300006844 Bacteria 4751
383 Ga0075428_100067306 3300006844 Bacteria 3921
384 Ga0075428_100093758 3300006844 Bacteria 3273
385 Ga0075428_100140936 3300006844 Bacteria 2622
386 Ga0075428_100165910 3300006844 Bacteria 2396
387 Ga0075430_100000422 3300006846 Bacteria 31579
388 Ga0075430_100019678 3300006846 Bacteria 5743
389 Ga0075430_100126770 3300006846 Bacteria 2128
390 Ga0075430_100374764 3300006846 Bacteria 1175
391 Ga0075430_100593182 3300006846 Bacteria 914
392 Ga0075431_100001159 3300006847 Bacteria 23724
393 Ga0075431_100006206 3300006847 Bacteria 11866
394 Ga0075431_100051756 3300006847 Bacteria 4234
395 Ga0075431_100052112 3300006847 Bacteria 4219
396 Ga0075431_100196183 3300006847 Bacteria 2067
397 Ga0075431_100285141 3300006847 Bacteria 1672
398 Ga0075431_100374479 3300006847 Bacteria 1429
399 Ga0075433_10002900 3300006852 Bacteria 13140
400 Ga0075433_10014635 3300006852 Bacteria 6414
401 Ga0075433_10131607 3300006852 Bacteria 2222
402 Ga0075433_10249521 3300006852 Bacteria 1575
403 Ga0075434_100002589 3300006871 Bacteria 15970
404 Ga0075434_100008955 3300006871 Bacteria 9320
405 Ga0075434_100010342 3300006871 Bacteria 8746
406 Ga0075434_100014911 3300006871 Bacteria 7435
407 Ga0075434_100129440 3300006871 Bacteria 2542
408 Ga0075434_100161500 3300006871 Bacteria 2260
409 Ga0075434_100249777 3300006871 Bacteria 1793
410 Ga0075434_100261515 3300006871 Bacteria 1749
411 Ga0075434_100332065 3300006871 Bacteria 1541
412 Ga0075434_100334898 3300006871 Bacteria 1534
413 Ga0075434_100457240 3300006871 Bacteria 1298
414 Ga0075429_100003486 3300006880 Bacteria 13420
415 Ga0075429_100004721 3300006880 Bacteria 11729
416 Ga0075429_100074741 3300006880 Bacteria 2952
417 Ga0068865_100003962 3300006881 Bacteria 8883
418 Ga0068865_100024760 3300006881 Bacteria 3942
419 Ga0068865_100043887 3300006881 Bacteria 3057
420 Ga0068865_100057388 3300006881 Bacteria 2715
421 Ga0075436_100013190 3300006914 Bacteria 5667
422 Ga0075436_100059715 3300006914 Bacteria 2634
423 Ga0075436_100205351 3300006914 Bacteria 1396
424 Ga0097620_100013468 3300006931 Bacteria 8199
425 Ga0097620_100177395 3300006931 Bacteria 2213
426 Ga0075435_100003751 3300007076 Bacteria 10350
427 Ga0075435_100017230 3300007076 Bacteria 5462
428 Ga0075435_100079717 3300007076 Bacteria 2687
429 Ga0075435_100143205 3300007076 Bacteria 2006
430 Ga0075435_100370421 3300007076 Bacteria 1229
431 Ga0075435_100401348 3300007076 Bacteria 1179
432 Ga0075435_100436361 3300007076 Bacteria 1129
433 Ga0099794_10259007 3300007265 Bacteria 898
434 Ga0099795_10220100 3300007788 Bacteria 808
435 Ga0105251_10171265 3300009011 Bacteria 978
436 Ga0105251_10210356 3300009011 Bacteria 876
437 Ga0105244_10079145 3300009036 Bacteria 1629
438 Ga0105240_10147730 3300009093 Bacteria 2803
439 Ga0105240_10373238 3300009093 Bacteria 1612
440 Ga0105240_10551141 3300009093 Bacteria 1276
441 Ga0105240_10568195 3300009093 Bacteria 1253
442 Ga0105240_10672744 3300009093 Bacteria 1132
443 Ga0111539_10000115 3300009094 Bacteria 88645
444 Ga0111539_10001208 3300009094 Bacteria 34372
445 Ga0111539_10016618 3300009094 Bacteria 9120
446 Ga0111539_10035755 3300009094 Bacteria 6012
447 Ga0111539_10065361 3300009094 Bacteria 4298
448 Ga0111539_10066049 3300009094 Bacteria 4272
449 Ga0111539_10075477 3300009094 Bacteria 3971
450 Ga0111539_10188940 3300009094 Bacteria 2404
451 Ga0111539_10240392 3300009094 Bacteria 2108
452 Ga0111539_10285981 3300009094 Bacteria 1919
453 Ga0105245_10009095 3300009098 Bacteria 8657
454 Ga0105245_10032578 3300009098 Bacteria 4614
455 Ga0105245_10213700 3300009098 Bacteria 1858
456 Ga0105245_10446492 3300009098 Bacteria 1301
457 Ga0105245_10616985 3300009098 Bacteria 1112
458 Ga0105245_10628645 3300009098 Bacteria 1102
459 Ga0105245_10669224 3300009098 Bacteria 1069
460 Ga0105245_11081783 3300009098 Bacteria 848
461 Ga0105247_10011961 3300009101 Bacteria 5213
462 Ga0105247_10013019 3300009101 Bacteria 4988
463 Ga0105247_10302923 3300009101 Bacteria 1109
464 Ga0114129_10001209 3300009147 Bacteria 34278
465 Ga0114129_10002965 3300009147 Bacteria 23749
466 Ga0114129_10006052 3300009147 Bacteria 17153
467 Ga0114129_10013259 3300009147 Bacteria 11742
468 Ga0114129_10119804 3300009147 Bacteria 3625
469 Ga0114129_10467204 3300009147 Bacteria 1653
470 Ga0114129_10470224 3300009147 Bacteria 1646
471 Ga0114129_10492748 3300009147 Bacteria 1602
472 Ga0114129_10521651 3300009147 Bacteria 1549
473 Ga0114129_10839262 3300009147 Bacteria 1169
474 Ga0114129_11363407 3300009147 Bacteria 876
475 Ga0114129_11497736 3300009147 Bacteria 829
476 Ga0105243_10103149 3300009148 Bacteria 2371
477 Ga0105243_10180012 3300009148 Bacteria 1837
478 Ga0105243_10202271 3300009148 Bacteria 1743
479 Ga0105243_10704703 3300009148 Bacteria 984
480 Ga0105243_10861807 3300009148 Bacteria 898
481 Ga0105241_10047559 3300009174 Bacteria 3262
482 Ga0105241_10211075 3300009174 Bacteria 1627
483 Ga0105241_10277697 3300009174 Bacteria 1429
484 Ga0105241_10308526 3300009174 Bacteria 1360
485 Ga0105242_10014426 3300009176 Bacteria 6122
486 Ga0105242_10035204 3300009176 Bacteria 4015
487 Ga0105242_10199891 3300009176 Bacteria 1775
488 Ga0105242_10222232 3300009176 Bacteria 1688
489 Ga0105242_11194723 3300009176 Bacteria 779
490 Ga0105248_10063976 3300009177 Bacteria 4129
491 Ga0105248_10078423 3300009177 Bacteria 3713
492 Ga0105248_10218449 3300009177 Bacteria 2146
493 Ga0105248_10366006 3300009177 Bacteria 1623
494 Ga0105237_10012745 3300009545 Bacteria 8842
495 Ga0105237_10013130 3300009545 Bacteria 8692
496 Ga0105237_10256334 3300009545 Bacteria 1751
497 Ga0105238_10015798 3300009551 Bacteria 7641
498 Ga0105238_10027272 3300009551 Bacteria 5820
499 Ga0105238_10061206 3300009551 Bacteria 3768
500 Ga0105238_10079184 3300009551 Bacteria 3276
501 Ga0105238_10138257 3300009551 Bacteria 2413
502 Ga0105238_11020544 3300009551 Bacteria 848
503 Ga0105249_10129773 3300009553 Bacteria 2405
504 Ga0105249_10151432 3300009553 Bacteria 2233
505 Ga0105249_10225723 3300009553 Bacteria 1845
506 Ga0105249_10279335 3300009553 Bacteria 1667
507 Ga0099796_10001206 3300010159 Bacteria 5037
508 Ga0099796_10058032 3300010159 Bacteria 1363
509 Ga0105239_10054375 3300010375 Bacteria 4391
510 Ga0105239_10059193 3300010375 Bacteria 4205
511 Ga0105239_10211371 3300010375 Bacteria 2175
512 Ga0105239_10233781 3300010375 Bacteria 2062
513 Ga0105239_10461311 3300010375 Bacteria 1442
514 Ga0105239_10500033 3300010375 Bacteria 1382
515 Ga0105239_10708776 3300010375 Bacteria 1151
516 Ga0105246_10858189 3300011119 Bacteria 810
517 Ga0157323_1001008 3300012495 Bacteria 1326
518 Ga0157342_1003348 3300012507 Bacteria 1368
519 Ga0157342_1014577 3300012507 Bacteria 852
520 Ga0157373_10235162 3300013100 Bacteria 1294
521 Ga0157371_10062576 3300013102 Bacteria 2638
522 Ga0157371_10121861 3300013102 Bacteria 1854
523 Ga0157370_10045373 3300013104 Bacteria 4217
524 Ga0157370_10098914 3300013104 Bacteria 2734
525 Ga0157370_10912168 3300013104 Bacteria 797
526 Ga0157369_10098692 3300013105 Bacteria 3114
527 Ga0157369_10148854 3300013105 Bacteria 2474
528 Ga0157374_10012090 3300013296 Bacteria 7497
529 Ga0157374_10015579 3300013296 Bacteria 6672
530 Ga0157374_10432654 3300013296 Bacteria 1316
531 Ga0157378_10035925 3300013297 Bacteria 4386
532 Ga0157378_10192270 3300013297 Bacteria 1925
533 Ga0157378_10591563 3300013297 Bacteria 1120
534 Ga0157378_10689671 3300013297 Bacteria 1040
535 Ga0157378_10695806 3300013297 Bacteria 1035
536 Ga0157378_11088559 3300013297 Bacteria 836
537 Ga0163162_10092137 3300013306 Bacteria 3114
538 Ga0163162_10153097 3300013306 Bacteria 2424
539 Ga0163162_10154049 3300013306 Bacteria 2417
540 Ga0163162_10198253 3300013306 Bacteria 2136
541 Ga0163162_10377070 3300013306 Bacteria 1552
542 Ga0163162_10541103 3300013306 Bacteria 1293
543 Ga0157372_10166961 3300013307 Bacteria 2546
544 Ga0157372_10757546 3300013307 Bacteria 1129
545 Ga0157375_10080527 3300013308 Bacteria 3295
546 Ga0157375_10119204 3300013308 Bacteria 2746
547 Ga0157375_10420256 3300013308 Bacteria 1503
548 Ga0157375_10763754 3300013308 Bacteria 1117
549 Ga0157375_10855590 3300013308 Bacteria 1056
550 Ga0163163_10061221 3300014325 Bacteria 3729
551 Ga0163163_10211575 3300014325 Bacteria 1988
552 Ga0163163_10305180 3300014325 Bacteria 1644
553 Ga0157380_10014420 3300014326 Bacteria 5781
554 Ga0157380_10235786 3300014326 Bacteria 1646
555 Ga0157380_10384316 3300014326 Bacteria 1326
556 Ga0182008_10086728 3300014497 Bacteria 1542
557 Ga0157377_10005914 3300014745 Bacteria 5788
558 Ga0157377_10012295 3300014745 Bacteria 4300
559 Ga0157379_10009813 3300014968 Bacteria 8343
560 Ga0157379_10067495 3300014968 Bacteria 3196
561 Ga0157379_10081002 3300014968 Bacteria 2908
562 Ga0157379_10183651 3300014968 Bacteria 1889
563 Ga0157379_10206560 3300014968 Bacteria 1777
564 Ga0157379_10738369 3300014968 Bacteria 926
565 Ga0157376_10036071 3300014969 Bacteria 4003
566 Ga0157376_10056356 3300014969 Bacteria 3283
567 Ga0157376_10174926 3300014969 Bacteria 1957
568 Ga0182006_1022133 3300015261 Bacteria 2645
569 Ga0182007_10008405 3300015262 Bacteria 4243
570 Ga0182007_10029855 3300015262 Bacteria 1865
571 Ga0163161_10111188 3300017792 Bacteria 2048
572 Ga0163161_10398892 3300017792 Bacteria 1103
573 Ga0213874_10011428 3300021377 Bacteria 2249
574 Ga0213876_10043888 3300021384 Bacteria 2363
575 Ga0228598_1040063 3300024227 Bacteria 924
576 Ga0209026_1000041 3300025250 Bacteria 275745
577 Ga0209148_1000069 3300025254 Bacteria 334444
578 Ga0209759_1000183 3300025256 Bacteria 102218
579 Ga0209233_1000030 3300025261 Bacteria 636702
580 Ga0207666_1002128 3300025271 Bacteria 2376
581 Ga0209455_1000161 3300025272 Bacteria 117353
582 Ga0207673_1005562 3300025290 Bacteria 1540
583 Ga0209758_1002997 3300025297 Bacteria 16175
584 Ga0207713_1100460 3300025735 Bacteria 999
585 Ga0207653_10019567 3300025885 Bacteria 2135
586 Ga0207653_10071830 3300025885 Bacteria 1184
587 Ga0207682_10000143 3300025893 Bacteria 32063
588 Ga0207682_10000296 3300025893 Bacteria 22495
589 Ga0207692_10007719 3300025898 Bacteria 4419
590 Ga0207692_10008536 3300025898 Bacteria 4243
591 Ga0207692_10083114 3300025898 Bacteria 1717
592 Ga0207692_10108804 3300025898 Bacteria 1534
593 Ga0207642_10036287 3300025899 Bacteria 2114
594 Ga0207642_10084260 3300025899 Bacteria 1552
595 Ga0207710_10007601 3300025900 Bacteria 4585
596 Ga0207710_10057991 3300025900 Bacteria 1750
597 Ga0207710_10199718 3300025900 Bacteria 987
598 Ga0207688_10000128 3300025901 Bacteria 31837
599 Ga0207688_10003106 3300025901 Bacteria 9069
600 Ga0207688_10068503 3300025901 Bacteria 2010
601 Ga0207688_10125930 3300025901 Bacteria 1498
602 Ga0207680_10141904 3300025903 Bacteria 1593
603 Ga0207680_10430475 3300025903 Bacteria 935
604 Ga0207647_10014547 3300025904 Bacteria 5423
605 Ga0207647_10019708 3300025904 Bacteria 4533
606 Ga0207647_10057755 3300025904 Bacteria 2379
607 Ga0207685_10001276 3300025905 Bacteria 5147
608 Ga0207685_10050048 3300025905 Bacteria 1608
609 Ga0207685_10109643 3300025905 Bacteria 1194
610 Ga0207685_10131808 3300025905 Bacteria 1110
611 Ga0207699_10005685 3300025906 Bacteria 5991
612 Ga0207699_10087912 3300025906 Bacteria 1944
613 Ga0207699_10148884 3300025906 Bacteria 1546
614 Ga0207699_10210686 3300025906 Bacteria 1322
615 Ga0207699_10443363 3300025906 Bacteria 930
616 Ga0207699_10492285 3300025906 Bacteria 884
617 Ga0207699_10501300 3300025906 Bacteria 876
618 Ga0207645_10002217 3300025907 Bacteria 15495
619 Ga0207645_10029210 3300025907 Bacteria 3555
620 Ga0207645_10072385 3300025907 Bacteria 2206
621 Ga0207645_10175199 3300025907 Bacteria 1407
622 Ga0207645_10389540 3300025907 Bacteria 936
623 Ga0207643_10000336 3300025908 Bacteria 32116
624 Ga0207643_10001308 3300025908 Bacteria 14484
625 Ga0207705_10202606 3300025909 Bacteria 1504
626 Ga0207684_10223929 3300025910 Bacteria 1623
627 Ga0207684_10450150 3300025910 Bacteria 1105
628 Ga0207707_10106301 3300025912 Bacteria 2453
629 Ga0207707_10180986 3300025912 Bacteria 1840
630 Ga0207707_10251490 3300025912 Bacteria 1535
631 Ga0207707_10363961 3300025912 Bacteria 1245
632 Ga0207695_10081982 3300025913 Bacteria 3263
633 Ga0207695_10142713 3300025913 Bacteria 2341
634 Ga0207671_10003241 3300025914 Bacteria 16375
635 Ga0207671_10077644 3300025914 Bacteria 2486
636 Ga0207693_10004077 3300025915 Bacteria 12411
637 Ga0207693_10006884 3300025915 Bacteria 9392
638 Ga0207693_10007237 3300025915 Bacteria 9133
639 Ga0207693_10007632 3300025915 Bacteria 8880
640 Ga0207693_10038079 3300025915 Bacteria 3788
641 Ga0207693_10059618 3300025915 Bacteria 2989
642 Ga0207693_10203904 3300025915 Bacteria 1555
643 Ga0207693_10209264 3300025915 Bacteria 1533
644 Ga0207663_10049650 3300025916 Bacteria 2604
645 Ga0207663_10192580 3300025916 Bacteria 1465
646 Ga0207663_10276768 3300025916 Bacteria 1245
647 Ga0207663_10283648 3300025916 Bacteria 1231
648 Ga0207660_10115598 3300025917 Bacteria 2025
649 Ga0207660_10383925 3300025917 Bacteria 1129
650 Ga0207660_10770476 3300025917 Bacteria 785
651 Ga0207662_10007901 3300025918 Bacteria 5794
652 Ga0207657_10015231 3300025919 Bacteria 7459
653 Ga0207657_10019752 3300025919 Bacteria 6387
654 Ga0207649_10001348 3300025920 Bacteria 14601
655 Ga0207652_10015643 3300025921 Bacteria 6176
656 Ga0207652_10162319 3300025921 Bacteria 2003
657 Ga0207652_10251511 3300025921 Bacteria 1594
658 Ga0207646_10223682 3300025922 Bacteria 1700
659 Ga0207681_10003351 3300025923 Bacteria 10030
660 Ga0207681_10039840 3300025923 Bacteria 3122
661 Ga0207681_10365023 3300025923 Bacteria 1159
662 Ga0207681_10437974 3300025923 Bacteria 1061
663 Ga0207694_10003979 3300025924 Bacteria 11652
664 Ga0207694_10084697 3300025924 Bacteria 2494
665 Ga0207694_10334685 3300025924 Bacteria 1251
666 Ga0207650_10011030 3300025925 Bacteria 6213
667 Ga0207650_10016005 3300025925 Bacteria 5233
668 Ga0207650_10047882 3300025925 Bacteria 3152
669 Ga0207650_10110009 3300025925 Bacteria 2132
670 Ga0207650_10152665 3300025925 Bacteria 1824
671 Ga0207659_10003433 3300025926 Bacteria 9500
672 Ga0207659_10053791 3300025926 Bacteria 2873
673 Ga0207659_10101402 3300025926 Bacteria 2171
674 Ga0207659_10357891 3300025926 Bacteria 1212
675 Ga0207659_10410471 3300025926 Bacteria 1134
676 Ga0207659_10707596 3300025926 Bacteria 863
677 Ga0207687_10005007 3300025927 Bacteria 8773
678 Ga0207687_10019582 3300025927 Bacteria 4485
679 Ga0207687_10070256 3300025927 Bacteria 2499
680 Ga0207687_10151179 3300025927 Bacteria 1772
681 Ga0207700_10001518 3300025928 Bacteria 13150
682 Ga0207700_10006032 3300025928 Bacteria 7293
683 Ga0207700_10010061 3300025928 Bacteria 5945
684 Ga0207700_10100203 3300025928 Bacteria 2308
685 Ga0207700_10102435 3300025928 Bacteria 2286
686 Ga0207700_10125676 3300025928 Bacteria 2086
687 Ga0207700_10273292 3300025928 Bacteria 1451
688 Ga0207700_10298892 3300025928 Bacteria 1389
689 Ga0207700_10421891 3300025928 Bacteria 1172
690 Ga0207700_10550101 3300025928 Bacteria 1024
691 Ga0207664_10033324 3300025929 Bacteria 3956
692 Ga0207664_10053281 3300025929 Bacteria 3201
693 Ga0207664_10071807 3300025929 Bacteria 2789
694 Ga0207664_10143903 3300025929 Bacteria 2020
695 Ga0207664_10262335 3300025929 Bacteria 1511
696 Ga0207664_10917471 3300025929 Bacteria 786
697 Ga0207644_10007899 3300025931 Bacteria 6957
698 Ga0207644_10024450 3300025931 Bacteria 4147
699 Ga0207644_10050930 3300025931 Bacteria 2970
700 Ga0207644_10089230 3300025931 Bacteria 2294
701 Ga0207644_10339871 3300025931 Bacteria 1217
702 Ga0207644_10532576 3300025931 Bacteria 971
703 Ga0207690_10044750 3300025932 Bacteria 2920
704 Ga0207690_10054341 3300025932 Bacteria 2692
705 Ga0207690_10173230 3300025932 Bacteria 1618
706 Ga0207690_10393559 3300025932 Bacteria 1104
707 Ga0207706_10009717 3300025933 Bacteria 8829
708 Ga0207706_10071194 3300025933 Bacteria 3058
709 Ga0207706_10217627 3300025933 Bacteria 1673
710 Ga0207706_10240164 3300025933 Bacteria 1584
711 Ga0207706_10408549 3300025933 Bacteria 1177
712 Ga0207686_10023266 3300025934 Bacteria 3576
713 Ga0207686_10087086 3300025934 Bacteria 2053
714 Ga0207686_10143041 3300025934 Bacteria 1656
715 Ga0207686_10755308 3300025934 Bacteria 777
716 Ga0207709_10039683 3300025935 Bacteria 2814
717 Ga0207670_10001760 3300025936 Bacteria 11325
718 Ga0207670_10129792 3300025936 Bacteria 1844
719 Ga0207670_10819981 3300025936 Bacteria 776
720 Ga0207669_10002028 3300025937 Bacteria 8594
721 Ga0207669_10003483 3300025937 Bacteria 6808
722 Ga0207669_10011823 3300025937 Bacteria 4265
723 Ga0207669_10240900 3300025937 Bacteria 1340
724 Ga0207704_10013867 3300025938 Bacteria 4051
725 Ga0207704_10054915 3300025938 Bacteria 2431
726 Ga0207704_10118425 3300025938 Bacteria 1806
727 Ga0207665_10003757 3300025939 Bacteria 10141
728 Ga0207665_10030549 3300025939 Bacteria 3561
729 Ga0207665_10115412 3300025939 Bacteria 1892
730 Ga0207665_10291835 3300025939 Bacteria 1217
731 Ga0207665_10301724 3300025939 Bacteria 1197
732 Ga0207665_10592719 3300025939 Bacteria 865
733 Ga0207691_10009341 3300025940 Bacteria 9412
734 Ga0207691_10012127 3300025940 Bacteria 8264
735 Ga0207691_10071621 3300025940 Bacteria 3127
736 Ga0207691_10106627 3300025940 Bacteria 2495
737 Ga0207711_10002949 3300025941 Bacteria 14881
738 Ga0207711_10094742 3300025941 Bacteria 2632
739 Ga0207711_10139086 3300025941 Bacteria 2183
740 Ga0207689_10000929 3300025942 Bacteria 28093
741 Ga0207689_10015457 3300025942 Bacteria 6462
742 Ga0207689_10046163 3300025942 Bacteria 3601
743 Ga0207689_10403173 3300025942 Bacteria 1140
744 Ga0207661_10079426 3300025944 Bacteria 2704
745 Ga0207661_10426211 3300025944 Bacteria 1205
746 Ga0207661_10559788 3300025944 Bacteria 1048
747 Ga0207679_10001711 3300025945 Bacteria 13671
748 Ga0207679_10074330 3300025945 Bacteria 2575
749 Ga0207679_10227636 3300025945 Bacteria 1572
750 Ga0207667_10098190 3300025949 Bacteria 3022
751 Ga0207667_10377394 3300025949 Bacteria 1445
752 Ga0207651_10000218 3300025960 Bacteria 24731
753 Ga0207651_10035078 3300025960 Bacteria 3257
754 Ga0207651_10413879 3300025960 Bacteria 1149
755 Ga0207651_10420243 3300025960 Bacteria 1141
756 Ga0207712_10064600 3300025961 Bacteria 2610
757 Ga0207712_10109208 3300025961 Bacteria 2072
758 Ga0207712_10144440 3300025961 Bacteria 1830
759 Ga0207668_10002885 3300025972 Bacteria 10079
760 Ga0207668_10019953 3300025972 Bacteria 4249
761 Ga0207668_10026891 3300025972 Bacteria 3743
762 Ga0207668_10607274 3300025972 Bacteria 953
763 Ga0207640_10002339 3300025981 Bacteria 10188
764 Ga0207640_10073720 3300025981 Bacteria 2307
765 Ga0207640_10088009 3300025981 Bacteria 2143
766 Ga0207658_10004688 3300025986 Bacteria 9474
767 Ga0207658_10080256 3300025986 Bacteria 2498
768 Ga0207658_10105166 3300025986 Bacteria 2219
769 Ga0207658_10106059 3300025986 Bacteria 2211
770 Ga0207677_10010326 3300026023 Bacteria 5280
771 Ga0207677_10291832 3300026023 Bacteria 1343
772 Ga0207677_10426806 3300026023 Bacteria 1130
773 Ga0207703_10007006 3300026035 Bacteria 8970
774 Ga0207703_10580423 3300026035 Bacteria 1059
775 Ga0207639_10015755 3300026041 Bacteria 5334
776 Ga0207639_10030339 3300026041 Bacteria 3965
777 Ga0207639_10131417 3300026041 Bacteria 2073
778 Ga0207678_10009613 3300026067 Bacteria 8504
779 Ga0207678_10009800 3300026067 Bacteria 8425
780 Ga0207678_10013639 3300026067 Bacteria 7137
781 Ga0207678_10031911 3300026067 Bacteria 4593
782 Ga0207678_10036839 3300026067 Bacteria 4258
783 Ga0207678_10280989 3300026067 Bacteria 1429
784 Ga0207678_10287799 3300026067 Bacteria 1411
785 Ga0207708_10021157 3300026075 Bacteria 4906
786 Ga0207708_10214654 3300026075 Bacteria 1539
787 Ga0207708_10275730 3300026075 Bacteria 1361
788 Ga0207702_10015377 3300026078 Bacteria 6342
789 Ga0207702_10087305 3300026078 Bacteria 2723
790 Ga0207702_10106569 3300026078 Bacteria 2484
791 Ga0207702_10177532 3300026078 Bacteria 1958
792 Ga0207702_10458952 3300026078 Bacteria 1237
793 Ga0207641_10010250 3300026088 Bacteria 7707
794 Ga0207641_10052179 3300026088 Bacteria 3462
795 Ga0207641_10182571 3300026088 Bacteria 1923
796 Ga0207648_10004873 3300026089 Bacteria 13685
797 Ga0207648_10008818 3300026089 Bacteria 9714
798 Ga0207648_10032399 3300026089 Bacteria 4615
799 Ga0207648_10099452 3300026089 Bacteria 2547
800 Ga0207648_10219101 3300026089 Bacteria 1691
801 Ga0207676_10028629 3300026095 Bacteria 4163
802 Ga0207676_10037767 3300026095 Bacteria 3682
803 Ga0207676_10452666 3300026095 Bacteria 1210
804 Ga0207674_10011855 3300026116 Bacteria 9772
805 Ga0207674_10088974 3300026116 Bacteria 3080
806 Ga0207674_10213579 3300026116 Bacteria 1878
807 Ga0207674_10269903 3300026116 Bacteria 1649
808 Ga0207674_10301809 3300026116 Bacteria 1550
809 Ga0207674_10550998 3300026116 Bacteria 1114
810 Ga0207675_100001656 3300026118 Bacteria 22283
811 Ga0207675_100008431 3300026118 Bacteria 9714
812 Ga0207675_100168864 3300026118 Bacteria 2090
813 Ga0207675_100209548 3300026118 Bacteria 1874
814 Ga0207675_100279600 3300026118 Bacteria 1622
815 Ga0207683_10002838 3300026121 Bacteria 15130
816 Ga0207683_10009004 3300026121 Bacteria 8504
817 Ga0207683_10013750 3300026121 Bacteria 6900
818 Ga0207683_10048234 3300026121 Bacteria 3730
819 Ga0207683_10095740 3300026121 Bacteria 2647
820 Ga0207683_10125701 3300026121 Bacteria 2304
821 Ga0207698_10027688 3300026142 Bacteria 4028
822 Ga0207698_10028080 3300026142 Bacteria 4006
823 Ga0207698_10201705 3300026142 Bacteria 1782
824 Ga0207698_10244784 3300026142 Bacteria 1637
825 Ga0207698_10417506 3300026142 Bacteria 1287
826 Ga0207698_10701400 3300026142 Bacteria 1007
827 Ga0209973_1029682 3300027252 Bacteria 765
828 Ga0209969_1025574 3300027360 Bacteria 890
829 Ga0209995_1006503 3300027471 Bacteria 1877
830 Ga0209179_1048460 3300027512 Bacteria 907
831 Ga0209999_1002776 3300027543 Bacteria 3097
832 Ga0209982_1001422 3300027552 Bacteria 3265
833 Ga0209970_1011011 3300027614 Bacteria 1484
834 Ga0210002_1011310 3300027617 Bacteria 1378
835 Ga0209971_1018136 3300027682 Bacteria 1669
836 Ga0209966_1009501 3300027695 Bacteria 1738
837 Ga0209813_10030435 3300027866 Bacteria 1586
838 Ga0209813_10049603 3300027866 Bacteria 1307
839 Ga0207428_10000141 3300027907 Bacteria 97064
840 Ga0207428_10014276 3300027907 Bacteria 6912
841 Ga0207428_10039926 3300027907 Bacteria 3809
842 Ga0207428_10091485 3300027907 Bacteria 2362
843 Ga0207428_10166226 3300027907 Bacteria 1673
844 Ga0207428_10169474 3300027907 Bacteria 1654
845 Ga0207428_10338290 3300027907 Bacteria 1109
846 Ga0207428_10494738 3300027907 Bacteria 888
847 Ga0265356_1013400 3300028017 Bacteria 895
848 Ga0268266_10007909 3300028379 Bacteria 9520
849 Ga0268266_10014975 3300028379 Bacteria 6657
850 Ga0268266_10039742 3300028379 Bacteria 4007
851 Ga0268266_10075110 3300028379 Bacteria 2935
852 Ga0268266_10470945 3300028379 Bacteria 1196
853 Ga0268265_10039232 3300028380 Bacteria 3489
854 Ga0268264_10118741 3300028381 Bacteria 2328
855 Ga0268264_10627263 3300028381 Bacteria 1062
856 Ga0265337_1000296 3300028556 Bacteria 26607
857 Ga0265337_1000755 3300028556 Bacteria 17042
858 Ga0265318_10015760 3300028577 Bacteria 3136
859 Ga0265318_10023091 3300028577 Bacteria 2482
860 Ga0265338_10232393 3300028800 Bacteria 1370
861 Ga0265762_1014004 3300030760 Bacteria 1444
862 Ga0265330_10020155 3300031235 Bacteria 3048
863 Ga0265332_10001176 3300031238 Bacteria 15152
864 Ga0265332_10158826 3300031238 Bacteria 945
865 Ga0265320_10023737 3300031240 Bacteria 3257
866 Ga0265325_10000690 3300031241 Bacteria 24604
867 Ga0265325_10001878 3300031241 Bacteria 14496
868 Ga0265325_10005553 3300031241 Bacteria 7783
869 Ga0265325_10008093 3300031241 Bacteria 6230
870 Ga0265325_10008367 3300031241 Bacteria 6110
871 Ga0265325_10056105 3300031241 Bacteria 2012
872 Ga0265329_10008900 3300031242 Bacteria 3780
873 Ga0265340_10013597 3300031247 Bacteria 4273
874 Ga0265340_10043555 3300031247 Bacteria 2199
875 Ga0265340_10065668 3300031247 Bacteria 1727
876 Ga0265339_10001183 3300031249 Bacteria 19723
877 Ga0265339_10004646 3300031249 Bacteria 9334
878 Ga0265339_10014668 3300031249 Bacteria 4718
879 Ga0265339_10189036 3300031249 Bacteria 1022
880 Ga0265339_10210135 3300031249 Bacteria 956
881 Ga0265331_10005916 3300031250 Bacteria 7314
882 Ga0265331_10022654 3300031250 Bacteria 3203
883 Ga0265331_10038045 3300031250 Bacteria 2353
884 Ga0265331_10147611 3300031250 Bacteria 1068
885 Ga0265316_10020706 3300031344 Bacteria 5592
886 Ga0265316_10063233 3300031344 Bacteria 2870
887 Ga0265316_10087724 3300031344 Bacteria 2377
888 Ga0265316_10112540 3300031344 Bacteria 2060
889 Ga0265316_10137600 3300031344 Bacteria 1837
890 Ga0265316_10151203 3300031344 Bacteria 1739
891 Ga0265316_10304092 3300031344 Bacteria 1161
892 Ga0265313_10000703 3300031595 Bacteria 34516
893 Ga0265313_10001097 3300031595 Bacteria 26024
894 Ga0265313_10005683 3300031595 Bacteria 9097
895 Ga0265313_10013716 3300031595 Bacteria 4837
896 Ga0265313_10015356 3300031595 Bacteria 4465
897 Ga0265313_10148496 3300031595 Bacteria 1003
898 Ga0316575_10012428 3300031665 Bacteria 3167
899 Ga0265314_10006018 3300031711 Bacteria 10810
900 Ga0265314_10011879 3300031711 Bacteria 7153
901 Ga0265314_10065812 3300031711 Bacteria 2446
902 Ga0265314_10109323 3300031711 Bacteria 1760
903 Ga0265314_10222219 3300031711 Bacteria 1101
904 Ga0265342_10000963 3300031712 Bacteria 28564
905 Ga0265342_10014514 3300031712 Bacteria 5226
906 Ga0265342_10064870 3300031712 Bacteria 2142
907 Ga0265342_10073822 3300031712 Bacteria 1983
908 Ga0265342_10084140 3300031712 Bacteria 1833
909 Ga0316576_10357940 3300031727 Bacteria 1085
910 Ga0316578_10012670 3300031728 Bacteria 4451
911 Ga0307409_100784937 3300031995 Bacteria 959
912 Ga0307416_100234309 3300032002 Bacteria 1773
913 Ga0307416_100274865 3300032002 Bacteria 1657
914 Ga0316583_10076371 3300032133 Bacteria 1171
915 Ga0307510_10258114 3300033180 Bacteria 1226
916 Ga0373930_0000149 3300034816 Bacteria 7906
917 Ga0373930_0014354 3300034816 Bacteria 1474
918 Ga0373948_0001402 3300034817 Bacteria 3325
919 Ga0373950_0002469 3300034818 Bacteria 2544
920 Ga0373950_0002565 3300034818 Bacteria 2510
921 Ga0373950_0060772 3300034818 Bacteria 758
922 Ga0373958_0000770 3300034819 Bacteria 4103
923 Ga0373959_0000590 3300034820 Bacteria 6366
924 Ga0373959_0006317 3300034820 Bacteria 1964
925 Ga0373938_0002746 3300034957 Bacteria 2842
926 Ga0373938_0016180 3300034957 Bacteria 1454
927 Ga0373938_0107165 3300034957 Bacteria 708
928 Ga0373926_0003809 3300035083 Bacteria 4920
929 Ga0373926_0021505 3300035083 Bacteria 2234
930 Ga0373926_0047407 3300035083 Bacteria 1543
931 Ga0373928_0001444 3300035084 Bacteria 4615
932 Ga0373928_0011763 3300035084 Bacteria 1737
933 Ga0373928_0012733 3300035084 Bacteria 1682
934 Ga0373928_0017713 3300035084 Bacteria 1468
935 Ga0373928_0122648 3300035084 Bacteria 698
936 Ga0373929_0030101 3300035085 Bacteria 1155
937 Ga0373934_0096068 3300035086 Bacteria 1197
938 Ga0373934_0118775 3300035086 Bacteria 1075
939 Ga0373934_0250712 3300035086 Bacteria 732
940 Ga0373940_0000020 3300035088 Bacteria 18639
941 Ga0373940_0031949 3300035088 Bacteria 1408
942 Ga0373940_0100946 3300035088 Bacteria 876
943 Ga0373944_0045739 3300035089 Bacteria 1366
944 Ga0373944_0080025 3300035089 Bacteria 1078
945 Ga0373944_0112064 3300035089 Bacteria 932
946 Ga0373949_0001308 3300035090 Bacteria 7206
947 Ga0373949_0030421 3300035090 Bacteria 1283
948 Ga0373951_0010560 3300035091 Bacteria 2073
949 Ga0373951_0084742 3300035091 Bacteria 824
950 Ga0373951_0125376 3300035091 Unclassified 702
951 Ga0373952_0000244 3300035092 Bacteria 8816
952 Ga0373952_0013542 3300035092 Bacteria 1619
953 Ga0373952_0040712 3300035092 Bacteria 1072
954 Ga0373923_0001289 3300035111 Bacteria 7075
955 Ga0373923_0056090 3300035111 Bacteria 1663
956 Ga0373932_0000776 3300035112 Bacteria 9469
957 Ga0373932_0004742 3300035112 Bacteria 3208
958 Ga0373932_0047826 3300035112 Bacteria 1258
959 Ga0373932_0108773 3300035112 Bacteria 911
960 Ga0373936_0001566 3300035113 Bacteria 8344
961 Ga0373936_0017507 3300035113 Bacteria 2760
962 Ga0373936_0116755 3300035113 Bacteria 1137
963 Ga0373936_0124798 3300035113 Bacteria 1103
964 Ga0373936_0303204 3300035113 Bacteria 721
965 Ga0373939_0000304 3300035114 Bacteria 12763
966 Ga0373939_0002839 3300035114 Bacteria 4068
967 Ga0373939_0003357 3300035114 Bacteria 3758
968 Ga0373939_0009072 3300035114 Bacteria 2457
969 Ga0373939_0025888 3300035114 Bacteria 1648
970 Ga0373939_0250011 3300035114 Bacteria 690
971 Ga0373941_0000096 3300035115 Bacteria 14448
972 Ga0373941_0000334 3300035115 Bacteria 9212
973 Ga0373941_0016891 3300035115 Bacteria 1991
974 Ga0373941_0178383 3300035115 Bacteria 796
975 Ga0373945_0003184 3300035116 Bacteria 5148
976 Ga0373945_0013788 3300035116 Bacteria 2701
977 Ga0373945_0027750 3300035116 Bacteria 1979
978 Ga0373953_0001936 3300035117 Bacteria 6155
979 Ga0373953_0026490 3300035117 Bacteria 2221
980 Ga0373953_0031276 3300035117 Bacteria 2069
981 Ga0373953_0031941 3300035117 Bacteria 2050
982 Ga0373954_0001803 3300035118 Bacteria 8825
983 Ga0373954_0005111 3300035118 Bacteria 5664
984 Ga0373954_0020764 3300035118 Bacteria 2973
985 Ga0373954_0051938 3300035118 Bacteria 1926
986 Ga0373954_0246533 3300035118 Bacteria 879
987 Ga0373954_0248510 3300035118 Bacteria 875
988 Ga0373956_0003652 3300035119 Bacteria 6215
989 Ga0373956_0009351 3300035119 Bacteria 3986
990 Ga0373956_0044824 3300035119 Bacteria 1972
991 Ga0373956_0051167 3300035119 Bacteria 1856
992 Ga0373956_0055351 3300035119 Bacteria 1789
993 Ga0373957_0016296 3300035120 Bacteria 2571
994 Ga0373957_0103692 3300035120 Bacteria 1140
995 Ga0373960_0004352 3300035121 Bacteria 3240
996 Ga0373960_0010008 3300035121 Bacteria 2309
997 Ga0373960_0034005 3300035121 Bacteria 1440
998 Ga0373960_0105862 3300035121 Bacteria 917
999 Ga0373960_0176177 3300035121 Bacteria 744
1000 Ga0373960_0183194 3300035121 Bacteria 732
1001 Ga0373943_0002507 3300035170 Bacteria 8346
1002 Ga0373943_0003853 3300035170 Bacteria 6821
1003 Ga0373943_0010123 3300035170 Bacteria 4230
1004 Ga0373943_0013691 3300035170 Bacteria 3666
1005 Ga0373943_0069624 3300035170 Bacteria 1778
1006 Ga0373943_0091689 3300035170 Bacteria 1575
1007 Ga0373943_0198565 3300035170 Bacteria 1109
1008 Ga0373946_0000239 3300035171 Bacteria 17240
1009 Ga0373946_0006973 3300035171 Bacteria 4117
1010 Ga0373946_0010723 3300035171 Bacteria 3402
1011 Ga0373946_0111761 3300035171 Bacteria 1237
1012 Ga0373946_0173857 3300035171 Bacteria 1018
1013 Ga0373955_0001041 3300035172 Bacteria 11788
1014 Ga0373955_0003147 3300035172 Bacteria 7220
1015 Ga0373955_0006462 3300035172 Bacteria 5338
1016 Ga0373955_0012671 3300035172 Bacteria 4057
1017 Ga0373955_0025815 3300035172 Bacteria 3021
1018 Ga0373955_0081141 3300035172 Bacteria 1833
1019 Ga0373955_0313039 3300035172 Bacteria 948
1020 Ga0373942_0003489 3300035207 Bacteria 3689
1021 Ga0373942_0004614 3300035207 Bacteria 3196
1022 Ga0373942_0005062 3300035207 Bacteria 3058
1023 Ga0373961_0017676 3300035241 Bacteria 1854
1024 Ga0373961_0052057 3300035241 Bacteria 1218
1025 Ga0373962_0014039 3300035242 Bacteria 2036
1026 Ga0373962_0032604 3300035242 Bacteria 1433
1027 Ga0316574_0000385 3300035398 Bacteria 17232
1028 Ga0373924_0006978 3300035410 Bacteria 4065
1029 Ga0373924_0017612 3300035410 Bacteria 2743
1030 Ga0373924_0075601 3300035410 Bacteria 1426
1031 Ga0373924_0130717 3300035410 Bacteria 1092
1032 Ga0373924_0206817 3300035410 Bacteria 866
1033 Ga0373924_0303636 3300035410 Bacteria 709
1034 Ga0373931_0030830 3300035691 Bacteria 2763
1035 Ga0373931_0062737 3300035691 Bacteria 2007
1036 Ga0373931_0076862 3300035691 Bacteria 1835
1037 Ga0373931_0107563 3300035691 Bacteria 1577
1038 Ga0373931_0157115 3300035691 Bacteria 1330
1039 Ga0373935_0000026 3300035692 Bacteria 58851
1040 Ga0373935_0018001 3300035692 Bacteria 4293
1041 Ga0373935_0022121 3300035692 Bacteria 3895
1042 Ga0373935_0031146 3300035692 Bacteria 3308
1043 Ga0373935_0048529 3300035692 Bacteria 2688
1044 Ga0373935_0221758 3300035692 Bacteria 1313
1045 Ga0373935_0580108 3300035692 Bacteria 819
1046 Ga0373927_0003590 3300035695 Bacteria 11065
1047 Ga0373927_0005902 3300035695 Bacteria 8389
1048 Ga0373927_0006091 3300035695 Bacteria 8258
1049 Ga0373927_0006630 3300035695 Bacteria 7885
1050 Ga0373927_0020647 3300035695 Bacteria 4319
1051 Ga0373927_0021751 3300035695 Bacteria 4203
1052 Ga0373927_0053959 3300035695 Bacteria 2600
1053 Ga0373927_0058298 3300035695 Bacteria 2497
1054 Ga0373927_0091898 3300035695 Bacteria 1971
1055 Ga0373927_0113723 3300035695 Bacteria 1764
1056 Ga0373927_0287498 3300035695 Bacteria 1082
1057 Ga0373927_0352993 3300035695 Bacteria 969
1058 Ga0373933_0002567 3300035724 Bacteria 10181
1059 Ga0373933_0008436 3300035724 Bacteria 5622
1060 Ga0373933_0009369 3300035724 Bacteria 5349
1061 Ga0373933_0040893 3300035724 Bacteria 2734
1062 Ga0373933_0055986 3300035724 Bacteria 2366
1063 Ga0373933_0110891 3300035724 Bacteria 1711
1064 Ga0373933_0185126 3300035724 Bacteria 1329
1065 Ga0373933_0345715 3300035724 Unclassified 966
1066 Ga0373933_0544717 3300035724 Bacteria 761
1067 Ga0373947_0001350 3300035725 Bacteria 15076
1068 Ga0373947_0003178 3300035725 Bacteria 9770
1069 Ga0373947_0077797 3300035725 Bacteria 2046
1070 Ga0373947_0159371 3300035725 Bacteria 1458
1071 Ga0373947_0185614 3300035725 Bacteria 1355
1072 Ga0373947_0207996 3300035725 Bacteria 1282
1073 Ga0373947_0305421 3300035725 Bacteria 1062
1074 Ga0373937_0000593 3300036401 Bacteria 32100
1075 Ga0373937_0003470 3300036401 Bacteria 13244
1076 Ga0373937_0004203 3300036401 Bacteria 12211
1077 Ga0373937_0005150 3300036401 Bacteria 11146
1078 Ga0373937_0008172 3300036401 Bacteria 9086
1079 Ga0373937_0009653 3300036401 Bacteria 8403
1080 Ga0373937_0035094 3300036401 Bacteria 4563
1081 Ga0373937_0035243 3300036401 Bacteria 4554
1082 Ga0373937_0043521 3300036401 Bacteria 4099
1083 Ga0373937_0081596 3300036401 Bacteria 2992
1084 Ga0373937_0218187 3300036401 Bacteria 1795
1085 Ga0373937_0283416 3300036401 Bacteria 1565
1086 Ga0373937_0325121 3300036401 Bacteria 1455
1087 Ga0373937_0338448 3300036401 Bacteria 1425
1088 Ga0373937_0660692 3300036401 Bacteria 991
1089 Ga0316584_0022130 3300036712 Bacteria 4633
1090 Ga0373925_0001043 3300037068 Bacteria 25109
1091 Ga0373925_0001734 3300037068 Bacteria 18299
1092 Ga0373925_0001829 3300037068 Bacteria 17750
1093 Ga0373925_0019956 3300037068 Bacteria 4876
1094 Ga0373925_0095124 3300037068 Bacteria 2281
1095 Ga0373925_0105851 3300037068 Bacteria 2168
1096 Ga0373925_0112939 3300037068 Bacteria 2100
1097 Ga0373925_0197531 3300037068 Bacteria 1598
1098 Ga0373925_0243214 3300037068 Bacteria 1442
1099 Ga0373925_0331339 3300037068 Bacteria 1233
1100 Ga0395900_0197033 3300037418 Bacteria 2040
1101 Ga0395900_0229385 3300037418 Bacteria 1868
1102 Ga0436364_0272511 3300037853 Bacteria 1038
1103 Ga0436364_0276897 3300037853 Bacteria 48262
1104 Ga0436364_1094950 3300037853 Bacteria 1242
1105 Ga0395901_0025998 3300038443 Bacteria 6011
1106 Ga0395901_0029783 3300038443 Bacteria 5622
1107 Ga0395901_1443645 3300038443 Bacteria 645
1108 Ga0436365_1080340 3300039437 Bacteria 3241
1109 Ga0436365_1299178 3300039437 Bacteria 2447
1110 Ga0436360_0104768 3300039438 Bacteria 1411
1111 Ga0436360_0146589 3300039438 Bacteria 935
1112 Ga0436360_0979935 3300039438 Bacteria 1825
1113 Ga0436361_0028445 3300039447 Bacteria 820
1114 Ga0436361_0058212 3300039447 Bacteria 1364
1115 Ga0436363_0033382 3300039450 Bacteria 1037
1116 Ga0436363_0048977 3300039450 Bacteria 647
1117 Ga0436363_0209638 3300039450 Bacteria 2551
1118 Ga0436363_1126896 3300039450 Bacteria 1136
1119 Ga0436362_0160032 3300039453 Bacteria 943
1120 Ga0436362_1162105 3300039453 Bacteria 3949
1121 Ga0439453_0009771 3300041408 Bacteria 1569
1122 Ga0451807_0541634 3300041486 Bacteria 673
1123 Ga0451847_0125728 3300041503 Bacteria 1195
1124 Ga0451853_1376749 3300041512 Bacteria 770
1125 Ga0439441_024254 3300042001 Bacteria 1138
1126 Ga0439455_0016484 3300042012 Bacteria 1710
1127 Ga0439463_039602 3300042016 Bacteria 1197
1128 Ga0439434_0027162 3300042435 Bacteria 1730
1129 Ga0439459_0057035 3300042438 Bacteria 873
1130 Ga0439464_0027481 3300042439 Bacteria 1582
1131 Ga0439464_0086774 3300042439 Bacteria 940
1132 Ga0451577_0351855 3300042876 Bacteria 1336
1133 Ga0466972_0063083 3300044658 Bacteria 1775
1134 Ga0466963_0069749 3300044694 Bacteria 2363
1135 Ga0466963_0211080 3300044694 Bacteria 1358
1136 Ga0466971_0238133 3300044719 Bacteria 865
1137 Ga0466971_0311900 3300044719 Bacteria 757
1138 Ga0466957_0042342 3300044842 Bacteria 2755
1139 Ga0466959_0221148 3300045049 Bacteria 1313
1140 Ga0466967_0011344 3300045976 Bacteria 6742
1141 Ga0466967_0109186 3300045976 Bacteria 2540
1142 Ga0466967_0111510 3300045976 Bacteria 2514
1143 Ga0466967_0711658 3300045976 Bacteria 995
1144 Ga0495617_034371 3300046452 Bacteria 1702
1145 Ga0495592_0000031 3300046454 Bacteria 128596
1146 Ga0495592_0018134 3300046454 Bacteria 5349
1147 Ga0495592_0077193 3300046454 Bacteria 2415
1148 Ga0495592_0304235 3300046454 Bacteria 1035
1149 Ga0495603_0011593 3300046455 Bacteria 5334
1150 Ga0495603_0014236 3300046455 Bacteria 4811
1151 Ga0495603_0090037 3300046455 Bacteria 1794
1152 Ga0495590_0026739 3300046457 Bacteria 2025
1153 Ga0495591_026697 3300046458 Bacteria 1790
1154 Ga0495629_0001405 3300046459 Bacteria 18978
1155 Ga0495629_0004844 3300046459 Bacteria 10095
1156 Ga0495629_0038350 3300046459 Bacteria 3375
1157 Ga0495629_0180392 3300046459 Bacteria 1463
1158 Ga0495629_0270072 3300046459 Bacteria 1168
1159 Ga0495629_0327623 3300046459 Bacteria 1046
1160 Ga0495629_0511937 3300046459 Bacteria 809
1161 Ga0495638_0123357 3300046460 Bacteria 1529
1162 Ga0495641_0008026 3300046461 Bacteria 6501
1163 Ga0495641_0016245 3300046461 Bacteria 3928
1164 Ga0495641_0170387 3300046461 Bacteria 974
1165 Ga0495651_0000747 3300046462 Bacteria 25154
1166 Ga0495651_0002247 3300046462 Bacteria 14915
1167 Ga0495651_0004808 3300046462 Bacteria 10341
1168 Ga0495651_0014554 3300046462 Bacteria 6082
1169 Ga0495651_0084927 3300046462 Bacteria 2384
1170 Ga0495651_0100459 3300046462 Bacteria 2155
1171 Ga0495651_0138155 3300046462 Bacteria 1771
1172 Ga0495651_0281204 3300046462 Bacteria 1124
1173 Ga0495653_0000063 3300046463 Bacteria 93232
1174 Ga0495653_0009990 3300046463 Bacteria 7763
1175 Ga0495653_0013482 3300046463 Bacteria 6660
1176 Ga0495653_0023259 3300046463 Bacteria 5010
1177 Ga0495580_0006404 3300046472 Bacteria 9592
1178 Ga0495580_0047935 3300046472 Bacteria 3028
1179 Ga0495580_0189902 3300046472 Bacteria 1417
1180 Ga0495580_0279766 3300046472 Bacteria 1138
1181 Ga0495582_0009206 3300046473 Bacteria 5446
1182 Ga0495582_0011279 3300046473 Bacteria 4925
1183 Ga0495582_0072027 3300046473 Bacteria 1912
1184 Ga0495582_0213196 3300046473 Bacteria 1104
1185 Ga0495605_0060282 3300046474 Bacteria 1819
1186 Ga0495605_0117192 3300046474 Bacteria 1210
1187 Ga0495605_0149824 3300046474 Bacteria 1042
1188 Ga0495639_0001451 3300046475 Bacteria 10596
1189 Ga0495639_0087500 3300046475 Bacteria 1458
1190 Ga0495639_0298335 3300046475 Bacteria 803
1191 Ga0495662_0000915 3300046476 Bacteria 14429
1192 Ga0495662_0007090 3300046476 Bacteria 5563
1193 Ga0495662_0042812 3300046476 Bacteria 2185
1194 Ga0495662_0145721 3300046476 Bacteria 1166
1195 Ga0495662_0195056 3300046476 Bacteria 998
1196 Ga0495664_0000004 3300046477 Bacteria 489411
1197 Ga0495664_0001447 3300046477 Bacteria 12583
1198 Ga0495664_0016143 3300046477 Bacteria 4253
1199 Ga0495664_0068956 3300046477 Bacteria 2111
1200 Ga0495584_0010949 3300046491 Bacteria 4654
1201 Ga0495584_0016022 3300046491 Bacteria 3825
1202 Ga0495584_0092244 3300046491 Bacteria 1528
1203 Ga0495585_0003492 3300046492 Bacteria 10604
1204 Ga0495585_0014510 3300046492 Bacteria 4587
1205 Ga0495585_0292151 3300046492 Bacteria 803
1206 Ga0495594_0021870 3300046499 Bacteria 3416
1207 Ga0495594_0026216 3300046499 Bacteria 3135
1208 Ga0495594_0061028 3300046499 Bacteria 2086
1209 Ga0495607_0011896 3300046501 Bacteria 5764
1210 Ga0495606_0171810 3300046507 Bacteria 1257
1211 Ga0495608_0000005 3300046511 Bacteria 350726
1212 Ga0495608_0002687 3300046511 Bacteria 12772
1213 Ga0495608_0002757 3300046511 Bacteria 12626
1214 Ga0495608_0081716 3300046511 Bacteria 2099
1215 Ga0495608_0091097 3300046511 Bacteria 1972
1216 Ga0495616_0045956 3300046513 Bacteria 2207
1217 Ga0495618_0000095 3300046514 Bacteria 63583
1218 Ga0495618_0016938 3300046514 Bacteria 4465
1219 Ga0495618_0080671 3300046514 Bacteria 2076
1220 Ga0495618_0113556 3300046514 Bacteria 1734
1221 Ga0495618_0126654 3300046514 Bacteria 1635
1222 Ga0495618_0148394 3300046514 Bacteria 1498
1223 Ga0495620_0148348 3300046515 Bacteria 915
1224 Ga0495628_0000001 3300046516 Bacteria 917742
1225 Ga0495628_0015484 3300046516 Bacteria 6368
1226 Ga0495628_0031977 3300046516 Bacteria 4252
1227 Ga0495628_0322007 3300046516 Bacteria 1141
1228 Ga0495628_0399179 3300046516 Bacteria 1005
1229 Ga0495630_0001137 3300046517 Bacteria 18353
1230 Ga0495630_0140478 3300046517 Bacteria 1836
1231 Ga0495630_0356668 3300046517 Bacteria 1119
1232 Ga0495630_0600530 3300046517 Bacteria 844
1233 Ga0495631_0020045 3300046518 Bacteria 3129
1234 Ga0495631_0147677 3300046518 Bacteria 1009
1235 Ga0495632_0063439 3300046519 Bacteria 1789
1236 Ga0495632_0205315 3300046519 Bacteria 896
1237 Ga0495637_0031952 3300046520 Bacteria 2324
1238 Ga0495644_0002698 3300046523 Bacteria 7053
1239 Ga0495644_0013585 3300046523 Bacteria 3123
1240 Ga0495644_0029747 3300046523 Bacteria 2063
1241 Ga0495663_0009130 3300046525 Bacteria 2748
1242 Ga0495666_0007167 3300046526 Bacteria 5597
1243 Ga0495666_0111386 3300046526 Bacteria 1285
1244 Ga0495666_0116445 3300046526 Bacteria 1253
1245 Ga0495642_0128081 3300046528 Bacteria 1092
1246 Ga0495652_0000002 3300046529 Bacteria 946606
1247 Ga0495652_0002710 3300046529 Bacteria 17983
1248 Ga0495652_0018745 3300046529 Bacteria 6167
1249 Ga0495652_0043342 3300046529 Bacteria 3876
1250 Ga0495652_0073255 3300046529 Bacteria 2852
1251 Ga0495652_0073847 3300046529 Bacteria 2838
1252 Ga0495652_0106579 3300046529 Bacteria 2263
1253 Ga0495665_0002969 3300046531 Bacteria 9164
1254 Ga0495665_0157707 3300046531 Bacteria 1183
1255 Ga0495665_0272853 3300046531 Bacteria 868
1256 Ga0495640_0000001 3300046533 Bacteria 853827
1257 Ga0495640_0000961 3300046533 Bacteria 22249
1258 Ga0495640_0023309 3300046533 Bacteria 4512
1259 Ga0495640_0031035 3300046533 Bacteria 3818
1260 Ga0495640_0061797 3300046533 Bacteria 2543
1261 Ga0495640_0120421 3300046533 Bacteria 1707
1262 Ga0495640_0147161 3300046533 Bacteria 1515
1263 Ga0495640_0346310 3300046533 Bacteria 918
1264 Ga0495640_0461845 3300046533 Bacteria 775
1265 Ga0495586_0028882 3300046535 Bacteria 2968
1266 Ga0495586_0069359 3300046535 Bacteria 1924
1267 Ga0495587_0000016 3300046536 Bacteria 185585
1268 Ga0495587_0003832 3300046536 Bacteria 9975
1269 Ga0495587_0008130 3300046536 Bacteria 6761
1270 Ga0495587_0018158 3300046536 Bacteria 4362
1271 Ga0495587_0029830 3300046536 Bacteria 3310
1272 Ga0495587_0077800 3300046536 Bacteria 1925
1273 Ga0495587_0263075 3300046536 Bacteria 969
1274 Ga0495598_0000364 3300046537 Bacteria 8124
1275 Ga0495598_0001832 3300046537 Bacteria 4278
1276 Ga0495598_0022957 3300046537 Bacteria 1674
1277 Ga0495598_0049138 3300046537 Bacteria 1263
1278 Ga0495609_0084839 3300046538 Bacteria 1382
1279 Ga0495621_0006549 3300046539 Bacteria 3407
1280 Ga0495621_0057546 3300046539 Bacteria 1404
1281 Ga0495645_0000002 3300046543 Bacteria 651644
1282 Ga0495645_0002925 3300046543 Bacteria 11582
1283 Ga0495645_0003698 3300046543 Bacteria 10399
1284 Ga0495645_0296159 3300046543 Bacteria 1058
1285 Ga0495622_0002915 3300046557 Bacteria 8163
1286 Ga0495622_0032151 3300046557 Bacteria 2450
1287 Ga0495622_0079233 3300046557 Bacteria 1512
1288 Ga0495622_0097449 3300046557 Bacteria 1349
1289 Ga0495633_0002269 3300046558 Bacteria 13755
1290 Ga0495633_0082663 3300046558 Bacteria 1494
1291 Ga0495633_0107181 3300046558 Bacteria 1296
1292 Ga0495633_0387054 3300046558 Bacteria 633
1293 Ga0495667_0000007 3300046559 Bacteria 234736
1294 Ga0495667_0002304 3300046559 Bacteria 12788
1295 Ga0495667_0003312 3300046559 Bacteria 10787
1296 Ga0495667_0085357 3300046559 Bacteria 2049
1297 Ga0495667_0087124 3300046559 Bacteria 2025
1298 Ga0495667_0090911 3300046559 Bacteria 1977
1299 Ga0495667_0092466 3300046559 Bacteria 1958
1300 Ga0495667_0291832 3300046559 Bacteria 1034
1301 Ga0495656_0017382 3300046615 Bacteria 2744
1302 Ga0495656_0142885 3300046615 Bacteria 1149
1303 Ga0495668_0017078 3300046616 Bacteria 4215
1304 Ga0495668_0080460 3300046616 Bacteria 1788
1305 Ga0495668_0092160 3300046616 Bacteria 1660
1306 Ga0495668_0191670 3300046616 Bacteria 1120
1307 Ga0495668_0291583 3300046616 Bacteria 894
1308 Ga0495634_0000591 3300046642 Bacteria 35197
1309 Ga0495634_0010775 3300046642 Bacteria 6687
1310 Ga0495634_0016302 3300046642 Bacteria 5316
1311 Ga0495634_0159241 3300046642 Bacteria 1424
1312 Ga0495611_0059680 3300046648 Bacteria 1732
1313 Ga0495625_0015947 3300046660 Bacteria 5927
1314 Ga0495625_0191251 3300046660 Bacteria 1356
1315 Ga0495635_0000002 3300046663 Bacteria 490490
1316 Ga0495635_0005234 3300046663 Bacteria 9025
1317 Ga0495635_0006535 3300046663 Bacteria 8135
1318 Ga0495635_0007098 3300046663 Bacteria 7832
1319 Ga0495635_0077769 3300046663 Bacteria 2272
1320 Ga0495635_0089878 3300046663 Bacteria 2101
1321 Ga0495635_0100310 3300046663 Bacteria 1979
1322 Ga0495635_0189940 3300046663 Bacteria 1395
1323 Ga0495635_0295378 3300046663 Bacteria 1087
1324 Ga0495659_0018708 3300046664 Bacteria 2312
1325 Ga0495659_0020141 3300046664 Bacteria 2238
1326 Ga0495659_0084452 3300046664 Bacteria 1210
1327 Ga0495661_0083494 3300046665 Bacteria 1836
1328 Ga0495588_0054325 3300046674 Bacteria 2066
1329 Ga0495588_0129982 3300046674 Bacteria 1328
1330 Ga0495657_0001508 3300046675 Bacteria 20038
1331 Ga0495657_0017047 3300046675 Bacteria 5280
1332 Ga0495657_0055369 3300046675 Bacteria 2646
1333 Ga0495657_0121845 3300046675 Bacteria 1642
1334 Ga0495657_0390970 3300046675 Bacteria 819
1335 Ga0495599_0000005 3300046678 Bacteria 300169
1336 Ga0495599_0001517 3300046678 Bacteria 13353
1337 Ga0495599_0015355 3300046678 Bacteria 4752
1338 Ga0495599_0062130 3300046678 Bacteria 2334
1339 Ga0495599_0348938 3300046678 Bacteria 887
1340 Ga0495623_0000016 3300046679 Bacteria 113454
1341 Ga0495623_0010442 3300046679 Bacteria 6012
1342 Ga0495623_0050142 3300046679 Bacteria 2644
1343 Ga0495623_0052926 3300046679 Bacteria 2564
1344 Ga0495646_0000002 3300046680 Bacteria 310568
1345 Ga0495646_0053802 3300046680 Bacteria 2424
1346 Ga0495646_0089427 3300046680 Bacteria 1782
1347 Ga0495646_0120727 3300046680 Bacteria 1483
1348 Ga0495647_0007975 3300046681 Bacteria 3558
1349 Ga0495647_0118231 3300046681 Bacteria 1112
1350 Ga0495647_0126829 3300046681 Bacteria 1078
1351 Ga0495658_0000324 3300046683 Bacteria 26774
1352 Ga0495658_0001251 3300046683 Bacteria 13345
1353 Ga0495658_0008707 3300046683 Bacteria 5039
1354 Ga0495658_0034851 3300046683 Bacteria 2764
1355 Ga0495658_0068877 3300046683 Bacteria 2050
1356 Ga0495658_0153880 3300046683 Bacteria 1414
1357 Ga0495658_0156897 3300046683 Bacteria 1401
1358 Ga0495658_0525383 3300046683 Bacteria 757
1359 Ga0495669_0057601 3300046684 Bacteria 1753
1360 Ga0495613_0020625 3300046689 Bacteria 4913
1361 Ga0495613_0024143 3300046689 Bacteria 4531
1362 Ga0495613_0032639 3300046689 Bacteria 3868
1363 Ga0495613_0066624 3300046689 Bacteria 2629
1364 Ga0495613_0320781 3300046689 Bacteria 1069
1365 Ga0495613_0330621 3300046689 Bacteria 1050
1366 Ga0495613_0338030 3300046689 Bacteria 1036
1367 Ga0495624_0003658 3300046690 Bacteria 11369
1368 Ga0495624_0005296 3300046690 Bacteria 9318
1369 Ga0495624_0032731 3300046690 Bacteria 3369
1370 Ga0495624_0065667 3300046690 Bacteria 2266
1371 Ga0495624_0321200 3300046690 Bacteria 932
1372 Ga0495624_0492436 3300046690 Bacteria 734
1373 Ga0495624_0590689 3300046690 Bacteria 662
1374 Ga0495670_0001527 3300046691 Bacteria 11313
1375 Ga0495670_0003553 3300046691 Bacteria 7656
1376 Ga0495670_0070625 3300046691 Bacteria 1767
1377 Ga0495671_0075170 3300046692 Bacteria 1657
1378 Ga0495649_0131391 3300046694 Bacteria 1321
1379 Ga0495600_0000018 3300046809 Bacteria 102683
1380 Ga0495600_0001403 3300046809 Bacteria 13299
1381 Ga0495600_0004584 3300046809 Bacteria 8286
1382 Ga0495600_0007959 3300046809 Bacteria 6495
1383 Ga0495660_0211966 3300046810 Bacteria 918
1384 Ga0495581_0002626 3300047315 Bacteria 10229
1385 Ga0495581_0008249 3300047315 Bacteria 6038
1386 Ga0495581_0072942 3300047315 Bacteria 1986
1387 Ga0495581_0131854 3300047315 Bacteria 1456
1388 Ga0495581_0177064 3300047315 Bacteria 1247
1389 Ga0495604_0000020 3300047317 Bacteria 171989
1390 Ga0495604_0004893 3300047317 Bacteria 10619
1391 Ga0495604_0007365 3300047317 Bacteria 8719
1392 Ga0495604_0050971 3300047317 Bacteria 3211
1393 Ga0495604_0073389 3300047317 Bacteria 2583
1394 Ga0495604_0371830 3300047317 Bacteria 946
1395 Ga0495674_0000002 3300047319 Bacteria 642785
1396 Ga0495674_0005017 3300047319 Bacteria 12734
1397 Ga0495674_0010434 3300047319 Bacteria 8797
1398 Ga0495674_0198230 3300047319 Bacteria 1666
1399 Ga0495674_0392179 3300047319 Bacteria 1122
1400 Ga0495676_0025687 3300047321 Bacteria 5081
1401 Ga0495676_0058840 3300047321 Bacteria 3021
1402 Ga0495676_0067588 3300047321 Bacteria 2764
1403 Ga0495676_0191733 3300047321 Bacteria 1425
1404 Ga0495676_0288450 3300047321 Bacteria 1109
1405 Ga0495676_0305931 3300047321 Bacteria 1071
1406 Ga0495676_0424043 3300047321 Bacteria 880
1407 Ga0495676_0430290 3300047321 Bacteria 872
1408 Ga0495680_0000419 3300047322 Bacteria 47547
1409 Ga0495680_0003143 3300047322 Bacteria 16455
1410 Ga0495680_0009838 3300047322 Bacteria 8571
1411 Ga0495680_0014232 3300047322 Bacteria 6899
1412 Ga0495680_0015610 3300047322 Bacteria 6549
1413 Ga0495675_0000120 3300047444 Bacteria 57071
1414 Ga0495675_0000855 3300047444 Bacteria 18610
1415 Ga0495675_0020773 3300047444 Bacteria 4178
1416 Ga0495675_0024229 3300047444 Bacteria 3869
1417 Ga0495675_0038878 3300047444 Bacteria 3030
1418 Ga0495675_0165530 3300047444 Bacteria 1360
1419 Ga0495677_0071328 3300047445 Bacteria 1295
1420 Ga0495677_0154073 3300047445 Bacteria 885
1421 Ga0495681_0182395 3300047470 Bacteria 862
1422 Ga0495681_0211223 3300047470 Bacteria 782
1423 Ga0495684_0000016 3300047471 Bacteria 169338
1424 Ga0495684_0000281 3300047471 Bacteria 41079
1425 Ga0495684_0001907 3300047471 Bacteria 16734
1426 Ga0495684_0011490 3300047471 Bacteria 6840
1427 Ga0495684_0038374 3300047471 Bacteria 3673
1428 Ga0495684_0050979 3300047471 Bacteria 3159
1429 Ga0495684_0077697 3300047471 Bacteria 2519
1430 Ga0495684_0097367 3300047471 Bacteria 2226
1431 Ga0495684_0387633 3300047471 Bacteria 984
1432 Ga0495686_0050548 3300047472 Bacteria 2612
1433 Ga0495686_0087262 3300047472 Bacteria 1898
1434 Ga0495593_0003828 3300047673 Bacteria 8985
1435 Ga0495593_0005567 3300047673 Bacteria 7438
1436 Ga0495593_0058970 3300047673 Bacteria 2012
1437 Ga0495593_0134135 3300047673 Bacteria 1256
1438 Ga0495593_0237457 3300047673 Bacteria 913
1439 Ga0495602_0000040 3300048088 Bacteria 127280
1440 Ga0495602_0002833 3300048088 Bacteria 17757
1441 Ga0495602_0008505 3300048088 Bacteria 10717
1442 Ga0495602_0222496 3300048088 Bacteria 1424
1443 Ga0495602_0232778 3300048088 Bacteria 1383
1444 Ga0495614_0052143 3300048089 Bacteria 1753
1445 Ga0495614_0233924 3300048089 Bacteria 838
1446 Ga0495615_0001702 3300048090 Bacteria 3342
1447 Ga0496100_0003625 3300048903 Bacteria 8065
1448 Ga0496100_0006330 3300048903 Bacteria 6449
1449 Ga0496100_0006797 3300048903 Bacteria 6265
1450 Ga0496100_0021787 3300048903 Bacteria 3867
1451 Ga0496100_0035404 3300048903 Bacteria 3139
1452 Ga0496100_0038192 3300048903 Bacteria 3041
1453 Ga0496100_0048437 3300048903 Bacteria 2743
1454 Ga0496100_0704882 3300048903 Bacteria 788
1455 Ga0496101_0065606 3300048904 Bacteria 2646
1456 Ga0496101_0073762 3300048904 Bacteria 2507
1457 Ga0496101_0133379 3300048904 Bacteria 1887
1458 Ga0496101_0137336 3300048904 Bacteria 1861
1459 Ga0496101_0150727 3300048904 Bacteria 1779
1460 Ga0496101_0626049 3300048904 Bacteria 850
1461 Ga0496102_0001696 3300048905 Bacteria 19325
1462 Ga0496102_0039328 3300048905 Bacteria 4273
1463 Ga0496102_0069408 3300048905 Bacteria 3235
1464 Ga0496102_0199308 3300048905 Bacteria 1887
1465 Ga0496102_0312970 3300048905 Bacteria 1479
1466 Ga0496102_0452617 3300048905 Bacteria 1204
1467 Ga0496103_0001607 3300048906 Bacteria 14845
1468 Ga0496103_0008874 3300048906 Bacteria 5964
1469 Ga0496103_0247347 3300048906 Bacteria 1147
1470 Ga0496103_0321335 3300048906 Bacteria 995
1471 Ga0496103_0456549 3300048906 Bacteria 819
1472 Ga0496104_0000140 3300048907 Bacteria 67259
1473 Ga0496104_0002721 3300048907 Bacteria 15217
1474 Ga0496104_0004972 3300048907 Bacteria 11608
1475 Ga0496104_0014489 3300048907 Bacteria 7122
1476 Ga0496104_0031740 3300048907 Bacteria 4914
1477 Ga0496104_0043040 3300048907 Bacteria 4240
1478 Ga0496104_0043087 3300048907 Bacteria 4238
1479 Ga0496104_0051153 3300048907 Bacteria 3898
1480 Ga0496104_0147720 3300048907 Bacteria 2257
1481 Ga0496104_0230587 3300048907 Bacteria 1763
1482 Ga0496104_0286580 3300048907 Bacteria 1559
1483 Ga0496104_0340869 3300048907 Bacteria 1412
1484 Ga0496104_0842558 3300048907 Bacteria 822
1485 Ga0496105_0003395 3300048908 Bacteria 11776
1486 Ga0496105_0004096 3300048908 Bacteria 10924
1487 Ga0496105_0005232 3300048908 Bacteria 9836
1488 Ga0496105_0005721 3300048908 Bacteria 9462
1489 Ga0496105_0011829 3300048908 Bacteria 6912
1490 Ga0496105_0029686 3300048908 Bacteria 4476
1491 Ga0496105_0039448 3300048908 Bacteria 3892
1492 Ga0496105_0039548 3300048908 Bacteria 3887
1493 Ga0496105_0134875 3300048908 Bacteria 2034
1494 Ga0496105_0190975 3300048908 Bacteria 1674
1495 Ga0496105_0254351 3300048908 Bacteria 1422
1496 Ga0496106_0004480 3300048909 Bacteria 10359
1497 Ga0496106_0016830 3300048909 Bacteria 5409
1498 Ga0496106_0022791 3300048909 Bacteria 4651
1499 Ga0496106_0024379 3300048909 Bacteria 4497
1500 Ga0496106_0068016 3300048909 Bacteria 2716
1501 Ga0496106_0083927 3300048909 Bacteria 2450
1502 Ga0496106_0141367 3300048909 Bacteria 1893
1503 Ga0496106_0368710 3300048909 Bacteria 1154
1504 Ga0496106_0523635 3300048909 Bacteria 952
1505 Ga0496106_0757888 3300048909 Bacteria 771
1506 Ga0496107_0003453 3300048910 Bacteria 10559
1507 Ga0496107_0037797 3300048910 Bacteria 3465
1508 Ga0496107_0044607 3300048910 Bacteria 3187
1509 Ga0496107_0386138 3300048910 Bacteria 1041
1510 Ga0496108_0005933 3300048911 Bacteria 9894
1511 Ga0496108_0021157 3300048911 Bacteria 5345
1512 Ga0496108_0030567 3300048911 Bacteria 4463
1513 Ga0496108_0073646 3300048911 Bacteria 2883
1514 Ga0496108_0090852 3300048911 Bacteria 2595
1515 Ga0496108_0091305 3300048911 Bacteria 2589
1516 Ga0496108_0203847 3300048911 Bacteria 1716
1517 Ga0496108_0236140 3300048911 Bacteria 1590
1518 Ga0496108_0560737 3300048911 Bacteria 996
1519 Ga0496109_0001484 3300048912 Bacteria 19478
1520 Ga0496109_0003909 3300048912 Bacteria 12447
1521 Ga0496109_0009665 3300048912 Bacteria 8229
1522 Ga0496109_0014253 3300048912 Bacteria 6916
1523 Ga0496109_0015586 3300048912 Bacteria 6628
1524 Ga0496109_0049080 3300048912 Bacteria 3841
1525 Ga0496109_0139388 3300048912 Bacteria 2267
1526 Ga0496109_0214410 3300048912 Bacteria 1810
1527 Ga0496109_0553796 3300048912 Bacteria 1085
1528 Ga0496110_0008732 3300048913 Bacteria 8160
1529 Ga0496110_0010650 3300048913 Bacteria 7485
1530 Ga0496110_0038423 3300048913 Bacteria 4165
1531 Ga0496110_0038837 3300048913 Bacteria 4143
1532 Ga0496110_0069675 3300048913 Bacteria 3115
1533 Ga0496110_0095676 3300048913 Bacteria 2660
1534 Ga0496110_0106612 3300048913 Bacteria 2515
1535 Ga0496110_0131135 3300048913 Bacteria 2263
1536 Ga0496110_0378089 3300048913 Bacteria 1291
1537 Ga0496111_0008610 3300048914 Bacteria 6763
1538 Ga0496111_0033172 3300048914 Bacteria 3681
1539 Ga0496111_0044205 3300048914 Bacteria 3201
1540 Ga0496111_0051265 3300048914 Bacteria 2979
1541 Ga0496111_0058814 3300048914 Bacteria 2783
1542 Ga0496111_0369895 3300048914 Bacteria 1060
1543 Ga0496111_0405742 3300048914 Bacteria 1007
1544 Ga0496111_0621090 3300048914 Bacteria 790
1545 Ga0496112_0003462 3300048915 Bacteria 13045
1546 Ga0496112_0007154 3300048915 Bacteria 9880
1547 Ga0496112_0022133 3300048915 Bacteria 6055
1548 Ga0496112_0043278 3300048915 Bacteria 4408
1549 Ga0496112_0043923 3300048915 Bacteria 4376
1550 Ga0496112_0075222 3300048915 Bacteria 3340
1551 Ga0496112_0076231 3300048915 Bacteria 3316
1552 Ga0496112_0299013 3300048915 Bacteria 1555
1553 Ga0496112_0301211 3300048915 Bacteria 1548
1554 Ga0496112_0306151 3300048915 Bacteria 1534
1555 Ga0496112_0415521 3300048915 Bacteria 1284
1556 Ga0496112_0748573 3300048915 Bacteria 903
1557 Ga0496113_0001986 3300048916 Bacteria 11727
1558 Ga0496113_0002230 3300048916 Bacteria 11189
1559 Ga0496113_0068686 3300048916 Bacteria 2689
1560 Ga0496113_0276824 3300048916 Bacteria 1341
1561 Ga0496114_0004604 3300048917 Bacteria 10712
1562 Ga0496114_0037810 3300048917 Bacteria 3993
1563 Ga0496114_0055281 3300048917 Bacteria 3311
1564 Ga0496114_0084639 3300048917 Bacteria 2685
1565 Ga0496114_0084699 3300048917 Bacteria 2684
1566 Ga0496114_0087165 3300048917 Bacteria 2646
1567 Ga0496114_0192591 3300048917 Bacteria 1784
1568 Ga0496114_0696351 3300048917 Bacteria 891
1569 Ga0496115_0004832 3300048918 Bacteria 9778
1570 Ga0496115_0040379 3300048918 Bacteria 3709
1571 Ga0496115_0044173 3300048918 Bacteria 3553
1572 Ga0496115_0045504 3300048918 Bacteria 3504
1573 Ga0496115_0068541 3300048918 Bacteria 2872
1574 Ga0496115_0078144 3300048918 Bacteria 2692
1575 Ga0496115_0139297 3300048918 Bacteria 2001
1576 Ga0496115_0147723 3300048918 Bacteria 1940
1577 Ga0496115_0148255 3300048918 Bacteria 1937
1578 Ga0496115_0198918 3300048918 Bacteria 1655
1579 Ga0496115_0369934 3300048918 Bacteria 1167
1580 Ga0496117_0040353 3300048920 Bacteria 3433
1581 Ga0496117_0324117 3300048920 Bacteria 806
1582 Ga0496119_0030403 3300048922 Bacteria 3642
1583 Ga0496119_0062453 3300048922 Bacteria 2220
1584 Ga0496120_0002681 3300048923 Bacteria 17483
1585 Ga0496121_0090310 3300048924 Bacteria 2395
1586 Ga0496121_0289227 3300048924 Bacteria 1117
1587 Ga0496125_0003199 3300048928 Bacteria 20213
1588 Ga0496125_0109577 3300048928 Bacteria 2004
1589 Ga0496126_0023605 3300048929 Bacteria 5958
1590 Ga0501031_0070380 3300049568 Bacteria 2279
1591 Ga0501031_0099268 3300049568 Bacteria 1900
1592 Ga0501031_0165336 3300049568 Bacteria 1446
1593 Ga0501031_0480044 3300049568 Bacteria 802
1594 Ga0501031_0609017 3300049568 Bacteria 702
1595 Ga0501032_0031245 3300049569 Bacteria 3651
1596 Ga0501032_0054687 3300049569 Bacteria 2687
1597 Ga0501032_0060626 3300049569 Bacteria 2537
1598 Ga0501032_0075310 3300049569 Bacteria 2248
1599 Ga0501032_0080574 3300049569 Bacteria 2166
1600 Ga0501032_0197345 3300049569 Bacteria 1314
1601 Ga0501033_0058558 3300049570 Bacteria 2845
1602 Ga0501033_0095903 3300049570 Bacteria 2167
1603 Ga0501033_0148900 3300049570 Bacteria 1689
1604 Ga0501033_0152507 3300049570 Bacteria 1666
1605 Ga0501033_0400309 3300049570 Bacteria 958
1606 Ga0501033_0435756 3300049570 Bacteria 912
1607 Ga0501033_0480010 3300049570 Bacteria 861
1608 Ga0501034_0000270 3300049571 Bacteria 94119
1609 Ga0501034_0010212 3300049571 Bacteria 9794
1610 Ga0501034_0013362 3300049571 Bacteria 8453
1611 Ga0501034_0025837 3300049571 Bacteria 5981
1612 Ga0501034_0059925 3300049571 Bacteria 3823
1613 Ga0501034_0063087 3300049571 Bacteria 3719
1614 Ga0501034_0086055 3300049571 Bacteria 3144
1615 Ga0501034_0091894 3300049571 Bacteria 3032
1616 Ga0501034_0148868 3300049571 Bacteria 2317
1617 Ga0501034_0176174 3300049571 Bacteria 2104
1618 Ga0501034_0316706 3300049571 Bacteria 1493
1619 Ga0501034_0388388 3300049571 Bacteria 1320
1620 Ga0501034_0468132 3300049571 Bacteria 1176
1621 Ga0501034_0501811 3300049571 Bacteria 1127
1622 Ga0501034_0553944 3300049571 Bacteria 1059
1623 Ga0501034_0615349 3300049571 Bacteria 990
1624 Ga0501034_0619329 3300049571 Bacteria 986
1625 Ga0501036_0004953 3300049572 Bacteria 10765
1626 Ga0501036_0029528 3300049572 Bacteria 4631
1627 Ga0501036_0030694 3300049572 Bacteria 4539
1628 Ga0501036_0032877 3300049572 Bacteria 4386
1629 Ga0501036_0070304 3300049572 Bacteria 2959
1630 Ga0501036_0091314 3300049572 Bacteria 2572
1631 Ga0501036_0255225 3300049572 Bacteria 1469
1632 Ga0501036_0321708 3300049572 Bacteria 1292
1633 Ga0501036_0423562 3300049572 Bacteria 1110
1634 Ga0501037_0009782 3300049573 Bacteria 7038
1635 Ga0501037_0012371 3300049573 Bacteria 6283
1636 Ga0501037_0019445 3300049573 Bacteria 5010
1637 Ga0501037_0033685 3300049573 Bacteria 3782
1638 Ga0501037_0090745 3300049573 Bacteria 2209
1639 Ga0501037_0185478 3300049573 Bacteria 1474
1640 Ga0501038_0008042 3300049574 Bacteria 9711
1641 Ga0501038_0044386 3300049574 Bacteria 3862
1642 Ga0501038_0050906 3300049574 Bacteria 3577
1643 Ga0501038_0057908 3300049574 Bacteria 3325
1644 Ga0501038_0089335 3300049574 Bacteria 2584
1645 Ga0501038_0091673 3300049574 Bacteria 2545
1646 Ga0501038_0281326 3300049574 Bacteria 1309
1647 Ga0501038_0282660 3300049574 Bacteria 1306
1648 Ga0501038_0503378 3300049574 Bacteria 926
1649 Ga0501038_0591340 3300049574 Bacteria 840
1650 Ga0501039_0028887 3300049575 Bacteria 4270
1651 Ga0501039_0035601 3300049575 Bacteria 3842
1652 Ga0501039_0041593 3300049575 Bacteria 3550
1653 Ga0501039_0043068 3300049575 Bacteria 3487
1654 Ga0501039_0104615 3300049575 Bacteria 2210
1655 Ga0501039_0105217 3300049575 Bacteria 2204
1656 Ga0501039_0295647 3300049575 Bacteria 1273
1657 Ga0501039_0588172 3300049575 Bacteria 872
1658 Ga0501040_0139417 3300049576 Bacteria 1708
1659 Ga0501041_0092848 3300049577 Bacteria 1864
1660 Ga0501042_0152732 3300049578 Bacteria 1665
1661 Ga0501042_0258858 3300049578 Bacteria 1256
1662 Ga0501042_0310536 3300049578 Bacteria 1139
1663 Ga0501043_0003166 3300049579 Bacteria 13613
1664 Ga0501043_0011917 3300049579 Bacteria 6803
1665 Ga0501043_0035618 3300049579 Bacteria 3915
1666 Ga0501043_0044147 3300049579 Bacteria 3504
1667 Ga0501043_0047020 3300049579 Bacteria 3392
1668 Ga0501043_0127124 3300049579 Bacteria 1998
1669 Ga0501043_0144024 3300049579 Bacteria 1866
1670 Ga0501046_0050140 3300049580 Bacteria 3298
1671 Ga0501046_0055509 3300049580 Bacteria 3112
1672 Ga0501046_0069611 3300049580 Bacteria 2737
1673 Ga0501046_0082747 3300049580 Bacteria 2478
1674 Ga0501047_0000161 3300049581 Bacteria 81928
1675 Ga0501047_0005032 3300049581 Bacteria 12407
1676 Ga0501047_0023893 3300049581 Bacteria 5869
1677 Ga0501047_0027414 3300049581 Bacteria 5487
1678 Ga0501047_0083097 3300049581 Bacteria 3078
1679 Ga0501047_0116591 3300049581 Bacteria 2552
1680 Ga0501047_0150356 3300049581 Bacteria 2205
1681 Ga0501047_0346979 3300049581 Bacteria 1321
1682 Ga0501047_0678439 3300049581 Bacteria 848
1683 Ga0501047_0697469 3300049581 Bacteria 833
1684 Ga0501048_0000030 3300049582 Bacteria 66042
1685 Ga0501048_0080302 3300049582 Bacteria 2301
1686 Ga0501048_0200994 3300049582 Bacteria 1413
1687 Ga0501048_0619817 3300049582 Bacteria 777
1688 Ga0501067_0005711 3300049583 Bacteria 6906
1689 Ga0501067_0037890 3300049583 Bacteria 2678
1690 Ga0501067_0116889 3300049583 Bacteria 1483
1691 Ga0501067_0334695 3300049583 Bacteria 843
1692 Ga0501068_0015567 3300049584 Bacteria 4370
1693 Ga0501068_0043888 3300049584 Bacteria 2690
1694 Ga0501068_0056360 3300049584 Bacteria 2382
1695 Ga0501068_0087419 3300049584 Bacteria 1919
1696 Ga0501068_0174503 3300049584 Bacteria 1358
1697 Ga0501068_0264284 3300049584 Bacteria 1098
1698 Ga0501068_0379234 3300049584 Bacteria 910
1699 Ga0501068_0459317 3300049584 Bacteria 824
1700 Ga0501069_0069586 3300049585 Bacteria 1970
1701 Ga0501069_0111854 3300049585 Bacteria 1556
1702 Ga0501069_0123672 3300049585 Bacteria 1478
1703 Ga0501069_0176291 3300049585 Bacteria 1235
1704 Ga0501070_0012412 3300049586 Bacteria 7186
1705 Ga0501070_0051670 3300049586 Bacteria 3411
1706 Ga0501070_0054110 3300049586 Bacteria 3328
1707 Ga0501070_0072847 3300049586 Bacteria 2843
1708 Ga0501070_0091103 3300049586 Bacteria 2523
1709 Ga0501070_0225421 3300049586 Bacteria 1536
1710 Ga0501070_0394930 3300049586 Bacteria 1119
1711 Ga0501071_0079422 3300049587 Bacteria 2398
1712 Ga0501071_0169803 3300049587 Bacteria 1632
1713 Ga0501071_0259349 3300049587 Bacteria 1313
1714 Ga0501072_0022800 3300049588 Bacteria 4858
1715 Ga0501072_0073814 3300049588 Bacteria 2697
1716 Ga0501072_0157126 3300049588 Bacteria 1813
1717 Ga0501072_0245551 3300049588 Bacteria 1426
1718 Ga0501072_0326701 3300049588 Bacteria 1219
1719 Ga0501072_0447621 3300049588 Bacteria 1023
1720 Ga0501073_0022538 3300049589 Bacteria 4534
1721 Ga0501073_0026122 3300049589 Bacteria 4184
1722 Ga0501073_0034330 3300049589 Bacteria 3611
1723 Ga0501073_0049398 3300049589 Bacteria 2950
1724 Ga0501073_0061827 3300049589 Bacteria 2612
1725 Ga0501073_0138945 3300049589 Bacteria 1683
1726 Ga0501073_0149013 3300049589 Bacteria 1621
1727 Ga0501073_0176215 3300049589 Bacteria 1480
1728 Ga0501073_0304200 3300049589 Bacteria 1100
1729 Ga0501073_0316748 3300049589 Bacteria 1076
1730 Ga0501073_0454170 3300049589 Bacteria 886
1731 Ga0501074_0007516 3300049590 Bacteria 7885
1732 Ga0501074_0097059 3300049590 Bacteria 2110
1733 Ga0501074_0097838 3300049590 Bacteria 2100
1734 Ga0501074_0103528 3300049590 Bacteria 2038
1735 Ga0501074_0159350 3300049590 Bacteria 1612
1736 Ga0501074_0162235 3300049590 Bacteria 1596
1737 Ga0501074_0237302 3300049590 Bacteria 1297
1738 Ga0501075_0016123 3300049591 Bacteria 5378
1739 Ga0501075_0217805 3300049591 Bacteria 1456
1740 Ga0501075_0497997 3300049591 Bacteria 929
1741 Ga0501076_0067689 3300049592 Bacteria 2852
1742 Ga0501076_0194735 3300049592 Bacteria 1654
1743 Ga0501076_0279907 3300049592 Bacteria 1366
1744 Ga0501076_0419213 3300049592 Bacteria 1101
1745 Ga0501076_0448245 3300049592 Bacteria 1062
1746 Ga0501076_0577220 3300049592 Bacteria 927
1747 Ga0501077_0031803 3300049593 Bacteria 3358
1748 Ga0501077_0036846 3300049593 Bacteria 3116
1749 Ga0501077_0039300 3300049593 Bacteria 3014
1750 Ga0501077_0143464 3300049593 Bacteria 1515
1751 Ga0501077_0160220 3300049593 Bacteria 1428
1752 Ga0501077_0164991 3300049593 Bacteria 1407
1753 Ga0501077_0279940 3300049593 Bacteria 1062
1754 Ga0501077_0345802 3300049593 Bacteria 949
1755 Ga0501077_0473723 3300049593 Bacteria 802
1756 Ga0501079_0016018 3300049741 Bacteria 5727
1757 Ga0501079_0060955 3300049741 Bacteria 2911
1758 Ga0501079_0330830 3300049741 Bacteria 1193
1759 Ga0501079_0404723 3300049741 Bacteria 1070
1760 Ga0501080_0000181 3300049742 Bacteria 45949
1761 Ga0501080_0013887 3300049742 Bacteria 7413
1762 Ga0501080_0064398 3300049742 Bacteria 3410
1763 Ga0501080_0101279 3300049742 Bacteria 2672
1764 Ga0501080_0120165 3300049742 Bacteria 2435
1765 Ga0501080_0146534 3300049742 Bacteria 2182
1766 Ga0501080_0167755 3300049742 Bacteria 2026
1767 Ga0501080_0202208 3300049742 Bacteria 1823
1768 Ga0501080_0252474 3300049742 Bacteria 1608
1769 Ga0501080_0256614 3300049742 Bacteria 1593
1770 Ga0501080_0295023 3300049742 Bacteria 1471
1771 Ga0501080_0324733 3300049742 Bacteria 1393
1772 Ga0501080_0437387 3300049742 Bacteria 1174
1773 Ga0501080_0464541 3300049742 Bacteria 1134
1774 Ga0501081_0019712 3300049743 Bacteria 4494
1775 Ga0501081_0061635 3300049743 Bacteria 2601
1776 Ga0501081_0189235 3300049743 Bacteria 1490
1777 Ga0501081_0561189 3300049743 Bacteria 853
1778 Ga0501083_0004820 3300049744 Bacteria 9536
1779 Ga0501083_0016725 3300049744 Bacteria 5125
1780 Ga0501083_0051230 3300049744 Bacteria 2776
1781 Ga0501083_0081928 3300049744 Bacteria 2139
1782 Ga0501083_0117698 3300049744 Bacteria 1743
1783 Ga0501083_0161779 3300049744 Bacteria 1464
1784 Ga0501083_0206371 3300049744 Bacteria 1281
1785 Ga0501035_0021373 3300049822 Bacteria 5949
1786 Ga0501035_0030882 3300049822 Bacteria 4880
1787 Ga0501035_0042553 3300049822 Bacteria 4096
1788 Ga0501035_0070338 3300049822 Bacteria 3100
1789 Ga0501035_0152803 3300049822 Bacteria 2002
1790 Ga0501035_0186582 3300049822 Bacteria 1785
1791 Ga0501035_0198851 3300049822 Bacteria 1720
1792 Ga0501035_0379481 3300049822 Bacteria 1179
1793 Ga0501044_0000332 3300049823 Bacteria 59619
1794 Ga0501044_0000342 3300049823 Bacteria 58651
1795 Ga0501044_0012418 3300049823 Bacteria 9222
1796 Ga0501044_0041240 3300049823 Bacteria 4805
1797 Ga0501044_0047168 3300049823 Bacteria 4457
1798 Ga0501044_0055988 3300049823 Bacteria 4048
1799 Ga0501044_0121696 3300049823 Bacteria 2610
1800 Ga0501044_0123030 3300049823 Bacteria 2593
1801 Ga0501044_0133458 3300049823 Bacteria 2475
1802 Ga0501044_0144388 3300049823 Bacteria 2366
1803 Ga0501044_0205877 3300049823 Bacteria 1924
1804 Ga0501044_0242875 3300049823 Bacteria 1744
1805 Ga0501044_0602572 3300049823 Bacteria 991
1806 Ga0501044_0761189 3300049823 Bacteria 850
1807 Ga0501044_0870257 3300049823 Bacteria 777
1808 Ga0501044_1035762 3300049823 Bacteria 691
1809 Ga0501045_0235771 3300049824 Bacteria 1362
1810 nmdc:mga03683_158978_c1 3300050489 Bacteria 1023
1811 nmdc:mga03683_177775_c1 3300050489 Bacteria 970
1812 nmdc:mga03n38_471871_c1 3300050490 Bacteria 701
1813 nmdc:mga03n38_55404_c1 3300050490 Bacteria 1786
1814 nmdc:mga00v17_107713_c1 3300050491 Bacteria 1765
1815 nmdc:mga00v17_375685_c1 3300050491 Bacteria 924
1816 nmdc:mga0yw44_104245_c1 3300050492 Bacteria 1810
1817 nmdc:mga0yw44_130131_c1 3300050492 Bacteria 1629
1818 nmdc:mga0yw44_150547_c1 3300050492 Bacteria 1517
1819 nmdc:mga0yw44_261085_c1 3300050492 Bacteria 1154
1820 nmdc:mga0yw44_364301_c1 3300050492 Bacteria 974
1821 nmdc:mga0yw44_457860_c1 3300050492 Bacteria 865
1822 nmdc:mga0yw44_46155_c1 3300050492 Bacteria 2615
1823 nmdc:mga0yw44_474846_c1 3300050492 Bacteria 848
1824 nmdc:mga0yw44_584308_c1 3300050492 Bacteria 759
1825 nmdc:mga0yw44_606171_c1 3300050492 Bacteria 744
1826 nmdc:mga0k408_7684_c1 3300050493 Bacteria 5761
1827 nmdc:mga06z11_134722_c1 3300050494 Bacteria 1391
1828 nmdc:mga06z11_179966_c1 3300050494 Bacteria 1219
1829 nmdc:mga06z11_28602_c1 3300050494 Bacteria 2676
1830 nmdc:mga04h51_179286_c1 3300050495 Bacteria 824
1831 nmdc:mga04h51_45274_c1 3300050495 Bacteria 1454
1832 nmdc:mga04h51_90757_c1 3300050495 Bacteria 1099
1833 nmdc:mga05p37_1435222_c1 3300050507 Bacteria 692
1834 nmdc:mga05p37_198406_c1 3300050507 Bacteria 2432
1835 nmdc:mga05p37_2462_c1 3300050507 Bacteria 21532
1836 nmdc:mga05p37_358653_c1 3300050507 Bacteria 1714
1837 nmdc:mga05p37_371022_c1 3300050507 Bacteria 1679
1838 nmdc:mga05p37_6398_c1 3300050507 Bacteria 13881
1839 nmdc:mga05p37_76079_c1 3300050507 Bacteria 4133
1840 nmdc:mga05p37_819_c2 3300050507 Bacteria 27529
1841 nmdc:mga05p37_88623_c1 3300050507 Bacteria 3814
1842 nmdc:mga09592_11541_c1 3300050508 Bacteria 7189
1843 nmdc:mga09592_115995_c1 3300050508 Bacteria 2298
1844 nmdc:mga09592_1563_c1 3300050508 Bacteria 18432
1845 nmdc:mga09592_324_c1 3300050508 Bacteria 34853
1846 nmdc:mga0qj67_145888_c1 3300050509 Bacteria 1919
1847 nmdc:mga0qj67_25585_c1 3300050509 Bacteria 4561
1848 nmdc:mga0qj67_457832_c1 3300050509 Bacteria 1027
1849 nmdc:mga0qj67_575097_c1 3300050509 Bacteria 902
1850 nmdc:mga0qj67_656_c1 3300050509 Bacteria 23860
1851 nmdc:mga06r32_1450_c1 3300050510 Bacteria 21424
1852 nmdc:mga06r32_190679_c1 3300050510 Bacteria 2037
1853 nmdc:mga06r32_381340_c1 3300050510 Bacteria 1393
1854 nmdc:mga06r32_46283_c1 3300050510 Bacteria 4151
1855 nmdc:mga06r32_527938_c1 3300050510 Bacteria 1155
1856 nmdc:mga06r32_53800_c1 3300050510 Bacteria 3858
1857 nmdc:mga06r32_585012_c1 3300050510 Bacteria 1088
1858 nmdc:mga06r32_591433_c1 3300050510 Bacteria 1081
1859 nmdc:mga06r32_770_c1 3300050510 Bacteria 28278
1860 nmdc:mga08y16_255360_c1 3300050511 Bacteria 1811
1861 nmdc:mga08y16_298559_c1 3300050511 Bacteria 1661
1862 nmdc:mga08y16_359949_c1 3300050511 Bacteria 1494
1863 nmdc:mga08y16_4006_c1 3300050511 Bacteria 15356
1864 nmdc:mga08y16_451739_c1 3300050511 Bacteria 1310
1865 nmdc:mga08y16_46999_c1 3300050511 Bacteria 4518
1866 nmdc:mga08y16_490239_c1 3300050511 Bacteria 1250
1867 nmdc:mga08y16_667045_c1 3300050511 Bacteria 1043
1868 nmdc:mga08y16_697_c1 3300050511 Bacteria 31905
1869 nmdc:mga08y16_72_c1 3300050511 Bacteria 84439
1870 nmdc:mga08y16_75750_c1 3300050511 Bacteria 3507
1871 nmdc:mga08y16_80137_c1 3300050511 Bacteria 3404
1872 nmdc:mga08y16_968822_c1 3300050511 Bacteria 832
1873 nmdc:mga0n895_10439_c1 3300050512 Bacteria 8205
1874 nmdc:mga0n895_348965_c1 3300050512 Bacteria 1499
1875 nmdc:mga0n895_501080_c1 3300050512 Bacteria 1223
1876 nmdc:mga0n895_59412_c1 3300050512 Bacteria 3772
1877 nmdc:mga0n895_6034_c1 3300050512 Bacteria 10213
1878 nmdc:mga0n895_61610_c1 3300050512 Bacteria 3705
1879 nmdc:mga0n895_896149_c1 3300050512 Bacteria 873
1880 nmdc:mga0n895_96518_c1 3300050512 Bacteria 2961
1881 nmdc:mga0rr50_121519_c1 3300050513 Bacteria 2079
1882 nmdc:mga0rr50_309512_c1 3300050513 Bacteria 1323
1883 nmdc:mga0rr50_340718_c1 3300050513 Bacteria 1260
1884 nmdc:mga0rr50_3913_c1 3300050513 Bacteria 8664
1885 nmdc:mga0rr50_92268_c1 3300050513 Bacteria 2361
1886 nmdc:mga08x19_292391_c1 3300050514 Bacteria 1130
1887 nmdc:mga08x19_321383_c1 3300050514 Bacteria 1077
1888 nmdc:mga08x19_4517_c1 3300050514 Bacteria 8245
1889 nmdc:mga08x19_55533_c1 3300050514 Bacteria 2553
1890 nmdc:mga08x19_92847_c1 3300050514 Bacteria 1994
1891 nmdc:mga0a205_125304_c1 3300050515 Bacteria 2468
1892 nmdc:mga0a205_179713_c1 3300050515 Bacteria 2010
1893 nmdc:mga0a205_296237_c1 3300050515 Bacteria 1491
1894 nmdc:mga0a205_300502_c1 3300050515 Bacteria 1478
1895 nmdc:mga0a205_374833_c1 3300050515 Bacteria 1289
1896 nmdc:mga0a205_47937_c1 3300050515 Bacteria 4123
1897 nmdc:mga0a205_6688_c1 3300050515 Bacteria 10430
1898 nmdc:mga0sz30_8100_c1 3300050516 Bacteria 3959
1899 Ga0495601_0000018 3300053077 Bacteria 171665
1900 Ga0495601_0003683 3300053077 Bacteria 8814
1901 Ga0495601_0004319 3300053077 Bacteria 8209
1902 Ga0495601_0005565 3300053077 Bacteria 7347
1903 Ga0495601_0006052 3300053077 Bacteria 7059
1904 Ga0495601_0009705 3300053077 Bacteria 5694
1905 Ga0495601_0030092 3300053077 Bacteria 3371
1906 Ga0495601_0047578 3300053077 Bacteria 2701
1907 Ga0495601_0056215 3300053077 Bacteria 2492
1908 Ga0495601_0058237 3300053077 Bacteria 2448
1909 Ga0495601_0086353 3300053077 Bacteria 2016
1910 Ga0495601_0148300 3300053077 Bacteria 1531
1911 Ga0495612_0000011 3300053078 Bacteria 224729
1912 Ga0495612_0001141 3300053078 Bacteria 10900
1913 Ga0495612_0001779 3300053078 Bacteria 8826
1914 Ga0495612_0001873 3300053078 Bacteria 8648
1915 Ga0495612_0001975 3300053078 Bacteria 8448
1916 Ga0500610_0015774 3300053079 Bacteria 3586
1917 Ga0500635_0020235 3300053080 Bacteria 2036
1918 Ga0500635_0100150 3300053080 Bacteria 1065
1919 Ga0495655_0001970 3300053083 Bacteria 3208
1920 Ga0495655_0013475 3300053083 Bacteria 1692
1921 Ga0495655_0020624 3300053083 Bacteria 1481
1922 Ga0495595_0000043 3300053084 Bacteria 63655
1923 Ga0495595_0000954 3300053084 Bacteria 11130
1924 Ga0495595_0002892 3300053084 Bacteria 6767
1925 Ga0495595_0008760 3300053084 Bacteria 4165
1926 Ga0495595_0013234 3300053084 Bacteria 3483
1927 Ga0495595_0021589 3300053084 Bacteria 2814
1928 Ga0495595_0040846 3300053084 Bacteria 2121
1929 Ga0495595_0048082 3300053084 Bacteria 1969
1930 Ga0495595_0114281 3300053084 Bacteria 1311
1931 Ga0495595_0126362 3300053084 Bacteria 1248
1932 Ga0495595_0151678 3300053084 Bacteria 1141
1933 Ga0495595_0286854 3300053084 Bacteria 827
1934 Ga0495619_0000014 3300053085 Bacteria 261449
1935 Ga0495619_0000421 3300053085 Bacteria 28651
1936 Ga0495619_0000700 3300053085 Bacteria 21932
1937 Ga0495619_0000715 3300053085 Bacteria 21668
1938 Ga0495619_0001421 3300053085 Bacteria 15730
1939 Ga0495619_0001423 3300053085 Bacteria 15727
1940 Ga0495619_0008363 3300053085 Bacteria 6541
1941 Ga0495619_0010802 3300053085 Bacteria 5746
1942 Ga0495619_0058043 3300053085 Bacteria 2568
1943 Ga0495619_0064309 3300053085 Bacteria 2445
1944 Ga0495619_0136396 3300053085 Bacteria 1688
1945 Ga0495619_0546462 3300053085 Bacteria 795
1946 Ga0495619_0665733 3300053085 Bacteria 709
1947 Ga0500643_002441 3300053087 Bacteria 9603
1948 Ga0500644_0000902 3300053088 Bacteria 9489
1949 Ga0500646_0018525 3300053090 Bacteria 1835
1950 Ga0500646_0023621 3300053090 Bacteria 1650
1951 Ga0500651_0059982 3300053093 Bacteria 2378
1952 Ga0500641_0004528 3300053096 Bacteria 4913
1953 Ga0500641_0007475 3300053096 Bacteria 3898
1954 Ga0500641_0138980 3300053096 Bacteria 1049
1955 Ga0500650_0072702 3300053098 Bacteria 1607
1956 Ga0500572_001509 3300053111 Bacteria 6265
1957 Ga0500592_035976 3300053116 Bacteria 800
1958 Ga0500595_000006 3300053119 Bacteria 300857
1959 Ga0500595_045883 3300053119 Bacteria 1377
1960 Ga0500595_047706 3300053119 Bacteria 1341
1961 Ga0500597_000193 3300053120 Bacteria 12502
1962 Ga0500597_102986 3300053120 Bacteria 1240
1963 Ga0500642_0209280 3300053130 Bacteria 906
1964 Ga0500652_003773 3300053131 Bacteria 4619
1965 Ga0500658_0052616 3300053134 Bacteria 1668
1966 Ga0500658_0165618 3300053134 Bacteria 1002
1967 Ga0500559_0002528 3300053136 Bacteria 9396
1968 Ga0500568_0040507 3300053139 Bacteria 1875
1969 Ga0500590_138974 3300053148 Bacteria 1113
1970 Ga0500604_0023571 3300053151 Bacteria 1756
1971 Ga0500616_0000001 3300053153 Bacteria 1986011
1972 Ga0500616_0028459 3300053153 Bacteria 3079
1973 Ga0500616_0051396 3300053153 Bacteria 2172
1974 Ga0500616_0067776 3300053153 Bacteria 1829
1975 Ga0500616_0196299 3300053153 Bacteria 897
1976 Ga0500616_0282652 3300053153 Bacteria 696
1977 Ga0500620_000357 3300053155 Bacteria 8508
1978 Ga0500620_002055 3300053155 Bacteria 3931
1979 Ga0500624_000003 3300053157 Bacteria 253364
1980 Ga0500627_0031869 3300053158 Bacteria 2218
1981 Ga0500634_0187678 3300053161 Bacteria 922
1982 Ga0500639_005960 3300053163 Bacteria 6272
1983 Ga0500637_0000024 3300053178 Bacteria 59926
1984 Ga0500611_018246 3300053727 Bacteria 1291
1985 Ga0500645_000294 3300053730 Bacteria 35747
1986 Ga0500596_004182 3300053735 Bacteria 2669
1987 Ga0501084_0042336 3300054114 Bacteria 3810
1988 Ga0501084_0053673 3300054114 Bacteria 3372
1989 Ga0501084_0080820 3300054114 Bacteria 2725
1990 Ga0501084_0109233 3300054114 Bacteria 2324
1991 Ga0501084_0232934 3300054114 Bacteria 1554
1992 Ga0501084_0240611 3300054114 Bacteria 1528
1993 Ga0501084_0276058 3300054114 Bacteria 1419
1994 Ga0501084_0341349 3300054114 Bacteria 1265
1995 Ga0501084_0426782 3300054114 Bacteria 1121
1996 Ga0501084_0558336 3300054114 Bacteria 967
1997 Ga0501084_0575824 3300054114 Bacteria 951
1998 Ga0501082_0042260 3300060353 Bacteria 3930
1999 Ga0501082_0058086 3300060353 Bacteria 3333
2000 Ga0501082_0080014 3300060353 Bacteria 2819
2001 Ga0501082_0196213 3300060353 Bacteria 1756
2002 Ga0501082_0282946 3300060353 Bacteria 1443
2003 Ga0501082_0302242 3300060353 Bacteria 1393
2004 Ga0501082_0468674 3300060353 Bacteria 1101
2005 Ga0501082_0643518 3300060353 Bacteria 928
2006 Ga0501082_0774555 3300060353 Bacteria 839
2007 Ga0501082_0831605 3300060353 Unclassified 808
2008 Ga0501082_1038434 3300060353 Bacteria 717
2009 Ga0501082_1394486 3300060353 Bacteria 612
2010 Ga0466962_0219667 3300061719 Bacteria 931
2011 Ga0530510_0098131 3300061734 Bacteria 2142
2012 Ga0530510_0138333 3300061734 Bacteria 1793
2013 Ga0530510_0148221 3300061734 Bacteria 1731
2014 Ga0530510_0168570 3300061734 Bacteria 1622

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050510 nmdc:mga06r32_190679_c1 nmdc:mga06r32_190679_c1_1477_2025 182
2 3300006058 Ga0075432_10010899 Ga0075432_100108994 183
3 3300006177 Ga0075362_10144249 Ga0075362_101442492 183
4 3300005289 Ga0065704_10006262 Ga0065704_100062624 184
5 3300049823 Ga0501044_0000342 Ga0501044_0000342_22349_22939 184
6 3300053120 Ga0500597_000193 Ga0500597_000193_4492_5085 184
7 3300053157 Ga0500624_000003 Ga0500624_000003_126080_126673 184
8 3300053178 Ga0500637_0000024 Ga0500637_0000024_34325_34918 184
9 3300009148 Ga0105243_10861807 Ga0105243_108618072 185
10 3300033180 Ga0307510_10258114 Ga0307510_102581142 185
11 3300035089 Ga0373944_0080025 Ga0373944_0080025_461_1039 189
12 3300035692 Ga0373935_0022121 Ga0373935_0022121_3305_3883 189
13 3300039450 Ga0436363_0048977 Ga0436363_0048977_52_630 189
14 3300046514 Ga0495618_0080671 Ga0495618_0080671_1486_2064 189
15 3300046558 Ga0495633_0387054 Ga0495633_0387054_37_621 189
16 3300048907 Ga0496104_0043040 Ga0496104_0043040_3646_4224 189
17 3300048920 Ga0496117_0040353 Ga0496117_0040353_42_626 189
18 3300048928 Ga0496125_0109577 Ga0496125_0109577_1392_1976 189
19 3300050495 nmdc:mga04h51_179286_c1 nmdc:mga04h51_179286_c1_14_592 189
20 3300053148 Ga0500590_138974 Ga0500590_138974_504_1082 189
21 3300053161 Ga0500634_0187678 Ga0500634_0187678_311_895 189
22 3300034957 Ga0373938_0107165 Ga0373938_0107165_12_596 190
23 3300049824 Ga0501045_0235771 Ga0501045_0235771_757_1335 192
24 3300039447 Ga0436361_0058212 Ga0436361_0058212_684_1265 193
25 3300035410 Ga0373924_0303636 Ga0373924_0303636_110_697 195
26 3300049568 Ga0501031_0609017 Ga0501031_0609017_10_597 195
27 3300060353 Ga0501082_0080014 Ga0501082_0080014_2220_2807 195
28 3300060353 Ga0501082_1394486 Ga0501082_1394486_11_598 195
29 3300035207 Ga0373942_0005062 Ga0373942_0005062_1836_2465 196
30 3300046557 Ga0495622_0002915 Ga0495622_0002915_5529_6158 196
31 3300050511 nmdc:mga08y16_968822_c1 nmdc:mga08y16_968822_c1_22_645 196
32 3300053080 Ga0500635_0020235 Ga0500635_0020235_492_1121 196
33 3300036401 Ga0373937_0035243 Ga0373937_0035243_2656_3255 198
34 3300046559 Ga0495667_0087124 Ga0495667_0087124_924_1523 198
35 3300039447 Ga0436361_0028445 Ga0436361_0028445_121_762 200
36 3300050507 nmdc:mga05p37_358653_c1 nmdc:mga05p37_358653_c1_28_642 200
37 iso_pu_bacteria 2508501123 2509115214 200
38 iso_pu_bacteria 2509276022 2509394517 200
39 iso_pu_bacteria 2512875024 2512961026 200
40 iso_pu_bacteria 2513237090 2513611215 200
41 iso_pu_bacteria 2513237164 2514038454 200
42 iso_pu_bacteria 2513237305 2514417202 200
43 iso_pu_bacteria 2599185301 2599939073 200
44 iso_pu_bacteria 2693429783 2694634250 200
45 iso_pu_bacteria 2693429784 2694637975 200
46 iso_pu_bacteria 2721755686 2723573965 200
47 iso_pu_bacteria 2791355123 2792748406 200
48 iso_pu_bacteria 2847670302 2847674607 200
49 iso_pu_bacteria 2856314179 2856317507 200
50 iso_pu_bacteria 2856320880 2856322672 200
51 iso_pu_bacteria 2856349417 2856351269 200
52 iso_pu_bacteria 2856356410 2856361536 200
53 iso_pu_bacteria 2856364286 2856366711 200
54 iso_pu_bacteria 2857349434 2857356607 200
55 iso_pu_bacteria 2869169390 2869174355 200
56 iso_pu_bacteria 2869234852 2869237782 200
57 iso_pu_bacteria 2869242130 2869244740 200
58 iso_pu_bacteria 2869256925 2869258946 200
59 iso_pu_bacteria 2869278585 2869285810 200
60 iso_pu_bacteria 2869285874 2869287878 200
61 iso_pu_bacteria 2871429161 2871435826 200
62 iso_pu_bacteria 2871435913 2871441841 200
63 iso_pu_bacteria 2871481445 2871486153 200
64 iso_pu_bacteria 2871488783 2871489899 200
65 iso_pu_bacteria 2874109183 2874111120 200
66 iso_pu_bacteria 2874116593 2874117227 200
67 iso_pu_bacteria 2874123672 2874128809 200
68 iso_pu_bacteria 2874139085 2874141876 200
69 iso_pu_bacteria 2874146452 2874151511 200
70 iso_pu_bacteria 2874155637 2874159143 200
71 iso_pu_bacteria 2874168670 2874175696 200
72 iso_pu_bacteria 2876377896 2876379686 200
73 iso_pu_bacteria 2876392853 2876396196 200
74 iso_pu_bacteria 2876413966 2876417562 200
75 iso_pu_bacteria 2876420981 2876426096 200
76 iso_pu_bacteria 2878035449 2878038545 200
77 iso_pu_bacteria 2878738818 2878739385 200
78 iso_pu_bacteria 2878745973 2878749389 200
79 iso_pu_bacteria 2878753008 2878754429 200
80 iso_pu_bacteria 2881155292 2881160623 200
81 iso_pu_bacteria 2881161766 2881166315 200
82 iso_pu_bacteria 2881853255 2881854754 200
83 iso_pu_bacteria 2882632389 2882634087 200
84 iso_pu_bacteria 2882912400 2882919363 200
85 iso_pu_bacteria 2885305155 2885307744 200
86 iso_pu_bacteria 2885318864 2885322657 200
87 iso_pu_bacteria 2885326080 2885327086 200
88 iso_pu_bacteria 2885334103 2885340180 200
89 iso_pu_bacteria 2885342637 2885342876 200
90 iso_pu_bacteria 2885350715 2885353227 200
91 iso_pu_bacteria 2888337043 2888337962 200
92 iso_pu_bacteria 2888350351 2888354552 200
93 iso_pu_bacteria 2889010040 2889016156 200
94 iso_pu_bacteria 2889016732 2889018803 200
95 iso_pu_bacteria 2903492973 2903493620 200
96 iso_pu_bacteria 2903513507 2903518001 200
97 iso_pu_bacteria 2904659560 2904662972 200
98 iso_pu_bacteria 2906308376 2906310427 200
99 iso_pu_bacteria 2906321335 2906324492 200
100 iso_pu_bacteria 2906354277 2906358229 200
101 iso_pu_bacteria 2906401398 2906405652 200
102 iso_pu_bacteria 2906414383 2906417572 200
103 iso_pu_bacteria 2906427513 2906428312 200
104 iso_pu_bacteria 2922130491 2922133633 200
105 iso_pu_bacteria 2922185730 2922187832 200
106 iso_pu_bacteria 2924718760 2924724037 200
107 iso_pu_bacteria 2924762789 2924769295 200
108 iso_pu_bacteria 2924776078 2924776906 200
109 iso_pu_bacteria 2924784321 2924790183 200
110 iso_pu_bacteria 2937813078 2937817255 200
111 iso_pu_bacteria 2937822353 2937825778 200
112 iso_pu_bacteria 2937861824 2937866678 200
113 iso_pu_bacteria 2937877337 2937883494 200
114 iso_pu_bacteria 2937972304 2937973527 200
115 iso_pu_bacteria 2937980651 2937984979 200
116 iso_pu_bacteria 2938014810 2938018523 200
117 iso_pu_bacteria 2958034702 2958041826 200
118 iso_pu_bacteria 2958041894 2958043489 200
119 iso_pu_bacteria 2958041894 2958050357 200
120 iso_pu_bacteria 2958064165 2958070081 200
121 iso_pu_bacteria 2958084443 2958090661 200
122 iso_pu_bacteria 2958100919 2958108045 200
123 iso_pu_bacteria 2958108152 2958108299 200
124 iso_pu_bacteria 2958130278 2958132282 200
125 iso_pu_bacteria 2958144490 2958146193 200
126 iso_pu_bacteria 2958172287 2958177588 200
127 iso_pu_bacteria 2958179912 2958182096 200
128 iso_pu_bacteria 2961077736 2961079940 200
129 iso_pu_bacteria 2961114664 2961117998 200
130 iso_pu_bacteria 2961127735 2961133390 200
131 iso_pu_bacteria 2961183825 2961184874 200
132 iso_pu_bacteria 2965119406 2965126165 200
133 iso_pu_bacteria 2967996073 2967996966 200
134 iso_pu_bacteria 2968003550 2968005027 200
135 iso_pu_bacteria 2968016561 2968016677 200
136 iso_pu_bacteria 2968110612 2968114059 200
137 iso_pu_bacteria 2968117919 2968123250 200
138 iso_pu_bacteria 2970469710 2970470019 200
139 iso_pu_bacteria 2970503327 2970504457 200
140 iso_pu_bacteria 2970510686 2970515185 200
141 iso_pu_bacteria 2970532167 2970534831 200
142 iso_pu_bacteria 2970593180 2970600427 200
143 iso_pu_bacteria 2970627176 2970631857 200
144 iso_pu_bacteria 2977821940 2977823646 200
145 iso_pu_bacteria 2977828996 2977832106 200
146 iso_pu_bacteria 2977843712 2977847544 200
147 iso_pu_bacteria 2977851361 2977856346 200
148 iso_pu_bacteria 2977907340 2977908152 200
149 iso_pu_bacteria 2977922695 2977928849 200
150 iso_pu_bacteria 2977942078 2977943061 200
151 iso_pu_bacteria 2977971508 2977978184 200
152 iso_pu_bacteria 2979710463 2979710535 200
153 iso_pu_bacteria 2979742915 2979743838 200
154 iso_pu_bacteria 2979772303 2979778514 200
155 iso_pu_bacteria 2979808191 2979809094 200
156 iso_pu_bacteria 2987636660 2987643887 200
157 iso_pu_bacteria 2987652177 2987657341 200
158 iso_pu_bacteria 2987666974 2987672471 200
159 iso_pu_bacteria 2996348954 2996353052 200
160 iso_pu_bacteria 2996386984 2996389668 200
161 iso_pu_bacteria 3000135777 3000141337 200
162 iso_pu_bacteria 3004203850 3004208036 200
163 iso_pu_bacteria 3004232784 3004237396 200
164 iso_pu_bacteria 3004248173 3004249969 200
165 iso_pu_bacteria 3004268573 3004270586 200
166 iso_pu_bacteria 3004275668 3004279734 200
167 iso_pu_bacteria 3004289098 3004291181 200
168 iso_pu_bacteria 3004334049 3004336215 200
169 iso_pu_bacteria 637000159 637076084 200
170 iso_pu_bacteria 8004312739 8004318031 200
171 iso_pu_bacteria 8004374579 8004376005 200
172 iso_pu_bacteria 8004387939 8004389666 200
173 iso_pu_bacteria 8004640170 8004645521 200
174 iso_pu_bacteria 8004714634 8004718063 200
175 iso_pu_bacteria 8004727605 8004732922 200
176 3300005434 Ga0070709_10276944 Ga0070709_102769441 201
177 3300005435 Ga0070714_100154877 Ga0070714_1001548773 201
178 3300005436 Ga0070713_100208308 Ga0070713_1002083082 201
179 3300025906 Ga0207699_10210686 Ga0207699_102106861 201
180 3300046517 Ga0495630_0600530 Ga0495630_0600530_85_711 201
181 3300001979 JGI24740J21852_10002310 JGI24740J21852_100023102 202
182 3300001989 JGI24739J22299_10009248 JGI24739J22299_100092482 202
183 3300002067 JGI24735J21928_10031051 JGI24735J21928_100310512 202
184 3300002067 JGI24735J21928_10061987 JGI24735J21928_100619872 202
185 3300003214 JGI25165J46597_1000097 JGI25165J46597_1000097134 202
186 3300003762 Ga0055542_1000343 Ga0055542_100034324 202
187 3300005339 Ga0070660_100074311 Ga0070660_1000743112 202
188 3300005367 Ga0070667_100318081 Ga0070667_1003180812 202
189 3300005455 Ga0070663_100270908 Ga0070663_1002709081 202
190 3300005455 Ga0070663_100820542 Ga0070663_1008205421 202
191 3300005535 Ga0070684_100844934 Ga0070684_1008449341 202
192 3300005539 Ga0068853_100020941 Ga0068853_1000209416 202
193 3300005539 Ga0068853_100103523 Ga0068853_1001035232 202
194 3300005547 Ga0070693_100688932 Ga0070693_1006889321 202
195 3300005548 Ga0070665_100114489 Ga0070665_1001144891 202
196 3300005563 Ga0068855_100356747 Ga0068855_1003567473 202
197 3300005563 Ga0068855_100612759 Ga0068855_1006127592 202
198 3300005577 Ga0068857_100422674 Ga0068857_1004226742 202
199 3300005614 Ga0068856_100149603 Ga0068856_1001496032 202
200 3300005614 Ga0068856_100227753 Ga0068856_1002277532 202
201 3300006038 Ga0075365_10010892 Ga0075365_100108925 202
202 3300006038 Ga0075365_10271708 Ga0075365_102717082 202
203 3300006038 Ga0075365_10303469 Ga0075365_103034692 202
204 3300006042 Ga0075368_10025010 Ga0075368_100250103 202
205 3300006048 Ga0075363_100087914 Ga0075363_1000879142 202
206 3300006051 Ga0075364_10024491 Ga0075364_100244914 202
207 3300006051 Ga0075364_10155574 Ga0075364_101555742 202
208 3300006177 Ga0075362_10031766 Ga0075362_100317663 202
209 3300006178 Ga0075367_10008343 Ga0075367_100083434 202
210 3300006353 Ga0075370_10017435 Ga0075370_100174354 202
211 3300009093 Ga0105240_10147730 Ga0105240_101477302 202
212 3300009174 Ga0105241_10211075 Ga0105241_102110752 202
213 3300009177 Ga0105248_10218449 Ga0105248_102184491 202
214 3300009545 Ga0105237_10012745 Ga0105237_100127453 202
215 3300009545 Ga0105237_10256334 Ga0105237_102563343 202
216 3300009551 Ga0105238_10027272 Ga0105238_100272725 202
217 3300013104 Ga0157370_10912168 Ga0157370_109121682 202
218 3300013105 Ga0157369_10098692 Ga0157369_100986925 202
219 3300013105 Ga0157369_10148854 Ga0157369_101488542 202
220 3300015261 Ga0182006_1022133 Ga0182006_10221333 202
221 3300015262 Ga0182007_10008405 Ga0182007_100084053 202
222 3300025250 Ga0209026_1000041 Ga0209026_1000041263 202
223 3300025254 Ga0209148_1000069 Ga0209148_1000069294 202
224 3300025256 Ga0209759_1000183 Ga0209759_100018374 202
225 3300025261 Ga0209233_1000030 Ga0209233_1000030539 202
226 3300025272 Ga0209455_1000161 Ga0209455_100016148 202
227 3300025904 Ga0207647_10014547 Ga0207647_100145476 202
228 3300025913 Ga0207695_10142713 Ga0207695_101427132 202
229 3300025914 Ga0207671_10003241 Ga0207671_100032415 202
230 3300025924 Ga0207694_10003979 Ga0207694_100039796 202
231 3300025949 Ga0207667_10377394 Ga0207667_103773942 202
232 3300025981 Ga0207640_10073720 Ga0207640_100737202 202
233 3300026041 Ga0207639_10030339 Ga0207639_100303395 202
234 3300026041 Ga0207639_10131417 Ga0207639_101314172 202
235 3300026067 Ga0207678_10280989 Ga0207678_102809891 202
236 3300026067 Ga0207678_10287799 Ga0207678_102877992 202
237 3300026142 Ga0207698_10201705 Ga0207698_102017051 202
238 3300026142 Ga0207698_10244784 Ga0207698_102447844 202
239 3300027866 Ga0209813_10030435 Ga0209813_100304352 202
240 3300028379 Ga0268266_10039742 Ga0268266_100397424 202
241 3300028379 Ga0268266_10075110 Ga0268266_100751102 202
242 3300028379 Ga0268266_10470945 Ga0268266_104709452 202
243 3300037418 Ga0395900_0229385 Ga0395900_0229385_738_1352 202
244 3300038443 Ga0395901_0025998 Ga0395901_0025998_406_1020 202
245 3300038443 Ga0395901_1443645 Ga0395901_1443645_21_635 202
246 3300041486 Ga0451807_0541634 Ga0451807_0541634_18_632 202
247 3300044658 Ga0466972_0063083 Ga0466972_0063083_908_1522 202
248 3300046519 Ga0495632_0205315 Ga0495632_0205315_202_816 202
249 3300046616 Ga0495668_0092160 Ga0495668_0092160_18_632 202
250 3300046616 Ga0495668_0291583 Ga0495668_0291583_40_654 202
251 3300047472 Ga0495686_0050548 Ga0495686_0050548_415_1029 202
252 3300047472 Ga0495686_0087262 Ga0495686_0087262_96_710 202
253 3300048905 Ga0496102_0199308 Ga0496102_0199308_454_1068 202
254 3300048915 Ga0496112_0075222 Ga0496112_0075222_2120_2734 202
255 3300048918 Ga0496115_0148255 Ga0496115_0148255_358_972 202
256 3300048922 Ga0496119_0030403 Ga0496119_0030403_303_917 202
257 3300048922 Ga0496119_0062453 Ga0496119_0062453_857_1474 202
258 3300048923 Ga0496120_0002681 Ga0496120_0002681_7858_8475 202
259 3300048924 Ga0496121_0090310 Ga0496121_0090310_948_1562 202
260 3300048929 Ga0496126_0023605 Ga0496126_0023605_2751_3365 202
261 3300053116 Ga0500592_035976 Ga0500592_035976_73_687 202
262 3300053119 Ga0500595_047706 Ga0500595_047706_32_646 202
263 3300053139 Ga0500568_0040507 Ga0500568_0040507_466_1080 202
264 3300053151 Ga0500604_0023571 Ga0500604_0023571_376_990 202
265 3300053153 Ga0500616_0028459 Ga0500616_0028459_2300_2914 202
266 3300053153 Ga0500616_0282652 Ga0500616_0282652_20_634 202
267 3300053155 Ga0500620_000357 Ga0500620_000357_1434_2048 202
268 3300053155 Ga0500620_002055 Ga0500620_002055_2281_2895 202
269 3300053727 Ga0500611_018246 Ga0500611_018246_336_950 202
270 3300035086 Ga0373934_0250712 Ga0373934_0250712_18_629 203
271 3300035091 Ga0373951_0125376 Ga0373951_0125376_44_682 203
272 3300060353 Ga0501082_0831605 Ga0501082_0831605_10_636 203
273 3300005329 Ga0070683_100481433 Ga0070683_1004814331 204
274 3300005354 Ga0070675_100120816 Ga0070675_1001208163 204
275 3300005530 Ga0070679_100095548 Ga0070679_1000955484 204
276 3300005535 Ga0070684_100739148 Ga0070684_1007391482 204
277 3300005563 Ga0068855_100230418 Ga0068855_1002304182 204
278 3300005564 Ga0070664_100546047 Ga0070664_1005460472 204
279 3300005564 Ga0070664_100585386 Ga0070664_1005853861 204
280 3300006844 Ga0075428_100093758 Ga0075428_1000937586 204
281 3300006846 Ga0075430_100374764 Ga0075430_1003747641 204
282 3300006847 Ga0075431_100285141 Ga0075431_1002851412 204
283 3300009094 Ga0111539_10066049 Ga0111539_100660494 204
284 3300009147 Ga0114129_11363407 Ga0114129_113634072 204
285 3300014326 Ga0157380_10384316 Ga0157380_103843162 204
286 3300025921 Ga0207652_10015643 Ga0207652_100156437 204
287 3300025926 Ga0207659_10357891 Ga0207659_103578912 204
288 3300025944 Ga0207661_10559788 Ga0207661_105597881 204
289 3300027907 Ga0207428_10169474 Ga0207428_101694742 204
290 3300035118 Ga0373954_0020764 Ga0373954_0020764_643_1275 204
291 3300035172 Ga0373955_0313039 Ga0373955_0313039_223_855 204
292 3300035724 Ga0373933_0345715 Ga0373933_0345715_227_859 204
293 3300036401 Ga0373937_0035094 Ga0373937_0035094_1415_2047 204
294 3300036401 Ga0373937_0081596 Ga0373937_0081596_96_728 204
295 3300046459 Ga0495629_0511937 Ga0495629_0511937_68_709 204
296 3300046472 Ga0495580_0189902 Ga0495580_0189902_601_1242 204
297 3300046476 Ga0495662_0145721 Ga0495662_0145721_299_940 204
298 3300046477 Ga0495664_0068956 Ga0495664_0068956_1461_2093 204
299 3300046533 Ga0495640_0147161 Ga0495640_0147161_453_1094 204
300 3300046533 Ga0495640_0461845 Ga0495640_0461845_17_682 204
301 3300046535 Ga0495586_0028882 Ga0495586_0028882_1769_2410 204
302 3300046684 Ga0495669_0057601 Ga0495669_0057601_792_1427 204
303 3300046690 Ga0495624_0590689 Ga0495624_0590689_11_652 204
304 3300047321 Ga0495676_0424043 Ga0495676_0424043_73_714 204
305 3300047444 Ga0495675_0165530 Ga0495675_0165530_687_1319 204
306 3300048088 Ga0495602_0222496 Ga0495602_0222496_166_798 204
307 3300049572 Ga0501036_0423562 Ga0501036_0423562_34_705 204
308 3300049586 Ga0501070_0394930 Ga0501070_0394930_262_936 204
309 3300049590 Ga0501074_0237302 Ga0501074_0237302_348_1019 204
310 3300050509 nmdc:mga0qj67_575097_c1 nmdc:mga0qj67_575097_c1_101_736 204
311 3300050511 nmdc:mga08y16_298559_c1 nmdc:mga08y16_298559_c1_623_1258 204
312 3300050511 nmdc:mga08y16_451739_c1 nmdc:mga08y16_451739_c1_266_901 204
313 3300054114 Ga0501084_0232934 Ga0501084_0232934_552_1226 204
314 3300060353 Ga0501082_0282946 Ga0501082_0282946_507_1181 204
315 3300060353 Ga0501082_0302242 Ga0501082_0302242_77_748 204
316 3300025735 Ga0207713_1100460 Ga0207713_11004601 205
317 3300026116 Ga0207674_10550998 Ga0207674_105509982 205
318 3300028556 Ga0265337_1000755 Ga0265337_100075512 205
319 3300049571 Ga0501034_0091894 Ga0501034_0091894_115_750 205
320 3300049578 Ga0501042_0152732 Ga0501042_0152732_407_1057 205
321 3300049588 Ga0501072_0073814 Ga0501072_0073814_1179_1829 205
322 3300049590 Ga0501074_0103528 Ga0501074_0103528_364_1014 205
323 3300049592 Ga0501076_0279907 Ga0501076_0279907_465_1115 205
324 3300049742 Ga0501080_0464541 Ga0501080_0464541_310_960 205
325 3300049743 Ga0501081_0189235 Ga0501081_0189235_334_984 205
326 iso_pu_bacteria 2512875016 2512933003 205
327 iso_pu_bacteria 2588253730 2588519057 205
328 iso_pu_bacteria 2876363079 2876364749 205
329 iso_pu_bacteria 2881845957 2881848023 205
330 iso_pu_bacteria 2903448605 2903449264 205
331 iso_pu_bacteria 2903492973 2903497634 205
332 iso_pu_bacteria 2903521522 2903522515 205
333 iso_pu_bacteria 2903528002 2903528894 205
334 iso_pu_bacteria 2937848649 2937855443 205
335 iso_pu_bacteria 2961170736 2961171859 205
336 iso_pu_bacteria 2963644680 2963646205 205
337 iso_pu_bacteria 2968083720 2968085327 205
338 iso_pu_bacteria 2977986579 2977991803 205
339 iso_pu_bacteria 3004211236 3004211494 205
340 iso_pu_bacteria 3004218560 3004224957 205
341 3300005843 Ga0068860_100776091 Ga0068860_1007760912 206
342 3300028577 Ga0265318_10023091 Ga0265318_100230912 206
343 3300031249 Ga0265339_10189036 Ga0265339_101890362 206
344 3300031249 Ga0265339_10210135 Ga0265339_102101352 206
345 3300031250 Ga0265331_10022654 Ga0265331_100226543 206
346 3300031344 Ga0265316_10020706 Ga0265316_100207065 206
347 3300031711 Ga0265314_10006018 Ga0265314_100060186 206
348 3300031711 Ga0265314_10109323 Ga0265314_101093232 206
349 3300031711 Ga0265314_10222219 Ga0265314_102222192 206
350 3300031712 Ga0265342_10064870 Ga0265342_100648703 206
351 3300035692 Ga0373935_0580108 Ga0373935_0580108_91_720 206
352 3300049571 Ga0501034_0553944 Ga0501034_0553944_109_744 206
353 3300049571 Ga0501034_0619329 Ga0501034_0619329_280_915 206
354 3300049583 Ga0501067_0005711 Ga0501067_0005711_3132_3767 206
355 3300049588 Ga0501072_0447621 Ga0501072_0447621_211_846 206
356 3300049589 Ga0501073_0049398 Ga0501073_0049398_727_1362 206
357 3300049590 Ga0501074_0097059 Ga0501074_0097059_770_1405 206
358 3300049592 Ga0501076_0194735 Ga0501076_0194735_83_718 206
359 3300049592 Ga0501076_0419213 Ga0501076_0419213_188_823 206
360 3300049593 Ga0501077_0031803 Ga0501077_0031803_884_1519 206
361 3300049742 Ga0501080_0167755 Ga0501080_0167755_481_1116 206
362 3300049742 Ga0501080_0252474 Ga0501080_0252474_693_1328 206
363 3300049744 Ga0501083_0081928 Ga0501083_0081928_645_1280 206
364 3300049744 Ga0501083_0117698 Ga0501083_0117698_27_662 206
365 3300054114 Ga0501084_0080820 Ga0501084_0080820_1556_2191 206
366 3300054114 Ga0501084_0240611 Ga0501084_0240611_39_674 206
367 3300054114 Ga0501084_0276058 Ga0501084_0276058_301_936 206
368 3300060353 Ga0501082_0042260 Ga0501082_0042260_3019_3654 206
369 3300061734 Ga0530510_0168570 Ga0530510_0168570_162_797 206
370 3300005330 Ga0070690_100072393 Ga0070690_1000723932 207
371 3300005546 Ga0070696_100159303 Ga0070696_1001593032 207
372 3300009098 Ga0105245_11081783 Ga0105245_110817832 207
373 3300049568 Ga0501031_0099268 Ga0501031_0099268_1056_1688 207
374 3300049569 Ga0501032_0054687 Ga0501032_0054687_1224_1856 207
375 3300049569 Ga0501032_0080574 Ga0501032_0080574_478_1110 207
376 3300049570 Ga0501033_0148900 Ga0501033_0148900_93_725 207
377 3300049570 Ga0501033_0435756 Ga0501033_0435756_14_649 207
378 3300049571 Ga0501034_0013362 Ga0501034_0013362_2831_3463 207
379 3300049571 Ga0501034_0086055 Ga0501034_0086055_934_1566 207
380 3300049571 Ga0501034_0468132 Ga0501034_0468132_315_950 207
381 3300049572 Ga0501036_0032877 Ga0501036_0032877_3023_3655 207
382 3300049572 Ga0501036_0070304 Ga0501036_0070304_1563_2195 207
383 3300049573 Ga0501037_0019445 Ga0501037_0019445_3237_3869 207
384 3300049574 Ga0501038_0044386 Ga0501038_0044386_260_892 207
385 3300049574 Ga0501038_0089335 Ga0501038_0089335_1241_1873 207
386 3300049575 Ga0501039_0035601 Ga0501039_0035601_2508_3140 207
387 3300049575 Ga0501039_0104615 Ga0501039_0104615_498_1130 207
388 3300049579 Ga0501043_0011917 Ga0501043_0011917_1789_2421 207
389 3300049580 Ga0501046_0055509 Ga0501046_0055509_1275_1907 207
390 3300049581 Ga0501047_0005032 Ga0501047_0005032_2968_3600 207
391 3300049581 Ga0501047_0697469 Ga0501047_0697469_92_724 207
392 3300049582 Ga0501048_0200994 Ga0501048_0200994_720_1352 207
393 3300049583 Ga0501067_0037890 Ga0501067_0037890_1807_2439 207
394 3300049584 Ga0501068_0174503 Ga0501068_0174503_686_1318 207
395 3300049586 Ga0501070_0072847 Ga0501070_0072847_722_1354 207
396 3300049589 Ga0501073_0176215 Ga0501073_0176215_659_1294 207
397 3300049742 Ga0501080_0146534 Ga0501080_0146534_100_732 207
398 3300049822 Ga0501035_0152803 Ga0501035_0152803_1006_1638 207
399 3300049822 Ga0501035_0379481 Ga0501035_0379481_277_909 207
400 3300049823 Ga0501044_0055988 Ga0501044_0055988_841_1473 207
401 3300049823 Ga0501044_0144388 Ga0501044_0144388_656_1288 207
402 3300060353 Ga0501082_1038434 Ga0501082_1038434_37_672 207
403 3300005719 Ga0068861_100351108 Ga0068861_1003511082 208
404 3300006353 Ga0075370_10170196 Ga0075370_101701962 208
405 3300009093 Ga0105240_10568195 Ga0105240_105681953 208
406 3300009148 Ga0105243_10180012 Ga0105243_101800122 208
407 3300010375 Ga0105239_10054375 Ga0105239_100543752 208
408 3300026023 Ga0207677_10426806 Ga0207677_104268062 208
409 3300026089 Ga0207648_10219101 Ga0207648_102191011 208
410 3300037068 Ga0373925_0112939 Ga0373925_0112939_502_1128 208
411 3300039438 Ga0436360_0979935 Ga0436360_0979935_1118_1747 208
412 3300046660 Ga0495625_0015947 Ga0495625_0015947_2370_3008 208
413 3300048915 Ga0496112_0415521 Ga0496112_0415521_307_945 208
414 3300048920 Ga0496117_0324117 Ga0496117_0324117_98_736 208
415 3300048924 Ga0496121_0289227 Ga0496121_0289227_444_1082 208
416 3300049570 Ga0501033_0400309 Ga0501033_0400309_174_821 208
417 3300049572 Ga0501036_0255225 Ga0501036_0255225_331_978 208
418 3300049581 Ga0501047_0083097 Ga0501047_0083097_2302_2949 208
419 3300049589 Ga0501073_0316748 Ga0501073_0316748_224_871 208
420 3300049742 Ga0501080_0101279 Ga0501080_0101279_357_1004 208
421 3300049742 Ga0501080_0295023 Ga0501080_0295023_42_692 208
422 3300050492 nmdc:mga0yw44_104245_c1 nmdc:mga0yw44_104245_c1_47_685 208
423 3300050492 nmdc:mga0yw44_457860_c1 nmdc:mga0yw44_457860_c1_112_750 208
424 3300050492 nmdc:mga0yw44_474846_c1 nmdc:mga0yw44_474846_c1_84_722 208
425 3300050492 nmdc:mga0yw44_584308_c1 nmdc:mga0yw44_584308_c1_96_734 208
426 3300050516 nmdc:mga0sz30_8100_c1 nmdc:mga0sz30_8100_c1_115_753 208
427 3300053079 Ga0500610_0015774 Ga0500610_0015774_2402_3040 208
428 3300053083 Ga0495655_0013475 Ga0495655_0013475_1008_1646 208
429 3300005458 Ga0070681_10068116 Ga0070681_100681161 209
430 3300005530 Ga0070679_100433825 Ga0070679_1004338252 209
431 3300007265 Ga0099794_10259007 Ga0099794_102590071 209
432 3300007788 Ga0099795_10220100 Ga0099795_102201001 209
433 3300010159 Ga0099796_10001206 Ga0099796_100012063 209
434 3300025921 Ga0207652_10251511 Ga0207652_102515112 209
435 3300025939 Ga0207665_10301724 Ga0207665_103017242 209
436 3300028577 Ga0265318_10015760 Ga0265318_100157602 209
437 3300031235 Ga0265330_10020155 Ga0265330_100201553 209
438 3300031240 Ga0265320_10023737 Ga0265320_100237373 209
439 3300031241 Ga0265325_10008093 Ga0265325_100080934 209
440 3300031242 Ga0265329_10008900 Ga0265329_100089004 209
441 3300031247 Ga0265340_10065668 Ga0265340_100656682 209
442 3300031250 Ga0265331_10038045 Ga0265331_100380452 209
443 3300031344 Ga0265316_10063233 Ga0265316_100632332 209
444 3300031595 Ga0265313_10015356 Ga0265313_100153563 209
445 3300031712 Ga0265342_10014514 Ga0265342_100145145 209
446 3300035113 Ga0373936_0001566 Ga0373936_0001566_3608_4237 209
447 3300035116 Ga0373945_0003184 Ga0373945_0003184_3876_4505 209
448 3300035117 Ga0373953_0031941 Ga0373953_0031941_527_1156 209
449 3300035118 Ga0373954_0001803 Ga0373954_0001803_6761_7390 209
450 3300035119 Ga0373956_0044824 Ga0373956_0044824_323_952 209
451 3300035120 Ga0373957_0016296 Ga0373957_0016296_926_1555 209
452 3300035170 Ga0373943_0003853 Ga0373943_0003853_4819_5448 209
453 3300035171 Ga0373946_0000239 Ga0373946_0000239_13248_13877 209
454 3300035692 Ga0373935_0000026 Ga0373935_0000026_56668_57297 209
455 3300035724 Ga0373933_0009369 Ga0373933_0009369_3232_3861 209
456 3300036401 Ga0373937_0000593 Ga0373937_0000593_21754_22383 209
457 3300037068 Ga0373925_0001734 Ga0373925_0001734_5897_6526 209
458 3300046454 Ga0495592_0000031 Ga0495592_0000031_82261_82890 209
459 3300046459 Ga0495629_0270072 Ga0495629_0270072_87_716 209
460 3300046462 Ga0495651_0002247 Ga0495651_0002247_664_1293 209
461 3300046463 Ga0495653_0000063 Ga0495653_0000063_49290_49919 209
462 3300046476 Ga0495662_0042812 Ga0495662_0042812_851_1480 209
463 3300046477 Ga0495664_0000004 Ga0495664_0000004_425586_426215 209
464 3300046511 Ga0495608_0000005 Ga0495608_0000005_117321_117950 209
465 3300046514 Ga0495618_0000095 Ga0495618_0000095_45696_46325 209
466 3300046516 Ga0495628_0000001 Ga0495628_0000001_425575_426204 209
467 3300046517 Ga0495630_0001137 Ga0495630_0001137_488_1117 209
468 3300046529 Ga0495652_0000002 Ga0495652_0000002_640109_640738 209
469 3300046533 Ga0495640_0000001 Ga0495640_0000001_734113_734742 209
470 3300046536 Ga0495587_0000016 Ga0495587_0000016_30228_30857 209
471 3300046543 Ga0495645_0000002 Ga0495645_0000002_425588_426217 209
472 3300046559 Ga0495667_0000007 Ga0495667_0000007_218323_218952 209
473 3300046642 Ga0495634_0000591 Ga0495634_0000591_4828_5457 209
474 3300046663 Ga0495635_0000002 Ga0495635_0000002_60720_61349 209
475 3300046675 Ga0495657_0001508 Ga0495657_0001508_1362_1991 209
476 3300046678 Ga0495599_0000005 Ga0495599_0000005_253810_254439 209
477 3300046678 Ga0495599_0348938 Ga0495599_0348938_247_876 209
478 3300046679 Ga0495623_0000016 Ga0495623_0000016_77760_78389 209
479 3300046680 Ga0495646_0000002 Ga0495646_0000002_45672_46301 209
480 3300046690 Ga0495624_0065667 Ga0495624_0065667_879_1508 209
481 3300046809 Ga0495600_0000018 Ga0495600_0000018_42147_42776 209
482 3300047317 Ga0495604_0000020 Ga0495604_0000020_71918_72547 209
483 3300047319 Ga0495674_0000002 Ga0495674_0000002_425576_426205 209
484 3300047322 Ga0495680_0000419 Ga0495680_0000419_29707_30336 209
485 3300047444 Ga0495675_0000120 Ga0495675_0000120_17841_18470 209
486 3300047471 Ga0495684_0000016 Ga0495684_0000016_17292_17921 209
487 3300047673 Ga0495593_0003828 Ga0495593_0003828_1576_2205 209
488 3300048088 Ga0495602_0000040 Ga0495602_0000040_79886_80515 209
489 3300048089 Ga0495614_0233924 Ga0495614_0233924_19_648 209
490 3300049568 Ga0501031_0480044 Ga0501031_0480044_42_671 209
491 3300049571 Ga0501034_0615349 Ga0501034_0615349_170_802 209
492 3300049575 Ga0501039_0028887 Ga0501039_0028887_600_1229 209
493 3300049584 Ga0501068_0459317 Ga0501068_0459317_69_698 209
494 3300049588 Ga0501072_0022800 Ga0501072_0022800_4014_4643 209
495 3300049590 Ga0501074_0159350 Ga0501074_0159350_397_1026 209
496 3300049591 Ga0501075_0016123 Ga0501075_0016123_3961_4590 209
497 3300049592 Ga0501076_0448245 Ga0501076_0448245_129_758 209
498 3300049593 Ga0501077_0039300 Ga0501077_0039300_152_781 209
499 3300049741 Ga0501079_0330830 Ga0501079_0330830_437_1066 209
500 3300049743 Ga0501081_0061635 Ga0501081_0061635_263_892 209
501 3300049823 Ga0501044_0121696 Ga0501044_0121696_415_1047 209
502 3300049823 Ga0501044_0870257 Ga0501044_0870257_100_729 209
503 3300053077 Ga0495601_0000018 Ga0495601_0000018_56795_57424 209
504 3300053078 Ga0495612_0000011 Ga0495612_0000011_178255_178884 209
505 3300053084 Ga0495595_0000043 Ga0495595_0000043_17459_18088 209
506 3300053085 Ga0495619_0000014 Ga0495619_0000014_106049_106678 209
507 3300053111 Ga0500572_001509 Ga0500572_001509_5457_6119 209
508 3300053136 Ga0500559_0002528 Ga0500559_0002528_5681_6343 209
509 3300053163 Ga0500639_005960 Ga0500639_005960_3791_4453 209
510 3300053735 Ga0500596_004182 Ga0500596_004182_164_826 209
511 3300054114 Ga0501084_0575824 Ga0501084_0575824_166_795 209
512 3300006195 Ga0075366_10016643 Ga0075366_100166434 210
513 3300009147 Ga0114129_10492748 Ga0114129_104927482 210
514 3300026089 Ga0207648_10099452 Ga0207648_100994522 210
515 3300031238 Ga0265332_10158826 Ga0265332_101588262 210
516 3300031247 Ga0265340_10043555 Ga0265340_100435552 210
517 3300035084 Ga0373928_0122648 Ga0373928_0122648_17_649 210
518 3300035121 Ga0373960_0176177 Ga0373960_0176177_14_661 210
519 3300035695 Ga0373927_0003590 Ga0373927_0003590_4004_4651 210
520 3300037068 Ga0373925_0019956 Ga0373925_0019956_825_1472 210
521 3300039438 Ga0436360_0104768 Ga0436360_0104768_10_687 210
522 3300041512 Ga0451853_1376749 Ga0451853_1376749_118_750 210
523 3300046473 Ga0495582_0072027 Ga0495582_0072027_1191_1838 210
524 3300046492 Ga0495585_0292151 Ga0495585_0292151_11_661 210
525 3300046538 Ga0495609_0084839 Ga0495609_0084839_732_1364 210
526 3300046683 Ga0495658_0008707 Ga0495658_0008707_3363_4010 210
527 3300046683 Ga0495658_0525383 Ga0495658_0525383_13_645 210
528 3300047315 Ga0495581_0177064 Ga0495581_0177064_521_1168 210
529 3300048907 Ga0496104_0031740 Ga0496104_0031740_1978_2625 210
530 3300048908 Ga0496105_0254351 Ga0496105_0254351_110_757 210
531 3300049570 Ga0501033_0480010 Ga0501033_0480010_43_687 210
532 3300049571 Ga0501034_0063087 Ga0501034_0063087_156_800 210
533 3300049571 Ga0501034_0316706 Ga0501034_0316706_359_1003 210
534 3300049572 Ga0501036_0321708 Ga0501036_0321708_253_897 210
535 3300049574 Ga0501038_0050906 Ga0501038_0050906_1371_2015 210
536 3300049574 Ga0501038_0282660 Ga0501038_0282660_307_951 210
537 3300049575 Ga0501039_0295647 Ga0501039_0295647_455_1099 210
538 3300049586 Ga0501070_0054110 Ga0501070_0054110_841_1485 210
539 3300049593 Ga0501077_0473723 Ga0501077_0473723_26_658 210
540 3300049822 Ga0501035_0070338 Ga0501035_0070338_716_1360 210
541 3300049823 Ga0501044_0041240 Ga0501044_0041240_2371_3015 210
542 3300050489 nmdc:mga03683_177775_c1 nmdc:mga03683_177775_c1_326_958 210
543 3300050492 nmdc:mga0yw44_606171_c1 nmdc:mga0yw44_606171_c1_98_730 210
544 3300050507 nmdc:mga05p37_1435222_c1 nmdc:mga05p37_1435222_c1_16_663 210
545 3300050507 nmdc:mga05p37_371022_c1 nmdc:mga05p37_371022_c1_12_677 210
546 3300053077 Ga0495601_0030092 Ga0495601_0030092_182_814 210
547 3300053085 Ga0495619_0008363 Ga0495619_0008363_5344_5976 210
548 3300049581 Ga0501047_0678439 Ga0501047_0678439_201_836 211
549 3300049823 Ga0501044_1035762 Ga0501044_1035762_44_679 211
550 3300006051 Ga0075364_10243870 Ga0075364_102438702 212
551 3300006353 Ga0075370_10169918 Ga0075370_101699182 212
552 3300021384 Ga0213876_10043888 Ga0213876_100438883 212
553 3300039437 Ga0436365_1080340 Ga0436365_1080340_1843_2490 212
554 3300026118 Ga0207675_100279600 Ga0207675_1002796002 213
555 3300032002 Ga0307416_100234309 Ga0307416_1002343092 213
556 3300049581 Ga0501047_0150356 Ga0501047_0150356_266_925 213
557 3300049592 Ga0501076_0577220 Ga0501076_0577220_244_909 213
558 3300049578 Ga0501042_0258858 Ga0501042_0258858_353_1021 214
559 3300049587 Ga0501071_0259349 Ga0501071_0259349_382_1050 214
560 3300049591 Ga0501075_0217805 Ga0501075_0217805_402_1070 214
561 3300049593 Ga0501077_0143464 Ga0501077_0143464_803_1471 214
562 3300049742 Ga0501080_0324733 Ga0501080_0324733_414_1082 214
563 3300061734 Ga0530510_0138333 Ga0530510_0138333_747_1415 214
564 3300005455 Ga0070663_100203305 Ga0070663_1002033052 215
565 3300031241 Ga0265325_10000690 Ga0265325_1000069018 215
566 3300031250 Ga0265331_10005916 Ga0265331_100059161 215
567 3300031344 Ga0265316_10137600 Ga0265316_101376002 215
568 3300031711 Ga0265314_10011879 Ga0265314_100118794 215
569 3300031711 Ga0265314_10065812 Ga0265314_100658121 215
570 3300035118 Ga0373954_0051938 Ga0373954_0051938_232_879 215
571 3300035119 Ga0373956_0003652 Ga0373956_0003652_992_1639 215
572 3300035172 Ga0373955_0006462 Ga0373955_0006462_4510_5157 215
573 3300035172 Ga0373955_0025815 Ga0373955_0025815_471_1118 215
574 3300035410 Ga0373924_0206817 Ga0373924_0206817_32_685 215
575 3300035724 Ga0373933_0008436 Ga0373933_0008436_228_875 215
576 3300036401 Ga0373937_0003470 Ga0373937_0003470_7970_8617 215
577 3300046511 Ga0495608_0091097 Ga0495608_0091097_1227_1874 215
578 3300046536 Ga0495587_0077800 Ga0495587_0077800_75_722 215
579 3300046559 Ga0495667_0090911 Ga0495667_0090911_106_753 215
580 3300046663 Ga0495635_0189940 Ga0495635_0189940_533_1180 215
581 3300046675 Ga0495657_0390970 Ga0495657_0390970_73_720 215
582 3300047317 Ga0495604_0073389 Ga0495604_0073389_1624_2271 215
583 3300047444 Ga0495675_0038878 Ga0495675_0038878_949_1596 215
584 3300047471 Ga0495684_0387633 Ga0495684_0387633_93_740 215
585 3300050492 nmdc:mga0yw44_364301_c1 nmdc:mga0yw44_364301_c1_113_772 215
586 3300053077 Ga0495601_0006052 Ga0495601_0006052_6145_6792 215
587 3300053084 Ga0495595_0021589 Ga0495595_0021589_1687_2334 215
588 3300053085 Ga0495619_0064309 Ga0495619_0064309_363_1010 215
589 3300053087 Ga0500643_002441 Ga0500643_002441_3521_4168 215
590 3300053088 Ga0500644_0000902 Ga0500644_0000902_4125_4772 215
591 3300053093 Ga0500651_0059982 Ga0500651_0059982_763_1410 215
592 3300053098 Ga0500650_0072702 Ga0500650_0072702_894_1541 215
593 3300053119 Ga0500595_000006 Ga0500595_000006_54670_55317 215
594 3300053131 Ga0500652_003773 Ga0500652_003773_1822_2469 215
595 3300053153 Ga0500616_0000001 Ga0500616_0000001_454954_455601 215
596 3300053153 Ga0500616_0196299 Ga0500616_0196299_44_691 215
597 3300053730 Ga0500645_000294 Ga0500645_000294_25638_26285 215
598 3300009551 Ga0105238_11020544 Ga0105238_110205441 216
599 3300048915 Ga0496112_0299013 Ga0496112_0299013_564_1214 216
600 3300049744 Ga0501083_0016725 Ga0501083_0016725_1433_2086 216
601 iso_pu_bacteria 2597489875 2597811380 216
602 3300005458 Ga0070681_10667078 Ga0070681_106670782 217
603 3300013297 Ga0157378_10689671 Ga0157378_106896711 217
604 3300025912 Ga0207707_10251490 Ga0207707_102514902 217
605 3300025932 Ga0207690_10393559 Ga0207690_103935592 217
606 3300031241 Ga0265325_10008367 Ga0265325_100083673 217
607 3300031344 Ga0265316_10151203 Ga0265316_101512032 217
608 3300031595 Ga0265313_10000703 Ga0265313_1000070322 217
609 3300031595 Ga0265313_10013716 Ga0265313_100137162 217
610 3300035115 Ga0373941_0000334 Ga0373941_0000334_5188_5841 217
611 3300039453 Ga0436362_1162105 Ga0436362_1162105_2266_2946 217
612 3300048903 Ga0496100_0003625 Ga0496100_0003625_3051_3719 217
613 3300048904 Ga0496101_0133379 Ga0496101_0133379_442_1110 217
614 3300048905 Ga0496102_0001696 Ga0496102_0001696_15788_16456 217
615 3300048906 Ga0496103_0456549 Ga0496103_0456549_109_777 217
616 3300048907 Ga0496104_0014489 Ga0496104_0014489_6196_6864 217
617 3300048908 Ga0496105_0039548 Ga0496105_0039548_2902_3570 217
618 3300048909 Ga0496106_0004480 Ga0496106_0004480_8144_8812 217
619 3300048910 Ga0496107_0003453 Ga0496107_0003453_2089_2757 217
620 3300048911 Ga0496108_0090852 Ga0496108_0090852_214_882 217
621 3300048912 Ga0496109_0003909 Ga0496109_0003909_2502_3170 217
622 3300048913 Ga0496110_0008732 Ga0496110_0008732_228_896 217
623 3300048914 Ga0496111_0369895 Ga0496111_0369895_165_833 217
624 3300048915 Ga0496112_0007154 Ga0496112_0007154_5019_5687 217
625 3300048916 Ga0496113_0276824 Ga0496113_0276824_447_1115 217
626 3300048918 Ga0496115_0045504 Ga0496115_0045504_2411_3079 217
627 3300049568 Ga0501031_0070380 Ga0501031_0070380_993_1646 217
628 3300049569 Ga0501032_0031245 Ga0501032_0031245_2658_3311 217
629 3300049569 Ga0501032_0060626 Ga0501032_0060626_616_1269 217
630 3300049570 Ga0501033_0058558 Ga0501033_0058558_1178_1831 217
631 3300049570 Ga0501033_0095903 Ga0501033_0095903_1190_1843 217
632 3300049571 Ga0501034_0010212 Ga0501034_0010212_6026_6679 217
633 3300049571 Ga0501034_0059925 Ga0501034_0059925_2258_2911 217
634 3300049571 Ga0501034_0176174 Ga0501034_0176174_1293_1946 217
635 3300049572 Ga0501036_0004953 Ga0501036_0004953_6045_6698 217
636 3300049572 Ga0501036_0030694 Ga0501036_0030694_3362_4015 217
637 3300049572 Ga0501036_0091314 Ga0501036_0091314_1185_1838 217
638 3300049573 Ga0501037_0012371 Ga0501037_0012371_4421_5074 217
639 3300049573 Ga0501037_0033685 Ga0501037_0033685_696_1349 217
640 3300049573 Ga0501037_0090745 Ga0501037_0090745_1016_1669 217
641 3300049574 Ga0501038_0091673 Ga0501038_0091673_768_1421 217
642 3300049574 Ga0501038_0281326 Ga0501038_0281326_428_1081 217
643 3300049574 Ga0501038_0591340 Ga0501038_0591340_144_797 217
644 3300049575 Ga0501039_0041593 Ga0501039_0041593_1365_2018 217
645 3300049575 Ga0501039_0043068 Ga0501039_0043068_583_1236 217
646 3300049575 Ga0501039_0588172 Ga0501039_0588172_44_697 217
647 3300049576 Ga0501040_0139417 Ga0501040_0139417_651_1304 217
648 3300049578 Ga0501042_0310536 Ga0501042_0310536_402_1055 217
649 3300049579 Ga0501043_0003166 Ga0501043_0003166_8497_9150 217
650 3300049579 Ga0501043_0035618 Ga0501043_0035618_1551_2204 217
651 3300049579 Ga0501043_0047020 Ga0501043_0047020_2716_3369 217
652 3300049580 Ga0501046_0069611 Ga0501046_0069611_721_1374 217
653 3300049580 Ga0501046_0082747 Ga0501046_0082747_1019_1672 217
654 3300049581 Ga0501047_0000161 Ga0501047_0000161_72486_73139 217
655 3300049581 Ga0501047_0027414 Ga0501047_0027414_1016_1669 217
656 3300049581 Ga0501047_0116591 Ga0501047_0116591_1344_1997 217
657 3300049582 Ga0501048_0000030 Ga0501048_0000030_60225_60878 217
658 3300049583 Ga0501067_0116889 Ga0501067_0116889_209_862 217
659 3300049584 Ga0501068_0043888 Ga0501068_0043888_1343_1996 217
660 3300049584 Ga0501068_0056360 Ga0501068_0056360_807_1460 217
661 3300049584 Ga0501068_0087419 Ga0501068_0087419_486_1139 217
662 3300049585 Ga0501069_0069586 Ga0501069_0069586_978_1631 217
663 3300049585 Ga0501069_0123672 Ga0501069_0123672_771_1424 217
664 3300049586 Ga0501070_0051670 Ga0501070_0051670_789_1442 217
665 3300049586 Ga0501070_0091103 Ga0501070_0091103_696_1349 217
666 3300049586 Ga0501070_0225421 Ga0501070_0225421_756_1409 217
667 3300049587 Ga0501071_0079422 Ga0501071_0079422_1035_1688 217
668 3300049588 Ga0501072_0157126 Ga0501072_0157126_356_1009 217
669 3300049589 Ga0501073_0026122 Ga0501073_0026122_1489_2142 217
670 3300049589 Ga0501073_0061827 Ga0501073_0061827_1211_1864 217
671 3300049589 Ga0501073_0138945 Ga0501073_0138945_22_675 217
672 3300049589 Ga0501073_0149013 Ga0501073_0149013_914_1567 217
673 3300049590 Ga0501074_0007516 Ga0501074_0007516_5360_6013 217
674 3300049590 Ga0501074_0097838 Ga0501074_0097838_265_918 217
675 3300049593 Ga0501077_0345802 Ga0501077_0345802_96_749 217
676 3300049741 Ga0501079_0016018 Ga0501079_0016018_4859_5512 217
677 3300049742 Ga0501080_0000181 Ga0501080_0000181_5496_6149 217
678 3300049742 Ga0501080_0120165 Ga0501080_0120165_767_1420 217
679 3300049742 Ga0501080_0256614 Ga0501080_0256614_336_989 217
680 3300049744 Ga0501083_0004820 Ga0501083_0004820_415_1068 217
681 3300049744 Ga0501083_0161779 Ga0501083_0161779_323_976 217
682 3300049822 Ga0501035_0030882 Ga0501035_0030882_2137_2790 217
683 3300049822 Ga0501035_0042553 Ga0501035_0042553_2510_3163 217
684 3300049822 Ga0501035_0186582 Ga0501035_0186582_435_1088 217
685 3300049823 Ga0501044_0012418 Ga0501044_0012418_7109_7762 217
686 3300049823 Ga0501044_0047168 Ga0501044_0047168_853_1506 217
687 3300049823 Ga0501044_0133458 Ga0501044_0133458_807_1460 217
688 3300049823 Ga0501044_0602572 Ga0501044_0602572_262_915 217
689 3300050514 nmdc:mga08x19_4517_c1 nmdc:mga08x19_4517_c1_2945_3598 217
690 3300060353 Ga0501082_0196213 Ga0501082_0196213_988_1641 217
691 3300006871 Ga0075434_100457240 Ga0075434_1004572402 218
692 3300009147 Ga0114129_10467204 Ga0114129_104672042 218
693 3300031241 Ga0265325_10056105 Ga0265325_100561052 218
694 3300035695 Ga0373927_0091898 Ga0373927_0091898_1292_1948 218
695 3300039438 Ga0436360_0146589 Ga0436360_0146589_179_844 218
696 3300048928 Ga0496125_0003199 Ga0496125_0003199_6850_7524 218
697 3300049568 Ga0501031_0165336 Ga0501031_0165336_211_867 218
698 3300049569 Ga0501032_0197345 Ga0501032_0197345_48_707 218
699 3300049570 Ga0501033_0152507 Ga0501033_0152507_662_1318 218
700 3300049571 Ga0501034_0000270 Ga0501034_0000270_11101_11757 218
701 3300049571 Ga0501034_0025837 Ga0501034_0025837_1518_2174 218
702 3300049571 Ga0501034_0148868 Ga0501034_0148868_1258_1914 218
703 3300049572 Ga0501036_0029528 Ga0501036_0029528_2619_3275 218
704 3300049573 Ga0501037_0009782 Ga0501037_0009782_4477_5133 218
705 3300049573 Ga0501037_0185478 Ga0501037_0185478_202_858 218
706 3300049574 Ga0501038_0008042 Ga0501038_0008042_3799_4455 218
707 3300049579 Ga0501043_0044147 Ga0501043_0044147_2232_2888 218
708 3300049579 Ga0501043_0127124 Ga0501043_0127124_541_1197 218
709 3300049579 Ga0501043_0144024 Ga0501043_0144024_503_1159 218
710 3300049580 Ga0501046_0050140 Ga0501046_0050140_502_1158 218
711 3300049581 Ga0501047_0023893 Ga0501047_0023893_3653_4309 218
712 3300049581 Ga0501047_0346979 Ga0501047_0346979_43_702 218
713 3300049582 Ga0501048_0080302 Ga0501048_0080302_873_1529 218
714 3300049583 Ga0501067_0334695 Ga0501067_0334695_78_737 218
715 3300049584 Ga0501068_0015567 Ga0501068_0015567_3641_4297 218
716 3300049586 Ga0501070_0012412 Ga0501070_0012412_4672_5328 218
717 3300049587 Ga0501071_0169803 Ga0501071_0169803_28_684 218
718 3300049589 Ga0501073_0022538 Ga0501073_0022538_1090_1746 218
719 3300049590 Ga0501074_0162235 Ga0501074_0162235_178_834 218
720 3300049741 Ga0501079_0404723 Ga0501079_0404723_250_906 218
721 3300049742 Ga0501080_0013887 Ga0501080_0013887_3591_4247 218
722 3300049742 Ga0501080_0064398 Ga0501080_0064398_1418_2074 218
723 3300049743 Ga0501081_0561189 Ga0501081_0561189_129_785 218
724 3300049744 Ga0501083_0051230 Ga0501083_0051230_654_1313 218
725 3300049822 Ga0501035_0021373 Ga0501035_0021373_675_1331 218
726 3300049823 Ga0501044_0123030 Ga0501044_0123030_45_701 218
727 3300049823 Ga0501044_0242875 Ga0501044_0242875_1008_1667 218
728 3300049823 Ga0501044_0761189 Ga0501044_0761189_115_771 218
729 3300053090 Ga0500646_0023621 Ga0500646_0023621_523_1179 218
730 3300053096 Ga0500641_0004528 Ga0500641_0004528_3061_3717 218
731 3300054114 Ga0501084_0042336 Ga0501084_0042336_907_1566 218
732 3300054114 Ga0501084_0053673 Ga0501084_0053673_2089_2745 218
733 3300060353 Ga0501082_0058086 Ga0501082_0058086_1352_2011 218
734 3300005340 Ga0070689_100189918 Ga0070689_1001899182 219
735 3300005353 Ga0070669_100955736 Ga0070669_1009557361 219
736 3300005355 Ga0070671_100000307 Ga0070671_10000030716 219
737 3300005434 Ga0070709_10177616 Ga0070709_101776161 219
738 3300005435 Ga0070714_100115077 Ga0070714_1001150772 219
739 3300005436 Ga0070713_100064209 Ga0070713_1000642092 219
740 3300005436 Ga0070713_100091170 Ga0070713_1000911702 219
741 3300005436 Ga0070713_100112430 Ga0070713_1001124302 219
742 3300005437 Ga0070710_10073348 Ga0070710_100733483 219
743 3300005439 Ga0070711_100162010 Ga0070711_1001620102 219
744 3300005466 Ga0070685_10353901 Ga0070685_103539012 219
745 3300005530 Ga0070679_100026568 Ga0070679_1000265684 219
746 3300005548 Ga0070665_100115130 Ga0070665_1001151302 219
747 3300005985 Ga0081539_10000619 Ga0081539_1000061951 219
748 3300005985 Ga0081539_10011677 Ga0081539_100116774 219
749 3300006028 Ga0070717_10069777 Ga0070717_100697772 219
750 3300006028 Ga0070717_10254261 Ga0070717_102542612 219
751 3300006028 Ga0070717_10368532 Ga0070717_103685322 219
752 3300006038 Ga0075365_10060792 Ga0075365_100607922 219
753 3300006038 Ga0075365_10071419 Ga0075365_100714192 219
754 3300006051 Ga0075364_10230577 Ga0075364_102305772 219
755 3300006051 Ga0075364_10260417 Ga0075364_102604172 219
756 3300006058 Ga0075432_10039521 Ga0075432_100395212 219
757 3300006175 Ga0070712_100002937 Ga0070712_1000029374 219
758 3300006175 Ga0070712_100247001 Ga0070712_1002470011 219
759 3300006175 Ga0070712_100523101 Ga0070712_1005231012 219
760 3300006177 Ga0075362_10027431 Ga0075362_100274313 219
761 3300006844 Ga0075428_100046803 Ga0075428_1000468033 219
762 3300006844 Ga0075428_100140936 Ga0075428_1001409363 219
763 3300007076 Ga0075435_100143205 Ga0075435_1001432052 219
764 3300009098 Ga0105245_10628645 Ga0105245_106286452 219
765 3300009176 Ga0105242_11194723 Ga0105242_111947231 219
766 3300009553 Ga0105249_10279335 Ga0105249_102793352 219
767 3300010375 Ga0105239_10708776 Ga0105239_107087761 219
768 3300013296 Ga0157374_10432654 Ga0157374_104326542 219
769 3300024227 Ga0228598_1040063 Ga0228598_10400632 219
770 3300025905 Ga0207685_10109643 Ga0207685_101096432 219
771 3300025905 Ga0207685_10131808 Ga0207685_101318082 219
772 3300025906 Ga0207699_10492285 Ga0207699_104922852 219
773 3300025915 Ga0207693_10038079 Ga0207693_100380793 219
774 3300025915 Ga0207693_10203904 Ga0207693_102039042 219
775 3300025915 Ga0207693_10209264 Ga0207693_102092642 219
776 3300025916 Ga0207663_10192580 Ga0207663_101925801 219
777 3300025917 Ga0207660_10115598 Ga0207660_101155982 219
778 3300025923 Ga0207681_10437974 Ga0207681_104379742 219
779 3300025925 Ga0207650_10011030 Ga0207650_100110307 219
780 3300025927 Ga0207687_10070256 Ga0207687_100702561 219
781 3300025928 Ga0207700_10125676 Ga0207700_101256762 219
782 3300025928 Ga0207700_10298892 Ga0207700_102988922 219
783 3300025928 Ga0207700_10550101 Ga0207700_105501011 219
784 3300025929 Ga0207664_10262335 Ga0207664_102623352 219
785 3300025929 Ga0207664_10917471 Ga0207664_109174711 219
786 3300025931 Ga0207644_10024450 Ga0207644_100244502 219
787 3300025933 Ga0207706_10240164 Ga0207706_102401642 219
788 3300025934 Ga0207686_10755308 Ga0207686_107553081 219
789 3300025939 Ga0207665_10592719 Ga0207665_105927191 219
790 3300025960 Ga0207651_10035078 Ga0207651_100350782 219
791 3300026035 Ga0207703_10580423 Ga0207703_105804232 219
792 3300026078 Ga0207702_10106569 Ga0207702_101065692 219
793 3300026088 Ga0207641_10182571 Ga0207641_101825712 219
794 3300027512 Ga0209179_1048460 Ga0209179_10484601 219
795 3300027907 Ga0207428_10166226 Ga0207428_101662262 219
796 3300028017 Ga0265356_1013400 Ga0265356_10134002 219
797 3300028379 Ga0268266_10014975 Ga0268266_100149752 219
798 3300028800 Ga0265338_10232393 Ga0265338_102323931 219
799 3300030760 Ga0265762_1014004 Ga0265762_10140042 219
800 3300031241 Ga0265325_10005553 Ga0265325_100055535 219
801 3300031249 Ga0265339_10001183 Ga0265339_100011832 219
802 3300031249 Ga0265339_10004646 Ga0265339_100046465 219
803 3300031344 Ga0265316_10087724 Ga0265316_100877242 219
804 3300031595 Ga0265313_10001097 Ga0265313_100010974 219
805 3300031595 Ga0265313_10005683 Ga0265313_100056835 219
806 3300031665 Ga0316575_10012428 Ga0316575_100124282 219
807 3300031712 Ga0265342_10073822 Ga0265342_100738222 219
808 3300031712 Ga0265342_10084140 Ga0265342_100841401 219
809 3300031727 Ga0316576_10357940 Ga0316576_103579402 219
810 3300031728 Ga0316578_10012670 Ga0316578_100126702 219
811 3300032133 Ga0316583_10076371 Ga0316583_100763712 219
812 3300035086 Ga0373934_0096068 Ga0373934_0096068_120_779 219
813 3300035086 Ga0373934_0118775 Ga0373934_0118775_136_795 219
814 3300035089 Ga0373944_0045739 Ga0373944_0045739_371_1030 219
815 3300035113 Ga0373936_0124798 Ga0373936_0124798_84_743 219
816 3300035113 Ga0373936_0303204 Ga0373936_0303204_37_696 219
817 3300035116 Ga0373945_0027750 Ga0373945_0027750_1140_1799 219
818 3300035117 Ga0373953_0031276 Ga0373953_0031276_1089_1748 219
819 3300035118 Ga0373954_0005111 Ga0373954_0005111_4237_4896 219
820 3300035118 Ga0373954_0248510 Ga0373954_0248510_83_742 219
821 3300035120 Ga0373957_0103692 Ga0373957_0103692_328_987 219
822 3300035170 Ga0373943_0013691 Ga0373943_0013691_2446_3105 219
823 3300035170 Ga0373943_0198565 Ga0373943_0198565_197_856 219
824 3300035171 Ga0373946_0010723 Ga0373946_0010723_141_800 219
825 3300035171 Ga0373946_0173857 Ga0373946_0173857_215_874 219
826 3300035172 Ga0373955_0012671 Ga0373955_0012671_160_819 219
827 3300035172 Ga0373955_0081141 Ga0373955_0081141_755_1414 219
828 3300035398 Ga0316574_0000385 Ga0316574_0000385_15856_16515 219
829 3300035410 Ga0373924_0017612 Ga0373924_0017612_1936_2595 219
830 3300035692 Ga0373935_0048529 Ga0373935_0048529_119_778 219
831 3300035695 Ga0373927_0005902 Ga0373927_0005902_75_734 219
832 3300035695 Ga0373927_0006630 Ga0373927_0006630_6231_6890 219
833 3300035695 Ga0373927_0020647 Ga0373927_0020647_227_886 219
834 3300035695 Ga0373927_0287498 Ga0373927_0287498_323_982 219
835 3300035724 Ga0373933_0002567 Ga0373933_0002567_9305_9964 219
836 3300035724 Ga0373933_0185126 Ga0373933_0185126_505_1164 219
837 3300035725 Ga0373947_0001350 Ga0373947_0001350_8501_9160 219
838 3300035725 Ga0373947_0207996 Ga0373947_0207996_475_1134 219
839 3300036401 Ga0373937_0008172 Ga0373937_0008172_2142_2801 219
840 3300036401 Ga0373937_0218187 Ga0373937_0218187_1099_1758 219
841 3300036712 Ga0316584_0022130 Ga0316584_0022130_1645_2304 219
842 3300037068 Ga0373925_0001043 Ga0373925_0001043_6529_7188 219
843 3300037068 Ga0373925_0105851 Ga0373925_0105851_1287_1946 219
844 3300037853 Ga0436364_1094950 Ga0436364_1094950_202_861 219
845 3300039437 Ga0436365_1299178 Ga0436365_1299178_619_1305 219
846 3300039450 Ga0436363_1126896 Ga0436363_1126896_399_1058 219
847 3300039453 Ga0436362_0160032 Ga0436362_0160032_145_804 219
848 3300042439 Ga0439464_0086774 Ga0439464_0086774_141_800 219
849 3300044694 Ga0466963_0069749 Ga0466963_0069749_1319_1978 219
850 3300044719 Ga0466971_0238133 Ga0466971_0238133_16_675 219
851 3300044719 Ga0466971_0311900 Ga0466971_0311900_75_734 219
852 3300045049 Ga0466959_0221148 Ga0466959_0221148_501_1160 219
853 3300045976 Ga0466967_0109186 Ga0466967_0109186_1413_2072 219
854 3300045976 Ga0466967_0111510 Ga0466967_0111510_1649_2308 219
855 3300045976 Ga0466967_0711658 Ga0466967_0711658_11_670 219
856 3300046454 Ga0495592_0077193 Ga0495592_0077193_257_916 219
857 3300046459 Ga0495629_0004844 Ga0495629_0004844_221_880 219
858 3300046459 Ga0495629_0038350 Ga0495629_0038350_2534_3193 219
859 3300046462 Ga0495651_0000747 Ga0495651_0000747_579_1238 219
860 3300046462 Ga0495651_0281204 Ga0495651_0281204_373_1032 219
861 3300046463 Ga0495653_0013482 Ga0495653_0013482_5812_6471 219
862 3300046472 Ga0495580_0047935 Ga0495580_0047935_832_1491 219
863 3300046473 Ga0495582_0213196 Ga0495582_0213196_72_731 219
864 3300046475 Ga0495639_0087500 Ga0495639_0087500_620_1279 219
865 3300046475 Ga0495639_0298335 Ga0495639_0298335_100_759 219
866 3300046476 Ga0495662_0007090 Ga0495662_0007090_672_1331 219
867 3300046476 Ga0495662_0195056 Ga0495662_0195056_183_842 219
868 3300046477 Ga0495664_0001447 Ga0495664_0001447_214_873 219
869 3300046477 Ga0495664_0016143 Ga0495664_0016143_3404_4063 219
870 3300046491 Ga0495584_0092244 Ga0495584_0092244_236_895 219
871 3300046499 Ga0495594_0061028 Ga0495594_0061028_259_918 219
872 3300046511 Ga0495608_0002757 Ga0495608_0002757_877_1536 219
873 3300046511 Ga0495608_0081716 Ga0495608_0081716_905_1564 219
874 3300046514 Ga0495618_0126654 Ga0495618_0126654_465_1124 219
875 3300046514 Ga0495618_0148394 Ga0495618_0148394_206_865 219
876 3300046516 Ga0495628_0015484 Ga0495628_0015484_944_1603 219
877 3300046517 Ga0495630_0140478 Ga0495630_0140478_178_837 219
878 3300046517 Ga0495630_0356668 Ga0495630_0356668_256_915 219
879 3300046529 Ga0495652_0043342 Ga0495652_0043342_44_703 219
880 3300046529 Ga0495652_0073255 Ga0495652_0073255_250_909 219
881 3300046529 Ga0495652_0073847 Ga0495652_0073847_38_697 219
882 3300046531 Ga0495665_0157707 Ga0495665_0157707_183_842 219
883 3300046531 Ga0495665_0272853 Ga0495665_0272853_37_696 219
884 3300046533 Ga0495640_0000961 Ga0495640_0000961_20999_21658 219
885 3300046533 Ga0495640_0023309 Ga0495640_0023309_1404_2063 219
886 3300046535 Ga0495586_0069359 Ga0495586_0069359_183_842 219
887 3300046536 Ga0495587_0018158 Ga0495587_0018158_209_868 219
888 3300046543 Ga0495645_0002925 Ga0495645_0002925_78_737 219
889 3300046543 Ga0495645_0296159 Ga0495645_0296159_182_841 219
890 3300046559 Ga0495667_0002304 Ga0495667_0002304_11909_12568 219
891 3300046559 Ga0495667_0085357 Ga0495667_0085357_54_713 219
892 3300046642 Ga0495634_0010775 Ga0495634_0010775_140_799 219
893 3300046642 Ga0495634_0016302 Ga0495634_0016302_638_1297 219
894 3300046663 Ga0495635_0006535 Ga0495635_0006535_5800_6459 219
895 3300046663 Ga0495635_0007098 Ga0495635_0007098_6987_7646 219
896 3300046678 Ga0495599_0015355 Ga0495599_0015355_690_1349 219
897 3300046679 Ga0495623_0050142 Ga0495623_0050142_359_1018 219
898 3300046681 Ga0495647_0126829 Ga0495647_0126829_361_1020 219
899 3300046683 Ga0495658_0156897 Ga0495658_0156897_11_670 219
900 3300046689 Ga0495613_0020625 Ga0495613_0020625_4080_4739 219
901 3300046689 Ga0495613_0330621 Ga0495613_0330621_178_837 219
902 3300046689 Ga0495613_0338030 Ga0495613_0338030_182_841 219
903 3300046690 Ga0495624_0005296 Ga0495624_0005296_5042_5701 219
904 3300046690 Ga0495624_0321200 Ga0495624_0321200_31_690 219
905 3300046690 Ga0495624_0492436 Ga0495624_0492436_39_698 219
906 3300046809 Ga0495600_0004584 Ga0495600_0004584_66_725 219
907 3300047315 Ga0495581_0008249 Ga0495581_0008249_5177_5836 219
908 3300047315 Ga0495581_0072942 Ga0495581_0072942_815_1474 219
909 3300047317 Ga0495604_0007365 Ga0495604_0007365_7705_8364 219
910 3300047319 Ga0495674_0005017 Ga0495674_0005017_11871_12530 219
911 3300047319 Ga0495674_0010434 Ga0495674_0010434_3109_3768 219
912 3300047321 Ga0495676_0288450 Ga0495676_0288450_261_920 219
913 3300047322 Ga0495680_0009838 Ga0495680_0009838_7677_8336 219
914 3300047444 Ga0495675_0020773 Ga0495675_0020773_197_856 219
915 3300047471 Ga0495684_0001907 Ga0495684_0001907_4248_4907 219
916 3300047471 Ga0495684_0011490 Ga0495684_0011490_6027_6686 219
917 3300047471 Ga0495684_0038374 Ga0495684_0038374_171_830 219
918 3300047471 Ga0495684_0077697 Ga0495684_0077697_1656_2315 219
919 3300047471 Ga0495684_0097367 Ga0495684_0097367_778_1437 219
920 3300047673 Ga0495593_0134135 Ga0495593_0134135_204_863 219
921 3300048903 Ga0496100_0021787 Ga0496100_0021787_2500_3159 219
922 3300048907 Ga0496104_0340869 Ga0496104_0340869_369_1028 219
923 3300048909 Ga0496106_0523635 Ga0496106_0523635_226_885 219
924 3300048911 Ga0496108_0560737 Ga0496108_0560737_316_975 219
925 3300048913 Ga0496110_0378089 Ga0496110_0378089_439_1098 219
926 3300048915 Ga0496112_0043923 Ga0496112_0043923_172_831 219
927 3300048915 Ga0496112_0748573 Ga0496112_0748573_41_700 219
928 3300048918 Ga0496115_0369934 Ga0496115_0369934_290_949 219
929 3300049569 Ga0501032_0075310 Ga0501032_0075310_146_805 219
930 3300049571 Ga0501034_0388388 Ga0501034_0388388_22_681 219
931 3300049574 Ga0501038_0503378 Ga0501038_0503378_111_770 219
932 3300049577 Ga0501041_0092848 Ga0501041_0092848_1153_1812 219
933 3300049582 Ga0501048_0619817 Ga0501048_0619817_89_748 219
934 3300049584 Ga0501068_0264284 Ga0501068_0264284_32_691 219
935 3300049588 Ga0501072_0326701 Ga0501072_0326701_215_874 219
936 3300049593 Ga0501077_0164991 Ga0501077_0164991_11_670 219
937 3300049742 Ga0501080_0202208 Ga0501080_0202208_404_1063 219
938 3300049744 Ga0501083_0206371 Ga0501083_0206371_499_1158 219
939 3300049823 Ga0501044_0205877 Ga0501044_0205877_250_909 219
940 3300050492 nmdc:mga0yw44_150547_c1 nmdc:mga0yw44_150547_c1_174_833 219
941 3300050511 nmdc:mga08y16_359949_c1 nmdc:mga08y16_359949_c1_560_1219 219
942 3300050513 nmdc:mga0rr50_309512_c1 nmdc:mga0rr50_309512_c1_383_1042 219
943 3300050514 nmdc:mga08x19_321383_c1 nmdc:mga08x19_321383_c1_216_875 219
944 3300053077 Ga0495601_0009705 Ga0495601_0009705_134_793 219
945 3300053078 Ga0495612_0001779 Ga0495612_0001779_655_1314 219
946 3300053078 Ga0495612_0001975 Ga0495612_0001975_7596_8255 219
947 3300053084 Ga0495595_0002892 Ga0495595_0002892_5819_6478 219
948 3300053085 Ga0495619_0000700 Ga0495619_0000700_1498_2157 219
949 3300053085 Ga0495619_0001423 Ga0495619_0001423_3086_3745 219
950 3300053085 Ga0495619_0058043 Ga0495619_0058043_1014_1673 219
951 3300054114 Ga0501084_0109233 Ga0501084_0109233_891_1550 219
952 3300003215 JGI25153J46596_10009912 JGI25153J46596_100099124 220
953 3300005327 Ga0070658_10108492 Ga0070658_101084922 220
954 3300005329 Ga0070683_100121334 Ga0070683_1001213342 220
955 3300005330 Ga0070690_100079724 Ga0070690_1000797242 220
956 3300005331 Ga0070670_100023742 Ga0070670_1000237423 220
957 3300005331 Ga0070670_100068383 Ga0070670_1000683832 220
958 3300005333 Ga0070677_10001103 Ga0070677_100011032 220
959 3300005337 Ga0070682_100605939 Ga0070682_1006059392 220
960 3300005339 Ga0070660_100076652 Ga0070660_1000766522 220
961 3300005340 Ga0070689_100072676 Ga0070689_1000726762 220
962 3300005340 Ga0070689_100368837 Ga0070689_1003688371 220
963 3300005347 Ga0070668_100186104 Ga0070668_1001861041 220
964 3300005347 Ga0070668_100187018 Ga0070668_1001870182 220
965 3300005353 Ga0070669_100317202 Ga0070669_1003172021 220
966 3300005354 Ga0070675_100242675 Ga0070675_1002426752 220
967 3300005355 Ga0070671_100107838 Ga0070671_1001078382 220
968 3300005355 Ga0070671_100519946 Ga0070671_1005199462 220
969 3300005356 Ga0070674_100002115 Ga0070674_1000021152 220
970 3300005356 Ga0070674_100006828 Ga0070674_1000068284 220
971 3300005364 Ga0070673_100134111 Ga0070673_1001341112 220
972 3300005367 Ga0070667_100124252 Ga0070667_1001242522 220
973 3300005434 Ga0070709_10549388 Ga0070709_105493882 220
974 3300005436 Ga0070713_100103829 Ga0070713_1001038292 220
975 3300005437 Ga0070710_10224435 Ga0070710_102244351 220
976 3300005438 Ga0070701_10001029 Ga0070701_100010293 220
977 3300005438 Ga0070701_10067404 Ga0070701_100674043 220
978 3300005439 Ga0070711_100191037 Ga0070711_1001910372 220
979 3300005439 Ga0070711_100356500 Ga0070711_1003565001 220
980 3300005439 Ga0070711_100540433 Ga0070711_1005404331 220
981 3300005441 Ga0070700_100050223 Ga0070700_1000502233 220
982 3300005456 Ga0070678_100011394 Ga0070678_1000113945 220
983 3300005456 Ga0070678_100698663 Ga0070678_1006986631 220
984 3300005458 Ga0070681_10361045 Ga0070681_103610452 220
985 3300005466 Ga0070685_10141155 Ga0070685_101411552 220
986 3300005530 Ga0070679_100024102 Ga0070679_1000241024 220
987 3300005530 Ga0070679_100223239 Ga0070679_1002232392 220
988 3300005535 Ga0070684_100149487 Ga0070684_1001494872 220
989 3300005536 Ga0070697_100450787 Ga0070697_1004507872 220
990 3300005539 Ga0068853_100108358 Ga0068853_1001083582 220
991 3300005543 Ga0070672_100005449 Ga0070672_1000054494 220
992 3300005543 Ga0070672_100013949 Ga0070672_1000139493 220
993 3300005547 Ga0070693_100113938 Ga0070693_1001139381 220
994 3300005547 Ga0070693_100162926 Ga0070693_1001629262 220
995 3300005548 Ga0070665_100110374 Ga0070665_1001103743 220
996 3300005548 Ga0070665_100428927 Ga0070665_1004289272 220
997 3300005563 Ga0068855_100271524 Ga0068855_1002715242 220
998 3300005564 Ga0070664_100148523 Ga0070664_1001485232 220
999 3300005564 Ga0070664_100229448 Ga0070664_1002294482 220
1000 3300005578 Ga0068854_100148080 Ga0068854_1001480802 220
1001 3300005614 Ga0068856_100129438 Ga0068856_1001294382 220
1002 3300005614 Ga0068856_100298025 Ga0068856_1002980252 220
1003 3300005616 Ga0068852_100043739 Ga0068852_1000437393 220
1004 3300005617 Ga0068859_100177397 Ga0068859_1001773972 220
1005 3300005618 Ga0068864_100146322 Ga0068864_1001463222 220
1006 3300005718 Ga0068866_10067685 Ga0068866_100676852 220
1007 3300005719 Ga0068861_100006572 Ga0068861_1000065723 220
1008 3300005841 Ga0068863_100003905 Ga0068863_10000390513 220
1009 3300005842 Ga0068858_100054648 Ga0068858_1000546482 220
1010 3300005842 Ga0068858_100469571 Ga0068858_1004695711 220
1011 3300005842 Ga0068858_100482460 Ga0068858_1004824602 220
1012 3300005843 Ga0068860_100078579 Ga0068860_1000785792 220
1013 3300005937 Ga0081455_10074773 Ga0081455_100747733 220
1014 3300005981 Ga0081538_10012044 Ga0081538_100120446 220
1015 3300005983 Ga0081540_1002834 Ga0081540_100283412 220
1016 3300005983 Ga0081540_1065424 Ga0081540_10654241 220
1017 3300006028 Ga0070717_10052459 Ga0070717_100524593 220
1018 3300006028 Ga0070717_10271335 Ga0070717_102713352 220
1019 3300006051 Ga0075364_10241520 Ga0075364_102415201 220
1020 3300006163 Ga0070715_10038256 Ga0070715_100382562 220
1021 3300006173 Ga0070716_100063387 Ga0070716_1000633872 220
1022 3300006175 Ga0070712_100000510 Ga0070712_10000051016 220
1023 3300006175 Ga0070712_100548443 Ga0070712_1005484431 220
1024 3300006177 Ga0075362_10088404 Ga0075362_100884043 220
1025 3300006178 Ga0075367_10038620 Ga0075367_100386204 220
1026 3300006178 Ga0075367_10189243 Ga0075367_101892432 220
1027 3300006195 Ga0075366_10201921 Ga0075366_102019212 220
1028 3300006237 Ga0097621_100063668 Ga0097621_1000636682 220
1029 3300006237 Ga0097621_100172663 Ga0097621_1001726632 220
1030 3300006353 Ga0075370_10131055 Ga0075370_101310552 220
1031 3300006358 Ga0068871_100121747 Ga0068871_1001217473 220
1032 3300006358 Ga0068871_100144440 Ga0068871_1001444403 220
1033 3300006358 Ga0068871_100428758 Ga0068871_1004287582 220
1034 3300006844 Ga0075428_100165910 Ga0075428_1001659102 220
1035 3300006846 Ga0075430_100019678 Ga0075430_1000196783 220
1036 3300006846 Ga0075430_100126770 Ga0075430_1001267702 220
1037 3300006846 Ga0075430_100593182 Ga0075430_1005931821 220
1038 3300006847 Ga0075431_100006206 Ga0075431_1000062066 220
1039 3300006847 Ga0075431_100052112 Ga0075431_1000521122 220
1040 3300006847 Ga0075431_100196183 Ga0075431_1001961831 220
1041 3300006847 Ga0075431_100374479 Ga0075431_1003744791 220
1042 3300006852 Ga0075433_10014635 Ga0075433_100146353 220
1043 3300006871 Ga0075434_100010342 Ga0075434_1000103427 220
1044 3300006871 Ga0075434_100014911 Ga0075434_1000149115 220
1045 3300006871 Ga0075434_100332065 Ga0075434_1003320652 220
1046 3300006880 Ga0075429_100004721 Ga0075429_1000047216 220
1047 3300006880 Ga0075429_100074741 Ga0075429_1000747412 220
1048 3300006881 Ga0068865_100043887 Ga0068865_1000438872 220
1049 3300006881 Ga0068865_100057388 Ga0068865_1000573883 220
1050 3300006931 Ga0097620_100177395 Ga0097620_1001773952 220
1051 3300007076 Ga0075435_100079717 Ga0075435_1000797172 220
1052 3300009093 Ga0105240_10373238 Ga0105240_103732382 220
1053 3300009094 Ga0111539_10000115 Ga0111539_1000011586 220
1054 3300009094 Ga0111539_10035755 Ga0111539_100357552 220
1055 3300009094 Ga0111539_10285981 Ga0111539_102859812 220
1056 3300009098 Ga0105245_10213700 Ga0105245_102137002 220
1057 3300009147 Ga0114129_10001209 Ga0114129_1000120929 220
1058 3300009147 Ga0114129_10521651 Ga0114129_105216512 220
1059 3300009148 Ga0105243_10202271 Ga0105243_102022712 220
1060 3300009174 Ga0105241_10308526 Ga0105241_103085262 220
1061 3300009551 Ga0105238_10015798 Ga0105238_100157988 220
1062 3300009551 Ga0105238_10138257 Ga0105238_101382572 220
1063 3300010159 Ga0099796_10058032 Ga0099796_100580322 220
1064 3300013100 Ga0157373_10235162 Ga0157373_102351621 220
1065 3300013102 Ga0157371_10121861 Ga0157371_101218612 220
1066 3300013104 Ga0157370_10098914 Ga0157370_100989142 220
1067 3300013297 Ga0157378_10192270 Ga0157378_101922702 220
1068 3300013297 Ga0157378_11088559 Ga0157378_110885592 220
1069 3300013307 Ga0157372_10166961 Ga0157372_101669611 220
1070 3300013308 Ga0157375_10420256 Ga0157375_104202562 220
1071 3300014326 Ga0157380_10235786 Ga0157380_102357863 220
1072 3300014497 Ga0182008_10086728 Ga0182008_100867281 220
1073 3300014968 Ga0157379_10081002 Ga0157379_100810023 220
1074 3300014968 Ga0157379_10738369 Ga0157379_107383692 220
1075 3300014969 Ga0157376_10174926 Ga0157376_101749263 220
1076 3300015262 Ga0182007_10029855 Ga0182007_100298551 220
1077 3300017792 Ga0163161_10111188 Ga0163161_101111882 220
1078 3300017792 Ga0163161_10398892 Ga0163161_103988922 220
1079 3300025297 Ga0209758_1002997 Ga0209758_100299714 220
1080 3300025893 Ga0207682_10000296 Ga0207682_100002969 220
1081 3300025898 Ga0207692_10108804 Ga0207692_101088041 220
1082 3300025899 Ga0207642_10084260 Ga0207642_100842602 220
1083 3300025900 Ga0207710_10057991 Ga0207710_100579912 220
1084 3300025900 Ga0207710_10199718 Ga0207710_101997182 220
1085 3300025901 Ga0207688_10000128 Ga0207688_1000012829 220
1086 3300025901 Ga0207688_10068503 Ga0207688_100685032 220
1087 3300025904 Ga0207647_10057755 Ga0207647_100577552 220
1088 3300025905 Ga0207685_10050048 Ga0207685_100500481 220
1089 3300025906 Ga0207699_10148884 Ga0207699_101488842 220
1090 3300025907 Ga0207645_10029210 Ga0207645_100292102 220
1091 3300025908 Ga0207643_10001308 Ga0207643_1000130812 220
1092 3300025910 Ga0207684_10223929 Ga0207684_102239292 220
1093 3300025910 Ga0207684_10450150 Ga0207684_104501502 220
1094 3300025912 Ga0207707_10363961 Ga0207707_103639612 220
1095 3300025914 Ga0207671_10077644 Ga0207671_100776442 220
1096 3300025915 Ga0207693_10004077 Ga0207693_100040779 220
1097 3300025915 Ga0207693_10059618 Ga0207693_100596182 220
1098 3300025916 Ga0207663_10049650 Ga0207663_100496502 220
1099 3300025916 Ga0207663_10276768 Ga0207663_102767682 220
1100 3300025917 Ga0207660_10383925 Ga0207660_103839251 220
1101 3300025917 Ga0207660_10770476 Ga0207660_107704761 220
1102 3300025918 Ga0207662_10007901 Ga0207662_100079013 220
1103 3300025919 Ga0207657_10015231 Ga0207657_100152314 220
1104 3300025922 Ga0207646_10223682 Ga0207646_102236822 220
1105 3300025923 Ga0207681_10039840 Ga0207681_100398402 220
1106 3300025923 Ga0207681_10365023 Ga0207681_103650232 220
1107 3300025924 Ga0207694_10084697 Ga0207694_100846972 220
1108 3300025924 Ga0207694_10334685 Ga0207694_103346851 220
1109 3300025925 Ga0207650_10016005 Ga0207650_100160052 220
1110 3300025925 Ga0207650_10110009 Ga0207650_101100092 220
1111 3300025925 Ga0207650_10152665 Ga0207650_101526651 220
1112 3300025926 Ga0207659_10053791 Ga0207659_100537912 220
1113 3300025926 Ga0207659_10101402 Ga0207659_101014022 220
1114 3300025926 Ga0207659_10410471 Ga0207659_104104712 220
1115 3300025927 Ga0207687_10151179 Ga0207687_101511792 220
1116 3300025928 Ga0207700_10010061 Ga0207700_100100614 220
1117 3300025928 Ga0207700_10100203 Ga0207700_101002032 220
1118 3300025928 Ga0207700_10273292 Ga0207700_102732922 220
1119 3300025928 Ga0207700_10421891 Ga0207700_104218912 220
1120 3300025929 Ga0207664_10071807 Ga0207664_100718072 220
1121 3300025929 Ga0207664_10143903 Ga0207664_101439032 220
1122 3300025931 Ga0207644_10050930 Ga0207644_100509303 220
1123 3300025932 Ga0207690_10173230 Ga0207690_101732301 220
1124 3300025933 Ga0207706_10071194 Ga0207706_100711943 220
1125 3300025934 Ga0207686_10143041 Ga0207686_101430412 220
1126 3300025935 Ga0207709_10039683 Ga0207709_100396833 220
1127 3300025937 Ga0207669_10003483 Ga0207669_100034836 220
1128 3300025937 Ga0207669_10011823 Ga0207669_100118234 220
1129 3300025937 Ga0207669_10240900 Ga0207669_102409002 220
1130 3300025938 Ga0207704_10013867 Ga0207704_100138672 220
1131 3300025938 Ga0207704_10054915 Ga0207704_100549152 220
1132 3300025939 Ga0207665_10291835 Ga0207665_102918352 220
1133 3300025940 Ga0207691_10009341 Ga0207691_100093416 220
1134 3300025940 Ga0207691_10012127 Ga0207691_100121274 220
1135 3300025940 Ga0207691_10071621 Ga0207691_100716212 220
1136 3300025941 Ga0207711_10139086 Ga0207711_101390862 220
1137 3300025942 Ga0207689_10015457 Ga0207689_100154573 220
1138 3300025944 Ga0207661_10079426 Ga0207661_100794262 220
1139 3300025945 Ga0207679_10074330 Ga0207679_100743302 220
1140 3300025945 Ga0207679_10227636 Ga0207679_102276362 220
1141 3300025949 Ga0207667_10098190 Ga0207667_100981903 220
1142 3300025960 Ga0207651_10413879 Ga0207651_104138792 220
1143 3300025960 Ga0207651_10420243 Ga0207651_104202432 220
1144 3300025961 Ga0207712_10144440 Ga0207712_101444402 220
1145 3300025972 Ga0207668_10019953 Ga0207668_100199534 220
1146 3300025972 Ga0207668_10026891 Ga0207668_100268913 220
1147 3300025972 Ga0207668_10607274 Ga0207668_106072741 220
1148 3300025981 Ga0207640_10088009 Ga0207640_100880092 220
1149 3300025986 Ga0207658_10080256 Ga0207658_100802562 220
1150 3300026023 Ga0207677_10010326 Ga0207677_100103263 220
1151 3300026023 Ga0207677_10291832 Ga0207677_102918322 220
1152 3300026035 Ga0207703_10007006 Ga0207703_100070063 220
1153 3300026067 Ga0207678_10009800 Ga0207678_100098002 220
1154 3300026075 Ga0207708_10021157 Ga0207708_100211572 220
1155 3300026075 Ga0207708_10214654 Ga0207708_102146541 220
1156 3300026075 Ga0207708_10275730 Ga0207708_102757302 220
1157 3300026078 Ga0207702_10087305 Ga0207702_100873053 220
1158 3300026078 Ga0207702_10458952 Ga0207702_104589522 220
1159 3300026088 Ga0207641_10010250 Ga0207641_100102503 220
1160 3300026089 Ga0207648_10004873 Ga0207648_1000487310 220
1161 3300026089 Ga0207648_10032399 Ga0207648_100323992 220
1162 3300026095 Ga0207676_10028629 Ga0207676_100286293 220
1163 3300026116 Ga0207674_10088974 Ga0207674_100889742 220
1164 3300026116 Ga0207674_10301809 Ga0207674_103018092 220
1165 3300026118 Ga0207675_100001656 Ga0207675_1000016565 220
1166 3300026121 Ga0207683_10002838 Ga0207683_100028389 220
1167 3300026121 Ga0207683_10048234 Ga0207683_100482344 220
1168 3300026121 Ga0207683_10095740 Ga0207683_100957403 220
1169 3300026142 Ga0207698_10027688 Ga0207698_100276883 220
1170 3300027866 Ga0209813_10049603 Ga0209813_100496032 220
1171 3300027907 Ga0207428_10014276 Ga0207428_100142762 220
1172 3300027907 Ga0207428_10039926 Ga0207428_100399262 220
1173 3300027907 Ga0207428_10338290 Ga0207428_103382902 220
1174 3300028380 Ga0268265_10039232 Ga0268265_100392322 220
1175 3300028556 Ga0265337_1000296 Ga0265337_100029622 220
1176 3300031238 Ga0265332_10001176 Ga0265332_1000117614 220
1177 3300031241 Ga0265325_10001878 Ga0265325_1000187810 220
1178 3300031247 Ga0265340_10013597 Ga0265340_100135975 220
1179 3300031249 Ga0265339_10014668 Ga0265339_100146683 220
1180 3300031250 Ga0265331_10147611 Ga0265331_101476111 220
1181 3300031344 Ga0265316_10112540 Ga0265316_101125402 220
1182 3300031344 Ga0265316_10304092 Ga0265316_103040921 220
1183 3300031595 Ga0265313_10148496 Ga0265313_101484961 220
1184 3300031712 Ga0265342_10000963 Ga0265342_100009634 220
1185 3300035088 Ga0373940_0100946 Ga0373940_0100946_122_784 220
1186 3300035114 Ga0373939_0250011 Ga0373939_0250011_10_675 220
1187 3300035115 Ga0373941_0178383 Ga0373941_0178383_104_766 220
1188 3300035117 Ga0373953_0001936 Ga0373953_0001936_860_1522 220
1189 3300035119 Ga0373956_0055351 Ga0373956_0055351_918_1580 220
1190 3300035121 Ga0373960_0105862 Ga0373960_0105862_191_853 220
1191 3300035172 Ga0373955_0003147 Ga0373955_0003147_2127_2789 220
1192 3300035241 Ga0373961_0017676 Ga0373961_0017676_934_1596 220
1193 3300035410 Ga0373924_0130717 Ga0373924_0130717_349_1011 220
1194 3300035691 Ga0373931_0076862 Ga0373931_0076862_693_1358 220
1195 3300035695 Ga0373927_0352993 Ga0373927_0352993_111_773 220
1196 3300035724 Ga0373933_0110891 Ga0373933_0110891_782_1444 220
1197 3300035724 Ga0373933_0544717 Ga0373933_0544717_80_742 220
1198 3300035725 Ga0373947_0185614 Ga0373947_0185614_399_1061 220
1199 3300035725 Ga0373947_0305421 Ga0373947_0305421_347_1024 220
1200 3300036401 Ga0373937_0009653 Ga0373937_0009653_2099_2761 220
1201 3300036401 Ga0373937_0283416 Ga0373937_0283416_62_724 220
1202 3300036401 Ga0373937_0325121 Ga0373937_0325121_390_1052 220
1203 3300036401 Ga0373937_0660692 Ga0373937_0660692_23_688 220
1204 3300037068 Ga0373925_0331339 Ga0373925_0331339_189_851 220
1205 3300037853 Ga0436364_0272511 Ga0436364_0272511_308_1003 220
1206 3300037853 Ga0436364_0276897 Ga0436364_0276897_1788_2486 220
1207 3300042001 Ga0439441_024254 Ga0439441_024254_408_1070 220
1208 3300042439 Ga0439464_0027481 Ga0439464_0027481_19_681 220
1209 3300044694 Ga0466963_0211080 Ga0466963_0211080_186_851 220
1210 3300044842 Ga0466957_0042342 Ga0466957_0042342_548_1213 220
1211 3300045976 Ga0466967_0011344 Ga0466967_0011344_5437_6102 220
1212 3300046454 Ga0495592_0018134 Ga0495592_0018134_676_1338 220
1213 3300046462 Ga0495651_0084927 Ga0495651_0084927_1049_1711 220
1214 3300046462 Ga0495651_0138155 Ga0495651_0138155_503_1165 220
1215 3300046516 Ga0495628_0322007 Ga0495628_0322007_210_872 220
1216 3300046529 Ga0495652_0018745 Ga0495652_0018745_526_1188 220
1217 3300046536 Ga0495587_0263075 Ga0495587_0263075_211_873 220
1218 3300046537 Ga0495598_0022957 Ga0495598_0022957_785_1447 220
1219 3300046539 Ga0495621_0006549 Ga0495621_0006549_2437_3099 220
1220 3300046543 Ga0495645_0003698 Ga0495645_0003698_8702_9364 220
1221 3300046559 Ga0495667_0003312 Ga0495667_0003312_3559_4221 220
1222 3300046616 Ga0495668_0191670 Ga0495668_0191670_107_769 220
1223 3300046663 Ga0495635_0089878 Ga0495635_0089878_377_1039 220
1224 3300046663 Ga0495635_0295378 Ga0495635_0295378_318_980 220
1225 3300046675 Ga0495657_0055369 Ga0495657_0055369_302_964 220
1226 3300046678 Ga0495599_0062130 Ga0495599_0062130_551_1213 220
1227 3300046679 Ga0495623_0052926 Ga0495623_0052926_1558_2220 220
1228 3300046683 Ga0495658_0068877 Ga0495658_0068877_345_1007 220
1229 3300046809 Ga0495600_0007959 Ga0495600_0007959_3759_4421 220
1230 3300047317 Ga0495604_0050971 Ga0495604_0050971_2271_2933 220
1231 3300047317 Ga0495604_0371830 Ga0495604_0371830_174_836 220
1232 3300047319 Ga0495674_0392179 Ga0495674_0392179_184_846 220
1233 3300047322 Ga0495680_0015610 Ga0495680_0015610_4629_5291 220
1234 3300047444 Ga0495675_0024229 Ga0495675_0024229_199_861 220
1235 3300048088 Ga0495602_0002833 Ga0495602_0002833_9364_10026 220
1236 3300048088 Ga0495602_0232778 Ga0495602_0232778_276_938 220
1237 3300048090 Ga0495615_0001702 Ga0495615_0001702_556_1218 220
1238 3300048903 Ga0496100_0048437 Ga0496100_0048437_1483_2151 220
1239 3300048903 Ga0496100_0704882 Ga0496100_0704882_16_678 220
1240 3300048904 Ga0496101_0626049 Ga0496101_0626049_122_784 220
1241 3300048905 Ga0496102_0069408 Ga0496102_0069408_1839_2507 220
1242 3300048907 Ga0496104_0002721 Ga0496104_0002721_10152_10820 220
1243 3300048907 Ga0496104_0004972 Ga0496104_0004972_6730_7398 220
1244 3300048908 Ga0496105_0005232 Ga0496105_0005232_4332_5000 220
1245 3300048908 Ga0496105_0011829 Ga0496105_0011829_5237_5905 220
1246 3300048909 Ga0496106_0368710 Ga0496106_0368710_83_751 220
1247 3300048911 Ga0496108_0091305 Ga0496108_0091305_1826_2494 220
1248 3300048911 Ga0496108_0236140 Ga0496108_0236140_130_792 220
1249 3300048912 Ga0496109_0553796 Ga0496109_0553796_397_1059 220
1250 3300048914 Ga0496111_0621090 Ga0496111_0621090_109_771 220
1251 3300048917 Ga0496114_0037810 Ga0496114_0037810_992_1654 220
1252 3300048917 Ga0496114_0192591 Ga0496114_0192591_821_1489 220
1253 3300048918 Ga0496115_0040379 Ga0496115_0040379_594_1262 220
1254 3300048918 Ga0496115_0078144 Ga0496115_0078144_1808_2470 220
1255 3300048918 Ga0496115_0139297 Ga0496115_0139297_231_899 220
1256 3300049571 Ga0501034_0501811 Ga0501034_0501811_428_1090 220
1257 3300049574 Ga0501038_0057908 Ga0501038_0057908_712_1374 220
1258 3300049575 Ga0501039_0105217 Ga0501039_0105217_482_1144 220
1259 3300049585 Ga0501069_0111854 Ga0501069_0111854_385_1047 220
1260 3300049585 Ga0501069_0176291 Ga0501069_0176291_57_719 220
1261 3300049588 Ga0501072_0245551 Ga0501072_0245551_484_1146 220
1262 3300049589 Ga0501073_0454170 Ga0501073_0454170_124_786 220
1263 3300049591 Ga0501075_0497997 Ga0501075_0497997_112_774 220
1264 3300049593 Ga0501077_0279940 Ga0501077_0279940_286_969 220
1265 3300049741 Ga0501079_0060955 Ga0501079_0060955_1957_2619 220
1266 3300049742 Ga0501080_0437387 Ga0501080_0437387_451_1113 220
1267 3300049822 Ga0501035_0198851 Ga0501035_0198851_777_1439 220
1268 3300049823 Ga0501044_0000332 Ga0501044_0000332_15915_16577 220
1269 3300050491 nmdc:mga00v17_375685_c1 nmdc:mga00v17_375685_c1_36_698 220
1270 3300050493 nmdc:mga0k408_7684_c1 nmdc:mga0k408_7684_c1_4831_5493 220
1271 3300050494 nmdc:mga06z11_179966_c1 nmdc:mga06z11_179966_c1_23_685 220
1272 3300050494 nmdc:mga06z11_28602_c1 nmdc:mga06z11_28602_c1_694_1356 220
1273 3300050507 nmdc:mga05p37_2462_c1 nmdc:mga05p37_2462_c1_11157_11819 220
1274 3300050508 nmdc:mga09592_1563_c1 nmdc:mga09592_1563_c1_13684_14346 220
1275 3300050509 nmdc:mga0qj67_25585_c1 nmdc:mga0qj67_25585_c1_1013_1675 220
1276 3300050510 nmdc:mga06r32_585012_c1 nmdc:mga06r32_585012_c1_247_909 220
1277 3300050510 nmdc:mga06r32_770_c1 nmdc:mga06r32_770_c1_10157_10819 220
1278 3300050511 nmdc:mga08y16_255360_c1 nmdc:mga08y16_255360_c1_386_1054 220
1279 3300050511 nmdc:mga08y16_72_c1 nmdc:mga08y16_72_c1_6966_7628 220
1280 3300050511 nmdc:mga08y16_80137_c1 nmdc:mga08y16_80137_c1_1642_2319 220
1281 3300050512 nmdc:mga0n895_501080_c1 nmdc:mga0n895_501080_c1_139_801 220
1282 3300050512 nmdc:mga0n895_6034_c1 nmdc:mga0n895_6034_c1_6466_7143 220
1283 3300050512 nmdc:mga0n895_896149_c1 nmdc:mga0n895_896149_c1_86_754 220
1284 3300050514 nmdc:mga08x19_92847_c1 nmdc:mga08x19_92847_c1_873_1535 220
1285 3300050515 nmdc:mga0a205_125304_c1 nmdc:mga0a205_125304_c1_726_1394 220
1286 3300050515 nmdc:mga0a205_374833_c1 nmdc:mga0a205_374833_c1_157_834 220
1287 3300053077 Ga0495601_0003683 Ga0495601_0003683_8091_8753 220
1288 3300053077 Ga0495601_0086353 Ga0495601_0086353_530_1192 220
1289 3300053078 Ga0495612_0001873 Ga0495612_0001873_1414_2076 220
1290 3300053080 Ga0500635_0100150 Ga0500635_0100150_201_869 220
1291 3300053084 Ga0495595_0000954 Ga0495595_0000954_3305_3967 220
1292 3300053084 Ga0495595_0040846 Ga0495595_0040846_231_893 220
1293 3300053084 Ga0495595_0048082 Ga0495595_0048082_61_723 220
1294 3300053084 Ga0495595_0114281 Ga0495595_0114281_44_706 220
1295 3300053084 Ga0495595_0286854 Ga0495595_0286854_141_803 220
1296 3300053085 Ga0495619_0000421 Ga0495619_0000421_7775_8437 220
1297 3300053085 Ga0495619_0136396 Ga0495619_0136396_234_896 220
1298 3300053085 Ga0495619_0546462 Ga0495619_0546462_30_692 220
1299 3300053085 Ga0495619_0665733 Ga0495619_0665733_17_682 220
1300 3300053090 Ga0500646_0018525 Ga0500646_0018525_545_1207 220
1301 3300053096 Ga0500641_0007475 Ga0500641_0007475_1051_1713 220
1302 3300053096 Ga0500641_0138980 Ga0500641_0138980_125_787 220
1303 3300053119 Ga0500595_045883 Ga0500595_045883_388_1050 220
1304 3300053120 Ga0500597_102986 Ga0500597_102986_274_936 220
1305 3300053130 Ga0500642_0209280 Ga0500642_0209280_190_852 220
1306 3300053134 Ga0500658_0165618 Ga0500658_0165618_233_895 220
1307 3300053153 Ga0500616_0051396 Ga0500616_0051396_860_1522 220
1308 3300053153 Ga0500616_0067776 Ga0500616_0067776_611_1273 220
1309 3300054114 Ga0501084_0558336 Ga0501084_0558336_175_837 220
1310 3300060353 Ga0501082_0643518 Ga0501082_0643518_155_838 220
1311 3300061719 Ga0466962_0219667 Ga0466962_0219667_25_687 220
1312 3300061734 Ga0530510_0098131 Ga0530510_0098131_1362_2024 220
1313 3300003911 JGI25405J52794_10006793 JGI25405J52794_100067932 221
1314 3300005340 Ga0070689_100067780 Ga0070689_1000677802 221
1315 3300005365 Ga0070688_100146918 Ga0070688_1001469182 221
1316 3300005456 Ga0070678_100194954 Ga0070678_1001949542 221
1317 3300005937 Ga0081455_10020646 Ga0081455_100206464 221
1318 3300005937 Ga0081455_10164909 Ga0081455_101649092 221
1319 3300005981 Ga0081538_10029159 Ga0081538_100291593 221
1320 3300005981 Ga0081538_10063138 Ga0081538_100631383 221
1321 3300005983 Ga0081540_1059337 Ga0081540_10593372 221
1322 3300006177 Ga0075362_10031586 Ga0075362_100315862 221
1323 3300006178 Ga0075367_10005934 Ga0075367_100059344 221
1324 3300006847 Ga0075431_100051756 Ga0075431_1000517564 221
1325 3300006914 Ga0075436_100059715 Ga0075436_1000597152 221
1326 3300009176 Ga0105242_10199891 Ga0105242_101998912 221
1327 3300013306 Ga0163162_10154049 Ga0163162_101540492 221
1328 3300013306 Ga0163162_10541103 Ga0163162_105411032 221
1329 3300014325 Ga0163163_10305180 Ga0163163_103051802 221
1330 3300014968 Ga0157379_10183651 Ga0157379_101836512 221
1331 3300021377 Ga0213874_10011428 Ga0213874_100114281 221
1332 3300025931 Ga0207644_10532576 Ga0207644_105325762 221
1333 3300025942 Ga0207689_10403173 Ga0207689_104031731 221
1334 3300026095 Ga0207676_10452666 Ga0207676_104526661 221
1335 3300034816 Ga0373930_0014354 Ga0373930_0014354_177_842 221
1336 3300035084 Ga0373928_0012733 Ga0373928_0012733_511_1176 221
1337 3300035114 Ga0373939_0025888 Ga0373939_0025888_144_809 221
1338 3300035121 Ga0373960_0183194 Ga0373960_0183194_35_700 221
1339 3300035207 Ga0373942_0004614 Ga0373942_0004614_1517_2182 221
1340 3300035691 Ga0373931_0062737 Ga0373931_0062737_863_1528 221
1341 3300039450 Ga0436363_0209638 Ga0436363_0209638_1167_1832 221
1342 3300046457 Ga0495590_0026739 Ga0495590_0026739_1198_1881 221
1343 3300046491 Ga0495584_0016022 Ga0495584_0016022_1272_1937 221
1344 3300046648 Ga0495611_0059680 Ga0495611_0059680_833_1498 221
1345 3300046664 Ga0495659_0018708 Ga0495659_0018708_921_1586 221
1346 3300048903 Ga0496100_0006330 Ga0496100_0006330_4499_5164 221
1347 3300048906 Ga0496103_0321335 Ga0496103_0321335_212_877 221
1348 3300048909 Ga0496106_0083927 Ga0496106_0083927_779_1444 221
1349 3300048910 Ga0496107_0386138 Ga0496107_0386138_212_877 221
1350 3300048911 Ga0496108_0203847 Ga0496108_0203847_317_982 221
1351 3300048913 Ga0496110_0106612 Ga0496110_0106612_669_1352 221
1352 3300048913 Ga0496110_0131135 Ga0496110_0131135_1208_1873 221
1353 3300048914 Ga0496111_0051265 Ga0496111_0051265_77_742 221
1354 3300048917 Ga0496114_0084699 Ga0496114_0084699_969_1634 221
1355 3300048918 Ga0496115_0147723 Ga0496115_0147723_1208_1873 221
1356 3300049589 Ga0501073_0034330 Ga0501073_0034330_627_1292 221
1357 3300049592 Ga0501076_0067689 Ga0501076_0067689_1916_2581 221
1358 3300050489 nmdc:mga03683_158978_c1 nmdc:mga03683_158978_c1_218_883 221
1359 3300050492 nmdc:mga0yw44_130131_c1 nmdc:mga0yw44_130131_c1_223_888 221
1360 3300050507 nmdc:mga05p37_76079_c1 nmdc:mga05p37_76079_c1_343_1008 221
1361 3300050508 nmdc:mga09592_11541_c1 nmdc:mga09592_11541_c1_2951_3616 221
1362 3300050509 nmdc:mga0qj67_145888_c1 nmdc:mga0qj67_145888_c1_438_1103 221
1363 3300050510 nmdc:mga06r32_381340_c1 nmdc:mga06r32_381340_c1_461_1126 221
1364 3300050510 nmdc:mga06r32_53800_c1 nmdc:mga06r32_53800_c1_1348_2013 221
1365 3300053134 Ga0500658_0052616 Ga0500658_0052616_588_1253 221
1366 3300053158 Ga0500627_0031869 Ga0500627_0031869_1187_1852 221
1367 3300054114 Ga0501084_0426782 Ga0501084_0426782_446_1111 221
1368 3300060353 Ga0501082_0468674 Ga0501082_0468674_160_825 221
1369 3300061734 Ga0530510_0148221 Ga0530510_0148221_293_958 221
1370 2209111006 2214814668 2213848616 222
1371 3300000042 ARSoilYngRDRAFT_c00083 ARSoilYngRDRAFT_000835 222
1372 3300000045 ARCol0oldRDRAFT_c00760 ARCol0oldRDRAFT_007602 222
1373 3300000652 ARCol0yngRDRAFT_1000133 ARCol0yngRDRAFT_10001337 222
1374 3300001430 JGI24032J14994_100385 JGI24032J14994_1003852 222
1375 3300001989 JGI24739J22299_10007522 JGI24739J22299_100075224 222
1376 3300001990 JGI24737J22298_10004387 JGI24737J22298_100043873 222
1377 3300001990 JGI24737J22298_10009881 JGI24737J22298_100098813 222
1378 3300002070 JGI24750J21931_1001004 JGI24750J21931_10010041 222
1379 3300002070 JGI24750J21931_1001354 JGI24750J21931_10013542 222
1380 3300002074 JGI24748J21848_1001287 JGI24748J21848_10012873 222
1381 3300002074 JGI24748J21848_1003899 JGI24748J21848_10038992 222
1382 3300002075 JGI24738J21930_10009485 JGI24738J21930_100094851 222
1383 3300002075 JGI24738J21930_10040800 JGI24738J21930_100408002 222
1384 3300002077 JGI24744J21845_10001579 JGI24744J21845_100015792 222
1385 3300002077 JGI24744J21845_10002586 JGI24744J21845_100025862 222
1386 3300002155 JGI24033J26618_1001352 JGI24033J26618_10013522 222
1387 3300002155 JGI24033J26618_1005685 JGI24033J26618_10056852 222
1388 3300002239 JGI24034J26672_10004052 JGI24034J26672_100040521 222
1389 3300002244 JGI24742J22300_10000237 JGI24742J22300_100002372 222
1390 3300002244 JGI24742J22300_10002773 JGI24742J22300_100027733 222
1391 3300002459 JGI24751J29686_10014171 JGI24751J29686_100141712 222
1392 3300005276 Ga0065717_1004432 Ga0065717_10044321 222
1393 3300005293 Ga0065715_10005360 Ga0065715_100053604 222
1394 3300005293 Ga0065715_10114903 Ga0065715_101149032 222
1395 3300005328 Ga0070676_10003368 Ga0070676_100033682 222
1396 3300005329 Ga0070683_100018166 Ga0070683_1000181666 222
1397 3300005329 Ga0070683_100086994 Ga0070683_1000869942 222
1398 3300005329 Ga0070683_100172776 Ga0070683_1001727762 222
1399 3300005330 Ga0070690_100015741 Ga0070690_1000157414 222
1400 3300005330 Ga0070690_100070408 Ga0070690_1000704081 222
1401 3300005330 Ga0070690_100271967 Ga0070690_1002719671 222
1402 3300005331 Ga0070670_100017688 Ga0070670_1000176884 222
1403 3300005331 Ga0070670_100021799 Ga0070670_1000217993 222
1404 3300005331 Ga0070670_100067293 Ga0070670_1000672932 222
1405 3300005333 Ga0070677_10000267 Ga0070677_1000026713 222
1406 3300005334 Ga0068869_100000991 Ga0068869_10000099110 222
1407 3300005334 Ga0068869_100142155 Ga0068869_1001421552 222
1408 3300005335 Ga0070666_10026799 Ga0070666_100267993 222
1409 3300005335 Ga0070666_10043212 Ga0070666_100432123 222
1410 3300005336 Ga0070680_100117122 Ga0070680_1001171221 222
1411 3300005336 Ga0070680_100391858 Ga0070680_1003918581 222
1412 3300005336 Ga0070680_100434201 Ga0070680_1004342011 222
1413 3300005337 Ga0070682_100002951 Ga0070682_1000029515 222
1414 3300005337 Ga0070682_100069804 Ga0070682_1000698042 222
1415 3300005337 Ga0070682_100082454 Ga0070682_1000824542 222
1416 3300005338 Ga0068868_100002944 Ga0068868_1000029446 222
1417 3300005339 Ga0070660_100038138 Ga0070660_1000381382 222
1418 3300005339 Ga0070660_100175196 Ga0070660_1001751962 222
1419 3300005339 Ga0070660_100301569 Ga0070660_1003015692 222
1420 3300005340 Ga0070689_100030426 Ga0070689_1000304264 222
1421 3300005340 Ga0070689_100031004 Ga0070689_1000310044 222
1422 3300005340 Ga0070689_100054488 Ga0070689_1000544882 222
1423 3300005341 Ga0070691_10009416 Ga0070691_100094163 222
1424 3300005341 Ga0070691_10164886 Ga0070691_101648862 222
1425 3300005343 Ga0070687_100000779 Ga0070687_1000007794 222
1426 3300005343 Ga0070687_100000879 Ga0070687_1000008794 222
1427 3300005343 Ga0070687_100001496 Ga0070687_1000014965 222
1428 3300005343 Ga0070687_100256713 Ga0070687_1002567132 222
1429 3300005344 Ga0070661_100046215 Ga0070661_1000462153 222
1430 3300005344 Ga0070661_100107598 Ga0070661_1001075982 222
1431 3300005344 Ga0070661_100142355 Ga0070661_1001423552 222
1432 3300005344 Ga0070661_100656259 Ga0070661_1006562591 222
1433 3300005345 Ga0070692_10001248 Ga0070692_100012485 222
1434 3300005345 Ga0070692_10046232 Ga0070692_100462322 222
1435 3300005353 Ga0070669_100039772 Ga0070669_1000397723 222
1436 3300005353 Ga0070669_100269713 Ga0070669_1002697132 222
1437 3300005354 Ga0070675_100010374 Ga0070675_1000103744 222
1438 3300005354 Ga0070675_100102178 Ga0070675_1001021782 222
1439 3300005354 Ga0070675_100114679 Ga0070675_1001146791 222
1440 3300005354 Ga0070675_100396972 Ga0070675_1003969722 222
1441 3300005354 Ga0070675_100514825 Ga0070675_1005148251 222
1442 3300005355 Ga0070671_100007159 Ga0070671_1000071594 222
1443 3300005355 Ga0070671_100012646 Ga0070671_1000126465 222
1444 3300005355 Ga0070671_100026558 Ga0070671_1000265584 222
1445 3300005355 Ga0070671_100089670 Ga0070671_1000896702 222
1446 3300005356 Ga0070674_100307809 Ga0070674_1003078092 222
1447 3300005356 Ga0070674_100355354 Ga0070674_1003553541 222
1448 3300005356 Ga0070674_100384571 Ga0070674_1003845712 222
1449 3300005364 Ga0070673_100001635 Ga0070673_1000016356 222
1450 3300005364 Ga0070673_100013588 Ga0070673_1000135883 222
1451 3300005365 Ga0070688_100003323 Ga0070688_1000033236 222
1452 3300005365 Ga0070688_100009701 Ga0070688_1000097015 222
1453 3300005365 Ga0070688_100065251 Ga0070688_1000652512 222
1454 3300005365 Ga0070688_100216466 Ga0070688_1002164662 222
1455 3300005365 Ga0070688_100417516 Ga0070688_1004175161 222
1456 3300005366 Ga0070659_100090422 Ga0070659_1000904223 222
1457 3300005366 Ga0070659_100113439 Ga0070659_1001134392 222
1458 3300005367 Ga0070667_100007017 Ga0070667_1000070173 222
1459 3300005367 Ga0070667_100009571 Ga0070667_1000095715 222
1460 3300005367 Ga0070667_100190110 Ga0070667_1001901102 222
1461 3300005406 Ga0070703_10016156 Ga0070703_100161563 222
1462 3300005434 Ga0070709_10000722 Ga0070709_100007224 222
1463 3300005434 Ga0070709_10003844 Ga0070709_100038447 222
1464 3300005434 Ga0070709_10028926 Ga0070709_100289262 222
1465 3300005435 Ga0070714_100008512 Ga0070714_1000085129 222
1466 3300005435 Ga0070714_100031272 Ga0070714_1000312723 222
1467 3300005435 Ga0070714_100869445 Ga0070714_1008694452 222
1468 3300005436 Ga0070713_100000642 Ga0070713_10000064222 222
1469 3300005436 Ga0070713_100002545 Ga0070713_1000025457 222
1470 3300005436 Ga0070713_100002655 Ga0070713_10000265512 222
1471 3300005436 Ga0070713_100044640 Ga0070713_1000446404 222
1472 3300005436 Ga0070713_100073863 Ga0070713_1000738631 222
1473 3300005437 Ga0070710_10005698 Ga0070710_100056983 222
1474 3300005437 Ga0070710_10013642 Ga0070710_100136425 222
1475 3300005437 Ga0070710_10191503 Ga0070710_101915032 222
1476 3300005438 Ga0070701_10022674 Ga0070701_100226741 222
1477 3300005439 Ga0070711_100016884 Ga0070711_1000168843 222
1478 3300005439 Ga0070711_100026093 Ga0070711_1000260932 222
1479 3300005439 Ga0070711_100052196 Ga0070711_1000521963 222
1480 3300005439 Ga0070711_100121796 Ga0070711_1001217963 222
1481 3300005439 Ga0070711_100303892 Ga0070711_1003038922 222
1482 3300005440 Ga0070705_100176094 Ga0070705_1001760942 222
1483 3300005441 Ga0070700_100060010 Ga0070700_1000600101 222
1484 3300005444 Ga0070694_100091536 Ga0070694_1000915362 222
1485 3300005444 Ga0070694_100125882 Ga0070694_1001258821 222
1486 3300005445 Ga0070708_100092171 Ga0070708_1000921712 222
1487 3300005445 Ga0070708_100866050 Ga0070708_1008660501 222
1488 3300005455 Ga0070663_100033061 Ga0070663_1000330612 222
1489 3300005455 Ga0070663_100054484 Ga0070663_1000544842 222
1490 3300005455 Ga0070663_100057764 Ga0070663_1000577643 222
1491 3300005456 Ga0070678_100039475 Ga0070678_1000394752 222
1492 3300005456 Ga0070678_100106198 Ga0070678_1001061982 222
1493 3300005456 Ga0070678_100169360 Ga0070678_1001693602 222
1494 3300005456 Ga0070678_100331604 Ga0070678_1003316042 222
1495 3300005457 Ga0070662_100011788 Ga0070662_1000117882 222
1496 3300005457 Ga0070662_100072588 Ga0070662_1000725882 222
1497 3300005457 Ga0070662_100074481 Ga0070662_1000744812 222
1498 3300005457 Ga0070662_100144169 Ga0070662_1001441692 222
1499 3300005457 Ga0070662_100192610 Ga0070662_1001926102 222
1500 3300005458 Ga0070681_10011227 Ga0070681_100112272 222
1501 3300005458 Ga0070681_10035216 Ga0070681_100352164 222
1502 3300005459 Ga0068867_100035269 Ga0068867_1000352693 222
1503 3300005459 Ga0068867_100131533 Ga0068867_1001315331 222
1504 3300005466 Ga0070685_10006394 Ga0070685_100063943 222
1505 3300005466 Ga0070685_10017813 Ga0070685_100178132 222
1506 3300005466 Ga0070685_10314256 Ga0070685_103142562 222
1507 3300005530 Ga0070679_100079593 Ga0070679_1000795933 222
1508 3300005530 Ga0070679_100480497 Ga0070679_1004804971 222
1509 3300005530 Ga0070679_100534521 Ga0070679_1005345212 222
1510 3300005535 Ga0070684_100008016 Ga0070684_1000080162 222
1511 3300005535 Ga0070684_100053621 Ga0070684_1000536212 222
1512 3300005535 Ga0070684_100158332 Ga0070684_1001583323 222
1513 3300005535 Ga0070684_100514699 Ga0070684_1005146992 222
1514 3300005536 Ga0070697_100484933 Ga0070697_1004849332 222
1515 3300005536 Ga0070697_100673619 Ga0070697_1006736191 222
1516 3300005539 Ga0068853_100006686 Ga0068853_1000066865 222
1517 3300005543 Ga0070672_100100603 Ga0070672_1001006033 222
1518 3300005543 Ga0070672_100181347 Ga0070672_1001813472 222
1519 3300005544 Ga0070686_100009616 Ga0070686_1000096164 222
1520 3300005544 Ga0070686_100013100 Ga0070686_1000131002 222
1521 3300005544 Ga0070686_100039047 Ga0070686_1000390472 222
1522 3300005544 Ga0070686_100331686 Ga0070686_1003316861 222
1523 3300005545 Ga0070695_100003989 Ga0070695_1000039896 222
1524 3300005545 Ga0070695_100328761 Ga0070695_1003287611 222
1525 3300005545 Ga0070695_100538099 Ga0070695_1005380991 222
1526 3300005546 Ga0070696_100026156 Ga0070696_1000261563 222
1527 3300005546 Ga0070696_100327009 Ga0070696_1003270092 222
1528 3300005547 Ga0070693_100047839 Ga0070693_1000478392 222
1529 3300005547 Ga0070693_100094030 Ga0070693_1000940302 222
1530 3300005548 Ga0070665_100074437 Ga0070665_1000744371 222
1531 3300005549 Ga0070704_100153246 Ga0070704_1001532461 222
1532 3300005563 Ga0068855_100015824 Ga0068855_1000158245 222
1533 3300005564 Ga0070664_100027449 Ga0070664_1000274494 222
1534 3300005564 Ga0070664_100053843 Ga0070664_1000538432 222
1535 3300005564 Ga0070664_100213137 Ga0070664_1002131371 222
1536 3300005577 Ga0068857_100006755 Ga0068857_1000067553 222
1537 3300005578 Ga0068854_100036578 Ga0068854_1000365782 222
1538 3300005614 Ga0068856_100011342 Ga0068856_1000113422 222
1539 3300005615 Ga0070702_100005409 Ga0070702_1000054094 222
1540 3300005615 Ga0070702_100143643 Ga0070702_1001436432 222
1541 3300005615 Ga0070702_100285706 Ga0070702_1002857062 222
1542 3300005616 Ga0068852_100025247 Ga0068852_1000252474 222
1543 3300005617 Ga0068859_100013470 Ga0068859_1000134702 222
1544 3300005718 Ga0068866_10001677 Ga0068866_100016775 222
1545 3300005719 Ga0068861_100295945 Ga0068861_1002959451 222
1546 3300005840 Ga0068870_10000323 Ga0068870_100003235 222
1547 3300005841 Ga0068863_100008410 Ga0068863_1000084106 222
1548 3300005842 Ga0068858_100012534 Ga0068858_1000125342 222
1549 3300005843 Ga0068860_100020097 Ga0068860_1000200974 222
1550 3300005843 Ga0068860_100090029 Ga0068860_1000900292 222
1551 3300005843 Ga0068860_100242980 Ga0068860_1002429802 222
1552 3300005843 Ga0068860_100726026 Ga0068860_1007260262 222
1553 3300005844 Ga0068862_100391366 Ga0068862_1003913662 222
1554 3300005844 Ga0068862_100412650 Ga0068862_1004126502 222
1555 3300005937 Ga0081455_10000313 Ga0081455_1000031362 222
1556 3300005937 Ga0081455_10007840 Ga0081455_100078406 222
1557 3300005937 Ga0081455_10008306 Ga0081455_100083065 222
1558 3300005983 Ga0081540_1001997 Ga0081540_10019973 222
1559 3300006028 Ga0070717_10001127 Ga0070717_1000112712 222
1560 3300006028 Ga0070717_10157104 Ga0070717_101571042 222
1561 3300006038 Ga0075365_10010251 Ga0075365_100102514 222
1562 3300006038 Ga0075365_10295320 Ga0075365_102953202 222
1563 3300006048 Ga0075363_100051285 Ga0075363_1000512852 222
1564 3300006058 Ga0075432_10029716 Ga0075432_100297162 222
1565 3300006163 Ga0070715_10011765 Ga0070715_100117652 222
1566 3300006173 Ga0070716_100006514 Ga0070716_1000065143 222
1567 3300006173 Ga0070716_100041037 Ga0070716_1000410373 222
1568 3300006175 Ga0070712_100139071 Ga0070712_1001390712 222
1569 3300006178 Ga0075367_10015374 Ga0075367_100153743 222
1570 3300006194 Ga0075427_10000408 Ga0075427_100004082 222
1571 3300006237 Ga0097621_100024744 Ga0097621_1000247444 222
1572 3300006237 Ga0097621_100025426 Ga0097621_1000254265 222
1573 3300006237 Ga0097621_100058963 Ga0097621_1000589634 222
1574 3300006358 Ga0068871_100004355 Ga0068871_10000435510 222
1575 3300006358 Ga0068871_100005719 Ga0068871_1000057194 222
1576 3300006844 Ga0075428_100067306 Ga0075428_1000673062 222
1577 3300006846 Ga0075430_100000422 Ga0075430_1000004227 222
1578 3300006847 Ga0075431_100001159 Ga0075431_10000115916 222
1579 3300006852 Ga0075433_10002900 Ga0075433_100029004 222
1580 3300006852 Ga0075433_10131607 Ga0075433_101316071 222
1581 3300006852 Ga0075433_10249521 Ga0075433_102495212 222
1582 3300006871 Ga0075434_100002589 Ga0075434_1000025897 222
1583 3300006871 Ga0075434_100008955 Ga0075434_1000089552 222
1584 3300006871 Ga0075434_100129440 Ga0075434_1001294403 222
1585 3300006871 Ga0075434_100161500 Ga0075434_1001615001 222
1586 3300006871 Ga0075434_100249777 Ga0075434_1002497772 222
1587 3300006871 Ga0075434_100261515 Ga0075434_1002615152 222
1588 3300006871 Ga0075434_100334898 Ga0075434_1003348982 222
1589 3300006880 Ga0075429_100003486 Ga0075429_10000348613 222
1590 3300006881 Ga0068865_100003962 Ga0068865_1000039622 222
1591 3300006881 Ga0068865_100024760 Ga0068865_1000247604 222
1592 3300006914 Ga0075436_100013190 Ga0075436_1000131901 222
1593 3300006914 Ga0075436_100205351 Ga0075436_1002053511 222
1594 3300006931 Ga0097620_100013468 Ga0097620_1000134682 222
1595 3300007076 Ga0075435_100003751 Ga0075435_1000037513 222
1596 3300007076 Ga0075435_100017230 Ga0075435_1000172304 222
1597 3300007076 Ga0075435_100370421 Ga0075435_1003704212 222
1598 3300007076 Ga0075435_100401348 Ga0075435_1004013482 222
1599 3300007076 Ga0075435_100436361 Ga0075435_1004363612 222
1600 3300009011 Ga0105251_10171265 Ga0105251_101712651 222
1601 3300009011 Ga0105251_10210356 Ga0105251_102103561 222
1602 3300009036 Ga0105244_10079145 Ga0105244_100791452 222
1603 3300009093 Ga0105240_10551141 Ga0105240_105511412 222
1604 3300009093 Ga0105240_10672744 Ga0105240_106727441 222
1605 3300009094 Ga0111539_10001208 Ga0111539_100012081 222
1606 3300009094 Ga0111539_10016618 Ga0111539_100166185 222
1607 3300009094 Ga0111539_10065361 Ga0111539_100653613 222
1608 3300009094 Ga0111539_10075477 Ga0111539_100754773 222
1609 3300009094 Ga0111539_10188940 Ga0111539_101889402 222
1610 3300009094 Ga0111539_10240392 Ga0111539_102403923 222
1611 3300009098 Ga0105245_10009095 Ga0105245_100090952 222
1612 3300009098 Ga0105245_10032578 Ga0105245_100325785 222
1613 3300009098 Ga0105245_10446492 Ga0105245_104464921 222
1614 3300009098 Ga0105245_10616985 Ga0105245_106169851 222
1615 3300009098 Ga0105245_10669224 Ga0105245_106692241 222
1616 3300009101 Ga0105247_10011961 Ga0105247_100119614 222
1617 3300009101 Ga0105247_10013019 Ga0105247_100130192 222
1618 3300009101 Ga0105247_10302923 Ga0105247_103029232 222
1619 3300009147 Ga0114129_10002965 Ga0114129_1000296516 222
1620 3300009147 Ga0114129_10006052 Ga0114129_100060526 222
1621 3300009147 Ga0114129_10013259 Ga0114129_100132599 222
1622 3300009147 Ga0114129_10119804 Ga0114129_101198042 222
1623 3300009147 Ga0114129_10470224 Ga0114129_104702241 222
1624 3300009147 Ga0114129_10839262 Ga0114129_108392622 222
1625 3300009147 Ga0114129_11497736 Ga0114129_114977361 222
1626 3300009148 Ga0105243_10103149 Ga0105243_101031492 222
1627 3300009148 Ga0105243_10704703 Ga0105243_107047032 222
1628 3300009174 Ga0105241_10047559 Ga0105241_100475593 222
1629 3300009174 Ga0105241_10277697 Ga0105241_102776972 222
1630 3300009176 Ga0105242_10014426 Ga0105242_100144263 222
1631 3300009176 Ga0105242_10035204 Ga0105242_100352044 222
1632 3300009176 Ga0105242_10222232 Ga0105242_102222322 222
1633 3300009177 Ga0105248_10063976 Ga0105248_100639763 222
1634 3300009177 Ga0105248_10078423 Ga0105248_100784232 222
1635 3300009177 Ga0105248_10366006 Ga0105248_103660062 222
1636 3300009545 Ga0105237_10013130 Ga0105237_100131309 222
1637 3300009551 Ga0105238_10061206 Ga0105238_100612064 222
1638 3300009551 Ga0105238_10079184 Ga0105238_100791843 222
1639 3300009553 Ga0105249_10129773 Ga0105249_101297733 222
1640 3300009553 Ga0105249_10151432 Ga0105249_101514322 222
1641 3300009553 Ga0105249_10225723 Ga0105249_102257232 222
1642 3300010375 Ga0105239_10059193 Ga0105239_100591933 222
1643 3300010375 Ga0105239_10211371 Ga0105239_102113712 222
1644 3300010375 Ga0105239_10233781 Ga0105239_102337812 222
1645 3300010375 Ga0105239_10461311 Ga0105239_104613112 222
1646 3300010375 Ga0105239_10500033 Ga0105239_105000332 222
1647 3300011119 Ga0105246_10858189 Ga0105246_108581892 222
1648 3300012495 Ga0157323_1001008 Ga0157323_10010082 222
1649 3300012507 Ga0157342_1003348 Ga0157342_10033482 222
1650 3300012507 Ga0157342_1014577 Ga0157342_10145771 222
1651 3300013102 Ga0157371_10062576 Ga0157371_100625763 222
1652 3300013104 Ga0157370_10045373 Ga0157370_100453734 222
1653 3300013296 Ga0157374_10012090 Ga0157374_100120905 222
1654 3300013296 Ga0157374_10015579 Ga0157374_100155797 222
1655 3300013297 Ga0157378_10035925 Ga0157378_100359253 222
1656 3300013297 Ga0157378_10591563 Ga0157378_105915632 222
1657 3300013297 Ga0157378_10695806 Ga0157378_106958061 222
1658 3300013306 Ga0163162_10092137 Ga0163162_100921374 222
1659 3300013306 Ga0163162_10153097 Ga0163162_101530972 222
1660 3300013306 Ga0163162_10198253 Ga0163162_101982533 222
1661 3300013306 Ga0163162_10377070 Ga0163162_103770702 222
1662 3300013307 Ga0157372_10757546 Ga0157372_107575461 222
1663 3300013308 Ga0157375_10080527 Ga0157375_100805272 222
1664 3300013308 Ga0157375_10119204 Ga0157375_101192043 222
1665 3300013308 Ga0157375_10763754 Ga0157375_107637542 222
1666 3300013308 Ga0157375_10855590 Ga0157375_108555902 222
1667 3300014325 Ga0163163_10061221 Ga0163163_100612213 222
1668 3300014325 Ga0163163_10211575 Ga0163163_102115752 222
1669 3300014326 Ga0157380_10014420 Ga0157380_100144202 222
1670 3300014745 Ga0157377_10005914 Ga0157377_100059145 222
1671 3300014745 Ga0157377_10012295 Ga0157377_100122954 222
1672 3300014968 Ga0157379_10009813 Ga0157379_100098132 222
1673 3300014968 Ga0157379_10067495 Ga0157379_100674953 222
1674 3300014968 Ga0157379_10206560 Ga0157379_102065602 222
1675 3300014969 Ga0157376_10036071 Ga0157376_100360711 222
1676 3300014969 Ga0157376_10056356 Ga0157376_100563562 222
1677 3300025271 Ga0207666_1002128 Ga0207666_10021281 222
1678 3300025290 Ga0207673_1005562 Ga0207673_10055622 222
1679 3300025885 Ga0207653_10019567 Ga0207653_100195671 222
1680 3300025885 Ga0207653_10071830 Ga0207653_100718302 222
1681 3300025893 Ga0207682_10000143 Ga0207682_100001436 222
1682 3300025898 Ga0207692_10007719 Ga0207692_100077194 222
1683 3300025898 Ga0207692_10008536 Ga0207692_100085362 222
1684 3300025898 Ga0207692_10083114 Ga0207692_100831142 222
1685 3300025899 Ga0207642_10036287 Ga0207642_100362873 222
1686 3300025900 Ga0207710_10007601 Ga0207710_100076014 222
1687 3300025901 Ga0207688_10003106 Ga0207688_100031066 222
1688 3300025901 Ga0207688_10125930 Ga0207688_101259302 222
1689 3300025903 Ga0207680_10141904 Ga0207680_101419042 222
1690 3300025903 Ga0207680_10430475 Ga0207680_104304751 222
1691 3300025904 Ga0207647_10019708 Ga0207647_100197083 222
1692 3300025905 Ga0207685_10001276 Ga0207685_100012764 222
1693 3300025906 Ga0207699_10005685 Ga0207699_100056853 222
1694 3300025906 Ga0207699_10087912 Ga0207699_100879121 222
1695 3300025906 Ga0207699_10443363 Ga0207699_104433632 222
1696 3300025906 Ga0207699_10501300 Ga0207699_105013001 222
1697 3300025907 Ga0207645_10002217 Ga0207645_1000221716 222
1698 3300025907 Ga0207645_10072385 Ga0207645_100723852 222
1699 3300025907 Ga0207645_10175199 Ga0207645_101751991 222
1700 3300025907 Ga0207645_10389540 Ga0207645_103895402 222
1701 3300025908 Ga0207643_10000336 Ga0207643_100003366 222
1702 3300025909 Ga0207705_10202606 Ga0207705_102026062 222
1703 3300025912 Ga0207707_10106301 Ga0207707_101063011 222
1704 3300025912 Ga0207707_10180986 Ga0207707_101809861 222
1705 3300025913 Ga0207695_10081982 Ga0207695_100819823 222
1706 3300025915 Ga0207693_10006884 Ga0207693_100068844 222
1707 3300025915 Ga0207693_10007237 Ga0207693_100072378 222
1708 3300025915 Ga0207693_10007632 Ga0207693_100076325 222
1709 3300025916 Ga0207663_10283648 Ga0207663_102836481 222
1710 3300025919 Ga0207657_10019752 Ga0207657_100197522 222
1711 3300025920 Ga0207649_10001348 Ga0207649_100013488 222
1712 3300025921 Ga0207652_10162319 Ga0207652_101623191 222
1713 3300025923 Ga0207681_10003351 Ga0207681_100033516 222
1714 3300025925 Ga0207650_10047882 Ga0207650_100478824 222
1715 3300025926 Ga0207659_10003433 Ga0207659_100034332 222
1716 3300025926 Ga0207659_10707596 Ga0207659_107075962 222
1717 3300025927 Ga0207687_10005007 Ga0207687_100050072 222
1718 3300025927 Ga0207687_10019582 Ga0207687_100195822 222
1719 3300025928 Ga0207700_10001518 Ga0207700_100015186 222
1720 3300025928 Ga0207700_10006032 Ga0207700_100060327 222
1721 3300025928 Ga0207700_10102435 Ga0207700_101024352 222
1722 3300025929 Ga0207664_10033324 Ga0207664_100333242 222
1723 3300025929 Ga0207664_10053281 Ga0207664_100532813 222
1724 3300025931 Ga0207644_10007899 Ga0207644_100078991 222
1725 3300025931 Ga0207644_10089230 Ga0207644_100892302 222
1726 3300025931 Ga0207644_10339871 Ga0207644_103398712 222
1727 3300025932 Ga0207690_10044750 Ga0207690_100447501 222
1728 3300025932 Ga0207690_10054341 Ga0207690_100543413 222
1729 3300025933 Ga0207706_10009717 Ga0207706_100097173 222
1730 3300025933 Ga0207706_10217627 Ga0207706_102176272 222
1731 3300025933 Ga0207706_10408549 Ga0207706_104085492 222
1732 3300025934 Ga0207686_10023266 Ga0207686_100232662 222
1733 3300025934 Ga0207686_10087086 Ga0207686_100870862 222
1734 3300025936 Ga0207670_10001760 Ga0207670_100017605 222
1735 3300025936 Ga0207670_10129792 Ga0207670_101297921 222
1736 3300025936 Ga0207670_10819981 Ga0207670_108199811 222
1737 3300025937 Ga0207669_10002028 Ga0207669_100020282 222
1738 3300025938 Ga0207704_10118425 Ga0207704_101184252 222
1739 3300025939 Ga0207665_10003757 Ga0207665_100037573 222
1740 3300025939 Ga0207665_10030549 Ga0207665_100305492 222
1741 3300025939 Ga0207665_10115412 Ga0207665_101154122 222
1742 3300025940 Ga0207691_10106627 Ga0207691_101066272 222
1743 3300025941 Ga0207711_10002949 Ga0207711_1000294910 222
1744 3300025941 Ga0207711_10094742 Ga0207711_100947422 222
1745 3300025942 Ga0207689_10000929 Ga0207689_100009296 222
1746 3300025942 Ga0207689_10046163 Ga0207689_100461634 222
1747 3300025944 Ga0207661_10426211 Ga0207661_104262111 222
1748 3300025945 Ga0207679_10001711 Ga0207679_100017117 222
1749 3300025960 Ga0207651_10000218 Ga0207651_100002186 222
1750 3300025961 Ga0207712_10064600 Ga0207712_100646002 222
1751 3300025961 Ga0207712_10109208 Ga0207712_101092082 222
1752 3300025972 Ga0207668_10002885 Ga0207668_100028856 222
1753 3300025981 Ga0207640_10002339 Ga0207640_100023396 222
1754 3300025986 Ga0207658_10004688 Ga0207658_100046886 222
1755 3300025986 Ga0207658_10105166 Ga0207658_101051661 222
1756 3300025986 Ga0207658_10106059 Ga0207658_101060592 222
1757 3300026041 Ga0207639_10015755 Ga0207639_100157556 222
1758 3300026067 Ga0207678_10009613 Ga0207678_100096136 222
1759 3300026067 Ga0207678_10013639 Ga0207678_100136394 222
1760 3300026067 Ga0207678_10031911 Ga0207678_100319112 222
1761 3300026067 Ga0207678_10036839 Ga0207678_100368394 222
1762 3300026078 Ga0207702_10015377 Ga0207702_100153772 222
1763 3300026078 Ga0207702_10177532 Ga0207702_101775323 222
1764 3300026088 Ga0207641_10052179 Ga0207641_100521792 222
1765 3300026089 Ga0207648_10008818 Ga0207648_100088186 222
1766 3300026095 Ga0207676_10037767 Ga0207676_100377673 222
1767 3300026116 Ga0207674_10011855 Ga0207674_100118556 222
1768 3300026116 Ga0207674_10213579 Ga0207674_102135792 222
1769 3300026116 Ga0207674_10269903 Ga0207674_102699032 222
1770 3300026118 Ga0207675_100008431 Ga0207675_1000084316 222
1771 3300026118 Ga0207675_100168864 Ga0207675_1001688643 222
1772 3300026118 Ga0207675_100209548 Ga0207675_1002095482 222
1773 3300026121 Ga0207683_10009004 Ga0207683_100090042 222
1774 3300026121 Ga0207683_10013750 Ga0207683_100137503 222
1775 3300026121 Ga0207683_10125701 Ga0207683_101257012 222
1776 3300026142 Ga0207698_10028080 Ga0207698_100280801 222
1777 3300026142 Ga0207698_10417506 Ga0207698_104175062 222
1778 3300026142 Ga0207698_10701400 Ga0207698_107014002 222
1779 3300027252 Ga0209973_1029682 Ga0209973_10296822 222
1780 3300027360 Ga0209969_1025574 Ga0209969_10255742 222
1781 3300027471 Ga0209995_1006503 Ga0209995_10065032 222
1782 3300027543 Ga0209999_1002776 Ga0209999_10027763 222
1783 3300027552 Ga0209982_1001422 Ga0209982_10014222 222
1784 3300027614 Ga0209970_1011011 Ga0209970_10110112 222
1785 3300027617 Ga0210002_1011310 Ga0210002_10113101 222
1786 3300027682 Ga0209971_1018136 Ga0209971_10181361 222
1787 3300027695 Ga0209966_1009501 Ga0209966_10095012 222
1788 3300027907 Ga0207428_10000141 Ga0207428_10000141104 222
1789 3300027907 Ga0207428_10091485 Ga0207428_100914852 222
1790 3300027907 Ga0207428_10494738 Ga0207428_104947381 222
1791 3300028379 Ga0268266_10007909 Ga0268266_100079092 222
1792 3300028381 Ga0268264_10118741 Ga0268264_101187412 222
1793 3300028381 Ga0268264_10627263 Ga0268264_106272632 222
1794 3300031995 Ga0307409_100784937 Ga0307409_1007849372 222
1795 3300032002 Ga0307416_100274865 Ga0307416_1002748652 222
1796 3300034816 Ga0373930_0000149 Ga0373930_0000149_5987_6655 222
1797 3300034817 Ga0373948_0001402 Ga0373948_0001402_435_1103 222
1798 3300034818 Ga0373950_0002469 Ga0373950_0002469_1693_2361 222
1799 3300034818 Ga0373950_0002565 Ga0373950_0002565_148_816 222
1800 3300034818 Ga0373950_0060772 Ga0373950_0060772_68_736 222
1801 3300034819 Ga0373958_0000770 Ga0373958_0000770_1385_2053 222
1802 3300034820 Ga0373959_0000590 Ga0373959_0000590_5662_6330 222
1803 3300034820 Ga0373959_0006317 Ga0373959_0006317_658_1326 222
1804 3300034957 Ga0373938_0002746 Ga0373938_0002746_11_679 222
1805 3300034957 Ga0373938_0016180 Ga0373938_0016180_747_1415 222
1806 3300035083 Ga0373926_0003809 Ga0373926_0003809_3909_4577 222
1807 3300035083 Ga0373926_0021505 Ga0373926_0021505_976_1644 222
1808 3300035083 Ga0373926_0047407 Ga0373926_0047407_793_1461 222
1809 3300035084 Ga0373928_0001444 Ga0373928_0001444_1630_2298 222
1810 3300035084 Ga0373928_0011763 Ga0373928_0011763_486_1154 222
1811 3300035084 Ga0373928_0017713 Ga0373928_0017713_378_1046 222
1812 3300035085 Ga0373929_0030101 Ga0373929_0030101_189_857 222
1813 3300035088 Ga0373940_0000020 Ga0373940_0000020_7685_8353 222
1814 3300035088 Ga0373940_0031949 Ga0373940_0031949_185_853 222
1815 3300035089 Ga0373944_0112064 Ga0373944_0112064_105_773 222
1816 3300035090 Ga0373949_0001308 Ga0373949_0001308_591_1259 222
1817 3300035090 Ga0373949_0030421 Ga0373949_0030421_36_704 222
1818 3300035091 Ga0373951_0010560 Ga0373951_0010560_284_952 222
1819 3300035091 Ga0373951_0084742 Ga0373951_0084742_123_791 222
1820 3300035092 Ga0373952_0000244 Ga0373952_0000244_5952_6620 222
1821 3300035092 Ga0373952_0013542 Ga0373952_0013542_586_1254 222
1822 3300035092 Ga0373952_0040712 Ga0373952_0040712_50_718 222
1823 3300035111 Ga0373923_0001289 Ga0373923_0001289_3665_4333 222
1824 3300035111 Ga0373923_0056090 Ga0373923_0056090_256_924 222
1825 3300035112 Ga0373932_0000776 Ga0373932_0000776_1360_2028 222
1826 3300035112 Ga0373932_0004742 Ga0373932_0004742_819_1487 222
1827 3300035112 Ga0373932_0047826 Ga0373932_0047826_440_1108 222
1828 3300035112 Ga0373932_0108773 Ga0373932_0108773_41_709 222
1829 3300035113 Ga0373936_0017507 Ga0373936_0017507_1012_1680 222
1830 3300035113 Ga0373936_0116755 Ga0373936_0116755_355_1023 222
1831 3300035114 Ga0373939_0000304 Ga0373939_0000304_10865_11533 222
1832 3300035114 Ga0373939_0002839 Ga0373939_0002839_2813_3481 222
1833 3300035114 Ga0373939_0003357 Ga0373939_0003357_1640_2308 222
1834 3300035114 Ga0373939_0009072 Ga0373939_0009072_1597_2265 222
1835 3300035115 Ga0373941_0000096 Ga0373941_0000096_8182_8850 222
1836 3300035115 Ga0373941_0016891 Ga0373941_0016891_140_808 222
1837 3300035116 Ga0373945_0013788 Ga0373945_0013788_942_1610 222
1838 3300035117 Ga0373953_0026490 Ga0373953_0026490_1337_2005 222
1839 3300035118 Ga0373954_0246533 Ga0373954_0246533_121_789 222
1840 3300035119 Ga0373956_0009351 Ga0373956_0009351_3056_3724 222
1841 3300035119 Ga0373956_0051167 Ga0373956_0051167_307_975 222
1842 3300035121 Ga0373960_0004352 Ga0373960_0004352_2085_2753 222
1843 3300035121 Ga0373960_0010008 Ga0373960_0010008_883_1551 222
1844 3300035121 Ga0373960_0034005 Ga0373960_0034005_385_1053 222
1845 3300035170 Ga0373943_0002507 Ga0373943_0002507_7630_8298 222
1846 3300035170 Ga0373943_0010123 Ga0373943_0010123_2323_2991 222
1847 3300035170 Ga0373943_0069624 Ga0373943_0069624_943_1611 222
1848 3300035170 Ga0373943_0091689 Ga0373943_0091689_542_1210 222
1849 3300035171 Ga0373946_0006973 Ga0373946_0006973_2730_3398 222
1850 3300035171 Ga0373946_0111761 Ga0373946_0111761_283_951 222
1851 3300035172 Ga0373955_0001041 Ga0373955_0001041_3871_4539 222
1852 3300035207 Ga0373942_0003489 Ga0373942_0003489_1154_1822 222
1853 3300035241 Ga0373961_0052057 Ga0373961_0052057_518_1186 222
1854 3300035242 Ga0373962_0014039 Ga0373962_0014039_1355_2023 222
1855 3300035242 Ga0373962_0032604 Ga0373962_0032604_189_857 222
1856 3300035410 Ga0373924_0006978 Ga0373924_0006978_1885_2553 222
1857 3300035410 Ga0373924_0075601 Ga0373924_0075601_464_1132 222
1858 3300035691 Ga0373931_0030830 Ga0373931_0030830_1338_2006 222
1859 3300035691 Ga0373931_0107563 Ga0373931_0107563_552_1220 222
1860 3300035691 Ga0373931_0157115 Ga0373931_0157115_508_1176 222
1861 3300035692 Ga0373935_0018001 Ga0373935_0018001_3387_4055 222
1862 3300035692 Ga0373935_0031146 Ga0373935_0031146_60_728 222
1863 3300035692 Ga0373935_0221758 Ga0373935_0221758_219_887 222
1864 3300035695 Ga0373927_0006091 Ga0373927_0006091_5692_6360 222
1865 3300035695 Ga0373927_0021751 Ga0373927_0021751_2473_3141 222
1866 3300035695 Ga0373927_0053959 Ga0373927_0053959_834_1547 222
1867 3300035695 Ga0373927_0058298 Ga0373927_0058298_1497_2165 222
1868 3300035695 Ga0373927_0113723 Ga0373927_0113723_880_1548 222
1869 3300035724 Ga0373933_0040893 Ga0373933_0040893_1975_2643 222
1870 3300035724 Ga0373933_0055986 Ga0373933_0055986_818_1486 222
1871 3300035725 Ga0373947_0003178 Ga0373947_0003178_692_1360 222
1872 3300035725 Ga0373947_0077797 Ga0373947_0077797_817_1485 222
1873 3300035725 Ga0373947_0159371 Ga0373947_0159371_46_714 222
1874 3300036401 Ga0373937_0004203 Ga0373937_0004203_7602_8270 222
1875 3300036401 Ga0373937_0005150 Ga0373937_0005150_6154_6822 222
1876 3300036401 Ga0373937_0043521 Ga0373937_0043521_2418_3137 222
1877 3300036401 Ga0373937_0338448 Ga0373937_0338448_70_738 222
1878 3300037068 Ga0373925_0001829 Ga0373925_0001829_11486_12154 222
1879 3300037068 Ga0373925_0095124 Ga0373925_0095124_1055_1723 222
1880 3300037068 Ga0373925_0197531 Ga0373925_0197531_879_1547 222
1881 3300037068 Ga0373925_0243214 Ga0373925_0243214_243_911 222
1882 3300037418 Ga0395900_0197033 Ga0395900_0197033_628_1329 222
1883 3300038443 Ga0395901_0029783 Ga0395901_0029783_2578_3279 222
1884 3300039450 Ga0436363_0033382 Ga0436363_0033382_152_853 222
1885 3300041408 Ga0439453_0009771 Ga0439453_0009771_24_692 222
1886 3300041503 Ga0451847_0125728 Ga0451847_0125728_177_845 222
1887 3300042012 Ga0439455_0016484 Ga0439455_0016484_696_1364 222
1888 3300042016 Ga0439463_039602 Ga0439463_039602_369_1037 222
1889 3300042435 Ga0439434_0027162 Ga0439434_0027162_247_915 222
1890 3300042438 Ga0439459_0057035 Ga0439459_0057035_166_840 222
1891 3300042876 Ga0451577_0351855 Ga0451577_0351855_59_727 222
1892 3300046452 Ga0495617_034371 Ga0495617_034371_183_851 222
1893 3300046454 Ga0495592_0304235 Ga0495592_0304235_85_753 222
1894 3300046455 Ga0495603_0011593 Ga0495603_0011593_3878_4546 222
1895 3300046455 Ga0495603_0014236 Ga0495603_0014236_1603_2271 222
1896 3300046455 Ga0495603_0090037 Ga0495603_0090037_1019_1687 222
1897 3300046458 Ga0495591_026697 Ga0495591_026697_158_826 222
1898 3300046459 Ga0495629_0001405 Ga0495629_0001405_17606_18274 222
1899 3300046459 Ga0495629_0180392 Ga0495629_0180392_45_713 222
1900 3300046459 Ga0495629_0327623 Ga0495629_0327623_317_985 222
1901 3300046460 Ga0495638_0123357 Ga0495638_0123357_114_782 222
1902 3300046461 Ga0495641_0008026 Ga0495641_0008026_1638_2306 222
1903 3300046461 Ga0495641_0016245 Ga0495641_0016245_2131_2799 222
1904 3300046461 Ga0495641_0170387 Ga0495641_0170387_203_871 222
1905 3300046462 Ga0495651_0004808 Ga0495651_0004808_9369_10037 222
1906 3300046462 Ga0495651_0014554 Ga0495651_0014554_4916_5584 222
1907 3300046462 Ga0495651_0100459 Ga0495651_0100459_571_1248 222
1908 3300046463 Ga0495653_0009990 Ga0495653_0009990_1120_1788 222
1909 3300046463 Ga0495653_0023259 Ga0495653_0023259_3156_3824 222
1910 3300046472 Ga0495580_0006404 Ga0495580_0006404_8168_8836 222
1911 3300046472 Ga0495580_0279766 Ga0495580_0279766_254_922 222
1912 3300046473 Ga0495582_0009206 Ga0495582_0009206_1736_2404 222
1913 3300046473 Ga0495582_0011279 Ga0495582_0011279_2487_3155 222
1914 3300046474 Ga0495605_0060282 Ga0495605_0060282_794_1462 222
1915 3300046474 Ga0495605_0117192 Ga0495605_0117192_326_994 222
1916 3300046474 Ga0495605_0149824 Ga0495605_0149824_189_890 222
1917 3300046475 Ga0495639_0001451 Ga0495639_0001451_3737_4405 222
1918 3300046476 Ga0495662_0000915 Ga0495662_0000915_4303_4971 222
1919 3300046491 Ga0495584_0010949 Ga0495584_0010949_1946_2614 222
1920 3300046492 Ga0495585_0003492 Ga0495585_0003492_725_1393 222
1921 3300046492 Ga0495585_0014510 Ga0495585_0014510_3345_4013 222
1922 3300046499 Ga0495594_0021870 Ga0495594_0021870_2124_2792 222
1923 3300046499 Ga0495594_0026216 Ga0495594_0026216_2132_2800 222
1924 3300046501 Ga0495607_0011896 Ga0495607_0011896_5047_5715 222
1925 3300046507 Ga0495606_0171810 Ga0495606_0171810_245_913 222
1926 3300046511 Ga0495608_0002687 Ga0495608_0002687_1844_2512 222
1927 3300046513 Ga0495616_0045956 Ga0495616_0045956_881_1549 222
1928 3300046514 Ga0495618_0016938 Ga0495618_0016938_105_773 222
1929 3300046514 Ga0495618_0113556 Ga0495618_0113556_956_1624 222
1930 3300046515 Ga0495620_0148348 Ga0495620_0148348_218_886 222
1931 3300046516 Ga0495628_0031977 Ga0495628_0031977_3452_4120 222
1932 3300046516 Ga0495628_0399179 Ga0495628_0399179_192_860 222
1933 3300046518 Ga0495631_0020045 Ga0495631_0020045_1966_2634 222
1934 3300046518 Ga0495631_0147677 Ga0495631_0147677_27_695 222
1935 3300046519 Ga0495632_0063439 Ga0495632_0063439_177_845 222
1936 3300046520 Ga0495637_0031952 Ga0495637_0031952_1234_1902 222
1937 3300046523 Ga0495644_0002698 Ga0495644_0002698_4315_4983 222
1938 3300046523 Ga0495644_0013585 Ga0495644_0013585_169_837 222
1939 3300046523 Ga0495644_0029747 Ga0495644_0029747_1252_1920 222
1940 3300046525 Ga0495663_0009130 Ga0495663_0009130_1565_2233 222
1941 3300046526 Ga0495666_0007167 Ga0495666_0007167_721_1389 222
1942 3300046526 Ga0495666_0111386 Ga0495666_0111386_87_755 222
1943 3300046526 Ga0495666_0116445 Ga0495666_0116445_536_1204 222
1944 3300046528 Ga0495642_0128081 Ga0495642_0128081_195_863 222
1945 3300046529 Ga0495652_0002710 Ga0495652_0002710_7469_8137 222
1946 3300046529 Ga0495652_0106579 Ga0495652_0106579_769_1437 222
1947 3300046531 Ga0495665_0002969 Ga0495665_0002969_1000_1668 222
1948 3300046533 Ga0495640_0031035 Ga0495640_0031035_3120_3788 222
1949 3300046533 Ga0495640_0061797 Ga0495640_0061797_912_1580 222
1950 3300046533 Ga0495640_0120421 Ga0495640_0120421_164_832 222
1951 3300046533 Ga0495640_0346310 Ga0495640_0346310_229_897 222
1952 3300046536 Ga0495587_0003832 Ga0495587_0003832_9264_9932 222
1953 3300046536 Ga0495587_0008130 Ga0495587_0008130_117_785 222
1954 3300046536 Ga0495587_0029830 Ga0495587_0029830_112_780 222
1955 3300046537 Ga0495598_0000364 Ga0495598_0000364_2866_3534 222
1956 3300046537 Ga0495598_0001832 Ga0495598_0001832_2137_2805 222
1957 3300046537 Ga0495598_0049138 Ga0495598_0049138_423_1091 222
1958 3300046539 Ga0495621_0057546 Ga0495621_0057546_557_1225 222
1959 3300046557 Ga0495622_0032151 Ga0495622_0032151_1334_2002 222
1960 3300046557 Ga0495622_0079233 Ga0495622_0079233_389_1057 222
1961 3300046557 Ga0495622_0097449 Ga0495622_0097449_493_1161 222
1962 3300046558 Ga0495633_0002269 Ga0495633_0002269_5644_6312 222
1963 3300046558 Ga0495633_0082663 Ga0495633_0082663_107_775 222
1964 3300046558 Ga0495633_0107181 Ga0495633_0107181_37_705 222
1965 3300046559 Ga0495667_0092466 Ga0495667_0092466_893_1561 222
1966 3300046559 Ga0495667_0291832 Ga0495667_0291832_323_991 222
1967 3300046615 Ga0495656_0017382 Ga0495656_0017382_1163_1831 222
1968 3300046615 Ga0495656_0142885 Ga0495656_0142885_45_713 222
1969 3300046616 Ga0495668_0017078 Ga0495668_0017078_2377_3045 222
1970 3300046616 Ga0495668_0080460 Ga0495668_0080460_589_1257 222
1971 3300046642 Ga0495634_0159241 Ga0495634_0159241_521_1189 222
1972 3300046660 Ga0495625_0191251 Ga0495625_0191251_405_1073 222
1973 3300046663 Ga0495635_0005234 Ga0495635_0005234_2088_2756 222
1974 3300046663 Ga0495635_0077769 Ga0495635_0077769_752_1420 222
1975 3300046663 Ga0495635_0100310 Ga0495635_0100310_65_733 222
1976 3300046664 Ga0495659_0020141 Ga0495659_0020141_1184_1852 222
1977 3300046664 Ga0495659_0084452 Ga0495659_0084452_358_1026 222
1978 3300046665 Ga0495661_0083494 Ga0495661_0083494_583_1251 222
1979 3300046674 Ga0495588_0054325 Ga0495588_0054325_181_849 222
1980 3300046674 Ga0495588_0129982 Ga0495588_0129982_219_887 222
1981 3300046675 Ga0495657_0017047 Ga0495657_0017047_2820_3488 222
1982 3300046675 Ga0495657_0121845 Ga0495657_0121845_761_1429 222
1983 3300046678 Ga0495599_0001517 Ga0495599_0001517_5248_5916 222
1984 3300046679 Ga0495623_0010442 Ga0495623_0010442_417_1085 222
1985 3300046680 Ga0495646_0053802 Ga0495646_0053802_1347_2015 222
1986 3300046680 Ga0495646_0089427 Ga0495646_0089427_524_1192 222
1987 3300046680 Ga0495646_0120727 Ga0495646_0120727_751_1419 222
1988 3300046681 Ga0495647_0007975 Ga0495647_0007975_751_1419 222
1989 3300046681 Ga0495647_0118231 Ga0495647_0118231_398_1066 222
1990 3300046683 Ga0495658_0000324 Ga0495658_0000324_21756_22424 222
1991 3300046683 Ga0495658_0001251 Ga0495658_0001251_7012_7680 222
1992 3300046683 Ga0495658_0034851 Ga0495658_0034851_1721_2389 222
1993 3300046683 Ga0495658_0153880 Ga0495658_0153880_47_715 222
1994 3300046689 Ga0495613_0024143 Ga0495613_0024143_31_699 222
1995 3300046689 Ga0495613_0032639 Ga0495613_0032639_81_749 222
1996 3300046689 Ga0495613_0066624 Ga0495613_0066624_951_1619 222
1997 3300046689 Ga0495613_0320781 Ga0495613_0320781_139_807 222
1998 3300046690 Ga0495624_0003658 Ga0495624_0003658_9778_10446 222
1999 3300046690 Ga0495624_0032731 Ga0495624_0032731_1038_1706 222
2000 3300046691 Ga0495670_0001527 Ga0495670_0001527_3717_4385 222
2001 3300046691 Ga0495670_0003553 Ga0495670_0003553_216_884 222
2002 3300046691 Ga0495670_0070625 Ga0495670_0070625_483_1151 222
2003 3300046692 Ga0495671_0075170 Ga0495671_0075170_705_1373 222
2004 3300046694 Ga0495649_0131391 Ga0495649_0131391_281_949 222
2005 3300046809 Ga0495600_0001403 Ga0495600_0001403_9952_10620 222
2006 3300046810 Ga0495660_0211966 Ga0495660_0211966_56_724 222
2007 3300047315 Ga0495581_0002626 Ga0495581_0002626_3896_4564 222
2008 3300047315 Ga0495581_0131854 Ga0495581_0131854_160_828 222
2009 3300047317 Ga0495604_0004893 Ga0495604_0004893_2668_3336 222
2010 3300047319 Ga0495674_0198230 Ga0495674_0198230_16_684 222
2011 3300047321 Ga0495676_0025687 Ga0495676_0025687_4195_4863 222
2012 3300047321 Ga0495676_0058840 Ga0495676_0058840_1940_2608 222
2013 3300047321 Ga0495676_0067588 Ga0495676_0067588_1115_1783 222
2014 3300047321 Ga0495676_0191733 Ga0495676_0191733_115_783 222
2015 3300047321 Ga0495676_0305931 Ga0495676_0305931_354_1022 222
2016 3300047321 Ga0495676_0430290 Ga0495676_0430290_186_854 222
2017 3300047322 Ga0495680_0003143 Ga0495680_0003143_8104_8772 222
2018 3300047322 Ga0495680_0014232 Ga0495680_0014232_5913_6581 222
2019 3300047444 Ga0495675_0000855 Ga0495675_0000855_14553_15221 222
2020 3300047445 Ga0495677_0071328 Ga0495677_0071328_584_1252 222
2021 3300047445 Ga0495677_0154073 Ga0495677_0154073_182_850 222
2022 3300047470 Ga0495681_0182395 Ga0495681_0182395_77_745 222
2023 3300047470 Ga0495681_0211223 Ga0495681_0211223_67_735 222
2024 3300047471 Ga0495684_0000281 Ga0495684_0000281_32690_33358 222
2025 3300047471 Ga0495684_0050979 Ga0495684_0050979_740_1408 222
2026 3300047673 Ga0495593_0005567 Ga0495593_0005567_6635_7303 222
2027 3300047673 Ga0495593_0058970 Ga0495593_0058970_100_768 222
2028 3300047673 Ga0495593_0237457 Ga0495593_0237457_189_857 222
2029 3300048088 Ga0495602_0008505 Ga0495602_0008505_1352_2020 222
2030 3300048089 Ga0495614_0052143 Ga0495614_0052143_1072_1740 222
2031 3300048903 Ga0496100_0006797 Ga0496100_0006797_1891_2559 222
2032 3300048903 Ga0496100_0035404 Ga0496100_0035404_1978_2646 222
2033 3300048903 Ga0496100_0038192 Ga0496100_0038192_1734_2402 222
2034 3300048904 Ga0496101_0065606 Ga0496101_0065606_342_1010 222
2035 3300048904 Ga0496101_0073762 Ga0496101_0073762_1071_1739 222
2036 3300048904 Ga0496101_0137336 Ga0496101_0137336_764_1432 222
2037 3300048904 Ga0496101_0150727 Ga0496101_0150727_310_1011 222
2038 3300048905 Ga0496102_0039328 Ga0496102_0039328_2165_2833 222
2039 3300048905 Ga0496102_0312970 Ga0496102_0312970_376_1044 222
2040 3300048905 Ga0496102_0452617 Ga0496102_0452617_383_1051 222
2041 3300048906 Ga0496103_0001607 Ga0496103_0001607_6096_6764 222
2042 3300048906 Ga0496103_0008874 Ga0496103_0008874_2787_3455 222
2043 3300048906 Ga0496103_0247347 Ga0496103_0247347_176_844 222
2044 3300048907 Ga0496104_0000140 Ga0496104_0000140_59643_60311 222
2045 3300048907 Ga0496104_0043087 Ga0496104_0043087_1310_1978 222
2046 3300048907 Ga0496104_0051153 Ga0496104_0051153_2415_3083 222
2047 3300048907 Ga0496104_0147720 Ga0496104_0147720_525_1193 222
2048 3300048907 Ga0496104_0230587 Ga0496104_0230587_274_942 222
2049 3300048907 Ga0496104_0286580 Ga0496104_0286580_736_1404 222
2050 3300048907 Ga0496104_0842558 Ga0496104_0842558_143_811 222
2051 3300048908 Ga0496105_0003395 Ga0496105_0003395_3465_4133 222
2052 3300048908 Ga0496105_0004096 Ga0496105_0004096_6340_7008 222
2053 3300048908 Ga0496105_0005721 Ga0496105_0005721_2307_2975 222
2054 3300048908 Ga0496105_0029686 Ga0496105_0029686_127_795 222
2055 3300048908 Ga0496105_0039448 Ga0496105_0039448_2883_3551 222
2056 3300048908 Ga0496105_0134875 Ga0496105_0134875_1119_1787 222
2057 3300048908 Ga0496105_0190975 Ga0496105_0190975_988_1656 222
2058 3300048909 Ga0496106_0016830 Ga0496106_0016830_1953_2621 222
2059 3300048909 Ga0496106_0022791 Ga0496106_0022791_1940_2608 222
2060 3300048909 Ga0496106_0024379 Ga0496106_0024379_1891_2559 222
2061 3300048909 Ga0496106_0068016 Ga0496106_0068016_2029_2697 222
2062 3300048909 Ga0496106_0141367 Ga0496106_0141367_84_752 222
2063 3300048909 Ga0496106_0757888 Ga0496106_0757888_44_745 222
2064 3300048910 Ga0496107_0037797 Ga0496107_0037797_2283_2984 222
2065 3300048910 Ga0496107_0044607 Ga0496107_0044607_1137_1805 222
2066 3300048911 Ga0496108_0005933 Ga0496108_0005933_6752_7420 222
2067 3300048911 Ga0496108_0021157 Ga0496108_0021157_280_948 222
2068 3300048911 Ga0496108_0030567 Ga0496108_0030567_1587_2255 222
2069 3300048911 Ga0496108_0073646 Ga0496108_0073646_1309_1977 222
2070 3300048912 Ga0496109_0001484 Ga0496109_0001484_6752_7420 222
2071 3300048912 Ga0496109_0009665 Ga0496109_0009665_359_1027 222
2072 3300048912 Ga0496109_0014253 Ga0496109_0014253_3003_3671 222
2073 3300048912 Ga0496109_0015586 Ga0496109_0015586_3511_4179 222
2074 3300048912 Ga0496109_0049080 Ga0496109_0049080_1065_1733 222
2075 3300048912 Ga0496109_0139388 Ga0496109_0139388_1482_2150 222
2076 3300048912 Ga0496109_0214410 Ga0496109_0214410_15_683 222
2077 3300048913 Ga0496110_0010650 Ga0496110_0010650_1986_2699 222
2078 3300048913 Ga0496110_0038423 Ga0496110_0038423_1461_2129 222
2079 3300048913 Ga0496110_0038837 Ga0496110_0038837_1131_1799 222
2080 3300048913 Ga0496110_0069675 Ga0496110_0069675_1844_2512 222
2081 3300048913 Ga0496110_0095676 Ga0496110_0095676_1679_2347 222
2082 3300048914 Ga0496111_0008610 Ga0496111_0008610_3310_3978 222
2083 3300048914 Ga0496111_0033172 Ga0496111_0033172_947_1615 222
2084 3300048914 Ga0496111_0044205 Ga0496111_0044205_1145_1813 222
2085 3300048914 Ga0496111_0058814 Ga0496111_0058814_926_1594 222
2086 3300048914 Ga0496111_0405742 Ga0496111_0405742_224_892 222
2087 3300048915 Ga0496112_0003462 Ga0496112_0003462_6742_7410 222
2088 3300048915 Ga0496112_0022133 Ga0496112_0022133_3348_4016 222
2089 3300048915 Ga0496112_0043278 Ga0496112_0043278_858_1526 222
2090 3300048915 Ga0496112_0076231 Ga0496112_0076231_146_814 222
2091 3300048915 Ga0496112_0301211 Ga0496112_0301211_858_1526 222
2092 3300048915 Ga0496112_0306151 Ga0496112_0306151_751_1419 222
2093 3300048916 Ga0496113_0001986 Ga0496113_0001986_6767_7435 222
2094 3300048916 Ga0496113_0002230 Ga0496113_0002230_50_718 222
2095 3300048916 Ga0496113_0068686 Ga0496113_0068686_1742_2410 222
2096 3300048917 Ga0496114_0004604 Ga0496114_0004604_2849_3517 222
2097 3300048917 Ga0496114_0055281 Ga0496114_0055281_1937_2605 222
2098 3300048917 Ga0496114_0084639 Ga0496114_0084639_1024_1692 222
2099 3300048917 Ga0496114_0087165 Ga0496114_0087165_1782_2450 222
2100 3300048917 Ga0496114_0696351 Ga0496114_0696351_175_843 222
2101 3300048918 Ga0496115_0004832 Ga0496115_0004832_7542_8210 222
2102 3300048918 Ga0496115_0044173 Ga0496115_0044173_2147_2815 222
2103 3300048918 Ga0496115_0068541 Ga0496115_0068541_1916_2584 222
2104 3300048918 Ga0496115_0198918 Ga0496115_0198918_48_716 222
2105 3300049584 Ga0501068_0379234 Ga0501068_0379234_119_787 222
2106 3300049589 Ga0501073_0304200 Ga0501073_0304200_388_1056 222
2107 3300049593 Ga0501077_0036846 Ga0501077_0036846_1106_1774 222
2108 3300049593 Ga0501077_0160220 Ga0501077_0160220_305_973 222
2109 3300049743 Ga0501081_0019712 Ga0501081_0019712_1180_1848 222
2110 3300050490 nmdc:mga03n38_471871_c1 nmdc:mga03n38_471871_c1_20_688 222
2111 3300050490 nmdc:mga03n38_55404_c1 nmdc:mga03n38_55404_c1_954_1622 222
2112 3300050491 nmdc:mga00v17_107713_c1 nmdc:mga00v17_107713_c1_343_1011 222
2113 3300050492 nmdc:mga0yw44_261085_c1 nmdc:mga0yw44_261085_c1_94_795 222
2114 3300050492 nmdc:mga0yw44_46155_c1 nmdc:mga0yw44_46155_c1_515_1183 222
2115 3300050494 nmdc:mga06z11_134722_c1 nmdc:mga06z11_134722_c1_313_981 222
2116 3300050495 nmdc:mga04h51_45274_c1 nmdc:mga04h51_45274_c1_273_941 222
2117 3300050495 nmdc:mga04h51_90757_c1 nmdc:mga04h51_90757_c1_93_761 222
2118 3300050507 nmdc:mga05p37_198406_c1 nmdc:mga05p37_198406_c1_628_1341 222
2119 3300050507 nmdc:mga05p37_6398_c1 nmdc:mga05p37_6398_c1_7944_8612 222
2120 3300050507 nmdc:mga05p37_819_c2 nmdc:mga05p37_819_c2_496_1164 222
2121 3300050507 nmdc:mga05p37_88623_c1 nmdc:mga05p37_88623_c1_204_908 222
2122 3300050508 nmdc:mga09592_115995_c1 nmdc:mga09592_115995_c1_633_1337 222
2123 3300050508 nmdc:mga09592_324_c1 nmdc:mga09592_324_c1_16123_16791 222
2124 3300050509 nmdc:mga0qj67_457832_c1 nmdc:mga0qj67_457832_c1_105_809 222
2125 3300050509 nmdc:mga0qj67_656_c1 nmdc:mga0qj67_656_c1_7831_8499 222
2126 3300050510 nmdc:mga06r32_1450_c1 nmdc:mga06r32_1450_c1_7697_8365 222
2127 3300050510 nmdc:mga06r32_46283_c1 nmdc:mga06r32_46283_c1_684_1388 222
2128 3300050510 nmdc:mga06r32_527938_c1 nmdc:mga06r32_527938_c1_424_1125 222
2129 3300050510 nmdc:mga06r32_591433_c1 nmdc:mga06r32_591433_c1_297_1010 222
2130 3300050511 nmdc:mga08y16_4006_c1 nmdc:mga08y16_4006_c1_7284_7952 222
2131 3300050511 nmdc:mga08y16_46999_c1 nmdc:mga08y16_46999_c1_2938_3606 222
2132 3300050511 nmdc:mga08y16_490239_c1 nmdc:mga08y16_490239_c1_410_1078 222
2133 3300050511 nmdc:mga08y16_667045_c1 nmdc:mga08y16_667045_c1_235_903 222
2134 3300050511 nmdc:mga08y16_697_c1 nmdc:mga08y16_697_c1_7413_8081 222
2135 3300050511 nmdc:mga08y16_75750_c1 nmdc:mga08y16_75750_c1_857_1525 222
2136 3300050512 nmdc:mga0n895_10439_c1 nmdc:mga0n895_10439_c1_760_1428 222
2137 3300050512 nmdc:mga0n895_348965_c1 nmdc:mga0n895_348965_c1_222_890 222
2138 3300050512 nmdc:mga0n895_59412_c1 nmdc:mga0n895_59412_c1_836_1504 222
2139 3300050512 nmdc:mga0n895_61610_c1 nmdc:mga0n895_61610_c1_1976_2644 222
2140 3300050512 nmdc:mga0n895_96518_c1 nmdc:mga0n895_96518_c1_1135_1848 222
2141 3300050513 nmdc:mga0rr50_121519_c1 nmdc:mga0rr50_121519_c1_980_1648 222
2142 3300050513 nmdc:mga0rr50_340718_c1 nmdc:mga0rr50_340718_c1_113_781 222
2143 3300050513 nmdc:mga0rr50_3913_c1 nmdc:mga0rr50_3913_c1_7036_7704 222
2144 3300050513 nmdc:mga0rr50_92268_c1 nmdc:mga0rr50_92268_c1_170_838 222
2145 3300050514 nmdc:mga08x19_292391_c1 nmdc:mga08x19_292391_c1_51_719 222
2146 3300050514 nmdc:mga08x19_55533_c1 nmdc:mga08x19_55533_c1_1529_2197 222
2147 3300050515 nmdc:mga0a205_179713_c1 nmdc:mga0a205_179713_c1_1024_1737 222
2148 3300050515 nmdc:mga0a205_296237_c1 nmdc:mga0a205_296237_c1_102_770 222
2149 3300050515 nmdc:mga0a205_300502_c1 nmdc:mga0a205_300502_c1_648_1316 222
2150 3300050515 nmdc:mga0a205_47937_c1 nmdc:mga0a205_47937_c1_2491_3159 222
2151 3300050515 nmdc:mga0a205_6688_c1 nmdc:mga0a205_6688_c1_623_1291 222
2152 3300053077 Ga0495601_0004319 Ga0495601_0004319_7421_8089 222
2153 3300053077 Ga0495601_0005565 Ga0495601_0005565_1449_2117 222
2154 3300053077 Ga0495601_0047578 Ga0495601_0047578_41_709 222
2155 3300053077 Ga0495601_0056215 Ga0495601_0056215_528_1196 222
2156 3300053077 Ga0495601_0058237 Ga0495601_0058237_758_1426 222
2157 3300053077 Ga0495601_0148300 Ga0495601_0148300_180_899 222
2158 3300053078 Ga0495612_0001141 Ga0495612_0001141_716_1384 222
2159 3300053083 Ga0495655_0001970 Ga0495655_0001970_898_1566 222
2160 3300053083 Ga0495655_0020624 Ga0495655_0020624_784_1452 222
2161 3300053084 Ga0495595_0008760 Ga0495595_0008760_852_1520 222
2162 3300053084 Ga0495595_0013234 Ga0495595_0013234_2772_3440 222
2163 3300053084 Ga0495595_0126362 Ga0495595_0126362_196_864 222
2164 3300053084 Ga0495595_0151678 Ga0495595_0151678_136_804 222
2165 3300053085 Ga0495619_0000715 Ga0495619_0000715_18764_19432 222
2166 3300053085 Ga0495619_0001421 Ga0495619_0001421_692_1360 222
2167 3300053085 Ga0495619_0010802 Ga0495619_0010802_5062_5730 222
2168 3300054114 Ga0501084_0341349 Ga0501084_0341349_455_1123 222
2169 3300060353 Ga0501082_0774555 Ga0501082_0774555_41_709 222

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07021

MetW

Methionine biosynthesis protein MetW

24

218

0.98

PF13847

Methyltransf_31

Methyltransferase domain

34

179

0.89

PF08241

Methyltransf_11

Methyltransferase domain

41

128

0.88

PF13649

Methyltransf_25

Methyltransferase domain

40

127

0.87

PF13489

Methyltransf_23

Methyltransferase domain

16

188

0.78

PF08242

Methyltransf_12

Methyltransferase domain

41

126

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
7v6h-assembly2.cif.gz_B crystal structure of the spnl 0.8013 27 193
3ll7-assembly1.cif.gz_A crystal structure of putative methyltransferase pg_1098 from porphyromonas gingivalis w83 0.7881 25 134
3l8d-assembly1.cif.gz_A-2 crystal structure of methyltransferase from bacillus thuringiensis 0.7661 27 222
2jjq-assembly1.cif.gz_A the crystal structure of pyrococcus abyssi trna (uracil-54, c5)- methyltransferase in complex with s-adenosyl-l-homocysteine 0.7365 27 219
7wm6-assembly1.cif.gz_B crystal structure of sah-bound trmm from mycoplasma capricolum 0.7351 26 222
ID Description Score Start End Superfamily
af_I6X9X6_5_255_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8553 28 125 3.40.50.150
af_I6X5U4_8_196_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8541 25 125 3.40.50.150
af_K7MPH7_12_143_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.849 36 106 3.40.50.150
af_Q9VBZ6_765_943_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.8438 61 84 3.40.50.1010
af_A0A0P0Y1E1_35_188_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8433 26 125 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A522W3Z1-F1-model_v4 Methyltransferase domain-containing protein 0.9986 24 128 GO:0008168
GO:0032259
AF-A0A7V1LIJ9-F1-model_v4 Methyltransferase domain-containing protein 0.9969 26 89 GO:0008168
GO:0032259
AF-A0A382NZD8-F1-model_v4 Methyltransferase domain-containing protein 0.9837 24 95
AF-A0A519IUE6-F1-model_v4 Methyltransferase domain-containing protein 0.9803 26 138 GO:0008168
GO:0032259
AF-A0A537R062-F1-model_v4 Methyltransferase domain-containing protein 0.9757 21 125 GO:0008168
GO:0032259

Feature Viewer

pLDDT pTM Quality
84.07 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map