F496476

General Info

Members Datasets Scaffolds Average Seq Length
2154 723 2014 250

Family's Representative Sequence

Representative Sequence 3300035695|Ga0373927_0178274|Ga0373927_0178274_131_1030
Length 299
Sequence MRLSNWSIAASYDTARIFAGLGFGSSRPDRASSEQESLMKEADVLAKAFAMPLTSPAFPPGPYRFVNREFLIITYRTDPERLRAVVPEPLEVAEPLVKYEFIRMPDSTGFGDYTETGQVIPVSFRGKRGGYTHCMFLNDEPPIAGGRELWGFPKKLANPSLRTEIDMLVGTLDYGPVRVATATMGYKHKRADLAATKAALSTPNFLLKIIPHVDGSARICELVEYYLEDITIKGAWTGPGALSLSPHAMAPVAELPVLEVVSAVHILSDLTLGLGKVVHDYLAPIAQQPARGKEKAHAS

Samples

Sample ID Description Type Environment
1 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
2 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
3 2512875024 Mesorhizobium loti R88b Isolate Nodule
4 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
5 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
6 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
7 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
8 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
9 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
10 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
11 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
12 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
13 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
14 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
15 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
16 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
17 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
18 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
19 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
20 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
21 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
22 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
23 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
24 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
25 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
26 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
27 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
28 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
29 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
30 2643221607 Rhizobium sp. Root73 Isolate Unclassified
31 2643221609 Acidovorax sp. Root217 Isolate Unclassified
32 2643221611 Acidovorax sp. Root219 Isolate Unclassified
33 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
34 2643221658 Variovorax sp. Root411 Isolate Unclassified
35 2643221672 Variovorax sp. Root434 Isolate Unclassified
36 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
37 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
38 2687453130 Dyella thiooxydans ATSB10 Isolate Unclassified
39 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
40 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
41 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
42 2738541277 Variovorax sp. GV051 Isolate Unclassified
43 2738541307 Variovorax sp. GV008 Isolate Unclassified
44 2738543013 Variovorax sp. BT01 Isolate Unclassified
45 2738543019 Variovorax sp. GV040 Isolate Unclassified
46 2739367700 Dyella sp. YR388 Isolate Unclassified
47 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
48 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
49 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
50 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
51 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
52 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
53 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
54 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
55 2818991446 Variovorax sp. 1180 Isolate Unclassified
56 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
57 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
58 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
59 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
60 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
61 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
62 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
63 2846033681 Chromobacterium sinusclupearum MWU13-2610 Isolate Rhizosphere
64 2846037992 Chromobacterium alticapitis MWU14-2602 Isolate Rhizosphere
65 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
66 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
67 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
68 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
69 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
70 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
71 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
72 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
73 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
74 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
75 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
76 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
77 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
78 2884411467 Dyella sp. AD56 Isolate Rhizosphere
79 2885198086 Variovorax sp. 679 Isolate Unclassified
80 2885211737 Variovorax sp. 553 Isolate Unclassified
81 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
82 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
83 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
84 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
85 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
86 2899924645 Variovorax sp. 369 Isolate Unclassified
87 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
88 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
89 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
90 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
91 2928037797 Variovorax sp. 1126 Isolate Unclassified
92 2928044640 Variovorax sp. 1128 Isolate Unclassified
93 2928051484 Variovorax sp. 1133 Isolate Unclassified
94 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
95 2928070936 Variovorax gossypii 1167 Isolate Unclassified
96 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
97 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
98 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
99 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
100 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
101 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
102 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
103 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
104 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
105 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
106 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
107 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
108 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
109 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
110 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
111 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
112 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
113 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
114 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
115 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
116 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
117 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
118 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
119 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
120 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
121 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
122 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
123 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
124 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
125 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
126 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
127 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
128 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
129 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
130 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
131 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
132 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
133 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
134 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
135 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
136 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
137 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
138 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
139 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
140 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
141 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
142 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
143 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
144 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
145 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
146 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
147 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
148 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
149 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
150 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
151 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
152 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
153 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
154 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
155 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
156 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
157 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
158 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
159 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
160 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
161 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
162 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
163 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
164 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
165 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
166 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
167 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
168 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
169 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
170 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
171 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
172 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
173 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
174 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
175 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
176 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
177 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
178 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
179 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
180 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
181 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
182 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
183 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
184 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
185 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
186 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
187 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
188 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
189 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
190 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
191 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
192 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
193 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
194 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
195 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
196 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
197 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
198 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
199 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
200 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
201 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
202 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
203 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
204 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
205 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
206 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
207 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
208 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
209 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
210 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
211 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
212 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
213 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
214 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
215 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
216 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
217 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
218 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
219 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
220 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
221 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
222 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
223 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
224 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
225 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
226 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
227 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
228 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
229 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
230 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
231 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
232 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
233 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
234 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
235 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
236 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
237 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
238 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
239 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
240 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
241 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
242 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
243 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
244 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
245 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
246 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
247 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
248 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
249 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
250 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
251 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
252 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
253 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
254 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
255 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
256 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
257 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
258 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
259 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
260 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
261 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
262 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
263 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
264 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
265 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
266 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
267 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
268 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
269 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
270 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
271 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
272 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
273 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
274 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
275 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
276 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
277 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
278 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
279 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
280 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
281 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
282 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
283 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
284 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
285 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
286 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
287 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
288 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
289 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
290 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
291 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
292 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
293 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
294 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
295 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
296 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
297 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
298 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
299 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
300 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
301 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
302 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
303 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
304 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
305 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
306 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
307 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
308 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
309 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
310 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
311 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
312 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
313 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
314 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
315 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
316 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
317 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
318 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
319 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
320 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
321 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
322 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
323 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
324 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
325 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
326 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
327 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
334 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
335 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
336 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
337 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
338 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
339 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
340 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
341 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
342 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
343 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
344 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
345 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
346 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
347 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
348 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
349 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
350 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
351 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
352 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
353 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
354 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
355 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
356 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
357 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
358 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
359 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
360 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
361 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
362 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
363 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
364 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
365 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
366 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
367 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
368 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
369 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
370 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
371 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
372 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
373 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
374 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
375 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
376 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
377 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
378 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
379 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
380 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
381 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
382 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
383 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
384 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
385 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
386 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
387 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
388 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
389 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
390 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
391 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
392 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
393 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
394 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
395 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
396 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
397 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
398 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
399 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
400 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
401 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
402 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
403 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
404 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
405 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
406 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
407 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
408 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
409 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
410 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
411 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
412 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
413 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
414 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
415 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
416 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
417 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
418 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
419 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
420 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
421 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
422 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
423 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
424 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
425 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
426 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
427 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
428 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
429 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
430 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
431 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
432 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
433 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
434 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
435 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
436 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
437 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
438 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
439 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
440 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
441 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
442 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
443 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
444 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
445 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
446 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
447 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
448 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
449 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
450 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
451 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
452 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
453 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
454 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
455 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
456 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
457 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
458 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
459 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
460 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
461 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
462 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
463 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
464 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
465 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
466 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
467 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
468 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
469 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
470 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
471 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
472 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
473 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
474 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
475 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
476 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
477 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
478 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
479 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
480 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
481 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
482 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
483 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
484 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
485 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
486 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
487 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
488 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
489 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
490 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
491 3300044661 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COC2E Metagenome Unclassified
492 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
493 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
494 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
495 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
496 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
497 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
498 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
499 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
500 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
501 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
502 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
503 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
504 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
505 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
506 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
507 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
508 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
509 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
510 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
511 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
512 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
513 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
514 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
515 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
516 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
517 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
518 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
519 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
520 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
521 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
522 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
523 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
524 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
525 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
526 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
527 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
528 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
529 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
530 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
531 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
532 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
533 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
534 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
535 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
536 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
537 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
538 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
539 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
540 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
541 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
542 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
543 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
544 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
545 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
546 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
547 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
548 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
549 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
550 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
551 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
552 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
553 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
554 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
555 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
556 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
557 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
558 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
559 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
560 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
561 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
562 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
563 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
564 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
565 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
566 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
567 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
568 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
569 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
570 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
571 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
572 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
573 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
574 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
575 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
576 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
577 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
578 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
579 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
580 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
581 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
582 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
583 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
584 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
585 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
586 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
587 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
588 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
589 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
590 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
591 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
592 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
593 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
594 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
595 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
596 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
597 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
598 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
599 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
600 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
601 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
602 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
603 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
604 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
605 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
606 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
607 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
608 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
609 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
610 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
611 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
612 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
613 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
614 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
615 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
616 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
617 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
618 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
619 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
620 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
621 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
622 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
623 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
624 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
625 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
626 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
627 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
628 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
629 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
630 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
631 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
632 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
633 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
634 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
635 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
636 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
637 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
638 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
639 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
640 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
641 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
642 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
643 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
644 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
645 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
646 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
647 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
648 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
649 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
650 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
651 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
652 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
653 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
654 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
655 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
656 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
657 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
658 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
659 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
660 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
661 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
662 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
663 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
664 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
665 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
666 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
667 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
668 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
669 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
670 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
671 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
672 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
673 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
674 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
675 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
676 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
677 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
678 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
679 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
680 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
681 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
682 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
683 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
684 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
685 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
686 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
687 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
688 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
689 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
690 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
691 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
692 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
693 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
694 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
695 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
696 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
697 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
698 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
699 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
700 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
701 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
702 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
703 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
704 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
705 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
706 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
707 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
708 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
709 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
710 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
711 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
712 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
713 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
714 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
715 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
716 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
717 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
718 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
719 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
720 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
721 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
722 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
723 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.36
Metatranscriptomes 0.14
Isolates 6.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.64
Nodule 3.3
Rhizoplane 8.08
Rhizosphere 73.91
Stem 0
Stem Tuber 0
Unclassified 6.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10012904 3300001979 Bacteria 3138
2 JGI24740J21852_10032676 3300001979 Bacteria 1661
3 JGI24739J22299_10004123 3300001989 Bacteria 5557
4 JGI24737J22298_10006525 3300001990 Bacteria 3980
5 JGI24743J22301_10014960 3300001991 Bacteria 1434
6 JGI24735J21928_10036930 3300002067 Bacteria 1433
7 JGI24738J21930_10009674 3300002075 Bacteria 2163
8 JGI24751J29686_10007247 3300002459 Bacteria 2265
9 JGI25156J39149_1003850 3300002705 Bacteria 4770
10 JGI25162J39368_1000206 3300002737 Bacteria 62562
11 JGI25158J39367_1002019 3300002739 Bacteria 3413
12 JGI25157J39369_1000292 3300002741 Bacteria 36468
13 JGI25157J39369_1001420 3300002741 Bacteria 9117
14 JGI25163J39215_1004145 3300002771 Bacteria 1054
15 JGI25164J39214_1000091 3300002772 Bacteria 90400
16 JGI25150J39212_1002312 3300002774 Bacteria 4796
17 JGI25150J39212_1011368 3300002774 Bacteria 1618
18 JGI25159J45721_1016148 3300002987 Bacteria 1607
19 JGI25151J46595_10008596 3300003187 Bacteria 4895
20 JGI25406J46586_10000109 3300003203 Bacteria 36339
21 JGI25165J46597_1000196 3300003214 Bacteria 90400
22 JGI25153J46596_10000138 3300003215 Bacteria 75653
23 rootL2_10002585 3300003322 Bacteria 5796
24 JGI25160J50197_1026311 3300003354 Bacteria 1607
25 JGI25161J50226_1006439 3300003374 Bacteria 2123
26 JGI25161J50226_1008356 3300003374 Bacteria 1604
27 Ga0006562J51391_1102710 3300003578 Bacteria 3980
28 Ga0006562J51391_1102711 3300003578 Bacteria 3860
29 Ga0055532_1009791 3300003758 Bacteria 1157
30 Ga0055535_1000240 3300003761 Bacteria 57957
31 Ga0055535_1004621 3300003761 Bacteria 3275
32 Ga0055542_1000027 3300003762 Bacteria 254819
33 Ga0055542_1000244 3300003762 Bacteria 62562
34 Ga0055529_1000170 3300003763 Bacteria 90400
35 Ga0055526_1029740 3300003771 Bacteria 1612
36 Ga0055526_1029826 3300003771 Bacteria 1607
37 Ga0055537_1002045 3300003773 Bacteria 7119
38 Ga0055537_1012862 3300003773 Bacteria 1607
39 Ga0055524_1029525 3300003775 Bacteria 1618
40 Ga0055524_1029734 3300003775 Bacteria 1607
41 Ga0055536_1038424 3300003781 Bacteria 1160
42 Ga0055534_1004617 3300003784 Bacteria 3923
43 Ga0055534_1013090 3300003784 Bacteria 1607
44 Ga0055528_1027366 3300003790 Bacteria 1607
45 Ga0055530_10001422 3300003791 Bacteria 17574
46 Ga0055540_1001616 3300003792 Bacteria 13119
47 Ga0055540_1022181 3300003792 Bacteria 1630
48 Ga0055540_1030708 3300003792 Bacteria 1243
49 Ga0055531_10002054 3300003794 Bacteria 13887
50 Ga0055531_10007043 3300003794 Bacteria 6223
51 Ga0055531_10013026 3300003794 Bacteria 3864
52 JGI25405J52794_10002173 3300003911 Bacteria 3340
53 JGI25405J52794_10028101 3300003911 Bacteria 1160
54 Ga0055543_1012645 3300004625 Bacteria 1688
55 Ga0065165_1004603 3300005262 Bacteria 8396
56 Ga0065165_1032220 3300005262 Bacteria 1645
57 Ga0065715_10174933 3300005293 Bacteria 1518
58 Ga0065715_10179887 3300005293 Bacteria 1484
59 Ga0070676_10001076 3300005328 Bacteria 13611
60 Ga0070676_10010057 3300005328 Bacteria 5123
61 Ga0070676_10053861 3300005328 Bacteria 2370
62 Ga0070683_100083307 3300005329 Bacteria 2996
63 Ga0070683_100151277 3300005329 Bacteria 2201
64 Ga0070683_100220248 3300005329 Bacteria 1804
65 Ga0070690_100044632 3300005330 Bacteria 2814
66 Ga0070690_100051000 3300005330 Bacteria 2640
67 Ga0070690_100328804 3300005330 Bacteria 1104
68 Ga0070670_100017710 3300005331 Bacteria 6111
69 Ga0070670_100054601 3300005331 Bacteria 3430
70 Ga0070670_100059727 3300005331 Bacteria 3273
71 Ga0070670_100123587 3300005331 Bacteria 2233
72 Ga0070670_100134931 3300005331 Bacteria 2133
73 Ga0070670_100363219 3300005331 Bacteria 1273
74 Ga0070670_100637856 3300005331 Bacteria 955
75 Ga0070677_10000906 3300005333 Bacteria 9732
76 Ga0070677_10033973 3300005333 Bacteria 1967
77 Ga0068869_100126293 3300005334 Bacteria 1962
78 Ga0068869_100131958 3300005334 Bacteria 1921
79 Ga0068869_100206735 3300005334 Bacteria 1550
80 Ga0068869_100262234 3300005334 Bacteria 1384
81 Ga0068869_100317763 3300005334 Bacteria 1262
82 Ga0070666_10000771 3300005335 Bacteria 19371
83 Ga0070666_10019311 3300005335 Bacteria 4397
84 Ga0070666_10057858 3300005335 Bacteria 2621
85 Ga0070666_10122633 3300005335 Bacteria 1803
86 Ga0070666_10144552 3300005335 Bacteria 1657
87 Ga0070666_10255303 3300005335 Bacteria 1242
88 Ga0070680_100001629 3300005336 Bacteria 16406
89 Ga0070680_100034336 3300005336 Bacteria 4089
90 Ga0070680_100272839 3300005336 Bacteria 1432
91 Ga0070682_100010513 3300005337 Bacteria 5252
92 Ga0070682_100059155 3300005337 Bacteria 2419
93 Ga0068868_100000959 3300005338 Bacteria 19639
94 Ga0068868_100011665 3300005338 Bacteria 6402
95 Ga0068868_100077654 3300005338 Bacteria 2656
96 Ga0068868_100231766 3300005338 Bacteria 1549
97 Ga0068868_100497539 3300005338 Bacteria 1067
98 Ga0070660_100001625 3300005339 Bacteria 15452
99 Ga0070660_100023576 3300005339 Bacteria 4559
100 Ga0070660_100126476 3300005339 Bacteria 2042
101 Ga0070660_100231192 3300005339 Bacteria 1505
102 Ga0070660_100245549 3300005339 Bacteria 1459
103 Ga0070660_100668480 3300005339 Bacteria 870
104 Ga0070689_100002174 3300005340 Bacteria 12697
105 Ga0070689_100020981 3300005340 Bacteria 4856
106 Ga0070689_100188744 3300005340 Bacteria 1677
107 Ga0070689_100424010 3300005340 Bacteria 1128
108 Ga0070691_10002284 3300005341 Bacteria 8489
109 Ga0070691_10003094 3300005341 Bacteria 7459
110 Ga0070691_10118629 3300005341 Bacteria 1330
111 Ga0070691_10218679 3300005341 Bacteria 1009
112 Ga0070687_100006156 3300005343 Bacteria 4901
113 Ga0070687_100022431 3300005343 Bacteria 2985
114 Ga0070687_100042113 3300005343 Bacteria 2312
115 Ga0070661_100020671 3300005344 Bacteria 4695
116 Ga0070661_100079819 3300005344 Bacteria 2415
117 Ga0070661_100088953 3300005344 Bacteria 2287
118 Ga0070661_100578633 3300005344 Bacteria 906
119 Ga0070692_10008674 3300005345 Bacteria 4544
120 Ga0070692_10101428 3300005345 Bacteria 1578
121 Ga0070668_100002125 3300005347 Bacteria 14489
122 Ga0070668_100055757 3300005347 Bacteria 3051
123 Ga0070668_100236655 3300005347 Bacteria 1511
124 Ga0070668_100639979 3300005347 Bacteria 933
125 Ga0070669_100012580 3300005353 Bacteria 6002
126 Ga0070669_100111605 3300005353 Bacteria 2075
127 Ga0070675_100007594 3300005354 Bacteria 8389
128 Ga0070675_100077454 3300005354 Bacteria 2767
129 Ga0070675_100195169 3300005354 Bacteria 1756
130 Ga0070671_100001958 3300005355 Bacteria 15779
131 Ga0070671_100005139 3300005355 Bacteria 10414
132 Ga0070671_100021914 3300005355 Bacteria 5219
133 Ga0070671_100037163 3300005355 Bacteria 4038
134 Ga0070671_100097817 3300005355 Bacteria 2461
135 Ga0070671_100369505 3300005355 Bacteria 1225
136 Ga0070671_100455674 3300005355 Bacteria 1097
137 Ga0070671_100496415 3300005355 Bacteria 1050
138 Ga0070671_100665177 3300005355 Bacteria 902
139 Ga0070674_100021328 3300005356 Bacteria 4155
140 Ga0070674_100023394 3300005356 Bacteria 3999
141 Ga0070674_100090867 3300005356 Bacteria 2203
142 Ga0070673_100000442 3300005364 Bacteria 21910
143 Ga0070673_100005099 3300005364 Bacteria 8383
144 Ga0070673_100010089 3300005364 Bacteria 6375
145 Ga0070673_100057174 3300005364 Bacteria 3081
146 Ga0070688_100002832 3300005365 Bacteria 8832
147 Ga0070688_100096067 3300005365 Bacteria 1946
148 Ga0070688_100098712 3300005365 Bacteria 1922
149 Ga0070659_100045435 3300005366 Bacteria 3441
150 Ga0070659_100122458 3300005366 Bacteria 2108
151 Ga0070659_100128238 3300005366 Bacteria 2059
152 Ga0070659_100136618 3300005366 Bacteria 1994
153 Ga0070659_100591571 3300005366 Bacteria 953
154 Ga0070667_100001863 3300005367 Bacteria 18741
155 Ga0070667_100014818 3300005367 Bacteria 6440
156 Ga0070667_100017211 3300005367 Bacteria 5988
157 Ga0070667_100026157 3300005367 Bacteria 4853
158 Ga0070667_100061205 3300005367 Bacteria 3187
159 Ga0070667_100068578 3300005367 Bacteria 3018
160 Ga0070667_100354413 3300005367 Bacteria 1329
161 Ga0070667_100759820 3300005367 Bacteria 899
162 Ga0070709_10158197 3300005434 Bacteria 1573
163 Ga0070709_10225958 3300005434 Bacteria 1337
164 Ga0070709_10227137 3300005434 Bacteria 1334
165 Ga0070709_10590191 3300005434 Bacteria 854
166 Ga0070714_100027101 3300005435 Bacteria 4741
167 Ga0070714_100058694 3300005435 Bacteria 3298
168 Ga0070714_100313801 3300005435 Bacteria 1464
169 Ga0070714_100366833 3300005435 Bacteria 1355
170 Ga0070714_100714857 3300005435 Bacteria 967
171 Ga0070714_100752682 3300005435 Bacteria 942
172 Ga0070713_100002048 3300005436 Bacteria 13024
173 Ga0070713_100030071 3300005436 Bacteria 4309
174 Ga0070713_100031008 3300005436 Bacteria 4252
175 Ga0070713_100056432 3300005436 Bacteria 3267
176 Ga0070713_100213872 3300005436 Bacteria 1746
177 Ga0070710_10005027 3300005437 Bacteria 6257
178 Ga0070710_10011078 3300005437 Bacteria 4446
179 Ga0070710_10038609 3300005437 Bacteria 2623
180 Ga0070710_10127476 3300005437 Bacteria 1548
181 Ga0070710_10212105 3300005437 Bacteria 1228
182 Ga0070701_10003125 3300005438 Bacteria 6498
183 Ga0070711_100054396 3300005439 Bacteria 2762
184 Ga0070711_100092229 3300005439 Bacteria 2185
185 Ga0070711_100158837 3300005439 Bacteria 1712
186 Ga0070705_100042571 3300005440 Bacteria 2597
187 Ga0070700_100002787 3300005441 Bacteria 8951
188 Ga0070700_100033480 3300005441 Bacteria 3095
189 Ga0070700_100040107 3300005441 Bacteria 2865
190 Ga0070700_100041474 3300005441 Bacteria 2822
191 Ga0070694_100000595 3300005444 Bacteria 19911
192 Ga0070694_100309251 3300005444 Bacteria 1213
193 Ga0070708_100223967 3300005445 Bacteria 1764
194 Ga0070663_100003107 3300005455 Bacteria 9503
195 Ga0070663_100015907 3300005455 Bacteria 4870
196 Ga0070663_100079064 3300005455 Bacteria 2412
197 Ga0070663_100134289 3300005455 Bacteria 1883
198 Ga0070663_100159377 3300005455 Bacteria 1736
199 Ga0070663_100308750 3300005455 Bacteria 1268
200 Ga0070678_100000215 3300005456 Bacteria 25885
201 Ga0070678_100004266 3300005456 Bacteria 8080
202 Ga0070678_100008229 3300005456 Bacteria 6235
203 Ga0070678_100011272 3300005456 Bacteria 5507
204 Ga0070678_100053981 3300005456 Bacteria 2925
205 Ga0070678_100060037 3300005456 Bacteria 2797
206 Ga0070678_100122785 3300005456 Bacteria 2051
207 Ga0070678_100213426 3300005456 Bacteria 1601
208 Ga0070662_100010721 3300005457 Bacteria 6033
209 Ga0070662_100014380 3300005457 Bacteria 5286
210 Ga0070662_100031178 3300005457 Bacteria 3739
211 Ga0070662_100038716 3300005457 Bacteria 3387
212 Ga0070662_100065447 3300005457 Bacteria 2665
213 Ga0070662_100106670 3300005457 Bacteria 2128
214 Ga0070681_10082645 3300005458 Bacteria 3167
215 Ga0070681_10093631 3300005458 Bacteria 2953
216 Ga0070681_10094477 3300005458 Bacteria 2939
217 Ga0070681_10101983 3300005458 Bacteria 2815
218 Ga0070681_10361197 3300005458 Bacteria 1362
219 Ga0068867_100036112 3300005459 Bacteria 3585
220 Ga0068867_100045590 3300005459 Bacteria 3216
221 Ga0068867_100070292 3300005459 Bacteria 2617
222 Ga0068867_100082462 3300005459 Bacteria 2426
223 Ga0068867_100171239 3300005459 Bacteria 1720
224 Ga0070685_10004693 3300005466 Bacteria 6912
225 Ga0070685_10032285 3300005466 Bacteria 2932
226 Ga0070685_10036946 3300005466 Bacteria 2764
227 Ga0070685_10222199 3300005466 Bacteria 1238
228 Ga0070707_100042202 3300005468 Bacteria 4366
229 Ga0070707_100237718 3300005468 Bacteria 1773
230 Ga0070698_100233320 3300005471 Bacteria 1773
231 Ga0070698_100349070 3300005471 Bacteria 1411
232 Ga0070698_100533648 3300005471 Bacteria 1112
233 Ga0070698_100832924 3300005471 Bacteria 867
234 Ga0070699_100393593 3300005518 Bacteria 1252
235 Ga0070679_100000826 3300005530 Bacteria 26921
236 Ga0070679_100030613 3300005530 Bacteria 5313
237 Ga0070684_100040401 3300005535 Bacteria 4016
238 Ga0070684_100105393 3300005535 Bacteria 2523
239 Ga0070697_100091284 3300005536 Bacteria 2518
240 Ga0070697_100147403 3300005536 Bacteria 1982
241 Ga0068853_100003115 3300005539 Bacteria 12681
242 Ga0068853_100003807 3300005539 Bacteria 11561
243 Ga0068853_100088892 3300005539 Bacteria 2713
244 Ga0068853_100104022 3300005539 Bacteria 2513
245 Ga0068853_100427981 3300005539 Bacteria 1242
246 Ga0070672_100020422 3300005543 Bacteria 4831
247 Ga0070672_100040425 3300005543 Bacteria 3578
248 Ga0070672_100124444 3300005543 Bacteria 2113
249 Ga0070686_100005706 3300005544 Bacteria 6899
250 Ga0070686_100222581 3300005544 Bacteria 1364
251 Ga0070695_100004124 3300005545 Bacteria 8486
252 Ga0070695_100061139 3300005545 Bacteria 2443
253 Ga0070695_100076651 3300005545 Bacteria 2202
254 Ga0070696_100001676 3300005546 Bacteria 14514
255 Ga0070696_100073684 3300005546 Bacteria 2406
256 Ga0070696_100086458 3300005546 Bacteria 2226
257 Ga0070696_100091356 3300005546 Bacteria 2168
258 Ga0070693_100039884 3300005547 Bacteria 2633
259 Ga0070693_100049929 3300005547 Bacteria 2389
260 Ga0070665_100005678 3300005548 Bacteria 12823
261 Ga0070665_100027499 3300005548 Bacteria 5729
262 Ga0070665_100027676 3300005548 Bacteria 5709
263 Ga0070665_100042906 3300005548 Bacteria 4547
264 Ga0070665_100061603 3300005548 Bacteria 3761
265 Ga0070665_100144919 3300005548 Bacteria 2378
266 Ga0070665_100160882 3300005548 Bacteria 2247
267 Ga0070665_100315808 3300005548 Bacteria 1566
268 Ga0070665_100493309 3300005548 Bacteria 1236
269 Ga0070704_100005192 3300005549 Bacteria 7574
270 Ga0070704_100051974 3300005549 Bacteria 2889
271 Ga0070704_100095045 3300005549 Bacteria 2231
272 Ga0070704_100198214 3300005549 Bacteria 1619
273 Ga0068855_100000006 3300005563 Bacteria 298092
274 Ga0068855_100010320 3300005563 Bacteria 11263
275 Ga0068855_100014521 3300005563 Bacteria 9486
276 Ga0068855_100022575 3300005563 Bacteria 7540
277 Ga0068855_100090949 3300005563 Bacteria 3521
278 Ga0068855_100195661 3300005563 Bacteria 2278
279 Ga0068855_100209445 3300005563 Bacteria 2191
280 Ga0070664_100002944 3300005564 Bacteria 13770
281 Ga0070664_100052959 3300005564 Bacteria 3439
282 Ga0070664_100091158 3300005564 Bacteria 2639
283 Ga0070664_100121996 3300005564 Bacteria 2283
284 Ga0070664_100268029 3300005564 Bacteria 1538
285 Ga0070664_100292157 3300005564 Bacteria 1472
286 Ga0068857_100005947 3300005577 Bacteria 10421
287 Ga0068857_100057421 3300005577 Bacteria 3454
288 Ga0068857_100144922 3300005577 Bacteria 2149
289 Ga0068857_100147209 3300005577 Bacteria 2131
290 Ga0068857_100210765 3300005577 Bacteria 1773
291 Ga0068857_100325061 3300005577 Bacteria 1421
292 Ga0068854_100001059 3300005578 Bacteria 16545
293 Ga0068854_100031269 3300005578 Bacteria 3698
294 Ga0068854_100082779 3300005578 Bacteria 2372
295 Ga0068854_100148639 3300005578 Bacteria 1804
296 Ga0068854_100348624 3300005578 Bacteria 1211
297 Ga0068856_100003185 3300005614 Bacteria 16706
298 Ga0068856_100022065 3300005614 Bacteria 6190
299 Ga0068856_100108999 3300005614 Bacteria 2765
300 Ga0068856_100643554 3300005614 Bacteria 1081
301 Ga0068856_100883277 3300005614 Bacteria 913
302 Ga0070702_100000687 3300005615 Bacteria 12724
303 Ga0070702_100043939 3300005615 Bacteria 2520
304 Ga0070702_100078173 3300005615 Bacteria 1974
305 Ga0070702_100334954 3300005615 Bacteria 1060
306 Ga0068852_100020557 3300005616 Bacteria 5251
307 Ga0068852_100043703 3300005616 Bacteria 3801
308 Ga0068852_100083412 3300005616 Bacteria 2842
309 Ga0068852_100103802 3300005616 Bacteria 2571
310 Ga0068852_100111122 3300005616 Bacteria 2491
311 Ga0068852_100242972 3300005616 Bacteria 1722
312 Ga0068859_100000201 3300005617 Bacteria 58643
313 Ga0068859_100072290 3300005617 Bacteria 3486
314 Ga0068859_100209228 3300005617 Bacteria 2037
315 Ga0068859_100231358 3300005617 Bacteria 1936
316 Ga0068864_100010491 3300005618 Bacteria 7655
317 Ga0068864_100091443 3300005618 Bacteria 2684
318 Ga0068864_100642291 3300005618 Bacteria 1033
319 Ga0068866_10027071 3300005718 Bacteria 2714
320 Ga0068866_10041605 3300005718 Bacteria 2281
321 Ga0068866_10131879 3300005718 Bacteria 1422
322 Ga0068861_100012217 3300005719 Bacteria 5987
323 Ga0068861_100114174 3300005719 Bacteria 2168
324 Ga0068861_100427390 3300005719 Bacteria 1182
325 Ga0068851_10000810 3300005834 Bacteria 13514
326 Ga0068851_10005149 3300005834 Bacteria 5931
327 Ga0068851_10029940 3300005834 Bacteria 2697
328 Ga0068851_10033102 3300005834 Bacteria 2575
329 Ga0068851_10074037 3300005834 Bacteria 1767
330 Ga0068851_10074447 3300005834 Bacteria 1763
331 Ga0068870_10005298 3300005840 Bacteria 5620
332 Ga0068870_10039314 3300005840 Bacteria 2447
333 Ga0068863_100003050 3300005841 Bacteria 16553
334 Ga0068863_100084376 3300005841 Bacteria 3010
335 Ga0068863_100128804 3300005841 Bacteria 2415
336 Ga0068863_100139575 3300005841 Bacteria 2316
337 Ga0068863_100141028 3300005841 Bacteria 2303
338 Ga0068863_100152338 3300005841 Bacteria 2213
339 Ga0068863_100192168 3300005841 Bacteria 1962
340 Ga0068863_100644988 3300005841 Bacteria 1050
341 Ga0068858_100018757 3300005842 Bacteria 6471
342 Ga0068858_100036953 3300005842 Bacteria 4528
343 Ga0068858_100037916 3300005842 Bacteria 4470
344 Ga0068858_100042053 3300005842 Bacteria 4237
345 Ga0068858_100670090 3300005842 Bacteria 1008
346 Ga0068860_100028773 3300005843 Bacteria 5347
347 Ga0068860_100116190 3300005843 Bacteria 2560
348 Ga0068860_100313591 3300005843 Bacteria 1538
349 Ga0068862_100000245 3300005844 Bacteria 60375
350 Ga0068862_100007454 3300005844 Bacteria 9070
351 Ga0068862_100013738 3300005844 Bacteria 6711
352 Ga0068862_100023866 3300005844 Bacteria 5127
353 Ga0081455_10000087 3300005937 Bacteria 99627
354 Ga0081455_10001860 3300005937 Bacteria 25395
355 Ga0081455_10002592 3300005937 Bacteria 21435
356 Ga0081455_10009744 3300005937 Bacteria 9841
357 Ga0081455_10031798 3300005937 Bacteria 4767
358 Ga0081455_10032303 3300005937 Bacteria 4719
359 Ga0081455_10094028 3300005937 Bacteria 2422
360 Ga0081455_10107263 3300005937 Bacteria 2227
361 Ga0081455_10220294 3300005937 Bacteria 1407
362 Ga0081538_10067425 3300005981 Bacteria 1998
363 Ga0081540_1000313 3300005983 Bacteria 50236
364 Ga0081540_1000411 3300005983 Bacteria 42270
365 Ga0081540_1002499 3300005983 Bacteria 14958
366 Ga0081540_1004584 3300005983 Bacteria 10467
367 Ga0081540_1008920 3300005983 Bacteria 6948
368 Ga0081540_1030618 3300005983 Bacteria 2977
369 Ga0081540_1088284 3300005983 Bacteria 1371
370 Ga0081540_1116893 3300005983 Bacteria 1115
371 Ga0081539_10001010 3300005985 Bacteria 51943
372 Ga0081539_10009313 3300005985 Bacteria 8243
373 Ga0081539_10042460 3300005985 Bacteria 2648
374 Ga0070717_10024298 3300006028 Bacteria 4809
375 Ga0070717_10065856 3300006028 Bacteria 3012
376 Ga0070717_10145611 3300006028 Bacteria 2046
377 Ga0075365_10002796 3300006038 Bacteria 8732
378 Ga0075365_10016608 3300006038 Bacteria 4481
379 Ga0075365_10104371 3300006038 Bacteria 1943
380 Ga0075365_10201304 3300006038 Bacteria 1395
381 Ga0075368_10084876 3300006042 Bacteria 1291
382 Ga0075432_10003067 3300006058 Bacteria 5630
383 Ga0075432_10122117 3300006058 Bacteria 979
384 Ga0070715_10000159 3300006163 Bacteria 15732
385 Ga0070715_10067591 3300006163 Bacteria 1587
386 Ga0070716_100078273 3300006173 Bacteria 1965
387 Ga0070712_100004130 3300006175 Bacteria 8923
388 Ga0070712_100012431 3300006175 Bacteria 5413
389 Ga0070712_100020375 3300006175 Bacteria 4340
390 Ga0070712_100073488 3300006175 Bacteria 2453
391 Ga0070712_100135774 3300006175 Bacteria 1870
392 Ga0070712_100219916 3300006175 Bacteria 1503
393 Ga0070712_100223235 3300006175 Bacteria 1492
394 Ga0070712_100410759 3300006175 Bacteria 1120
395 Ga0075362_10029208 3300006177 Bacteria 2374
396 Ga0075362_10043954 3300006177 Bacteria 1980
397 Ga0075367_10109785 3300006178 Bacteria 1692
398 Ga0075369_10056593 3300006186 Bacteria 1704
399 Ga0075369_10123065 3300006186 Bacteria 1175
400 Ga0075366_10125327 3300006195 Bacteria 1549
401 Ga0075366_10249018 3300006195 Bacteria 1083
402 Ga0097621_100000750 3300006237 Bacteria 22736
403 Ga0097621_100019564 3300006237 Bacteria 5199
404 Ga0097621_100025735 3300006237 Bacteria 4607
405 Ga0097621_100067602 3300006237 Bacteria 2945
406 Ga0097621_100089455 3300006237 Bacteria 2574
407 Ga0097621_100116626 3300006237 Bacteria 2261
408 Ga0097621_100220328 3300006237 Bacteria 1653
409 Ga0075370_10009939 3300006353 Bacteria 4958
410 Ga0075370_10010060 3300006353 Bacteria 4934
411 Ga0075370_10026648 3300006353 Bacteria 3203
412 Ga0075370_10053794 3300006353 Bacteria 2285
413 Ga0068871_100029781 3300006358 Bacteria 4291
414 Ga0068871_100200600 3300006358 Bacteria 1722
415 Ga0068871_100270601 3300006358 Bacteria 1484
416 Ga0068871_100590919 3300006358 Bacteria 1009
417 Ga0075428_100001439 3300006844 Bacteria 25419
418 Ga0075428_100026241 3300006844 Bacteria 6453
419 Ga0075428_100125478 3300006844 Bacteria 2793
420 Ga0075428_100147559 3300006844 Bacteria 2556
421 Ga0075428_100156030 3300006844 Bacteria 2480
422 Ga0075428_100243963 3300006844 Bacteria 1938
423 Ga0075428_100288007 3300006844 Bacteria 1767
424 Ga0075428_100393979 3300006844 Bacteria 1484
425 Ga0075430_100001275 3300006846 Bacteria 20297
426 Ga0075430_100224284 3300006846 Bacteria 1559
427 Ga0075431_100036324 3300006847 Bacteria 5074
428 Ga0075431_100052312 3300006847 Bacteria 4211
429 Ga0075431_100113074 3300006847 Bacteria 2802
430 Ga0075431_100388195 3300006847 Bacteria 1399
431 Ga0075433_10001203 3300006852 Bacteria 18853
432 Ga0075433_10002183 3300006852 Bacteria 14837
433 Ga0075433_10181153 3300006852 Bacteria 1875
434 Ga0075433_10291103 3300006852 Bacteria 1446
435 Ga0075433_10335109 3300006852 Bacteria 1337
436 Ga0075434_100002619 3300006871 Bacteria 15865
437 Ga0075434_100013375 3300006871 Bacteria 7806
438 Ga0075434_100023656 3300006871 Bacteria 5991
439 Ga0075434_100068221 3300006871 Bacteria 3542
440 Ga0075434_100086729 3300006871 Bacteria 3130
441 Ga0075434_100223108 3300006871 Bacteria 1904
442 Ga0075434_100461070 3300006871 Bacteria 1292
443 Ga0075429_100000388 3300006880 Bacteria 32233
444 Ga0075429_100049158 3300006880 Bacteria 3667
445 Ga0075429_100194166 3300006880 Bacteria 1778
446 Ga0075429_100197495 3300006880 Bacteria 1762
447 Ga0075429_100552915 3300006880 Bacteria 1009
448 Ga0075429_100740218 3300006880 Bacteria 861
449 Ga0068865_100003957 3300006881 Bacteria 8888
450 Ga0068865_100009546 3300006881 Bacteria 6022
451 Ga0068865_100017283 3300006881 Bacteria 4636
452 Ga0068865_100062061 3300006881 Bacteria 2622
453 Ga0068865_100109138 3300006881 Bacteria 2038
454 Ga0068865_100172763 3300006881 Bacteria 1658
455 Ga0068865_100338310 3300006881 Bacteria 1216
456 Ga0075436_100014089 3300006914 Bacteria 5473
457 Ga0075436_100147424 3300006914 Bacteria 1655
458 Ga0075436_100267772 3300006914 Bacteria 1219
459 Ga0075436_100335856 3300006914 Bacteria 1087
460 Ga0097620_100000201 3300006931 Bacteria 58643
461 Ga0097620_100072288 3300006931 Bacteria 3486
462 Ga0097620_100209244 3300006931 Bacteria 2037
463 Ga0097620_100231351 3300006931 Bacteria 1936
464 Ga0075435_100002584 3300007076 Bacteria 12081
465 Ga0075435_100038012 3300007076 Bacteria 3837
466 Ga0075435_100039197 3300007076 Bacteria 3780
467 Ga0075435_100100060 3300007076 Bacteria 2401
468 Ga0075435_100488946 3300007076 Bacteria 1063
469 Ga0075435_100519862 3300007076 Bacteria 1030
470 Ga0075435_100544788 3300007076 Bacteria 1005
471 Ga0099794_10012743 3300007265 Bacteria 3640
472 Ga0099795_10005183 3300007788 Bacteria 3441
473 Ga0099795_10037544 3300007788 Bacteria 1705
474 Ga0105244_10002722 3300009036 Bacteria 13216
475 Ga0105250_10039487 3300009092 Bacteria 1892
476 Ga0105240_10010009 3300009093 Bacteria 13356
477 Ga0105240_10019117 3300009093 Bacteria 9161
478 Ga0105240_10025571 3300009093 Bacteria 7754
479 Ga0105240_10061444 3300009093 Bacteria 4682
480 Ga0105240_10064374 3300009093 Bacteria 4556
481 Ga0105240_10071183 3300009093 Bacteria 4301
482 Ga0105240_10075391 3300009093 Bacteria 4161
483 Ga0105240_10094766 3300009093 Bacteria 3640
484 Ga0105240_10121886 3300009093 Bacteria 3139
485 Ga0105240_10490541 3300009093 Bacteria 1368
486 Ga0105240_10822380 3300009093 Bacteria 1005
487 Ga0111539_10002315 3300009094 Bacteria 25343
488 Ga0111539_10002984 3300009094 Bacteria 22446
489 Ga0111539_10016144 3300009094 Bacteria 9265
490 Ga0111539_10017625 3300009094 Bacteria 8840
491 Ga0111539_10062101 3300009094 Bacteria 4424
492 Ga0111539_10072021 3300009094 Bacteria 4077
493 Ga0111539_10091969 3300009094 Bacteria 3565
494 Ga0111539_10095868 3300009094 Bacteria 3484
495 Ga0111539_10747551 3300009094 Bacteria 1138
496 Ga0105245_10020211 3300009098 Bacteria 5836
497 Ga0105245_10060945 3300009098 Bacteria 3400
498 Ga0105247_10010893 3300009101 Bacteria 5493
499 Ga0105247_10080475 3300009101 Bacteria 2052
500 Ga0105247_10261384 3300009101 Bacteria 1187
501 Ga0105247_10267064 3300009101 Bacteria 1175
502 Ga0114129_10007449 3300009147 Bacteria 15590
503 Ga0114129_10022955 3300009147 Bacteria 8851
504 Ga0114129_10061685 3300009147 Bacteria 5240
505 Ga0114129_10084546 3300009147 Bacteria 4405
506 Ga0114129_10143681 3300009147 Bacteria 3269
507 Ga0114129_10158787 3300009147 Bacteria 3091
508 Ga0114129_10274188 3300009147 Bacteria 2256
509 Ga0114129_10356521 3300009147 Bacteria 1936
510 Ga0114129_10623477 3300009147 Bacteria 1395
511 Ga0114129_10647632 3300009147 Bacteria 1364
512 Ga0114129_10976123 3300009147 Bacteria 1068
513 Ga0105243_10000527 3300009148 Bacteria 38948
514 Ga0105243_10007058 3300009148 Bacteria 8637
515 Ga0105243_10026946 3300009148 Bacteria 4401
516 Ga0105243_10031318 3300009148 Bacteria 4100
517 Ga0105243_10048034 3300009148 Bacteria 3363
518 Ga0105243_10308137 3300009148 Bacteria 1438
519 Ga0105241_10009508 3300009174 Bacteria 7140
520 Ga0105241_10025068 3300009174 Bacteria 4432
521 Ga0105242_10000946 3300009176 Bacteria 22656
522 Ga0105242_10057719 3300009176 Bacteria 3180
523 Ga0105242_10129187 3300009176 Bacteria 2179
524 Ga0105242_10183682 3300009176 Bacteria 1847
525 Ga0105242_10523100 3300009176 Bacteria 1132
526 Ga0105242_10531531 3300009176 Bacteria 1124
527 Ga0105248_10022900 3300009177 Bacteria 6936
528 Ga0105248_10045266 3300009177 Bacteria 4935
529 Ga0105248_10069700 3300009177 Bacteria 3948
530 Ga0105248_10084028 3300009177 Bacteria 3581
531 Ga0105248_10113516 3300009177 Bacteria 3055
532 Ga0105248_10139895 3300009177 Bacteria 2730
533 Ga0105248_10141427 3300009177 Bacteria 2715
534 Ga0105248_10151997 3300009177 Bacteria 2612
535 Ga0105248_10161153 3300009177 Bacteria 2530
536 Ga0105248_10241756 3300009177 Bacteria 2032
537 Ga0105248_10301458 3300009177 Bacteria 1804
538 Ga0105248_10384961 3300009177 Bacteria 1579
539 Ga0105248_10405501 3300009177 Bacteria 1535
540 Ga0105237_10000847 3300009545 Bacteria 41677
541 Ga0105237_10000915 3300009545 Bacteria 39667
542 Ga0105237_10022783 3300009545 Bacteria 6426
543 Ga0105237_10074412 3300009545 Bacteria 3389
544 Ga0105237_10269095 3300009545 Bacteria 1707
545 Ga0105237_10359159 3300009545 Bacteria 1461
546 Ga0105237_10804555 3300009545 Bacteria 947
547 Ga0105238_10003841 3300009551 Bacteria 14925
548 Ga0105238_10031634 3300009551 Bacteria 5387
549 Ga0105238_10041248 3300009551 Bacteria 4675
550 Ga0105238_10051367 3300009551 Bacteria 4147
551 Ga0105238_10169050 3300009551 Bacteria 2162
552 Ga0105238_10373775 3300009551 Bacteria 1416
553 Ga0105249_10032614 3300009553 Bacteria 4713
554 Ga0105249_10128466 3300009553 Bacteria 2417
555 Ga0105249_10207932 3300009553 Bacteria 1919
556 Ga0105249_10327745 3300009553 Bacteria 1544
557 Ga0105249_10580285 3300009553 Bacteria 1174
558 Ga0105239_10027635 3300010375 Bacteria 6243
559 Ga0105239_10037879 3300010375 Bacteria 5283
560 Ga0105239_10101847 3300010375 Bacteria 3178
561 Ga0105239_10184745 3300010375 Bacteria 2333
562 Ga0105239_10199484 3300010375 Bacteria 2241
563 Ga0105239_10228023 3300010375 Bacteria 2090
564 Ga0105239_10330372 3300010375 Bacteria 1720
565 Ga0105239_10343275 3300010375 Bacteria 1685
566 Ga0105246_10018900 3300011119 Bacteria 4395
567 Ga0105246_10020051 3300011119 Bacteria 4285
568 Ga0105246_10068357 3300011119 Bacteria 2491
569 Ga0105246_10071926 3300011119 Bacteria 2437
570 Ga0105246_10132598 3300011119 Bacteria 1863
571 Ga0105246_10330228 3300011119 Bacteria 1243
572 Ga0157314_1000336 3300012500 Bacteria 4882
573 Ga0157373_10001433 3300013100 Bacteria 18195
574 Ga0157373_10059119 3300013100 Bacteria 2716
575 Ga0157373_10137393 3300013100 Bacteria 1719
576 Ga0157371_10033215 3300013102 Bacteria 3708
577 Ga0157370_10004330 3300013104 Bacteria 16316
578 Ga0157370_10005321 3300013104 Bacteria 14453
579 Ga0157370_10012557 3300013104 Bacteria 8781
580 Ga0157370_10024107 3300013104 Bacteria 6031
581 Ga0157370_10095040 3300013104 Bacteria 2796
582 Ga0157370_10192623 3300013104 Bacteria 1892
583 Ga0157370_10366060 3300013104 Bacteria 1328
584 Ga0157369_10030815 3300013105 Bacteria 5913
585 Ga0157369_10032889 3300013105 Bacteria 5700
586 Ga0157369_10084641 3300013105 Bacteria 3389
587 Ga0157374_10008130 3300013296 Bacteria 8965
588 Ga0157374_10032314 3300013296 Bacteria 4763
589 Ga0157374_10089608 3300013296 Bacteria 2931
590 Ga0157374_10121714 3300013296 Bacteria 2519
591 Ga0157374_10126224 3300013296 Bacteria 2473
592 Ga0157374_10151961 3300013296 Bacteria 2251
593 Ga0157374_10164769 3300013296 Bacteria 2160
594 Ga0157374_10357564 3300013296 Bacteria 1451
595 Ga0157374_10880860 3300013296 Bacteria 913
596 Ga0157378_10036294 3300013297 Bacteria 4362
597 Ga0157378_10046583 3300013297 Bacteria 3854
598 Ga0157378_10056981 3300013297 Bacteria 3482
599 Ga0157378_10090985 3300013297 Bacteria 2773
600 Ga0157378_10092382 3300013297 Bacteria 2753
601 Ga0157378_10095877 3300013297 Bacteria 2702
602 Ga0157378_10209068 3300013297 Bacteria 1849
603 Ga0157378_10284117 3300013297 Bacteria 1596
604 Ga0157378_10343352 3300013297 Bacteria 1457
605 Ga0157378_10586572 3300013297 Bacteria 1124
606 Ga0163162_10001714 3300013306 Bacteria 20541
607 Ga0163162_10003918 3300013306 Bacteria 14292
608 Ga0163162_10007822 3300013306 Bacteria 10420
609 Ga0163162_10033766 3300013306 Bacteria 5086
610 Ga0163162_10036069 3300013306 Bacteria 4927
611 Ga0163162_10053194 3300013306 Bacteria 4069
612 Ga0163162_10055718 3300013306 Bacteria 3982
613 Ga0163162_10376768 3300013306 Bacteria 1552
614 Ga0163162_10511858 3300013306 Bacteria 1330
615 Ga0163162_11020757 3300013306 Bacteria 936
616 Ga0157372_10007187 3300013307 Bacteria 11852
617 Ga0157372_10011420 3300013307 Bacteria 9446
618 Ga0157375_10001397 3300013308 Bacteria 20822
619 Ga0157375_10017888 3300013308 Bacteria 6412
620 Ga0157375_10020474 3300013308 Bacteria 6044
621 Ga0157375_10028676 3300013308 Bacteria 5223
622 Ga0157375_10054953 3300013308 Bacteria 3924
623 Ga0157375_10066468 3300013308 Bacteria 3600
624 Ga0157375_10124417 3300013308 Bacteria 2692
625 Ga0157375_10148998 3300013308 Bacteria 2473
626 Ga0157375_10213840 3300013308 Bacteria 2086
627 Ga0157375_11122074 3300013308 Bacteria 921
628 Ga0163163_10007632 3300014325 Bacteria 9554
629 Ga0163163_10012078 3300014325 Bacteria 7857
630 Ga0163163_10067902 3300014325 Bacteria 3546
631 Ga0157380_10067378 3300014326 Bacteria 2882
632 Ga0157380_10157992 3300014326 Bacteria 1967
633 Ga0157380_10423601 3300014326 Bacteria 1270
634 Ga0157380_10523567 3300014326 Bacteria 1157
635 Ga0182008_10005378 3300014497 Bacteria 7303
636 Ga0157377_10007033 3300014745 Bacteria 5405
637 Ga0157377_10015692 3300014745 Bacteria 3882
638 Ga0157379_10010447 3300014968 Bacteria 8092
639 Ga0157379_10010738 3300014968 Bacteria 7982
640 Ga0157379_10040992 3300014968 Bacteria 4133
641 Ga0157379_10051721 3300014968 Bacteria 3669
642 Ga0157379_10124964 3300014968 Bacteria 2315
643 Ga0157379_10125167 3300014968 Bacteria 2313
644 Ga0157379_10686952 3300014968 Bacteria 960
645 Ga0157376_10022001 3300014969 Bacteria 4961
646 Ga0157376_10025325 3300014969 Bacteria 4672
647 Ga0157376_10050657 3300014969 Bacteria 3446
648 Ga0157376_10079062 3300014969 Bacteria 2818
649 Ga0182006_1004665 3300015261 Bacteria 6710
650 Ga0182007_10001047 3300015262 Bacteria 15155
651 Ga0163161_10000065 3300017792 Bacteria 108321
652 Ga0163161_10007474 3300017792 Bacteria 7552
653 Ga0163161_10030285 3300017792 Bacteria 3850
654 Ga0163161_10032659 3300017792 Bacteria 3718
655 Ga0163161_10087344 3300017792 Bacteria 2303
656 Ga0163161_10244305 3300017792 Bacteria 1397
657 Ga0206350_10220090 3300020080 Bacteria 2070
658 Ga0213872_10000118 3300021361 Bacteria 73787
659 Ga0213872_10004098 3300021361 Bacteria 7842
660 Ga0213872_10037061 3300021361 Bacteria 2227
661 Ga0213872_10047045 3300021361 Bacteria 1962
662 Ga0213872_10075855 3300021361 Bacteria 1513
663 Ga0213872_10106399 3300021361 Bacteria 1248
664 Ga0213872_10129058 3300021361 Bacteria 1114
665 Ga0213872_10163022 3300021361 Bacteria 969
666 Ga0213874_10001048 3300021377 Bacteria 5666
667 Ga0213874_10015836 3300021377 Bacteria 1995
668 Ga0213876_10042201 3300021384 Bacteria 2411
669 Ga0213876_10045680 3300021384 Bacteria 2316
670 Ga0228598_1025571 3300024227 Bacteria 1162
671 Ga0209760_100361 3300025207 Bacteria 12472
672 Ga0209784_100074 3300025224 Bacteria 144366
673 Ga0209672_100616 3300025228 Bacteria 18532
674 Ga0209672_104312 3300025228 Bacteria 2667
675 Ga0209147_101025 3300025229 Bacteria 11908
676 Ga0207427_100079 3300025231 Bacteria 145096
677 Ga0209437_100163 3300025233 Bacteria 145370
678 Ga0209437_102147 3300025233 Bacteria 3963
679 Ga0209258_100048 3300025242 Bacteria 365881
680 Ga0209258_100196 3300025242 Bacteria 124063
681 Ga0207425_1000275 3300025245 Bacteria 37897
682 Ga0207425_1017078 3300025245 Bacteria 1601
683 Ga0207425_1022293 3300025245 Bacteria 1336
684 Ga0209646_1000369 3300025246 Bacteria 29925
685 Ga0209026_1000109 3300025250 Bacteria 144563
686 Ga0209026_1000184 3300025250 Bacteria 91780
687 Ga0209148_1000001 3300025254 Bacteria 2545271
688 Ga0209148_1000040 3300025254 Bacteria 473531
689 Ga0209759_1000414 3300025256 Bacteria 52750
690 Ga0209759_1000534 3300025256 Bacteria 40142
691 Ga0209129_1000007 3300025258 Bacteria 771325
692 Ga0209129_1003907 3300025258 Bacteria 6194
693 Ga0209129_1004952 3300025258 Bacteria 4942
694 Ga0209233_1000002 3300025261 Bacteria 2501366
695 Ga0209565_1000105 3300025263 Bacteria 122895
696 Ga0209565_1001643 3300025263 Bacteria 9391
697 Ga0209455_1000155 3300025272 Bacteria 121004
698 Ga0209455_1012952 3300025272 Bacteria 1965
699 Ga0209673_1005800 3300025273 Bacteria 6132
700 Ga0209130_1000172 3300025284 Bacteria 93199
701 Ga0209130_1000329 3300025284 Bacteria 54511
702 Ga0209675_1005938 3300025291 Bacteria 5007
703 Ga0209675_1005974 3300025291 Bacteria 4984
704 Ga0209676_1000004 3300025292 Bacteria 1138360
705 Ga0209676_1001472 3300025292 Bacteria 21882
706 Ga0209676_1041658 3300025292 Bacteria 1281
707 Ga0209025_1000111 3300025294 Bacteria 218982
708 Ga0209025_1000624 3300025294 Bacteria 62814
709 Ga0209025_1027909 3300025294 Bacteria 2782
710 Ga0209025_1031167 3300025294 Bacteria 2530
711 Ga0209564_1000153 3300025295 Bacteria 166910
712 Ga0209564_1000337 3300025295 Bacteria 90545
713 Ga0209758_1000025 3300025297 Bacteria 586687
714 Ga0209758_1000028 3300025297 Bacteria 530102
715 Ga0209758_1000088 3300025297 Bacteria 251547
716 Ga0209758_1000723 3300025297 Bacteria 48406
717 Ga0209758_1003925 3300025297 Bacteria 12968
718 Ga0209758_1017055 3300025297 Bacteria 3645
719 Ga0209758_1021417 3300025297 Bacteria 3014
720 Ga0209758_1038634 3300025297 Bacteria 1828
721 Ga0209050_1000002 3300025298 Bacteria 1792849
722 Ga0209050_1000412 3300025298 Bacteria 79647
723 Ga0209050_1003041 3300025298 Bacteria 12935
724 Ga0209050_1039333 3300025298 Bacteria 1334
725 Ga0209256_1000425 3300025299 Bacteria 66308
726 Ga0209256_1003613 3300025299 Bacteria 10621
727 Ga0207426_1000001 3300025302 Bacteria 1341301
728 Ga0207426_1000028 3300025302 Bacteria 483955
729 Ga0207426_1024803 3300025302 Bacteria 2030
730 Ga0209051_1000002 3300025303 Bacteria 1631846
731 Ga0209051_1000150 3300025303 Bacteria 132005
732 Ga0209051_1030888 3300025303 Bacteria 2071
733 Ga0209051_1057350 3300025303 Bacteria 1248
734 Ga0209257_1000002 3300025304 Bacteria 1767052
735 Ga0209257_1000275 3300025304 Bacteria 116952
736 Ga0209257_1012625 3300025304 Bacteria 3875
737 Ga0209257_1020979 3300025304 Bacteria 2391
738 Ga0207697_10019641 3300025315 Bacteria 2768
739 Ga0207656_10040471 3300025321 Bacteria 1976
740 Ga0207656_10059819 3300025321 Bacteria 1669
741 Ga0207656_10086819 3300025321 Bacteria 1414
742 Ga0207696_1039058 3300025711 Bacteria 1398
743 Ga0207655_1000936 3300025728 Bacteria 30274
744 Ga0207653_10044455 3300025885 Bacteria 1464
745 Ga0207653_10109620 3300025885 Bacteria 984
746 Ga0207682_10001738 3300025893 Bacteria 9995
747 Ga0207682_10022172 3300025893 Bacteria 2501
748 Ga0207682_10103027 3300025893 Bacteria 1249
749 Ga0207692_10004390 3300025898 Bacteria 5583
750 Ga0207692_10013154 3300025898 Bacteria 3582
751 Ga0207692_10119652 3300025898 Bacteria 1473
752 Ga0207642_10011242 3300025899 Bacteria 3185
753 Ga0207642_10070473 3300025899 Bacteria 1662
754 Ga0207710_10005521 3300025900 Bacteria 5441
755 Ga0207710_10021773 3300025900 Bacteria 2750
756 Ga0207710_10059930 3300025900 Bacteria 1724
757 Ga0207710_10109341 3300025900 Bacteria 1311
758 Ga0207710_10150574 3300025900 Bacteria 1128
759 Ga0207688_10002037 3300025901 Bacteria 10853
760 Ga0207688_10038389 3300025901 Bacteria 2657
761 Ga0207688_10080165 3300025901 Bacteria 1863
762 Ga0207680_10001058 3300025903 Bacteria 13002
763 Ga0207680_10002416 3300025903 Bacteria 8708
764 Ga0207680_10016663 3300025903 Bacteria 3863
765 Ga0207680_10043946 3300025903 Bacteria 2624
766 Ga0207680_10067102 3300025903 Bacteria 2209
767 Ga0207680_10084727 3300025903 Bacteria 2000
768 Ga0207647_10015192 3300025904 Bacteria 5287
769 Ga0207647_10018037 3300025904 Bacteria 4785
770 Ga0207685_10003238 3300025905 Bacteria 3922
771 Ga0207685_10012205 3300025905 Bacteria 2614
772 Ga0207685_10035038 3300025905 Bacteria 1828
773 Ga0207699_10024177 3300025906 Bacteria 3318
774 Ga0207699_10258203 3300025906 Bacteria 1203
775 Ga0207645_10003854 3300025907 Bacteria 11223
776 Ga0207645_10015977 3300025907 Bacteria 4973
777 Ga0207645_10016487 3300025907 Bacteria 4890
778 Ga0207645_10018353 3300025907 Bacteria 4604
779 Ga0207645_10021110 3300025907 Bacteria 4251
780 Ga0207645_10038255 3300025907 Bacteria 3076
781 Ga0207645_10137135 3300025907 Bacteria 1593
782 Ga0207645_10450973 3300025907 Bacteria 868
783 Ga0207643_10000872 3300025908 Bacteria 18178
784 Ga0207684_10006392 3300025910 Bacteria 10740
785 Ga0207654_10097443 3300025911 Bacteria 1806
786 Ga0207707_10000993 3300025912 Bacteria 27228
787 Ga0207707_10133932 3300025912 Bacteria 2167
788 Ga0207707_10136128 3300025912 Bacteria 2148
789 Ga0207707_10178845 3300025912 Bacteria 1852
790 Ga0207707_10278092 3300025912 Bacteria 1450
791 Ga0207695_10002637 3300025913 Bacteria 26235
792 Ga0207695_10012555 3300025913 Bacteria 10153
793 Ga0207695_10015602 3300025913 Bacteria 8935
794 Ga0207695_10046361 3300025913 Bacteria 4607
795 Ga0207695_10087600 3300025913 Bacteria 3136
796 Ga0207695_10102534 3300025913 Bacteria 2854
797 Ga0207695_10153138 3300025913 Bacteria 2243
798 Ga0207695_10171050 3300025913 Bacteria 2098
799 Ga0207671_10000009 3300025914 Bacteria 724862
800 Ga0207671_10012577 3300025914 Bacteria 6797
801 Ga0207671_10049241 3300025914 Bacteria 3119
802 Ga0207671_10072645 3300025914 Bacteria 2568
803 Ga0207671_10261439 3300025914 Bacteria 1362
804 Ga0207693_10010135 3300025915 Bacteria 7655
805 Ga0207693_10014239 3300025915 Bacteria 6398
806 Ga0207693_10024667 3300025915 Bacteria 4769
807 Ga0207693_10033504 3300025915 Bacteria 4053
808 Ga0207693_10083884 3300025915 Bacteria 2496
809 Ga0207693_10116759 3300025915 Bacteria 2095
810 Ga0207663_10015515 3300025916 Bacteria 4204
811 Ga0207663_10139487 3300025916 Bacteria 1687
812 Ga0207663_10145972 3300025916 Bacteria 1654
813 Ga0207663_10401644 3300025916 Bacteria 1048
814 Ga0207660_10001443 3300025917 Bacteria 15951
815 Ga0207662_10000929 3300025918 Bacteria 13584
816 Ga0207662_10035101 3300025918 Bacteria 2928
817 Ga0207662_10050630 3300025918 Bacteria 2468
818 Ga0207657_10000882 3300025919 Bacteria 31708
819 Ga0207657_10030389 3300025919 Bacteria 4904
820 Ga0207657_10054443 3300025919 Bacteria 3460
821 Ga0207657_10118675 3300025919 Bacteria 2177
822 Ga0207657_10512775 3300025919 Bacteria 939
823 Ga0207649_10037866 3300025920 Bacteria 2916
824 Ga0207649_10088310 3300025920 Bacteria 2024
825 Ga0207649_10154324 3300025920 Bacteria 1584
826 Ga0207652_10010460 3300025921 Bacteria 7468
827 Ga0207652_10013461 3300025921 Bacteria 6619
828 Ga0207652_10056791 3300025921 Bacteria 3370
829 Ga0207652_10078495 3300025921 Bacteria 2883
830 Ga0207652_10100762 3300025921 Bacteria 2550
831 Ga0207646_10086275 3300025922 Bacteria 2808
832 Ga0207646_10100674 3300025922 Bacteria 2590
833 Ga0207681_10062137 3300025923 Bacteria 2570
834 Ga0207681_10066034 3300025923 Bacteria 2503
835 Ga0207694_10027047 3300025924 Bacteria 4367
836 Ga0207694_10150962 3300025924 Bacteria 1872
837 Ga0207694_10233204 3300025924 Bacteria 1503
838 Ga0207694_10272681 3300025924 Bacteria 1388
839 Ga0207694_10771553 3300025924 Bacteria 812
840 Ga0207650_10002222 3300025925 Bacteria 13558
841 Ga0207650_10040855 3300025925 Bacteria 3396
842 Ga0207650_10055690 3300025925 Bacteria 2936
843 Ga0207650_10204831 3300025925 Bacteria 1582
844 Ga0207650_10435653 3300025925 Bacteria 1089
845 Ga0207659_10026579 3300025926 Bacteria 3906
846 Ga0207659_10281394 3300025926 Bacteria 1360
847 Ga0207659_10350862 3300025926 Bacteria 1224
848 Ga0207687_10048743 3300025927 Bacteria 2943
849 Ga0207687_10067330 3300025927 Bacteria 2547
850 Ga0207687_10114550 3300025927 Bacteria 2007
851 Ga0207687_10203847 3300025927 Bacteria 1548
852 Ga0207687_10698783 3300025927 Bacteria 861
853 Ga0207700_10000355 3300025928 Bacteria 26804
854 Ga0207700_10035401 3300025928 Bacteria 3596
855 Ga0207700_10050938 3300025928 Bacteria 3087
856 Ga0207700_10077303 3300025928 Bacteria 2585
857 Ga0207700_10082293 3300025928 Bacteria 2517
858 Ga0207700_10256478 3300025928 Bacteria 1496
859 Ga0207700_10320186 3300025928 Bacteria 1344
860 Ga0207700_10325758 3300025928 Bacteria 1332
861 Ga0207664_10041119 3300025929 Bacteria 3600
862 Ga0207664_10105270 3300025929 Bacteria 2338
863 Ga0207664_10916463 3300025929 Bacteria 787
864 Ga0207644_10000992 3300025931 Bacteria 18113
865 Ga0207644_10018949 3300025931 Bacteria 4666
866 Ga0207644_10069984 3300025931 Bacteria 2563
867 Ga0207644_10092319 3300025931 Bacteria 2258
868 Ga0207644_10310330 3300025931 Bacteria 1273
869 Ga0207644_10328232 3300025931 Bacteria 1238
870 Ga0207644_10545659 3300025931 Bacteria 959
871 Ga0207690_10007295 3300025932 Bacteria 6565
872 Ga0207690_10018571 3300025932 Bacteria 4266
873 Ga0207690_10234412 3300025932 Bacteria 1411
874 Ga0207690_10240571 3300025932 Bacteria 1394
875 Ga0207706_10000820 3300025933 Bacteria 32304
876 Ga0207706_10006344 3300025933 Bacteria 10985
877 Ga0207706_10023978 3300025933 Bacteria 5475
878 Ga0207706_10026374 3300025933 Bacteria 5201
879 Ga0207706_10072978 3300025933 Bacteria 3017
880 Ga0207706_10120544 3300025933 Bacteria 2306
881 Ga0207706_10174332 3300025933 Bacteria 1889
882 Ga0207686_10016093 3300025934 Bacteria 4192
883 Ga0207686_10024527 3300025934 Bacteria 3496
884 Ga0207686_10147828 3300025934 Bacteria 1632
885 Ga0207686_10271331 3300025934 Bacteria 1248
886 Ga0207709_10000815 3300025935 Bacteria 24134
887 Ga0207709_10011118 3300025935 Bacteria 4964
888 Ga0207709_10020302 3300025935 Bacteria 3745
889 Ga0207709_10094916 3300025935 Bacteria 1959
890 Ga0207709_10201169 3300025935 Bacteria 1423
891 Ga0207670_10002275 3300025936 Bacteria 10057
892 Ga0207670_10167863 3300025936 Bacteria 1643
893 Ga0207670_10181880 3300025936 Bacteria 1584
894 Ga0207670_10216132 3300025936 Bacteria 1465
895 Ga0207670_10282061 3300025936 Bacteria 1295
896 Ga0207669_10003927 3300025937 Bacteria 6486
897 Ga0207669_10070455 3300025937 Bacteria 2192
898 Ga0207669_10210723 3300025937 Bacteria 1418
899 Ga0207704_10037694 3300025938 Bacteria 2795
900 Ga0207704_10048800 3300025938 Bacteria 2541
901 Ga0207704_10069015 3300025938 Bacteria 2231
902 Ga0207704_10073040 3300025938 Bacteria 2183
903 Ga0207704_10140701 3300025938 Bacteria 1687
904 Ga0207704_10324708 3300025938 Bacteria 1189
905 Ga0207704_10484342 3300025938 Bacteria 994
906 Ga0207665_10001863 3300025939 Bacteria 14223
907 Ga0207665_10006295 3300025939 Bacteria 7873
908 Ga0207665_10105875 3300025939 Bacteria 1970
909 Ga0207691_10018587 3300025940 Bacteria 6587
910 Ga0207691_10019811 3300025940 Bacteria 6363
911 Ga0207691_10025399 3300025940 Bacteria 5563
912 Ga0207691_10056251 3300025940 Bacteria 3584
913 Ga0207711_10015709 3300025941 Bacteria 6279
914 Ga0207711_10026432 3300025941 Bacteria 4870
915 Ga0207711_10032690 3300025941 Bacteria 4399
916 Ga0207711_10058167 3300025941 Bacteria 3325
917 Ga0207711_10111720 3300025941 Bacteria 2431
918 Ga0207711_10122103 3300025941 Bacteria 2327
919 Ga0207711_10258907 3300025941 Bacteria 1599
920 Ga0207711_10334788 3300025941 Bacteria 1400
921 Ga0207711_10380658 3300025941 Bacteria 1309
922 Ga0207711_10415157 3300025941 Bacteria 1251
923 Ga0207689_10035473 3300025942 Bacteria 4144
924 Ga0207689_10044726 3300025942 Bacteria 3661
925 Ga0207689_10052332 3300025942 Bacteria 3365
926 Ga0207689_10090393 3300025942 Bacteria 2516
927 Ga0207661_10028106 3300025944 Bacteria 4304
928 Ga0207661_10129313 3300025944 Bacteria 2161
929 Ga0207661_10151152 3300025944 Bacteria 2007
930 Ga0207661_10174944 3300025944 Bacteria 1871
931 Ga0207679_10010584 3300025945 Bacteria 5943
932 Ga0207679_10032266 3300025945 Bacteria 3674
933 Ga0207679_10040139 3300025945 Bacteria 3348
934 Ga0207679_10268016 3300025945 Bacteria 1459
935 Ga0207679_10452267 3300025945 Bacteria 1139
936 Ga0207667_10000202 3300025949 Bacteria 86408
937 Ga0207667_10000653 3300025949 Bacteria 44974
938 Ga0207667_10001046 3300025949 Bacteria 35260
939 Ga0207667_10005173 3300025949 Bacteria 15937
940 Ga0207667_10156429 3300025949 Bacteria 2345
941 Ga0207667_10199000 3300025949 Bacteria 2056
942 Ga0207651_10002984 3300025960 Bacteria 8189
943 Ga0207651_10021608 3300025960 Bacteria 3915
944 Ga0207651_10029451 3300025960 Bacteria 3479
945 Ga0207651_10029670 3300025960 Bacteria 3469
946 Ga0207651_10060332 3300025960 Bacteria 2632
947 Ga0207651_10174125 3300025960 Bacteria 1700
948 Ga0207651_10180936 3300025960 Bacteria 1672
949 Ga0207712_10046641 3300025961 Bacteria 3005
950 Ga0207712_10176792 3300025961 Bacteria 1673
951 Ga0207712_10240547 3300025961 Bacteria 1458
952 Ga0207712_10273544 3300025961 Bacteria 1375
953 Ga0207668_10009222 3300025972 Bacteria 5904
954 Ga0207668_10018888 3300025972 Bacteria 4345
955 Ga0207668_10051269 3300025972 Bacteria 2849
956 Ga0207668_10061909 3300025972 Bacteria 2633
957 Ga0207640_10000372 3300025981 Bacteria 28973
958 Ga0207640_10000373 3300025981 Bacteria 28945
959 Ga0207640_10088670 3300025981 Bacteria 2136
960 Ga0207640_10094512 3300025981 Bacteria 2079
961 Ga0207640_10162428 3300025981 Bacteria 1654
962 Ga0207640_10182135 3300025981 Bacteria 1576
963 Ga0207640_10226290 3300025981 Bacteria 1436
964 Ga0207658_10020076 3300025986 Bacteria 4626
965 Ga0207658_10025067 3300025986 Bacteria 4174
966 Ga0207658_10047610 3300025986 Bacteria 3139
967 Ga0207658_10067178 3300025986 Bacteria 2699
968 Ga0207658_10198488 3300025986 Bacteria 1673
969 Ga0207658_10359861 3300025986 Bacteria 1269
970 Ga0207658_10933998 3300025986 Bacteria 790
971 Ga0207677_10086334 3300026023 Bacteria 2268
972 Ga0207677_10103212 3300026023 Bacteria 2104
973 Ga0207677_10139533 3300026023 Bacteria 1854
974 Ga0207677_10228930 3300026023 Bacteria 1496
975 Ga0207677_10403013 3300026023 Bacteria 1160
976 Ga0207703_10026290 3300026035 Bacteria 4580
977 Ga0207703_10042963 3300026035 Bacteria 3626
978 Ga0207703_10162465 3300026035 Bacteria 1957
979 Ga0207703_10361573 3300026035 Bacteria 1339
980 Ga0207703_10401336 3300026035 Bacteria 1272
981 Ga0207639_10012698 3300026041 Bacteria 5874
982 Ga0207639_10019195 3300026041 Bacteria 4871
983 Ga0207639_10040927 3300026041 Bacteria 3463
984 Ga0207639_10166534 3300026041 Bacteria 1862
985 Ga0207678_10001637 3300026067 Bacteria 20525
986 Ga0207678_10005238 3300026067 Bacteria 11614
987 Ga0207678_10025729 3300026067 Bacteria 5136
988 Ga0207678_10070505 3300026067 Bacteria 2997
989 Ga0207678_10085361 3300026067 Bacteria 2699
990 Ga0207678_10161769 3300026067 Bacteria 1912
991 Ga0207678_10344358 3300026067 Bacteria 1285
992 Ga0207678_10435723 3300026067 Bacteria 1138
993 Ga0207708_10003553 3300026075 Bacteria 11489
994 Ga0207708_10030683 3300026075 Bacteria 4076
995 Ga0207708_10044738 3300026075 Bacteria 3373
996 Ga0207708_10138258 3300026075 Bacteria 1909
997 Ga0207702_10077079 3300026078 Bacteria 2882
998 Ga0207702_10121842 3300026078 Bacteria 2335
999 Ga0207702_10443274 3300026078 Bacteria 1259
1000 Ga0207641_10204562 3300026088 Bacteria 1822
1001 Ga0207641_10265901 3300026088 Bacteria 1607
1002 Ga0207641_10573123 3300026088 Bacteria 1103
1003 Ga0207648_10004480 3300026089 Bacteria 14335
1004 Ga0207648_10026444 3300026089 Bacteria 5156
1005 Ga0207648_10045345 3300026089 Bacteria 3857
1006 Ga0207648_10049175 3300026089 Bacteria 3691
1007 Ga0207648_10076585 3300026089 Bacteria 2916
1008 Ga0207648_10082741 3300026089 Bacteria 2799
1009 Ga0207648_10093585 3300026089 Bacteria 2628
1010 Ga0207676_10007903 3300026095 Bacteria 7566
1011 Ga0207676_10029439 3300026095 Bacteria 4112
1012 Ga0207674_10001249 3300026116 Bacteria 33205
1013 Ga0207674_10004693 3300026116 Bacteria 16399
1014 Ga0207674_10009402 3300026116 Bacteria 11175
1015 Ga0207674_10178859 3300026116 Bacteria 2073
1016 Ga0207674_10311217 3300026116 Bacteria 1524
1017 Ga0207675_100000047 3300026118 Bacteria 85113
1018 Ga0207675_100037475 3300026118 Bacteria 4522
1019 Ga0207675_100059299 3300026118 Bacteria 3571
1020 Ga0207675_100169747 3300026118 Bacteria 2085
1021 Ga0207675_100201232 3300026118 Bacteria 1913
1022 Ga0207683_10000110 3300026121 Bacteria 66649
1023 Ga0207683_10000127 3300026121 Bacteria 62271
1024 Ga0207683_10007701 3300026121 Bacteria 9225
1025 Ga0207683_10011148 3300026121 Bacteria 7662
1026 Ga0207683_10018285 3300026121 Bacteria 5979
1027 Ga0207683_10023599 3300026121 Bacteria 5291
1028 Ga0207683_10044111 3300026121 Bacteria 3898
1029 Ga0207683_10136046 3300026121 Bacteria 2212
1030 Ga0207683_10145890 3300026121 Bacteria 2134
1031 Ga0207698_10044661 3300026142 Bacteria 3332
1032 Ga0207698_10053714 3300026142 Bacteria 3095
1033 Ga0207698_10069684 3300026142 Bacteria 2782
1034 Ga0207698_10079775 3300026142 Bacteria 2634
1035 Ga0207698_10272862 3300026142 Bacteria 1560
1036 Ga0207698_10331152 3300026142 Bacteria 1430
1037 Ga0207698_10691043 3300026142 Bacteria 1014
1038 Ga0209179_1001228 3300027512 Bacteria 3059
1039 Ga0209179_1018420 3300027512 Bacteria 1334
1040 Ga0209179_1030870 3300027512 Bacteria 1097
1041 Ga0207428_10000272 3300027907 Bacteria 69872
1042 Ga0207428_10070875 3300027907 Bacteria 2739
1043 Ga0207428_10089738 3300027907 Bacteria 2388
1044 Ga0207428_10132546 3300027907 Bacteria 1906
1045 Ga0268266_10000017 3300028379 Bacteria 607272
1046 Ga0268266_10032322 3300028379 Bacteria 4446
1047 Ga0268266_10034799 3300028379 Bacteria 4285
1048 Ga0268266_10038608 3300028379 Bacteria 4065
1049 Ga0268266_10076202 3300028379 Bacteria 2914
1050 Ga0268266_10126042 3300028379 Bacteria 2285
1051 Ga0268266_10236486 3300028379 Bacteria 1684
1052 Ga0268266_10319614 3300028379 Bacteria 1452
1053 Ga0268265_10000509 3300028380 Bacteria 39997
1054 Ga0268265_10012550 3300028380 Bacteria 5743
1055 Ga0268265_10020054 3300028380 Bacteria 4659
1056 Ga0268265_10045406 3300028380 Bacteria 3278
1057 Ga0268264_10012140 3300028381 Bacteria 7092
1058 Ga0268264_10096735 3300028381 Bacteria 2558
1059 Ga0268264_10185542 3300028381 Bacteria 1892
1060 Ga0268264_10546799 3300028381 Bacteria 1135
1061 Ga0307517_10142677 3300028786 Bacteria 1675
1062 Ga0307515_10000154 3300028794 Bacteria 166582
1063 Ga0307515_10003464 3300028794 Bacteria 33173
1064 Ga0307515_10270563 3300028794 Bacteria 1421
1065 Ga0307512_10031032 3300030522 Bacteria 4638
1066 Ga0265330_10016489 3300031235 Bacteria 3408
1067 Ga0265330_10075275 3300031235 Bacteria 1458
1068 Ga0265332_10001645 3300031238 Bacteria 12189
1069 Ga0265328_10000069 3300031239 Bacteria 55229
1070 Ga0265328_10094485 3300031239 Bacteria 1105
1071 Ga0265328_10128836 3300031239 Bacteria 947
1072 Ga0265325_10001981 3300031241 Bacteria 14098
1073 Ga0265329_10008979 3300031242 Bacteria 3757
1074 Ga0265339_10016519 3300031249 Bacteria 4397
1075 Ga0265331_10003158 3300031250 Bacteria 10762
1076 Ga0265331_10003427 3300031250 Bacteria 10256
1077 Ga0265331_10019627 3300031250 Bacteria 3487
1078 Ga0265327_10000116 3300031251 Bacteria 173745
1079 Ga0265327_10011782 3300031251 Bacteria 5983
1080 Ga0265327_10021854 3300031251 Bacteria 3847
1081 Ga0265327_10024262 3300031251 Bacteria 3569
1082 Ga0265327_10066157 3300031251 Bacteria 1825
1083 Ga0265327_10089344 3300031251 Bacteria 1505
1084 Ga0265316_10021653 3300031344 Bacteria 5439
1085 Ga0265316_10032696 3300031344 Bacteria 4243
1086 Ga0265316_10052324 3300031344 Bacteria 3204
1087 Ga0307513_10005286 3300031456 Bacteria 17089
1088 Ga0307513_10030576 3300031456 Bacteria 6115
1089 Ga0307513_10046000 3300031456 Bacteria 4765
1090 Ga0307513_10188666 3300031456 Bacteria 1916
1091 Ga0307513_10341002 3300031456 Bacteria 1249
1092 Ga0307509_10193154 3300031507 Bacteria 1884
1093 Ga0307509_10366695 3300031507 Bacteria 1158
1094 Ga0307509_10424351 3300031507 Bacteria 1030
1095 Ga0265313_10004677 3300031595 Bacteria 10341
1096 Ga0265313_10006105 3300031595 Bacteria 8667
1097 Ga0265313_10008556 3300031595 Bacteria 6778
1098 Ga0307508_10327842 3300031616 Bacteria 1123
1099 Ga0316575_10034796 3300031665 Bacteria 1979
1100 Ga0265314_10017569 3300031711 Bacteria 5610
1101 Ga0265314_10024605 3300031711 Bacteria 4562
1102 Ga0265314_10187385 3300031711 Bacteria 1234
1103 Ga0265342_10000487 3300031712 Bacteria 42945
1104 Ga0265342_10155152 3300031712 Bacteria 1269
1105 Ga0307410_10186603 3300031852 Bacteria 1574
1106 Ga0307410_10202592 3300031852 Bacteria 1516
1107 Ga0307412_10021192 3300031911 Bacteria 3966
1108 Ga0307412_10085148 3300031911 Bacteria 2196
1109 Ga0307409_100465259 3300031995 Bacteria 1223
1110 Ga0307416_100168118 3300032002 Bacteria 2037
1111 Ga0307416_100177260 3300032002 Bacteria 1993
1112 Ga0307411_10238786 3300032005 Bacteria 1421
1113 Ga0307415_100242669 3300032126 Bacteria 1458
1114 Ga0307415_100438802 3300032126 Bacteria 1125
1115 Ga0316583_10023855 3300032133 Bacteria 2184
1116 Ga0316583_10034987 3300032133 Bacteria 1783
1117 Ga0307510_10112030 3300033180 Bacteria 2467
1118 Ga0373958_0002456 3300034819 Bacteria 2600
1119 Ga0373958_0005498 3300034819 Bacteria 1929
1120 Ga0373958_0027552 3300034819 Bacteria 1095
1121 Ga0373959_0007207 3300034820 Bacteria 1866
1122 Ga0373938_0022844 3300034957 Bacteria 1281
1123 Ga0373934_0040638 3300035086 Bacteria 1835
1124 Ga0373944_0018497 3300035089 Bacteria 1990
1125 Ga0373951_0014805 3300035091 Bacteria 1755
1126 Ga0373951_0037622 3300035091 Bacteria 1158
1127 Ga0373952_0002856 3300035092 Bacteria 3121
1128 Ga0373923_0025144 3300035111 Bacteria 2357
1129 Ga0373923_0027365 3300035111 Bacteria 2275
1130 Ga0373932_0024794 3300035112 Bacteria 1618
1131 Ga0373932_0085748 3300035112 Bacteria 1003
1132 Ga0373936_0051268 3300035113 Bacteria 1670
1133 Ga0373939_0047935 3300035114 Bacteria 1314
1134 Ga0373941_0006795 3300035115 Bacteria 2772
1135 Ga0373953_0062150 3300035117 Bacteria 1528
1136 Ga0373954_0002463 3300035118 Bacteria 7765
1137 Ga0373954_0008896 3300035118 Bacteria 4418
1138 Ga0373954_0062174 3300035118 Bacteria 1763
1139 Ga0373956_0009177 3300035119 Bacteria 4013
1140 Ga0373956_0081683 3300035119 Bacteria 1483
1141 Ga0373956_0148965 3300035119 Bacteria 1101
1142 Ga0373957_0036911 3300035120 Bacteria 1823
1143 Ga0373957_0123829 3300035120 Bacteria 1048
1144 Ga0373960_0010383 3300035121 Bacteria 2273
1145 Ga0373960_0035789 3300035121 Bacteria 1411
1146 Ga0373943_0058749 3300035170 Bacteria 1915
1147 Ga0373943_0121080 3300035170 Bacteria 1390
1148 Ga0373946_0004147 3300035171 Bacteria 5160
1149 Ga0373946_0064124 3300035171 Bacteria 1571
1150 Ga0373955_0003655 3300035172 Bacteria 6771
1151 Ga0373955_0006391 3300035172 Bacteria 5371
1152 Ga0373942_0003016 3300035207 Bacteria 3988
1153 Ga0373961_0001242 3300035241 Bacteria 7820
1154 Ga0373961_0072195 3300035241 Bacteria 1069
1155 Ga0373962_0021718 3300035242 Bacteria 1696
1156 Ga0373924_0069463 3300035410 Bacteria 1484
1157 Ga0373924_0134815 3300035410 Bacteria 1075
1158 Ga0373931_0007171 3300035691 Bacteria 5243
1159 Ga0373931_0008109 3300035691 Bacteria 4974
1160 Ga0373931_0010866 3300035691 Bacteria 4381
1161 Ga0373931_0012753 3300035691 Bacteria 4078
1162 Ga0373931_0023347 3300035691 Bacteria 3121
1163 Ga0373931_0036783 3300035691 Bacteria 2553
1164 Ga0373931_0129952 3300035691 Bacteria 1448
1165 Ga0373931_0256390 3300035691 Bacteria 1065
1166 Ga0373931_0277590 3300035691 Bacteria 1028
1167 Ga0373935_0007419 3300035692 Bacteria 6563
1168 Ga0373935_0076284 3300035692 Bacteria 2170
1169 Ga0373935_0143045 3300035692 Bacteria 1617
1170 Ga0373935_0360173 3300035692 Bacteria 1038
1171 Ga0373927_0000350 3300035695 Bacteria 36173
1172 Ga0373927_0024395 3300035695 Bacteria 3956
1173 Ga0373927_0030825 3300035695 Bacteria 3498
1174 Ga0373927_0066728 3300035695 Bacteria 2328
1175 Ga0373927_0067750 3300035695 Bacteria 2309
1176 Ga0373927_0178274 3300035695 Bacteria 1393
1177 Ga0373927_0393633 3300035695 Bacteria 914
1178 Ga0373933_0000453 3300035724 Bacteria 25662
1179 Ga0373933_0005374 3300035724 Bacteria 6978
1180 Ga0373933_0104901 3300035724 Bacteria 1757
1181 Ga0373933_0226022 3300035724 Bacteria 1201
1182 Ga0373947_0005323 3300035725 Bacteria 7521
1183 Ga0373947_0039019 3300035725 Bacteria 2824
1184 Ga0373947_0071387 3300035725 Bacteria 2129
1185 Ga0373947_0297126 3300035725 Bacteria 1076
1186 Ga0373947_0532081 3300035725 Bacteria 800
1187 Ga0373937_0001219 3300036401 Bacteria 21632
1188 Ga0373937_0003088 3300036401 Bacteria 13931
1189 Ga0373937_0012242 3300036401 Bacteria 7537
1190 Ga0373937_0118422 3300036401 Bacteria 2467
1191 Ga0373937_0155724 3300036401 Bacteria 2141
1192 Ga0373937_0184099 3300036401 Bacteria 1962
1193 Ga0373937_0379420 3300036401 Bacteria 1341
1194 Ga0316584_0036083 3300036712 Bacteria 3669
1195 Ga0373925_0010886 3300037068 Bacteria 6598
1196 Ga0373925_0032321 3300037068 Bacteria 3852
1197 Ga0373925_0064282 3300037068 Bacteria 2762
1198 Ga0373925_0071351 3300037068 Bacteria 2627
1199 Ga0373925_0512523 3300037068 Bacteria 985
1200 Ga0395899_0000026 3300037312 Bacteria 345291
1201 Ga0395899_0114348 3300037312 Bacteria 1938
1202 Ga0395900_0000047 3300037418 Bacteria 230039
1203 Ga0395900_0001503 3300037418 Bacteria 27700
1204 Ga0395900_0019723 3300037418 Bacteria 6873
1205 Ga0395900_0621338 3300037418 Bacteria 1019
1206 Ga0395898_0003490 3300037466 Bacteria 17566
1207 Ga0395898_0019076 3300037466 Bacteria 6982
1208 Ga0395898_0440253 3300037466 Bacteria 1242
1209 Ga0395905_0004886 3300037471 Bacteria 13809
1210 Ga0395905_0199259 3300037471 Bacteria 1877
1211 Ga0436364_0828448 3300037853 Bacteria 2076
1212 Ga0436364_1393239 3300037853 Bacteria 1312
1213 Ga0395901_0001226 3300038443 Bacteria 27345
1214 Ga0395901_0010022 3300038443 Bacteria 9606
1215 Ga0395901_0209231 3300038443 Bacteria 2042
1216 Ga0436365_0151785 3300039437 Bacteria 3389
1217 Ga0436365_0949599 3300039437 Bacteria 4110
1218 Ga0436365_1641058 3300039437 Bacteria 1253
1219 Ga0436360_0531912 3300039438 Bacteria 3041
1220 Ga0436360_0891854 3300039438 Bacteria 1088
1221 Ga0436360_1009514 3300039438 Bacteria 2524
1222 Ga0436360_1174607 3300039438 Bacteria 1131
1223 Ga0436361_0028081 3300039447 Bacteria 7090
1224 Ga0436361_0048059 3300039447 Bacteria 1058
1225 Ga0436361_0127711 3300039447 Bacteria 54547
1226 Ga0436361_0418153 3300039447 Bacteria 14745
1227 Ga0436361_0638552 3300039447 Bacteria 2457
1228 Ga0436361_0755574 3300039447 Bacteria 2362
1229 Ga0436361_0812671 3300039447 Bacteria 15022
1230 Ga0436361_0835659 3300039447 Bacteria 4102
1231 Ga0436361_0853416 3300039447 Bacteria 1859
1232 Ga0436361_0860938 3300039447 Bacteria 1780
1233 Ga0436361_0928183 3300039447 Bacteria 11188
1234 Ga0436361_1075749 3300039447 Bacteria 6232
1235 Ga0436361_1093023 3300039447 Bacteria 2086
1236 Ga0436363_0312802 3300039450 Bacteria 1471
1237 Ga0436363_0352027 3300039450 Bacteria 1806
1238 Ga0436363_0527007 3300039450 Bacteria 6832
1239 Ga0436363_0692197 3300039450 Bacteria 1745
1240 Ga0436363_1416910 3300039450 Bacteria 1043
1241 Ga0436362_0105602 3300039453 Bacteria 1052
1242 Ga0436362_0370297 3300039453 Bacteria 3311
1243 Ga0439436_0002769 3300041404 Bacteria 5304
1244 Ga0439438_059149 3300041405 Bacteria 962
1245 Ga0439439_0020708 3300041406 Bacteria 1636
1246 Ga0439453_0003335 3300041408 Bacteria 2304
1247 Ga0451789_0668365 3300041443 Bacteria 923
1248 Ga0451791_0920587 3300041451 Bacteria 727
1249 Ga0451798_0386068 3300041458 Bacteria 874
1250 Ga0451802_1418806 3300041460 Bacteria 992
1251 Ga0451837_0967515 3300041494 Bacteria 1155
1252 Ga0451845_0807564 3300041501 Bacteria 948
1253 Ga0451849_1239345 3300041505 Bacteria 1923
1254 Ga0451843_0494544 3300041509 Bacteria 2629
1255 Ga0451853_1654492 3300041512 Bacteria 3931
1256 Ga0439431_0019756 3300041997 Bacteria 1604
1257 Ga0439448_0015317 3300042005 Bacteria 2321
1258 Ga0450911_000479 3300042115 Bacteria 12822
1259 Ga0450919_000339 3300042121 Bacteria 5613
1260 Ga0450906_004168 3300042145 Bacteria 3051
1261 Ga0450918_002696 3300042531 Bacteria 3334
1262 Ga0466969_0002458 3300044656 Bacteria 9886
1263 Ga0466969_0014983 3300044656 Bacteria 4067
1264 Ga0466969_0079314 3300044656 Bacteria 1569
1265 Ga0466975_0221082 3300044661 Bacteria 1270
1266 Ga0466965_0028638 3300044683 Bacteria 2707
1267 Ga0466965_0170339 3300044683 Bacteria 1145
1268 Ga0466966_0010009 3300044684 Bacteria 6283
1269 Ga0466961_0001657 3300044693 Bacteria 13849
1270 Ga0466961_0001859 3300044693 Bacteria 13097
1271 Ga0466961_0114302 3300044693 Bacteria 1696
1272 Ga0466964_0031808 3300044706 Bacteria 2094
1273 Ga0466971_0008342 3300044719 Bacteria 4520
1274 Ga0466970_0008475 3300044765 Bacteria 5176
1275 Ga0466957_0003055 3300044842 Bacteria 9102
1276 Ga0466960_0011337 3300044901 Bacteria 3726
1277 Ga0466959_0006800 3300045049 Bacteria 7968
1278 Ga0466958_0023682 3300045836 Bacteria 3607
1279 Ga0466958_0029015 3300045836 Bacteria 3282
1280 Ga0495617_000012 3300046452 Bacteria 295916
1281 Ga0495617_010086 3300046452 Bacteria 3237
1282 Ga0495617_078309 3300046452 Bacteria 1084
1283 Ga0495627_000118 3300046453 Bacteria 99480
1284 Ga0495627_005412 3300046453 Bacteria 5151
1285 Ga0495627_018115 3300046453 Bacteria 2383
1286 Ga0495627_032407 3300046453 Bacteria 1645
1287 Ga0495592_0008756 3300046454 Bacteria 7597
1288 Ga0495592_0016393 3300046454 Bacteria 5621
1289 Ga0495592_0034159 3300046454 Bacteria 3834
1290 Ga0495592_0068643 3300046454 Bacteria 2587
1291 Ga0495592_0288772 3300046454 Bacteria 1070
1292 Ga0495603_0017270 3300046455 Bacteria 4368
1293 Ga0495603_0035288 3300046455 Bacteria 3004
1294 Ga0495603_0076850 3300046455 Bacteria 1959
1295 Ga0495603_0093450 3300046455 Bacteria 1758
1296 Ga0495603_0134206 3300046455 Bacteria 1441
1297 Ga0495590_0009969 3300046457 Bacteria 3591
1298 Ga0495591_050666 3300046458 Bacteria 1136
1299 Ga0495629_0004167 3300046459 Bacteria 10851
1300 Ga0495629_0004691 3300046459 Bacteria 10238
1301 Ga0495629_0007672 3300046459 Bacteria 7943
1302 Ga0495629_0010101 3300046459 Bacteria 6886
1303 Ga0495629_0071685 3300046459 Bacteria 2418
1304 Ga0495629_0095264 3300046459 Bacteria 2077
1305 Ga0495629_0096585 3300046459 Bacteria 2061
1306 Ga0495629_0319679 3300046459 Bacteria 1061
1307 Ga0495629_0406119 3300046459 Bacteria 925
1308 Ga0495638_0000112 3300046460 Bacteria 130876
1309 Ga0495638_0002403 3300046460 Bacteria 15322
1310 Ga0495638_0011651 3300046460 Bacteria 6055
1311 Ga0495638_0015128 3300046460 Bacteria 5190
1312 Ga0495638_0039643 3300046460 Bacteria 2989
1313 Ga0495638_0113675 3300046460 Bacteria 1606
1314 Ga0495641_0017267 3300046461 Bacteria 3765
1315 Ga0495641_0049229 3300046461 Bacteria 1930
1316 Ga0495641_0063864 3300046461 Bacteria 1658
1317 Ga0495651_0003142 3300046462 Bacteria 12720
1318 Ga0495651_0003731 3300046462 Bacteria 11665
1319 Ga0495651_0019238 3300046462 Bacteria 5292
1320 Ga0495651_0042479 3300046462 Bacteria 3530
1321 Ga0495651_0065262 3300046462 Bacteria 2780
1322 Ga0495651_0204534 3300046462 Bacteria 1379
1323 Ga0495653_0000858 3300046463 Bacteria 23442
1324 Ga0495653_0006293 3300046463 Bacteria 9738
1325 Ga0495653_0008376 3300046463 Bacteria 8475
1326 Ga0495653_0019501 3300046463 Bacteria 5499
1327 Ga0495653_0111278 3300046463 Bacteria 1967
1328 Ga0495653_0286619 3300046463 Bacteria 1079
1329 Ga0495650_0067134 3300046471 Bacteria 1418
1330 Ga0495580_0000454 3300046472 Bacteria 33966
1331 Ga0495580_0081541 3300046472 Bacteria 2254
1332 Ga0495580_0196177 3300046472 Bacteria 1392
1333 Ga0495582_0002722 3300046473 Bacteria 9875
1334 Ga0495582_0008025 3300046473 Bacteria 5827
1335 Ga0495582_0066256 3300046473 Bacteria 1995
1336 Ga0495582_0124021 3300046473 Bacteria 1457
1337 Ga0495582_0243164 3300046473 Bacteria 1031
1338 Ga0495582_0333198 3300046473 Bacteria 874
1339 Ga0495605_0000072 3300046474 Bacteria 133731
1340 Ga0495605_0002665 3300046474 Bacteria 10921
1341 Ga0495605_0006147 3300046474 Bacteria 6921
1342 Ga0495605_0008015 3300046474 Bacteria 5979
1343 Ga0495605_0054683 3300046474 Bacteria 1932
1344 Ga0495639_0066508 3300046475 Bacteria 1659
1345 Ga0495662_0007894 3300046476 Bacteria 5240
1346 Ga0495662_0020129 3300046476 Bacteria 3229
1347 Ga0495662_0080776 3300046476 Bacteria 1581
1348 Ga0495662_0135497 3300046476 Bacteria 1211
1349 Ga0495662_0168840 3300046476 Bacteria 1078
1350 Ga0495664_0001899 3300046477 Bacteria 11114
1351 Ga0495664_0002840 3300046477 Bacteria 9325
1352 Ga0495664_0032858 3300046477 Bacteria 3047
1353 Ga0495664_0114409 3300046477 Bacteria 1630
1354 Ga0495584_0001725 3300046491 Bacteria 12782
1355 Ga0495584_0011234 3300046491 Bacteria 4586
1356 Ga0495584_0095832 3300046491 Bacteria 1498
1357 Ga0495584_0216217 3300046491 Bacteria 974
1358 Ga0495585_0056771 3300046492 Bacteria 2162
1359 Ga0495585_0127873 3300046492 Bacteria 1339
1360 Ga0495594_0015588 3300046499 Bacteria 3995
1361 Ga0495594_0029906 3300046499 Bacteria 2945
1362 Ga0495594_0062099 3300046499 Bacteria 2069
1363 Ga0495594_0169618 3300046499 Bacteria 1241
1364 Ga0495596_0000124 3300046500 Bacteria 53005
1365 Ga0495596_0013465 3300046500 Bacteria 3469
1366 Ga0495607_0002863 3300046501 Bacteria 13664
1367 Ga0495607_0100506 3300046501 Bacteria 1550
1368 Ga0495583_0009595 3300046506 Bacteria 5764
1369 Ga0495606_0000134 3300046507 Bacteria 125913
1370 Ga0495608_0001345 3300046511 Bacteria 17527
1371 Ga0495608_0012348 3300046511 Bacteria 5931
1372 Ga0495608_0027649 3300046511 Bacteria 3858
1373 Ga0495610_0008493 3300046512 Bacteria 6640
1374 Ga0495616_0001928 3300046513 Bacteria 13957
1375 Ga0495616_0004850 3300046513 Bacteria 8422
1376 Ga0495616_0013540 3300046513 Bacteria 4597
1377 Ga0495616_0014929 3300046513 Bacteria 4333
1378 Ga0495616_0043171 3300046513 Bacteria 2291
1379 Ga0495616_0206606 3300046513 Bacteria 861
1380 Ga0495618_0004528 3300046514 Bacteria 8540
1381 Ga0495618_0006192 3300046514 Bacteria 7257
1382 Ga0495618_0019953 3300046514 Bacteria 4125
1383 Ga0495618_0027957 3300046514 Bacteria 3513
1384 Ga0495618_0037853 3300046514 Bacteria 3030
1385 Ga0495618_0131332 3300046514 Bacteria 1602
1386 Ga0495620_0028522 3300046515 Bacteria 2595
1387 Ga0495620_0135337 3300046515 Bacteria 965
1388 Ga0495628_0014868 3300046516 Bacteria 6509
1389 Ga0495628_0032039 3300046516 Bacteria 4247
1390 Ga0495628_0040628 3300046516 Bacteria 3715
1391 Ga0495628_0047209 3300046516 Bacteria 3417
1392 Ga0495628_0047576 3300046516 Bacteria 3402
1393 Ga0495628_0290968 3300046516 Bacteria 1211
1394 Ga0495630_0001787 3300046517 Bacteria 15022
1395 Ga0495630_0062504 3300046517 Bacteria 2797
1396 Ga0495630_0074315 3300046517 Bacteria 2560
1397 Ga0495630_0273150 3300046517 Bacteria 1291
1398 Ga0495630_0451649 3300046517 Bacteria 985
1399 Ga0495630_0520008 3300046517 Bacteria 912
1400 Ga0495630_0566084 3300046517 Bacteria 871
1401 Ga0495631_0002075 3300046518 Bacteria 11654
1402 Ga0495631_0002621 3300046518 Bacteria 10044
1403 Ga0495631_0034872 3300046518 Bacteria 2253
1404 Ga0495631_0063240 3300046518 Bacteria 1603
1405 Ga0495637_0000813 3300046520 Bacteria 20603
1406 Ga0495643_0004593 3300046522 Bacteria 9610
1407 Ga0495643_0024947 3300046522 Bacteria 3387
1408 Ga0495643_0202120 3300046522 Bacteria 953
1409 Ga0495644_0001837 3300046523 Bacteria 8560
1410 Ga0495644_0005452 3300046523 Bacteria 4971
1411 Ga0495644_0010415 3300046523 Bacteria 3583
1412 Ga0495644_0035468 3300046523 Bacteria 1883
1413 Ga0495648_0000116 3300046524 Bacteria 98123
1414 Ga0495648_0004656 3300046524 Bacteria 11634
1415 Ga0495648_0058086 3300046524 Bacteria 2315
1416 Ga0495648_0080473 3300046524 Bacteria 1856
1417 Ga0495663_0008509 3300046525 Bacteria 2844
1418 Ga0495666_0002793 3300046526 Bacteria 8728
1419 Ga0495666_0011471 3300046526 Bacteria 4418
1420 Ga0495666_0056339 3300046526 Bacteria 1883
1421 Ga0495642_0000010 3300046528 Bacteria 136557
1422 Ga0495642_0002701 3300046528 Bacteria 7128
1423 Ga0495642_0013318 3300046528 Bacteria 3179
1424 Ga0495642_0165124 3300046528 Bacteria 961
1425 Ga0495652_0003110 3300046529 Bacteria 16584
1426 Ga0495652_0008953 3300046529 Bacteria 9109
1427 Ga0495652_0012748 3300046529 Bacteria 7572
1428 Ga0495652_0054659 3300046529 Bacteria 3399
1429 Ga0495652_0076648 3300046529 Bacteria 2773
1430 Ga0495654_0015441 3300046530 Bacteria 4054
1431 Ga0495654_0017612 3300046530 Bacteria 3751
1432 Ga0495654_0176708 3300046530 Bacteria 927
1433 Ga0495665_0003008 3300046531 Bacteria 9109
1434 Ga0495665_0070498 3300046531 Bacteria 1842
1435 Ga0495665_0155024 3300046531 Bacteria 1195
1436 Ga0495640_0000872 3300046533 Bacteria 23105
1437 Ga0495640_0005321 3300046533 Bacteria 10230
1438 Ga0495640_0015206 3300046533 Bacteria 5795
1439 Ga0495640_0022059 3300046533 Bacteria 4662
1440 Ga0495640_0022510 3300046533 Bacteria 4603
1441 Ga0495640_0036578 3300046533 Bacteria 3468
1442 Ga0495640_0064077 3300046533 Bacteria 2486
1443 Ga0495640_0124925 3300046533 Bacteria 1669
1444 Ga0495586_0019213 3300046535 Bacteria 3634
1445 Ga0495586_0034358 3300046535 Bacteria 2723
1446 Ga0495587_0005549 3300046536 Bacteria 8231
1447 Ga0495587_0011186 3300046536 Bacteria 5690
1448 Ga0495587_0019846 3300046536 Bacteria 4154
1449 Ga0495587_0031092 3300046536 Bacteria 3235
1450 Ga0495587_0070193 3300046536 Bacteria 2039
1451 Ga0495598_0048824 3300046537 Bacteria 1267
1452 Ga0495609_0001620 3300046538 Bacteria 14683
1453 Ga0495609_0047891 3300046538 Bacteria 1912
1454 Ga0495609_0161812 3300046538 Bacteria 948
1455 Ga0495597_0000892 3300046542 Bacteria 23251
1456 Ga0495597_0076441 3300046542 Bacteria 1436
1457 Ga0495597_0176235 3300046542 Bacteria 866
1458 Ga0495645_0011301 3300046543 Bacteria 6278
1459 Ga0495645_0019552 3300046543 Bacteria 4875
1460 Ga0495645_0133153 3300046543 Bacteria 1740
1461 Ga0495622_0001829 3300046557 Bacteria 10497
1462 Ga0495622_0002339 3300046557 Bacteria 9223
1463 Ga0495622_0003505 3300046557 Bacteria 7396
1464 Ga0495633_0003061 3300046558 Bacteria 11377
1465 Ga0495633_0126257 3300046558 Bacteria 1184
1466 Ga0495667_0002046 3300046559 Bacteria 13379
1467 Ga0495667_0005031 3300046559 Bacteria 8934
1468 Ga0495667_0007416 3300046559 Bacteria 7436
1469 Ga0495667_0009714 3300046559 Bacteria 6518
1470 Ga0495656_0001373 3300046615 Bacteria 7961
1471 Ga0495656_0005200 3300046615 Bacteria 4487
1472 Ga0495656_0025740 3300046615 Bacteria 2335
1473 Ga0495656_0052512 3300046615 Bacteria 1748
1474 Ga0495668_0000532 3300046616 Bacteria 47353
1475 Ga0495668_0003038 3300046616 Bacteria 13063
1476 Ga0495668_0032299 3300046616 Bacteria 2946
1477 Ga0495668_0078854 3300046616 Bacteria 1808
1478 Ga0495668_0128930 3300046616 Bacteria 1385
1479 Ga0495634_0002066 3300046642 Bacteria 16986
1480 Ga0495634_0002970 3300046642 Bacteria 13832
1481 Ga0495634_0006796 3300046642 Bacteria 8661
1482 Ga0495634_0024940 3300046642 Bacteria 4191
1483 Ga0495634_0035741 3300046642 Bacteria 3400
1484 Ga0495611_0010389 3300046648 Bacteria 3939
1485 Ga0495611_0019049 3300046648 Bacteria 2947
1486 Ga0495611_0047800 3300046648 Bacteria 1921
1487 Ga0495611_0066321 3300046648 Bacteria 1646
1488 Ga0495611_0173094 3300046648 Bacteria 1009
1489 Ga0495625_0012893 3300046660 Bacteria 6754
1490 Ga0495625_0121343 3300046660 Bacteria 1778
1491 Ga0495625_0142544 3300046660 Bacteria 1616
1492 Ga0495625_0166412 3300046660 Bacteria 1474
1493 Ga0495625_0240300 3300046660 Bacteria 1179
1494 Ga0495625_0323007 3300046660 Bacteria 982
1495 Ga0495635_0000696 3300046663 Bacteria 21692
1496 Ga0495635_0001315 3300046663 Bacteria 16546
1497 Ga0495635_0004092 3300046663 Bacteria 10123
1498 Ga0495635_0040985 3300046663 Bacteria 3199
1499 Ga0495635_0055139 3300046663 Bacteria 2738
1500 Ga0495635_0062991 3300046663 Bacteria 2547
1501 Ga0495635_0184885 3300046663 Bacteria 1416
1502 Ga0495635_0334767 3300046663 Bacteria 1011
1503 Ga0495659_0020746 3300046664 Bacteria 2210
1504 Ga0495661_0007951 3300046665 Bacteria 7363
1505 Ga0495661_0017548 3300046665 Bacteria 4724
1506 Ga0495661_0063945 3300046665 Bacteria 2173
1507 Ga0495588_0028816 3300046674 Bacteria 2782
1508 Ga0495588_0128157 3300046674 Bacteria 1338
1509 Ga0495657_0002369 3300046675 Bacteria 15864
1510 Ga0495657_0007156 3300046675 Bacteria 8656
1511 Ga0495657_0026208 3300046675 Bacteria 4129
1512 Ga0495599_0002774 3300046678 Bacteria 10217
1513 Ga0495599_0014101 3300046678 Bacteria 4948
1514 Ga0495599_0031932 3300046678 Bacteria 3305
1515 Ga0495599_0332346 3300046678 Bacteria 913
1516 Ga0495623_0002608 3300046679 Bacteria 11902
1517 Ga0495623_0012517 3300046679 Bacteria 5488
1518 Ga0495623_0016001 3300046679 Bacteria 4848
1519 Ga0495646_0004205 3300046680 Bacteria 9049
1520 Ga0495646_0017000 3300046680 Bacteria 4618
1521 Ga0495646_0024712 3300046680 Bacteria 3782
1522 Ga0495646_0035564 3300046680 Bacteria 3089
1523 Ga0495647_0011776 3300046681 Bacteria 3001
1524 Ga0495647_0026257 3300046681 Bacteria 2132
1525 Ga0495647_0087113 3300046681 Bacteria 1275
1526 Ga0495658_0002624 3300046683 Bacteria 9028
1527 Ga0495658_0029920 3300046683 Bacteria 2952
1528 Ga0495658_0074464 3300046683 Bacteria 1979
1529 Ga0495658_0190627 3300046683 Bacteria 1274
1530 Ga0495669_0008673 3300046684 Bacteria 4280
1531 Ga0495669_0010922 3300046684 Bacteria 3843
1532 Ga0495669_0013424 3300046684 Bacteria 3490
1533 Ga0495669_0034773 3300046684 Bacteria 2222
1534 Ga0495613_0007671 3300046689 Bacteria 8030
1535 Ga0495613_0033396 3300046689 Bacteria 3824
1536 Ga0495613_0093555 3300046689 Bacteria 2176
1537 Ga0495613_0173871 3300046689 Bacteria 1527
1538 Ga0495613_0201381 3300046689 Bacteria 1403
1539 Ga0495613_0250465 3300046689 Bacteria 1236
1540 Ga0495613_0322582 3300046689 Bacteria 1066
1541 Ga0495624_0023551 3300046690 Bacteria 4060
1542 Ga0495624_0025805 3300046690 Bacteria 3855
1543 Ga0495624_0177805 3300046690 Bacteria 1297
1544 Ga0495624_0218682 3300046690 Bacteria 1155
1545 Ga0495670_0017003 3300046691 Bacteria 3576
1546 Ga0495670_0191988 3300046691 Bacteria 1080
1547 Ga0495670_0259471 3300046691 Bacteria 927
1548 Ga0495671_0000092 3300046692 Bacteria 85232
1549 Ga0495671_0002678 3300046692 Bacteria 11159
1550 Ga0495671_0003738 3300046692 Bacteria 9258
1551 Ga0495671_0208591 3300046692 Bacteria 947
1552 Ga0495649_0000173 3300046694 Bacteria 56514
1553 Ga0495589_0000654 3300046794 Bacteria 22704
1554 Ga0495589_0002574 3300046794 Bacteria 10081
1555 Ga0495589_0009631 3300046794 Bacteria 5024
1556 Ga0495589_0012369 3300046794 Bacteria 4421
1557 Ga0495589_0027440 3300046794 Bacteria 2879
1558 Ga0495600_0005115 3300046809 Bacteria 7883
1559 Ga0495600_0007220 3300046809 Bacteria 6781
1560 Ga0495600_0023950 3300046809 Bacteria 3929
1561 Ga0495600_0027544 3300046809 Bacteria 3672
1562 Ga0495600_0126790 3300046809 Bacteria 1660
1563 Ga0495600_0177075 3300046809 Bacteria 1375
1564 Ga0495660_0038746 3300046810 Bacteria 2649
1565 Ga0495581_0000308 3300047315 Bacteria 23951
1566 Ga0495581_0079626 3300047315 Bacteria 1896
1567 Ga0495581_0211933 3300047315 Bacteria 1133
1568 Ga0495604_0001434 3300047317 Bacteria 19575
1569 Ga0495604_0004757 3300047317 Bacteria 10753
1570 Ga0495604_0040252 3300047317 Bacteria 3670
1571 Ga0495674_0003647 3300047319 Bacteria 14991
1572 Ga0495674_0003993 3300047319 Bacteria 14303
1573 Ga0495674_0007036 3300047319 Bacteria 10762
1574 Ga0495674_0023927 3300047319 Bacteria 5621
1575 Ga0495674_0060276 3300047319 Bacteria 3311
1576 Ga0495674_0069315 3300047319 Bacteria 3049
1577 Ga0495674_0113100 3300047319 Bacteria 2299
1578 Ga0495674_0270518 3300047319 Bacteria 1394
1579 Ga0495672_0017758 3300047320 Bacteria 4747
1580 Ga0495672_0032659 3300047320 Bacteria 3234
1581 Ga0495672_0110274 3300047320 Bacteria 1478
1582 Ga0495676_0000007 3300047321 Bacteria 276148
1583 Ga0495676_0011866 3300047321 Bacteria 7860
1584 Ga0495676_0029229 3300047321 Bacteria 4695
1585 Ga0495676_0069462 3300047321 Bacteria 2718
1586 Ga0495676_0132800 3300047321 Bacteria 1794
1587 Ga0495680_0000697 3300047322 Bacteria 37654
1588 Ga0495680_0003025 3300047322 Bacteria 16764
1589 Ga0495680_0008817 3300047322 Bacteria 9134
1590 Ga0495680_0018135 3300047322 Bacteria 5985
1591 Ga0495680_0033222 3300047322 Bacteria 4178
1592 Ga0495680_0040717 3300047322 Bacteria 3700
1593 Ga0495683_0042513 3300047323 Bacteria 2291
1594 Ga0495687_160705 3300047443 Bacteria 756
1595 Ga0495675_0002629 3300047444 Bacteria 10762
1596 Ga0495675_0011045 3300047444 Bacteria 5661
1597 Ga0495675_0024081 3300047444 Bacteria 3879
1598 Ga0495677_0000066 3300047445 Bacteria 56474
1599 Ga0495677_0000939 3300047445 Bacteria 11743
1600 Ga0495677_0007123 3300047445 Bacteria 4187
1601 Ga0495677_0010194 3300047445 Bacteria 3455
1602 Ga0495677_0042722 3300047445 Bacteria 1661
1603 Ga0495679_000300 3300047446 Bacteria 39860
1604 Ga0495685_046647 3300047447 Bacteria 1474
1605 Ga0495673_0002113 3300047469 Bacteria 14440
1606 Ga0495681_0010115 3300047470 Bacteria 5737
1607 Ga0495684_0000696 3300047471 Bacteria 26991
1608 Ga0495684_0026111 3300047471 Bacteria 4490
1609 Ga0495684_0032388 3300047471 Bacteria 4013
1610 Ga0495684_0314890 3300047471 Bacteria 1120
1611 Ga0495684_0332372 3300047471 Bacteria 1083
1612 Ga0495686_0001244 3300047472 Bacteria 29045
1613 Ga0495593_0007328 3300047673 Bacteria 6463
1614 Ga0495593_0058710 3300047673 Bacteria 2017
1615 Ga0495593_0063353 3300047673 Bacteria 1931
1616 Ga0495602_0002150 3300048088 Bacteria 19896
1617 Ga0495602_0013408 3300048088 Bacteria 8377
1618 Ga0495602_0021271 3300048088 Bacteria 6391
1619 Ga0495602_0204247 3300048088 Bacteria 1505
1620 Ga0495602_0277133 3300048088 Bacteria 1237
1621 Ga0495602_0450637 3300048088 Bacteria 908
1622 Ga0495614_0005257 3300048089 Bacteria 5838
1623 Ga0495614_0058997 3300048089 Bacteria 1648
1624 Ga0495614_0120256 3300048089 Bacteria 1158
1625 Ga0495614_0127077 3300048089 Bacteria 1126
1626 Ga0495614_0310991 3300048089 Bacteria 729
1627 Ga0495626_0015838 3300048091 Bacteria 3848
1628 Ga0495626_0024780 3300048091 Bacteria 2937
1629 Ga0496100_0006802 3300048903 Bacteria 6265
1630 Ga0496100_0045441 3300048903 Bacteria 2819
1631 Ga0496100_0064371 3300048903 Bacteria 2426
1632 Ga0496100_0090601 3300048903 Bacteria 2085
1633 Ga0496100_0139069 3300048903 Bacteria 1719
1634 Ga0496100_0208142 3300048903 Bacteria 1429
1635 Ga0496100_0435515 3300048903 Bacteria 1003
1636 Ga0496100_0469418 3300048903 Bacteria 967
1637 Ga0496101_0008609 3300048904 Bacteria 6670
1638 Ga0496101_0009760 3300048904 Bacteria 6319
1639 Ga0496101_0018267 3300048904 Bacteria 4767
1640 Ga0496101_0020712 3300048904 Bacteria 4509
1641 Ga0496101_0023566 3300048904 Bacteria 4254
1642 Ga0496101_0057291 3300048904 Bacteria 2818
1643 Ga0496101_0061606 3300048904 Bacteria 2725
1644 Ga0496101_0114106 3300048904 Bacteria 2037
1645 Ga0496101_0155871 3300048904 Bacteria 1749
1646 Ga0496101_0161084 3300048904 Bacteria 1720
1647 Ga0496101_0221864 3300048904 Bacteria 1467
1648 Ga0496101_0229944 3300048904 Bacteria 1441
1649 Ga0496101_0421438 3300048904 Bacteria 1052
1650 Ga0496102_0018387 3300048905 Bacteria 6141
1651 Ga0496102_0022286 3300048905 Bacteria 5612
1652 Ga0496102_0031350 3300048905 Bacteria 4768
1653 Ga0496102_0032411 3300048905 Bacteria 4693
1654 Ga0496102_0034017 3300048905 Bacteria 4583
1655 Ga0496102_0034379 3300048905 Bacteria 4558
1656 Ga0496102_0071555 3300048905 Bacteria 3184
1657 Ga0496102_0093560 3300048905 Bacteria 2784
1658 Ga0496102_0094360 3300048905 Bacteria 2772
1659 Ga0496102_0137229 3300048905 Bacteria 2292
1660 Ga0496102_0169809 3300048905 Bacteria 2053
1661 Ga0496102_0223604 3300048905 Bacteria 1775
1662 Ga0496102_0304882 3300048905 Bacteria 1501
1663 Ga0496102_0419678 3300048905 Bacteria 1257
1664 Ga0496102_0480880 3300048905 Bacteria 1163
1665 Ga0496102_0517654 3300048905 Bacteria 1115
1666 Ga0496103_0004445 3300048906 Bacteria 8503
1667 Ga0496103_0015631 3300048906 Bacteria 4522
1668 Ga0496103_0024209 3300048906 Bacteria 3662
1669 Ga0496103_0027729 3300048906 Bacteria 3434
1670 Ga0496103_0055714 3300048906 Bacteria 2452
1671 Ga0496103_0058180 3300048906 Bacteria 2401
1672 Ga0496103_0065344 3300048906 Bacteria 2269
1673 Ga0496104_0000138 3300048907 Bacteria 67803
1674 Ga0496104_0003625 3300048907 Bacteria 13338
1675 Ga0496104_0003883 3300048907 Bacteria 12932
1676 Ga0496104_0003891 3300048907 Bacteria 12924
1677 Ga0496104_0004923 3300048907 Bacteria 11650
1678 Ga0496104_0014708 3300048907 Bacteria 7071
1679 Ga0496104_0092589 3300048907 Bacteria 2890
1680 Ga0496104_0129111 3300048907 Bacteria 2427
1681 Ga0496104_0138666 3300048907 Bacteria 2337
1682 Ga0496104_0333943 3300048907 Bacteria 1429
1683 Ga0496104_0347063 3300048907 Bacteria 1397
1684 Ga0496105_0000100 3300048908 Bacteria 58110
1685 Ga0496105_0001322 3300048908 Bacteria 17343
1686 Ga0496105_0002213 3300048908 Bacteria 14093
1687 Ga0496105_0023569 3300048908 Bacteria 4993
1688 Ga0496105_0030005 3300048908 Bacteria 4454
1689 Ga0496105_0036542 3300048908 Bacteria 4046
1690 Ga0496105_0037172 3300048908 Bacteria 4010
1691 Ga0496105_0060095 3300048908 Bacteria 3135
1692 Ga0496105_0072250 3300048908 Bacteria 2852
1693 Ga0496105_0121306 3300048908 Bacteria 2155
1694 Ga0496105_0400543 3300048908 Bacteria 1089
1695 Ga0496106_0000001 3300048909 Bacteria 497458
1696 Ga0496106_0000763 3300048909 Bacteria 23263
1697 Ga0496106_0010825 3300048909 Bacteria 6740
1698 Ga0496106_0034181 3300048909 Bacteria 3797
1699 Ga0496106_0054424 3300048909 Bacteria 3023
1700 Ga0496106_0056595 3300048909 Bacteria 2964
1701 Ga0496106_0079508 3300048909 Bacteria 2517
1702 Ga0496106_0106246 3300048909 Bacteria 2182
1703 Ga0496106_0109146 3300048909 Bacteria 2153
1704 Ga0496106_0109305 3300048909 Bacteria 2151
1705 Ga0496106_0207849 3300048909 Bacteria 1559
1706 Ga0496106_0273851 3300048909 Bacteria 1352
1707 Ga0496107_0002458 3300048910 Bacteria 12020
1708 Ga0496107_0022544 3300048910 Bacteria 4449
1709 Ga0496107_0024599 3300048910 Bacteria 4260
1710 Ga0496107_0037478 3300048910 Bacteria 3479
1711 Ga0496107_0052994 3300048910 Bacteria 2926
1712 Ga0496107_0119764 3300048910 Bacteria 1939
1713 Ga0496107_0248666 3300048910 Bacteria 1323
1714 Ga0496107_0273052 3300048910 Bacteria 1258
1715 Ga0496107_0535661 3300048910 Bacteria 868
1716 Ga0496108_0002238 3300048911 Bacteria 15499
1717 Ga0496108_0012386 3300048911 Bacteria 6939
1718 Ga0496108_0053995 3300048911 Bacteria 3371
1719 Ga0496108_0110007 3300048911 Bacteria 2355
1720 Ga0496108_0132968 3300048911 Bacteria 2138
1721 Ga0496108_0263615 3300048911 Bacteria 1499
1722 Ga0496108_0462275 3300048911 Bacteria 1109
1723 Ga0496108_0618334 3300048911 Bacteria 943
1724 Ga0496109_0002809 3300048912 Bacteria 14583
1725 Ga0496109_0015267 3300048912 Bacteria 6687
1726 Ga0496109_0031863 3300048912 Bacteria 4735
1727 Ga0496109_0048271 3300048912 Bacteria 3873
1728 Ga0496109_0123466 3300048912 Bacteria 2413
1729 Ga0496109_0147505 3300048912 Bacteria 2201
1730 Ga0496109_0223610 3300048912 Bacteria 1770
1731 Ga0496109_0465971 3300048912 Bacteria 1193
1732 Ga0496110_0024038 3300048913 Bacteria 5191
1733 Ga0496110_0024415 3300048913 Bacteria 5152
1734 Ga0496110_0033606 3300048913 Bacteria 4438
1735 Ga0496110_0069778 3300048913 Bacteria 3113
1736 Ga0496110_0116400 3300048913 Bacteria 2406
1737 Ga0496110_0141465 3300048913 Bacteria 2175
1738 Ga0496110_0296562 3300048913 Bacteria 1473
1739 Ga0496110_0310470 3300048913 Bacteria 1436
1740 Ga0496110_0332341 3300048913 Bacteria 1384
1741 Ga0496110_0502085 3300048913 Bacteria 1104
1742 Ga0496111_0036092 3300048914 Bacteria 3534
1743 Ga0496111_0038968 3300048914 Bacteria 3405
1744 Ga0496111_0065352 3300048914 Bacteria 2640
1745 Ga0496111_0090167 3300048914 Bacteria 2246
1746 Ga0496111_0091598 3300048914 Bacteria 2228
1747 Ga0496111_0250611 3300048914 Bacteria 1314
1748 Ga0496111_0306932 3300048914 Bacteria 1176
1749 Ga0496111_0491646 3300048914 Bacteria 903
1750 Ga0496112_0015135 3300048915 Bacteria 7187
1751 Ga0496112_0033514 3300048915 Bacteria 4993
1752 Ga0496112_0049166 3300048915 Bacteria 4133
1753 Ga0496112_0063585 3300048915 Bacteria 3640
1754 Ga0496112_0064350 3300048915 Bacteria 3619
1755 Ga0496112_0067706 3300048915 Bacteria 3524
1756 Ga0496112_0079515 3300048915 Bacteria 3243
1757 Ga0496112_0142576 3300048915 Bacteria 2365
1758 Ga0496112_0187265 3300048915 Bacteria 2033
1759 Ga0496112_0241931 3300048915 Bacteria 1757
1760 Ga0496112_0635042 3300048915 Bacteria 998
1761 Ga0496112_0811694 3300048915 Bacteria 860
1762 Ga0496113_0001266 3300048916 Bacteria 13932
1763 Ga0496113_0045105 3300048916 Bacteria 3268
1764 Ga0496113_0046997 3300048916 Bacteria 3206
1765 Ga0496113_0085093 3300048916 Bacteria 2429
1766 Ga0496113_0129432 3300048916 Bacteria 1979
1767 Ga0496113_0272275 3300048916 Bacteria 1353
1768 Ga0496114_0009768 3300048917 Bacteria 7622
1769 Ga0496114_0018456 3300048917 Bacteria 5639
1770 Ga0496114_0039940 3300048917 Bacteria 3883
1771 Ga0496114_0093360 3300048917 Bacteria 2558
1772 Ga0496114_0115348 3300048917 Bacteria 2305
1773 Ga0496114_0115833 3300048917 Bacteria 2300
1774 Ga0496114_0117527 3300048917 Bacteria 2284
1775 Ga0496114_0163724 3300048917 Bacteria 1935
1776 Ga0496114_0450660 3300048917 Bacteria 1140
1777 Ga0496114_0474501 3300048917 Bacteria 1107
1778 Ga0496114_0555391 3300048917 Bacteria 1014
1779 Ga0496114_0736974 3300048917 Bacteria 862
1780 Ga0496115_0000608 3300048918 Bacteria 27307
1781 Ga0496115_0021975 3300048918 Bacteria 4934
1782 Ga0496115_0022583 3300048918 Bacteria 4877
1783 Ga0496115_0028515 3300048918 Bacteria 4377
1784 Ga0496115_0052402 3300048918 Bacteria 3273
1785 Ga0496115_0069119 3300048918 Bacteria 2860
1786 Ga0496115_0093601 3300048918 Bacteria 2457
1787 Ga0496115_0098438 3300048918 Bacteria 2395
1788 Ga0496115_0108045 3300048918 Bacteria 2284
1789 Ga0496115_0177138 3300048918 Bacteria 1763
1790 Ga0496115_0189624 3300048918 Bacteria 1698
1791 Ga0496115_0195672 3300048918 Bacteria 1670
1792 Ga0496115_0246875 3300048918 Bacteria 1470
1793 Ga0496115_0289646 3300048918 Bacteria 1343
1794 Ga0496115_0389215 3300048918 Bacteria 1132
1795 Ga0496116_0029838 3300048919 Bacteria 3925
1796 Ga0496117_0020744 3300048920 Bacteria 5347
1797 Ga0496117_0183564 3300048920 Bacteria 1199
1798 Ga0496118_0002912 3300048921 Bacteria 22251
1799 Ga0496118_0009889 3300048921 Bacteria 9537
1800 Ga0496118_0043712 3300048921 Bacteria 3517
1801 Ga0496119_0003321 3300048922 Bacteria 16786
1802 Ga0496119_0003757 3300048922 Bacteria 15541
1803 Ga0496119_0128043 3300048922 Bacteria 1387
1804 Ga0496119_0138127 3300048922 Bacteria 1319
1805 Ga0496120_0027850 3300048923 Bacteria 3470
1806 Ga0496121_0001975 3300048924 Bacteria 32578
1807 Ga0496121_0020294 3300048924 Bacteria 6587
1808 Ga0496121_0024049 3300048924 Bacteria 5838
1809 Ga0496121_0039430 3300048924 Bacteria 4163
1810 Ga0496121_0055248 3300048924 Bacteria 3310
1811 Ga0496121_0067710 3300048924 Bacteria 2892
1812 Ga0496121_0093819 3300048924 Bacteria 2336
1813 Ga0496121_0150065 3300048924 Bacteria 1716
1814 Ga0496121_0458540 3300048924 Bacteria 819
1815 Ga0496122_0089213 3300048925 Bacteria 2109
1816 Ga0496122_0170236 3300048925 Bacteria 1314
1817 Ga0496123_0009179 3300048926 Bacteria 8941
1818 Ga0496123_0051410 3300048926 Bacteria 2744
1819 Ga0496124_0040078 3300048927 Bacteria 4054
1820 Ga0496124_0069053 3300048927 Bacteria 2935
1821 Ga0496124_0215429 3300048927 Bacteria 1449
1822 Ga0496125_0002262 3300048928 Bacteria 25557
1823 Ga0496125_0015921 3300048928 Bacteria 7243
1824 Ga0496125_0016127 3300048928 Bacteria 7186
1825 Ga0496125_0027260 3300048928 Bacteria 5183
1826 Ga0496125_0052757 3300048928 Bacteria 3341
1827 Ga0496125_0125656 3300048928 Bacteria 1818
1828 Ga0496125_0144161 3300048928 Bacteria 1650
1829 Ga0496125_0170523 3300048928 Bacteria 1464
1830 Ga0496126_0010072 3300048929 Bacteria 9972
1831 Ga0496126_0089885 3300048929 Bacteria 2702
1832 Ga0496126_0112604 3300048929 Bacteria 2369
1833 Ga0496126_0126748 3300048929 Bacteria 2209
1834 Ga0495678_027259 3300049459 Bacteria 2426
1835 Ga0495682_0008940 3300049460 Bacteria 3928
1836 Ga0501031_0164108 3300049568 Bacteria 1452
1837 Ga0501032_0170654 3300049569 Bacteria 1427
1838 Ga0501034_0080607 3300049571 Bacteria 3258
1839 Ga0501036_0021406 3300049572 Bacteria 5436
1840 Ga0501037_0069565 3300049573 Bacteria 2562
1841 Ga0501038_0100362 3300049574 Bacteria 2412
1842 Ga0501039_0082173 3300049575 Bacteria 2508
1843 Ga0501039_0314579 3300049575 Bacteria 1231
1844 Ga0501042_0244324 3300049578 Bacteria 1295
1845 Ga0501043_0038510 3300049579 Bacteria 3759
1846 Ga0501046_0000127 3300049580 Bacteria 81278
1847 Ga0501046_0018959 3300049580 Bacteria 5712
1848 Ga0501047_0001112 3300049581 Bacteria 26731
1849 Ga0501067_0044144 3300049583 Bacteria 2477
1850 Ga0501069_0263549 3300049585 Bacteria 1006
1851 Ga0501070_0073920 3300049586 Bacteria 2821
1852 Ga0501071_0247565 3300049587 Bacteria 1345
1853 Ga0501072_0034779 3300049588 Bacteria 3948
1854 Ga0501072_0437801 3300049588 Bacteria 1036
1855 Ga0501073_0409642 3300049589 Bacteria 937
1856 Ga0501075_0180808 3300049591 Bacteria 1609
1857 Ga0501079_0154586 3300049741 Bacteria 1788
1858 Ga0501080_0082685 3300049742 Bacteria 2982
1859 Ga0501083_0118112 3300049744 Bacteria 1740
1860 Ga0501035_0260857 3300049822 Bacteria 1469
1861 Ga0501044_0010863 3300049823 Bacteria 9878
1862 Ga0501044_0174492 3300049823 Bacteria 2119
1863 Ga0501045_0162896 3300049824 Bacteria 1661
1864 Ga0501045_0318802 3300049824 Bacteria 1157
1865 nmdc:mga03683_25804_c1 3300050489 Bacteria 2312
1866 nmdc:mga0yw44_131348_c1 3300050492 Bacteria 1621
1867 nmdc:mga0yw44_1559_c1 3300050492 Bacteria 9183
1868 nmdc:mga0yw44_163892_c1 3300050492 Bacteria 1457
1869 nmdc:mga0yw44_94279_c1 3300050492 Bacteria 1897
1870 nmdc:mga0k408_174038_c1 3300050493 Bacteria 1283
1871 nmdc:mga0k408_64358_c1 3300050493 Bacteria 2134
1872 nmdc:mga06z11_43777_c1 3300050494 Bacteria 2254
1873 nmdc:mga04h51_39450_c1 3300050495 Bacteria 1534
1874 nmdc:mga07m45_1493_c1 3300050496 Bacteria 10739
1875 nmdc:mga07m45_2441_c1 3300050496 Bacteria 8725
1876 nmdc:mga07m45_35015_c1 3300050496 Bacteria 1649
1877 nmdc:mga07m45_52599_c1 3300050496 Bacteria 2299
1878 nmdc:mga07m45_6661_c1 3300050496 Bacteria 2083
1879 nmdc:mga05p37_1064518_c1 3300050507 Bacteria 851
1880 nmdc:mga05p37_1740_c1 3300050507 Bacteria 25419
1881 nmdc:mga05p37_240426_c1 3300050507 Bacteria 2177
1882 nmdc:mga05p37_25897_c1 3300050507 Bacteria 7131
1883 nmdc:mga05p37_30047_c1 3300050507 Bacteria 6631
1884 nmdc:mga05p37_316520_c1 3300050507 Bacteria 1848
1885 nmdc:mga05p37_44460_c1 3300050507 Bacteria 5464
1886 nmdc:mga05p37_499337_c1 3300050507 Bacteria 1397
1887 nmdc:mga05p37_56465_c1 3300050507 Bacteria 4427
1888 nmdc:mga05p37_740129_c1 3300050507 Bacteria 1085
1889 nmdc:mga09592_129203_c1 3300050508 Bacteria 2173
1890 nmdc:mga09592_193314_c1 3300050508 Bacteria 1761
1891 nmdc:mga09592_428858_c1 3300050508 Bacteria 1142
1892 nmdc:mga09592_49023_c1 3300050508 Bacteria 3561
1893 nmdc:mga0qj67_208201_c1 3300050509 Bacteria 1588
1894 nmdc:mga0qj67_2708_c1 3300050509 Bacteria 12703
1895 nmdc:mga0qj67_70730_c1 3300050509 Bacteria 2784
1896 nmdc:mga0qj67_7972_c1 3300050509 Bacteria 7831
1897 nmdc:mga06r32_25454_c1 3300050510 Bacteria 4782
1898 nmdc:mga06r32_45300_c1 3300050510 Bacteria 4192
1899 nmdc:mga06r32_546_c1 3300050510 Bacteria 32690
1900 nmdc:mga06r32_9960_c1 3300050510 Bacteria 8577
1901 nmdc:mga08y16_1229_c1 3300050511 Bacteria 25351
1902 nmdc:mga08y16_140040_c1 3300050511 Bacteria 2515
1903 nmdc:mga08y16_147138_c1 3300050511 Bacteria 2449
1904 nmdc:mga08y16_152775_c1 3300050511 Bacteria 2399
1905 nmdc:mga08y16_390719_c1 3300050511 Bacteria 1425
1906 nmdc:mga08y16_407660_c1 3300050511 Bacteria 1390
1907 nmdc:mga08y16_504823_c1 3300050511 Bacteria 1228
1908 nmdc:mga08y16_56459_c2 3300050511 Bacteria 2731
1909 nmdc:mga08y16_84713_c1 3300050511 Bacteria 3304
1910 nmdc:mga0n895_111129_c1 3300050512 Bacteria 2756
1911 nmdc:mga0n895_166244_c1 3300050512 Bacteria 2237
1912 nmdc:mga0n895_19447_c1 3300050512 Bacteria 6313
1913 nmdc:mga0n895_219747_c1 3300050512 Bacteria 1929
1914 nmdc:mga0n895_56236_c1 3300050512 Bacteria 3876
1915 nmdc:mga0n895_64693_c1 3300050512 Bacteria 3618
1916 nmdc:mga0n895_752206_c1 3300050512 Bacteria 968
1917 nmdc:mga0n895_973618_c1 3300050512 Bacteria 831
1918 nmdc:mga0rr50_1066_c1 3300050513 Bacteria 14910
1919 nmdc:mga0rr50_191539_c1 3300050513 Bacteria 1676
1920 nmdc:mga0rr50_206779_c1 3300050513 Bacteria 1616
1921 nmdc:mga0rr50_501799_c1 3300050513 Bacteria 1032
1922 nmdc:mga0rr50_504919_c1 3300050513 Bacteria 1028
1923 nmdc:mga0rr50_515178_c1 3300050513 Bacteria 1017
1924 nmdc:mga0rr50_60954_c1 3300050513 Bacteria 2840
1925 nmdc:mga08x19_136078_c1 3300050514 Bacteria 1656
1926 nmdc:mga08x19_217754_c1 3300050514 Bacteria 1311
1927 nmdc:mga08x19_400190_c1 3300050514 Bacteria 963
1928 nmdc:mga08x19_96425_c1 3300050514 Bacteria 1957
1929 nmdc:mga08x19_9797_c1 3300050514 Bacteria 5740
1930 nmdc:mga0a205_1661_c1 3300050515 Bacteria 19151
1931 nmdc:mga0a205_170474_c1 3300050515 Bacteria 2073
1932 nmdc:mga0a205_2299_c1 3300050515 Bacteria 16862
1933 nmdc:mga0a205_32270_c1 3300050515 Bacteria 5022
1934 nmdc:mga0a205_566370_c1 3300050515 Bacteria 991
1935 nmdc:mga0a205_591270_c1 3300050515 Bacteria 963
1936 Ga0495601_0000395 3300053077 Bacteria 23088
1937 Ga0495601_0007613 3300053077 Bacteria 6359
1938 Ga0495601_0011578 3300053077 Bacteria 5285
1939 Ga0495601_0022422 3300053077 Bacteria 3875
1940 Ga0495601_0035466 3300053077 Bacteria 3114
1941 Ga0495601_0350750 3300053077 Bacteria 959
1942 Ga0495612_0005839 3300053078 Bacteria 5084
1943 Ga0495612_0011638 3300053078 Bacteria 3545
1944 Ga0495612_0096560 3300053078 Bacteria 1255
1945 Ga0500610_0007129 3300053079 Bacteria 4758
1946 Ga0500610_0038192 3300053079 Bacteria 2473
1947 Ga0500610_0093117 3300053079 Bacteria 1564
1948 Ga0500635_0063807 3300053080 Bacteria 1293
1949 Ga0495655_0030384 3300053083 Bacteria 1306
1950 Ga0495595_0000431 3300053084 Bacteria 15886
1951 Ga0495595_0000818 3300053084 Bacteria 11891
1952 Ga0495595_0001047 3300053084 Bacteria 10658
1953 Ga0495595_0144249 3300053084 Bacteria 1169
1954 Ga0495619_0000335 3300053085 Bacteria 33006
1955 Ga0495619_0000398 3300053085 Bacteria 29632
1956 Ga0495619_0002289 3300053085 Bacteria 12621
1957 Ga0495619_0014953 3300053085 Bacteria 4902
1958 Ga0495619_0018656 3300053085 Bacteria 4402
1959 Ga0495619_0036794 3300053085 Bacteria 3188
1960 Ga0495619_0112498 3300053085 Bacteria 1861
1961 Ga0500643_003076 3300053087 Bacteria 8198
1962 Ga0500646_0041241 3300053090 Bacteria 1300
1963 Ga0500651_0000042 3300053093 Bacteria 87895
1964 Ga0500651_0276387 3300053093 Bacteria 970
1965 Ga0500566_0011976 3300053094 Bacteria 5106
1966 Ga0500566_0094857 3300053094 Bacteria 1644
1967 Ga0500641_0002029 3300053096 Bacteria 7190
1968 Ga0500554_001642 3300053102 Bacteria 4301
1969 Ga0500556_0000068 3300053104 Bacteria 103123
1970 Ga0500571_000385 3300053110 Bacteria 17471
1971 Ga0500593_000583 3300053117 Bacteria 14023
1972 Ga0500595_004799 3300053119 Bacteria 5987
1973 Ga0500595_014120 3300053119 Bacteria 3038
1974 Ga0500595_033589 3300053119 Bacteria 1701
1975 Ga0500595_036377 3300053119 Bacteria 1613
1976 Ga0500595_126127 3300053119 Bacteria 722
1977 Ga0500607_001690 3300053121 Bacteria 19265
1978 Ga0500607_049496 3300053121 Bacteria 2243
1979 Ga0500618_042029 3300053125 Bacteria 1048
1980 Ga0500642_0000735 3300053130 Bacteria 9651
1981 Ga0500642_0095775 3300053130 Bacteria 1376
1982 Ga0500655_002140 3300053133 Bacteria 3652
1983 Ga0500655_016566 3300053133 Bacteria 1359
1984 Ga0500658_0000641 3300053134 Bacteria 14522
1985 Ga0500658_0001086 3300053134 Bacteria 11125
1986 Ga0500658_0014456 3300053134 Bacteria 2922
1987 Ga0500658_0255697 3300053134 Bacteria 805
1988 Ga0500559_0002630 3300053136 Bacteria 9164
1989 Ga0500564_009533 3300053138 Bacteria 4230
1990 Ga0500568_0015825 3300053139 Bacteria 3366
1991 Ga0500568_0061196 3300053139 Bacteria 1456
1992 Ga0500574_023631 3300053141 Bacteria 1583
1993 Ga0500590_091923 3300053148 Bacteria 1472
1994 Ga0500604_0000673 3300053151 Bacteria 9355
1995 Ga0500604_0019995 3300053151 Bacteria 1880
1996 Ga0500604_0032547 3300053151 Bacteria 1537
1997 Ga0500616_0021744 3300053153 Bacteria 3590
1998 Ga0500616_0056629 3300053153 Bacteria 2045
1999 Ga0500620_035500 3300053155 Bacteria 1607
2000 Ga0500627_0075505 3300053158 Bacteria 1498
2001 Ga0500627_0103705 3300053158 Bacteria 1277
2002 Ga0500634_0036870 3300053161 Bacteria 2661
2003 Ga0500638_045806 3300053162 Bacteria 2121
2004 Ga0500636_0000232 3300053177 Bacteria 30484
2005 Ga0500637_0000080 3300053178 Bacteria 34464
2006 Ga0500637_0131142 3300053178 Bacteria 1453
2007 Ga0500609_000148 3300053731 Bacteria 9564
2008 Ga0500596_011587 3300053735 Bacteria 1348
2009 Ga0500599_002319 3300053736 Bacteria 2273
2010 Ga0501084_0325914 3300054114 Bacteria 1297
2011 Ga0500661_006305 3300055283 Bacteria 2208
2012 Ga0501082_0031005 3300060353 Bacteria 4608
2013 Ga0501082_0156238 3300060353 Bacteria 1982
2014 Ga0466962_0005581 3300061719 Bacteria 6039

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046462 Ga0495651_0065262 Ga0495651_0065262_29_661 209
2 3300047443 Ga0495687_160705 Ga0495687_160705_96_725 209
3 3300048089 Ga0495614_0310991 Ga0495614_0310991_23_652 209
4 3300053119 Ga0500595_126127 Ga0500595_126127_14_643 209
5 3300041451 Ga0451791_0920587 Ga0451791_0920587_61_693 210
6 3300025907 Ga0207645_10450973 Ga0207645_104509731 222
7 3300046674 Ga0495588_0128157 Ga0495588_0128157_641_1309 222
8 3300050511 nmdc:mga08y16_56459_c2 nmdc:mga08y16_56459_c2_75_914 223
9 iso_pu_bacteria 2775506901 2776261003 229
10 iso_pu_bacteria 2775506901 2776263167 229
11 iso_pu_bacteria 2856349417 2856356386 229
12 iso_pu_bacteria 2856356410 2856362563 229
13 iso_pu_bacteria 2871488783 2871491682 229
14 iso_pu_bacteria 2874123672 2874127437 229
15 iso_pu_bacteria 2878035449 2878036682 229
16 iso_pu_bacteria 2878753008 2878754898 229
17 iso_pu_bacteria 2881155292 2881159912 229
18 iso_pu_bacteria 2881853255 2881854536 229
19 iso_pu_bacteria 2885305155 2885305604 229
20 iso_pu_bacteria 2885312484 2885314985 229
21 iso_pu_bacteria 2885318864 2885321568 229
22 iso_pu_bacteria 2885334103 2885336434 229
23 iso_pu_bacteria 2903492973 2903504291 229
24 iso_pu_bacteria 2937836603 2937840656 229
25 iso_pu_bacteria 2961127735 2961133242 229
26 iso_pu_bacteria 2961170736 2961172436 229
27 iso_pu_bacteria 2967996073 2967997506 229
28 iso_pu_bacteria 2968003550 2968006535 229
29 iso_pu_bacteria 2970503327 2970505029 229
30 iso_pu_bacteria 2977821940 2977824746 229
31 iso_pu_bacteria 2977858184 2977860526 229
32 iso_pu_bacteria 2979808191 2979809672 229
33 iso_pu_bacteria 8004374579 8004376481 229
34 iso_pu_bacteria 8004395343 8004401876 229
35 iso_pu_bacteria 8004445564 8004451110 229
36 3300048922 Ga0496119_0128043 Ga0496119_0128043_627_1346 232
37 3300048923 Ga0496120_0027850 Ga0496120_0027850_2735_3454 232
38 3300046678 Ga0495599_0332346 Ga0495599_0332346_19_765 233
39 3300046689 Ga0495613_0322582 Ga0495613_0322582_304_1053 233
40 3300048904 Ga0496101_0155871 Ga0496101_0155871_982_1728 233
41 3300048907 Ga0496104_0138666 Ga0496104_0138666_1581_2327 233
42 3300050507 nmdc:mga05p37_1064518_c1 nmdc:mga05p37_1064518_c1_75_824 233
43 iso_pu_bacteria 2888378607 2888386911 236
44 3300053158 Ga0500627_0103705 Ga0500627_0103705_319_1032 237
45 3300025910 Ga0207684_10006392 Ga0207684_1000639211 239
46 3300005355 Ga0070671_100037163 Ga0070671_1000371632 240
47 3300005466 Ga0070685_10036946 Ga0070685_100369462 240
48 3300005616 Ga0068852_100103802 Ga0068852_1001038022 240
49 3300005840 Ga0068870_10005298 Ga0068870_100052982 240
50 3300009094 Ga0111539_10072021 Ga0111539_100720214 240
51 3300011119 Ga0105246_10132598 Ga0105246_101325982 240
52 3300025900 Ga0207710_10059930 Ga0207710_100599301 240
53 3300025901 Ga0207688_10002037 Ga0207688_100020379 240
54 3300025931 Ga0207644_10310330 Ga0207644_103103302 240
55 3300025933 Ga0207706_10006344 Ga0207706_100063446 240
56 3300025937 Ga0207669_10070455 Ga0207669_100704552 240
57 3300025938 Ga0207704_10073040 Ga0207704_100730403 240
58 3300025940 Ga0207691_10025399 Ga0207691_100253995 240
59 3300025960 Ga0207651_10180936 Ga0207651_101809361 240
60 3300026067 Ga0207678_10005238 Ga0207678_100052389 240
61 3300026118 Ga0207675_100059299 Ga0207675_1000592993 240
62 3300026121 Ga0207683_10007701 Ga0207683_100077012 240
63 3300048904 Ga0496101_0023566 Ga0496101_0023566_983_1759 240
64 3300048908 Ga0496105_0036542 Ga0496105_0036542_1402_2178 240
65 3300048909 Ga0496106_0056595 Ga0496106_0056595_1844_2620 240
66 3300048910 Ga0496107_0002458 Ga0496107_0002458_7763_8539 240
67 3300048911 Ga0496108_0110007 Ga0496108_0110007_1458_2234 240
68 3300048912 Ga0496109_0031863 Ga0496109_0031863_3922_4698 240
69 3300050511 nmdc:mga08y16_152775_c1 nmdc:mga08y16_152775_c1_1138_1914 240
70 3300025904 Ga0207647_10015192 Ga0207647_100151922 241
71 3300042005 Ga0439448_0015317 Ga0439448_0015317_72_815 241
72 3300048913 Ga0496110_0296562 Ga0496110_0296562_37_813 241
73 3300049568 Ga0501031_0164108 Ga0501031_0164108_472_1197 241
74 3300049572 Ga0501036_0021406 Ga0501036_0021406_1514_2239 241
75 3300049575 Ga0501039_0082173 Ga0501039_0082173_758_1483 241
76 3300049580 Ga0501046_0018959 Ga0501046_0018959_3961_4686 241
77 3300049588 Ga0501072_0034779 Ga0501072_0034779_2062_2787 241
78 iso_pu_bacteria 2508501114 2509074767 241
79 iso_pu_bacteria 2508501114 2509075272 241
80 iso_pu_bacteria 2512875016 2512934775 241
81 iso_pu_bacteria 2512875024 2512963132 241
82 iso_pu_bacteria 2513237082 2513555505 241
83 iso_pu_bacteria 2513237083 2513563665 241
84 iso_pu_bacteria 2513237084 2513571907 241
85 iso_pu_bacteria 2513237093 2513635883 241
86 iso_pu_bacteria 2513237103 2513712692 241
87 iso_pu_bacteria 2513237103 2513712878 241
88 iso_pu_bacteria 2513237104 2513724049 241
89 iso_pu_bacteria 2513237146 2513924635 241
90 iso_pu_bacteria 2513237162 2514024981 241
91 iso_pu_bacteria 2513237164 2514037725 241
92 iso_pu_bacteria 2515154113 2515637316 241
93 iso_pu_bacteria 2515154114 2515645216 241
94 iso_pu_bacteria 2515154116 2515661665 241
95 iso_pu_bacteria 2515154122 2515686725 241
96 iso_pu_bacteria 2515154189 2516021811 241
97 iso_pu_bacteria 2517093000 2517099520 241
98 iso_pu_bacteria 2562617112 2563057175 241
99 iso_pu_bacteria 2582581283 2585165054 241
100 iso_pu_bacteria 2582581306 2585270421 241
101 iso_pu_bacteria 2582581865 2585387753 241
102 iso_pu_bacteria 2599185170 2599419401 241
103 iso_pu_bacteria 2643221571 2643873928 241
104 iso_pu_bacteria 2643221607 2644047537 241
105 iso_pu_bacteria 2643221636 2644205993 241
106 iso_pu_bacteria 2643221686 2644481004 241
107 iso_pu_bacteria 2643221689 2644496687 241
108 iso_pu_bacteria 2687453130 2687581340 241
109 iso_pu_bacteria 2711768613 2713474100 241
110 iso_pu_bacteria 2721755755 2723845825 241
111 iso_pu_bacteria 2724679232 2725948003 241
112 iso_pu_bacteria 2739367700 2739733910 241
113 iso_pu_bacteria 2744054633 2745074912 241
114 iso_pu_bacteria 2756170246 2756677086 241
115 iso_pu_bacteria 2765235942 2766064956 241
116 iso_pu_bacteria 2767802442 2770195881 241
117 iso_pu_bacteria 2775506901 2776266299 241
118 iso_pu_bacteria 2775506902 2776269412 241
119 iso_pu_bacteria 2775506904 2776282342 241
120 iso_pu_bacteria 2791355123 2792746260 241
121 iso_pu_bacteria 2835312727 2835320141 241
122 iso_pu_bacteria 2838035591 2838040067 241
123 iso_pu_bacteria 2842110456 2842116045 241
124 iso_pu_bacteria 2842217011 2842222775 241
125 iso_pu_bacteria 2842521101 2842526369 241
126 iso_pu_bacteria 2846033681 2846035551 241
127 iso_pu_bacteria 2846037992 2846038188 241
128 iso_pu_bacteria 2857516855 2857522597 241
129 iso_pu_bacteria 2874168670 2874169135 241
130 iso_pu_bacteria 2874168670 2874171471 241
131 iso_pu_bacteria 2874168670 2874174768 241
132 iso_pu_bacteria 2876761206 2876769882 241
133 iso_pu_bacteria 2882456835 2882461083 241
134 iso_pu_bacteria 2882456835 2882462427 241
135 iso_pu_bacteria 2883291878 2883293556 241
136 iso_pu_bacteria 2884411467 2884412426 241
137 iso_pu_bacteria 2902682994 2902691323 241
138 iso_pu_bacteria 2919450847 2919452243 241
139 iso_pu_bacteria 2933586486 2933592262 241
140 iso_pu_bacteria 2936367885 2936373569 241
141 iso_pu_bacteria 2936375103 2936378363 241
142 iso_pu_bacteria 2963644680 2963650842 241
143 iso_pu_bacteria 2977523885 2977528263 241
144 iso_pu_bacteria 2977986579 2977992690 241
145 iso_pu_bacteria 637000159 637075199 241
146 iso_pu_bacteria 637000159 637077971 241
147 iso_pu_bacteria 639633055 639645717 241
148 iso_pu_bacteria 8001845381 8001845920 241
149 iso_pu_bacteria 8003955200 8003959237 241
150 iso_pu_bacteria 8005376324 8005382506 241
151 iso_pu_bacteria 8005556819 8005558792 241
152 iso_pu_bacteria 8005563573 8005563763 241
153 iso_pu_bacteria 8005658619 8005659653 241
154 iso_pu_bacteria 8018163183 8018164147 241
155 iso_pu_bacteria 8024479707 8024486544 241
156 iso_pu_bacteria 8055431914 8055436081 241
157 iso_pu_bacteria 8055617313 8055619974 241
158 iso_pu_bacteria 8055617313 8055620099 241
159 3300003578 Ga0006562J51391_1102710 Ga0006562J51391_11027102 243
160 3300003578 Ga0006562J51391_1102711 Ga0006562J51391_11027113 243
161 3300025928 Ga0207700_10077303 Ga0207700_100773034 243
162 3300003203 JGI25406J46586_10000109 JGI25406J46586_1000010924 244
163 3300005293 Ga0065715_10174933 Ga0065715_101749331 244
164 3300005328 Ga0070676_10053861 Ga0070676_100538612 244
165 3300005329 Ga0070683_100220248 Ga0070683_1002202482 244
166 3300005331 Ga0070670_100363219 Ga0070670_1003632192 244
167 3300005333 Ga0070677_10033973 Ga0070677_100339732 244
168 3300005334 Ga0068869_100126293 Ga0068869_1001262932 244
169 3300005335 Ga0070666_10144552 Ga0070666_101445522 244
170 3300005343 Ga0070687_100022431 Ga0070687_1000224312 244
171 3300005344 Ga0070661_100079819 Ga0070661_1000798192 244
172 3300005353 Ga0070669_100111605 Ga0070669_1001116051 244
173 3300005354 Ga0070675_100077454 Ga0070675_1000774542 244
174 3300005355 Ga0070671_100097817 Ga0070671_1000978173 244
175 3300005355 Ga0070671_100369505 Ga0070671_1003695052 244
176 3300005356 Ga0070674_100090867 Ga0070674_1000908672 244
177 3300005364 Ga0070673_100057174 Ga0070673_1000571742 244
178 3300005365 Ga0070688_100098712 Ga0070688_1000987121 244
179 3300005441 Ga0070700_100040107 Ga0070700_1000401073 244
180 3300005456 Ga0070678_100053981 Ga0070678_1000539814 244
181 3300005456 Ga0070678_100060037 Ga0070678_1000600372 244
182 3300005457 Ga0070662_100038716 Ga0070662_1000387162 244
183 3300005459 Ga0068867_100036112 Ga0068867_1000361124 244
184 3300005459 Ga0068867_100171239 Ga0068867_1001712392 244
185 3300005539 Ga0068853_100104022 Ga0068853_1001040222 244
186 3300005548 Ga0070665_100027676 Ga0070665_1000276764 244
187 3300005615 Ga0070702_100334954 Ga0070702_1003349541 244
188 3300005617 Ga0068859_100231358 Ga0068859_1002313583 244
189 3300005718 Ga0068866_10027071 Ga0068866_100270713 244
190 3300005834 Ga0068851_10033102 Ga0068851_100331023 244
191 3300005841 Ga0068863_100141028 Ga0068863_1001410282 244
192 3300005985 Ga0081539_10001010 Ga0081539_1000101043 244
193 3300006237 Ga0097621_100089455 Ga0097621_1000894552 244
194 3300006237 Ga0097621_100116626 Ga0097621_1001166262 244
195 3300006881 Ga0068865_100017283 Ga0068865_1000172835 244
196 3300006881 Ga0068865_100338310 Ga0068865_1003383102 244
197 3300006931 Ga0097620_100231351 Ga0097620_1002313513 244
198 3300009176 Ga0105242_10183682 Ga0105242_101836822 244
199 3300009177 Ga0105248_10384961 Ga0105248_103849612 244
200 3300009545 Ga0105237_10804555 Ga0105237_108045551 244
201 3300013296 Ga0157374_10089608 Ga0157374_100896082 244
202 3300013297 Ga0157378_10343352 Ga0157378_103433522 244
203 3300013306 Ga0163162_10053194 Ga0163162_100531943 244
204 3300013308 Ga0157375_10148998 Ga0157375_101489981 244
205 3300014325 Ga0163163_10067902 Ga0163163_100679022 244
206 3300014326 Ga0157380_10157992 Ga0157380_101579922 244
207 3300014969 Ga0157376_10079062 Ga0157376_100790623 244
208 3300017792 Ga0163161_10244305 Ga0163161_102443052 244
209 3300025321 Ga0207656_10040471 Ga0207656_100404711 244
210 3300025893 Ga0207682_10022172 Ga0207682_100221722 244
211 3300025901 Ga0207688_10038389 Ga0207688_100383892 244
212 3300025907 Ga0207645_10016487 Ga0207645_100164873 244
213 3300025918 Ga0207662_10035101 Ga0207662_100351012 244
214 3300025920 Ga0207649_10154324 Ga0207649_101543241 244
215 3300025925 Ga0207650_10040855 Ga0207650_100408552 244
216 3300025926 Ga0207659_10281394 Ga0207659_102813942 244
217 3300025926 Ga0207659_10350862 Ga0207659_103508622 244
218 3300025931 Ga0207644_10092319 Ga0207644_100923192 244
219 3300025931 Ga0207644_10328232 Ga0207644_103282322 244
220 3300025933 Ga0207706_10072978 Ga0207706_100729784 244
221 3300025934 Ga0207686_10271331 Ga0207686_102713312 244
222 3300025936 Ga0207670_10181880 Ga0207670_101818801 244
223 3300025937 Ga0207669_10210723 Ga0207669_102107232 244
224 3300025938 Ga0207704_10140701 Ga0207704_101407012 244
225 3300025938 Ga0207704_10324708 Ga0207704_103247082 244
226 3300025940 Ga0207691_10018587 Ga0207691_100185875 244
227 3300025941 Ga0207711_10058167 Ga0207711_100581672 244
228 3300025944 Ga0207661_10129313 Ga0207661_101293132 244
229 3300025960 Ga0207651_10060332 Ga0207651_100603322 244
230 3300025981 Ga0207640_10162428 Ga0207640_101624282 244
231 3300025986 Ga0207658_10067178 Ga0207658_100671782 244
232 3300026023 Ga0207677_10086334 Ga0207677_100863342 244
233 3300026075 Ga0207708_10138258 Ga0207708_101382582 244
234 3300026088 Ga0207641_10204562 Ga0207641_102045622 244
235 3300026089 Ga0207648_10045345 Ga0207648_100453454 244
236 3300026089 Ga0207648_10093585 Ga0207648_100935852 244
237 3300026116 Ga0207674_10178859 Ga0207674_101788591 244
238 3300026121 Ga0207683_10136046 Ga0207683_101360462 244
239 3300026121 Ga0207683_10145890 Ga0207683_101458902 244
240 3300028381 Ga0268264_10185542 Ga0268264_101855422 244
241 3300046463 Ga0495653_0111278 Ga0495653_0111278_467_1201 244
242 3300048904 Ga0496101_0421438 Ga0496101_0421438_248_1042 244
243 3300048910 Ga0496107_0535661 Ga0496107_0535661_23_817 244
244 3300048917 Ga0496114_0474501 Ga0496114_0474501_23_817 244
245 3300053153 Ga0500616_0021744 Ga0500616_0021744_289_1026 244
246 3300001979 JGI24740J21852_10032676 JGI24740J21852_100326762 245
247 3300001989 JGI24739J22299_10004123 JGI24739J22299_100041234 245
248 3300001990 JGI24737J22298_10006525 JGI24737J22298_100065253 245
249 3300001991 JGI24743J22301_10014960 JGI24743J22301_100149602 245
250 3300002067 JGI24735J21928_10036930 JGI24735J21928_100369302 245
251 3300002075 JGI24738J21930_10009674 JGI24738J21930_100096742 245
252 3300002459 JGI24751J29686_10007247 JGI24751J29686_100072472 245
253 3300002705 JGI25156J39149_1003850 JGI25156J39149_10038503 245
254 3300002737 JGI25162J39368_1000206 JGI25162J39368_100020621 245
255 3300002741 JGI25157J39369_1000292 JGI25157J39369_10002921 245
256 3300002741 JGI25157J39369_1001420 JGI25157J39369_10014203 245
257 3300002771 JGI25163J39215_1004145 JGI25163J39215_10041452 245
258 3300002772 JGI25164J39214_1000091 JGI25164J39214_100009173 245
259 3300003214 JGI25165J46597_1000196 JGI25165J46597_100019673 245
260 3300003215 JGI25153J46596_10000138 JGI25153J46596_1000013854 245
261 3300003322 rootL2_10002585 rootL2_100025852 245
262 3300003761 Ga0055535_1000240 Ga0055535_100024043 245
263 3300003762 Ga0055542_1000244 Ga0055542_100024421 245
264 3300003763 Ga0055529_1000170 Ga0055529_100017073 245
265 3300003794 Ga0055531_10013026 Ga0055531_100130262 245
266 3300003911 JGI25405J52794_10002173 JGI25405J52794_100021733 245
267 3300003911 JGI25405J52794_10028101 JGI25405J52794_100281011 245
268 3300005262 Ga0065165_1004603 Ga0065165_10046036 245
269 3300005293 Ga0065715_10179887 Ga0065715_101798872 245
270 3300005328 Ga0070676_10001076 Ga0070676_100010767 245
271 3300005328 Ga0070676_10010057 Ga0070676_100100578 245
272 3300005329 Ga0070683_100083307 Ga0070683_1000833072 245
273 3300005329 Ga0070683_100151277 Ga0070683_1001512772 245
274 3300005330 Ga0070690_100044632 Ga0070690_1000446324 245
275 3300005330 Ga0070690_100051000 Ga0070690_1000510003 245
276 3300005330 Ga0070690_100328804 Ga0070690_1003288042 245
277 3300005331 Ga0070670_100017710 Ga0070670_1000177106 245
278 3300005331 Ga0070670_100054601 Ga0070670_1000546012 245
279 3300005331 Ga0070670_100059727 Ga0070670_1000597273 245
280 3300005331 Ga0070670_100123587 Ga0070670_1001235872 245
281 3300005331 Ga0070670_100134931 Ga0070670_1001349312 245
282 3300005331 Ga0070670_100637856 Ga0070670_1006378562 245
283 3300005333 Ga0070677_10000906 Ga0070677_100009066 245
284 3300005334 Ga0068869_100131958 Ga0068869_1001319582 245
285 3300005334 Ga0068869_100206735 Ga0068869_1002067352 245
286 3300005334 Ga0068869_100262234 Ga0068869_1002622342 245
287 3300005334 Ga0068869_100317763 Ga0068869_1003177632 245
288 3300005335 Ga0070666_10000771 Ga0070666_1000077114 245
289 3300005335 Ga0070666_10019311 Ga0070666_100193112 245
290 3300005335 Ga0070666_10057858 Ga0070666_100578582 245
291 3300005335 Ga0070666_10122633 Ga0070666_101226332 245
292 3300005335 Ga0070666_10255303 Ga0070666_102553032 245
293 3300005336 Ga0070680_100001629 Ga0070680_10000162913 245
294 3300005336 Ga0070680_100034336 Ga0070680_1000343363 245
295 3300005336 Ga0070680_100272839 Ga0070680_1002728392 245
296 3300005337 Ga0070682_100010513 Ga0070682_1000105136 245
297 3300005337 Ga0070682_100059155 Ga0070682_1000591553 245
298 3300005338 Ga0068868_100000959 Ga0068868_10000095925 245
299 3300005338 Ga0068868_100011665 Ga0068868_1000116656 245
300 3300005338 Ga0068868_100077654 Ga0068868_1000776542 245
301 3300005338 Ga0068868_100231766 Ga0068868_1002317662 245
302 3300005338 Ga0068868_100497539 Ga0068868_1004975391 245
303 3300005339 Ga0070660_100001625 Ga0070660_1000016252 245
304 3300005339 Ga0070660_100023576 Ga0070660_1000235763 245
305 3300005339 Ga0070660_100126476 Ga0070660_1001264763 245
306 3300005339 Ga0070660_100231192 Ga0070660_1002311922 245
307 3300005339 Ga0070660_100245549 Ga0070660_1002455491 245
308 3300005339 Ga0070660_100668480 Ga0070660_1006684802 245
309 3300005340 Ga0070689_100002174 Ga0070689_1000021749 245
310 3300005340 Ga0070689_100020981 Ga0070689_1000209815 245
311 3300005340 Ga0070689_100188744 Ga0070689_1001887442 245
312 3300005340 Ga0070689_100424010 Ga0070689_1004240102 245
313 3300005341 Ga0070691_10002284 Ga0070691_100022844 245
314 3300005341 Ga0070691_10003094 Ga0070691_100030944 245
315 3300005341 Ga0070691_10118629 Ga0070691_101186292 245
316 3300005341 Ga0070691_10218679 Ga0070691_102186791 245
317 3300005343 Ga0070687_100006156 Ga0070687_1000061562 245
318 3300005343 Ga0070687_100042113 Ga0070687_1000421132 245
319 3300005344 Ga0070661_100020671 Ga0070661_1000206716 245
320 3300005344 Ga0070661_100088953 Ga0070661_1000889532 245
321 3300005345 Ga0070692_10008674 Ga0070692_100086742 245
322 3300005345 Ga0070692_10101428 Ga0070692_101014282 245
323 3300005347 Ga0070668_100002125 Ga0070668_1000021256 245
324 3300005347 Ga0070668_100055757 Ga0070668_1000557572 245
325 3300005347 Ga0070668_100236655 Ga0070668_1002366552 245
326 3300005347 Ga0070668_100639979 Ga0070668_1006399792 245
327 3300005353 Ga0070669_100012580 Ga0070669_1000125803 245
328 3300005354 Ga0070675_100007594 Ga0070675_1000075943 245
329 3300005354 Ga0070675_100195169 Ga0070675_1001951691 245
330 3300005355 Ga0070671_100001958 Ga0070671_1000019583 245
331 3300005355 Ga0070671_100005139 Ga0070671_1000051392 245
332 3300005355 Ga0070671_100021914 Ga0070671_1000219146 245
333 3300005355 Ga0070671_100455674 Ga0070671_1004556742 245
334 3300005355 Ga0070671_100496415 Ga0070671_1004964152 245
335 3300005355 Ga0070671_100665177 Ga0070671_1006651771 245
336 3300005356 Ga0070674_100021328 Ga0070674_1000213281 245
337 3300005356 Ga0070674_100023394 Ga0070674_1000233943 245
338 3300005364 Ga0070673_100000442 Ga0070673_10000044226 245
339 3300005364 Ga0070673_100005099 Ga0070673_1000050996 245
340 3300005364 Ga0070673_100010089 Ga0070673_1000100894 245
341 3300005365 Ga0070688_100002832 Ga0070688_1000028327 245
342 3300005365 Ga0070688_100096067 Ga0070688_1000960672 245
343 3300005366 Ga0070659_100045435 Ga0070659_1000454354 245
344 3300005366 Ga0070659_100122458 Ga0070659_1001224582 245
345 3300005366 Ga0070659_100128238 Ga0070659_1001282381 245
346 3300005366 Ga0070659_100136618 Ga0070659_1001366182 245
347 3300005367 Ga0070667_100001863 Ga0070667_1000018637 245
348 3300005367 Ga0070667_100014818 Ga0070667_1000148183 245
349 3300005367 Ga0070667_100017211 Ga0070667_1000172113 245
350 3300005367 Ga0070667_100026157 Ga0070667_1000261574 245
351 3300005367 Ga0070667_100061205 Ga0070667_1000612052 245
352 3300005367 Ga0070667_100068578 Ga0070667_1000685783 245
353 3300005367 Ga0070667_100354413 Ga0070667_1003544132 245
354 3300005367 Ga0070667_100759820 Ga0070667_1007598201 245
355 3300005434 Ga0070709_10158197 Ga0070709_101581972 245
356 3300005434 Ga0070709_10225958 Ga0070709_102259582 245
357 3300005434 Ga0070709_10227137 Ga0070709_102271372 245
358 3300005434 Ga0070709_10590191 Ga0070709_105901911 245
359 3300005435 Ga0070714_100027101 Ga0070714_1000271016 245
360 3300005435 Ga0070714_100058694 Ga0070714_1000586942 245
361 3300005435 Ga0070714_100313801 Ga0070714_1003138012 245
362 3300005435 Ga0070714_100366833 Ga0070714_1003668332 245
363 3300005435 Ga0070714_100714857 Ga0070714_1007148571 245
364 3300005435 Ga0070714_100752682 Ga0070714_1007526821 245
365 3300005436 Ga0070713_100002048 Ga0070713_1000020487 245
366 3300005436 Ga0070713_100030071 Ga0070713_1000300712 245
367 3300005436 Ga0070713_100031008 Ga0070713_1000310082 245
368 3300005436 Ga0070713_100056432 Ga0070713_1000564322 245
369 3300005436 Ga0070713_100213872 Ga0070713_1002138722 245
370 3300005437 Ga0070710_10005027 Ga0070710_100050276 245
371 3300005437 Ga0070710_10011078 Ga0070710_100110785 245
372 3300005437 Ga0070710_10038609 Ga0070710_100386092 245
373 3300005437 Ga0070710_10127476 Ga0070710_101274762 245
374 3300005437 Ga0070710_10212105 Ga0070710_102121051 245
375 3300005438 Ga0070701_10003125 Ga0070701_100031259 245
376 3300005439 Ga0070711_100054396 Ga0070711_1000543963 245
377 3300005439 Ga0070711_100092229 Ga0070711_1000922292 245
378 3300005439 Ga0070711_100158837 Ga0070711_1001588372 245
379 3300005440 Ga0070705_100042571 Ga0070705_1000425712 245
380 3300005441 Ga0070700_100002787 Ga0070700_1000027876 245
381 3300005441 Ga0070700_100033480 Ga0070700_1000334802 245
382 3300005441 Ga0070700_100041474 Ga0070700_1000414743 245
383 3300005444 Ga0070694_100000595 Ga0070694_1000005958 245
384 3300005444 Ga0070694_100309251 Ga0070694_1003092511 245
385 3300005445 Ga0070708_100223967 Ga0070708_1002239672 245
386 3300005455 Ga0070663_100003107 Ga0070663_1000031077 245
387 3300005455 Ga0070663_100015907 Ga0070663_1000159073 245
388 3300005455 Ga0070663_100079064 Ga0070663_1000790642 245
389 3300005455 Ga0070663_100134289 Ga0070663_1001342892 245
390 3300005455 Ga0070663_100159377 Ga0070663_1001593772 245
391 3300005455 Ga0070663_100308750 Ga0070663_1003087502 245
392 3300005456 Ga0070678_100000215 Ga0070678_1000002152 245
393 3300005456 Ga0070678_100004266 Ga0070678_1000042663 245
394 3300005456 Ga0070678_100008229 Ga0070678_1000082293 245
395 3300005456 Ga0070678_100011272 Ga0070678_1000112723 245
396 3300005456 Ga0070678_100122785 Ga0070678_1001227852 245
397 3300005456 Ga0070678_100213426 Ga0070678_1002134261 245
398 3300005457 Ga0070662_100010721 Ga0070662_1000107212 245
399 3300005457 Ga0070662_100031178 Ga0070662_1000311784 245
400 3300005457 Ga0070662_100065447 Ga0070662_1000654472 245
401 3300005457 Ga0070662_100106670 Ga0070662_1001066702 245
402 3300005458 Ga0070681_10082645 Ga0070681_100826452 245
403 3300005458 Ga0070681_10093631 Ga0070681_100936312 245
404 3300005458 Ga0070681_10094477 Ga0070681_100944771 245
405 3300005458 Ga0070681_10101983 Ga0070681_101019832 245
406 3300005458 Ga0070681_10361197 Ga0070681_103611972 245
407 3300005459 Ga0068867_100045590 Ga0068867_1000455902 245
408 3300005459 Ga0068867_100070292 Ga0068867_1000702922 245
409 3300005459 Ga0068867_100082462 Ga0068867_1000824622 245
410 3300005466 Ga0070685_10004693 Ga0070685_100046935 245
411 3300005466 Ga0070685_10032285 Ga0070685_100322854 245
412 3300005466 Ga0070685_10222199 Ga0070685_102221992 245
413 3300005468 Ga0070707_100042202 Ga0070707_1000422022 245
414 3300005468 Ga0070707_100237718 Ga0070707_1002377182 245
415 3300005471 Ga0070698_100233320 Ga0070698_1002333202 245
416 3300005471 Ga0070698_100349070 Ga0070698_1003490702 245
417 3300005471 Ga0070698_100533648 Ga0070698_1005336482 245
418 3300005471 Ga0070698_100832924 Ga0070698_1008329241 245
419 3300005518 Ga0070699_100393593 Ga0070699_1003935931 245
420 3300005530 Ga0070679_100000826 Ga0070679_10000082614 245
421 3300005530 Ga0070679_100030613 Ga0070679_1000306133 245
422 3300005535 Ga0070684_100040401 Ga0070684_1000404012 245
423 3300005535 Ga0070684_100105393 Ga0070684_1001053932 245
424 3300005536 Ga0070697_100091284 Ga0070697_1000912842 245
425 3300005536 Ga0070697_100147403 Ga0070697_1001474032 245
426 3300005539 Ga0068853_100003115 Ga0068853_1000031152 245
427 3300005539 Ga0068853_100088892 Ga0068853_1000888922 245
428 3300005539 Ga0068853_100427981 Ga0068853_1004279812 245
429 3300005543 Ga0070672_100020422 Ga0070672_1000204223 245
430 3300005543 Ga0070672_100040425 Ga0070672_1000404252 245
431 3300005543 Ga0070672_100124444 Ga0070672_1001244443 245
432 3300005544 Ga0070686_100005706 Ga0070686_1000057063 245
433 3300005544 Ga0070686_100222581 Ga0070686_1002225812 245
434 3300005545 Ga0070695_100004124 Ga0070695_1000041248 245
435 3300005545 Ga0070695_100061139 Ga0070695_1000611392 245
436 3300005545 Ga0070695_100076651 Ga0070695_1000766513 245
437 3300005546 Ga0070696_100001676 Ga0070696_10000167614 245
438 3300005546 Ga0070696_100073684 Ga0070696_1000736842 245
439 3300005546 Ga0070696_100086458 Ga0070696_1000864582 245
440 3300005546 Ga0070696_100091356 Ga0070696_1000913563 245
441 3300005547 Ga0070693_100039884 Ga0070693_1000398842 245
442 3300005547 Ga0070693_100049929 Ga0070693_1000499293 245
443 3300005548 Ga0070665_100005678 Ga0070665_10000567811 245
444 3300005548 Ga0070665_100027499 Ga0070665_1000274998 245
445 3300005548 Ga0070665_100042906 Ga0070665_1000429065 245
446 3300005548 Ga0070665_100061603 Ga0070665_1000616032 245
447 3300005548 Ga0070665_100144919 Ga0070665_1001449193 245
448 3300005548 Ga0070665_100160882 Ga0070665_1001608823 245
449 3300005548 Ga0070665_100315808 Ga0070665_1003158081 245
450 3300005548 Ga0070665_100493309 Ga0070665_1004933091 245
451 3300005549 Ga0070704_100005192 Ga0070704_1000051929 245
452 3300005549 Ga0070704_100051974 Ga0070704_1000519742 245
453 3300005549 Ga0070704_100095045 Ga0070704_1000950452 245
454 3300005549 Ga0070704_100198214 Ga0070704_1001982142 245
455 3300005563 Ga0068855_100000006 Ga0068855_100000006258 245
456 3300005563 Ga0068855_100010320 Ga0068855_1000103207 245
457 3300005563 Ga0068855_100014521 Ga0068855_10001452112 245
458 3300005563 Ga0068855_100022575 Ga0068855_1000225753 245
459 3300005563 Ga0068855_100195661 Ga0068855_1001956613 245
460 3300005563 Ga0068855_100209445 Ga0068855_1002094452 245
461 3300005564 Ga0070664_100002944 Ga0070664_10000294414 245
462 3300005564 Ga0070664_100052959 Ga0070664_1000529592 245
463 3300005564 Ga0070664_100091158 Ga0070664_1000911582 245
464 3300005564 Ga0070664_100121996 Ga0070664_1001219963 245
465 3300005564 Ga0070664_100292157 Ga0070664_1002921572 245
466 3300005577 Ga0068857_100005947 Ga0068857_1000059473 245
467 3300005577 Ga0068857_100057421 Ga0068857_1000574214 245
468 3300005577 Ga0068857_100144922 Ga0068857_1001449223 245
469 3300005577 Ga0068857_100210765 Ga0068857_1002107652 245
470 3300005577 Ga0068857_100325061 Ga0068857_1003250612 245
471 3300005578 Ga0068854_100001059 Ga0068854_1000010595 245
472 3300005578 Ga0068854_100031269 Ga0068854_1000312694 245
473 3300005578 Ga0068854_100082779 Ga0068854_1000827792 245
474 3300005578 Ga0068854_100348624 Ga0068854_1003486241 245
475 3300005614 Ga0068856_100003185 Ga0068856_10000318516 245
476 3300005614 Ga0068856_100022065 Ga0068856_1000220657 245
477 3300005614 Ga0068856_100108999 Ga0068856_1001089992 245
478 3300005614 Ga0068856_100643554 Ga0068856_1006435542 245
479 3300005614 Ga0068856_100883277 Ga0068856_1008832772 245
480 3300005615 Ga0070702_100000687 Ga0070702_10000068712 245
481 3300005615 Ga0070702_100043939 Ga0070702_1000439393 245
482 3300005615 Ga0070702_100078173 Ga0070702_1000781732 245
483 3300005616 Ga0068852_100020557 Ga0068852_1000205574 245
484 3300005616 Ga0068852_100043703 Ga0068852_1000437032 245
485 3300005616 Ga0068852_100083412 Ga0068852_1000834123 245
486 3300005616 Ga0068852_100111122 Ga0068852_1001111222 245
487 3300005616 Ga0068852_100242972 Ga0068852_1002429722 245
488 3300005617 Ga0068859_100000201 Ga0068859_10000020124 245
489 3300005617 Ga0068859_100072290 Ga0068859_1000722902 245
490 3300005617 Ga0068859_100209228 Ga0068859_1002092282 245
491 3300005618 Ga0068864_100010491 Ga0068864_1000104916 245
492 3300005618 Ga0068864_100091443 Ga0068864_1000914432 245
493 3300005618 Ga0068864_100642291 Ga0068864_1006422911 245
494 3300005718 Ga0068866_10041605 Ga0068866_100416052 245
495 3300005718 Ga0068866_10131879 Ga0068866_101318792 245
496 3300005719 Ga0068861_100012217 Ga0068861_1000122173 245
497 3300005719 Ga0068861_100114174 Ga0068861_1001141742 245
498 3300005719 Ga0068861_100427390 Ga0068861_1004273902 245
499 3300005834 Ga0068851_10000810 Ga0068851_1000081013 245
500 3300005834 Ga0068851_10005149 Ga0068851_100051495 245
501 3300005834 Ga0068851_10074037 Ga0068851_100740372 245
502 3300005834 Ga0068851_10074447 Ga0068851_100744472 245
503 3300005840 Ga0068870_10039314 Ga0068870_100393142 245
504 3300005841 Ga0068863_100003050 Ga0068863_1000030507 245
505 3300005841 Ga0068863_100084376 Ga0068863_1000843762 245
506 3300005841 Ga0068863_100128804 Ga0068863_1001288043 245
507 3300005841 Ga0068863_100139575 Ga0068863_1001395752 245
508 3300005841 Ga0068863_100152338 Ga0068863_1001523382 245
509 3300005841 Ga0068863_100192168 Ga0068863_1001921682 245
510 3300005841 Ga0068863_100644988 Ga0068863_1006449881 245
511 3300005842 Ga0068858_100018757 Ga0068858_1000187575 245
512 3300005842 Ga0068858_100036953 Ga0068858_1000369537 245
513 3300005842 Ga0068858_100037916 Ga0068858_1000379165 245
514 3300005842 Ga0068858_100042053 Ga0068858_1000420533 245
515 3300005842 Ga0068858_100670090 Ga0068858_1006700901 245
516 3300005843 Ga0068860_100028773 Ga0068860_1000287736 245
517 3300005843 Ga0068860_100116190 Ga0068860_1001161902 245
518 3300005843 Ga0068860_100313591 Ga0068860_1003135912 245
519 3300005844 Ga0068862_100000245 Ga0068862_10000024524 245
520 3300005844 Ga0068862_100007454 Ga0068862_1000074542 245
521 3300005844 Ga0068862_100013738 Ga0068862_1000137383 245
522 3300005844 Ga0068862_100023866 Ga0068862_1000238666 245
523 3300005937 Ga0081455_10000087 Ga0081455_1000008788 245
524 3300005937 Ga0081455_10001860 Ga0081455_1000186011 245
525 3300005937 Ga0081455_10002592 Ga0081455_1000259222 245
526 3300005937 Ga0081455_10009744 Ga0081455_100097448 245
527 3300005937 Ga0081455_10031798 Ga0081455_100317985 245
528 3300005937 Ga0081455_10032303 Ga0081455_100323032 245
529 3300005937 Ga0081455_10094028 Ga0081455_100940282 245
530 3300005937 Ga0081455_10107263 Ga0081455_101072632 245
531 3300005937 Ga0081455_10220294 Ga0081455_102202941 245
532 3300005981 Ga0081538_10067425 Ga0081538_100674252 245
533 3300005983 Ga0081540_1000313 Ga0081540_100031319 245
534 3300005983 Ga0081540_1000411 Ga0081540_100041138 245
535 3300005983 Ga0081540_1002499 Ga0081540_100249913 245
536 3300005983 Ga0081540_1004584 Ga0081540_100458413 245
537 3300005983 Ga0081540_1008920 Ga0081540_10089206 245
538 3300005983 Ga0081540_1030618 Ga0081540_10306182 245
539 3300005983 Ga0081540_1088284 Ga0081540_10882842 245
540 3300005983 Ga0081540_1116893 Ga0081540_11168932 245
541 3300005985 Ga0081539_10009313 Ga0081539_100093134 245
542 3300005985 Ga0081539_10042460 Ga0081539_100424602 245
543 3300006028 Ga0070717_10024298 Ga0070717_100242983 245
544 3300006028 Ga0070717_10065856 Ga0070717_100658564 245
545 3300006028 Ga0070717_10145611 Ga0070717_101456112 245
546 3300006038 Ga0075365_10002796 Ga0075365_1000279611 245
547 3300006038 Ga0075365_10016608 Ga0075365_100166083 245
548 3300006038 Ga0075365_10104371 Ga0075365_101043711 245
549 3300006038 Ga0075365_10201304 Ga0075365_102013041 245
550 3300006042 Ga0075368_10084876 Ga0075368_100848761 245
551 3300006058 Ga0075432_10003067 Ga0075432_100030672 245
552 3300006058 Ga0075432_10122117 Ga0075432_101221172 245
553 3300006163 Ga0070715_10000159 Ga0070715_1000015913 245
554 3300006163 Ga0070715_10067591 Ga0070715_100675912 245
555 3300006173 Ga0070716_100078273 Ga0070716_1000782731 245
556 3300006175 Ga0070712_100004130 Ga0070712_1000041307 245
557 3300006175 Ga0070712_100012431 Ga0070712_1000124311 245
558 3300006175 Ga0070712_100020375 Ga0070712_1000203755 245
559 3300006175 Ga0070712_100073488 Ga0070712_1000734883 245
560 3300006175 Ga0070712_100135774 Ga0070712_1001357741 245
561 3300006175 Ga0070712_100219916 Ga0070712_1002199162 245
562 3300006175 Ga0070712_100223235 Ga0070712_1002232352 245
563 3300006175 Ga0070712_100410759 Ga0070712_1004107592 245
564 3300006177 Ga0075362_10029208 Ga0075362_100292083 245
565 3300006177 Ga0075362_10043954 Ga0075362_100439542 245
566 3300006178 Ga0075367_10109785 Ga0075367_101097851 245
567 3300006186 Ga0075369_10056593 Ga0075369_100565932 245
568 3300006186 Ga0075369_10123065 Ga0075369_101230651 245
569 3300006195 Ga0075366_10125327 Ga0075366_101253272 245
570 3300006195 Ga0075366_10249018 Ga0075366_102490182 245
571 3300006237 Ga0097621_100000750 Ga0097621_10000075010 245
572 3300006237 Ga0097621_100019564 Ga0097621_1000195646 245
573 3300006237 Ga0097621_100025735 Ga0097621_1000257353 245
574 3300006237 Ga0097621_100067602 Ga0097621_1000676022 245
575 3300006237 Ga0097621_100220328 Ga0097621_1002203282 245
576 3300006353 Ga0075370_10026648 Ga0075370_100266484 245
577 3300006353 Ga0075370_10053794 Ga0075370_100537942 245
578 3300006358 Ga0068871_100029781 Ga0068871_1000297814 245
579 3300006358 Ga0068871_100200600 Ga0068871_1002006002 245
580 3300006358 Ga0068871_100270601 Ga0068871_1002706011 245
581 3300006358 Ga0068871_100590919 Ga0068871_1005909192 245
582 3300006844 Ga0075428_100001439 Ga0075428_1000014393 245
583 3300006844 Ga0075428_100026241 Ga0075428_1000262412 245
584 3300006844 Ga0075428_100125478 Ga0075428_1001254782 245
585 3300006844 Ga0075428_100147559 Ga0075428_1001475592 245
586 3300006844 Ga0075428_100156030 Ga0075428_1001560302 245
587 3300006844 Ga0075428_100243963 Ga0075428_1002439632 245
588 3300006844 Ga0075428_100288007 Ga0075428_1002880072 245
589 3300006844 Ga0075428_100393979 Ga0075428_1003939792 245
590 3300006846 Ga0075430_100001275 Ga0075430_1000012755 245
591 3300006846 Ga0075430_100224284 Ga0075430_1002242841 245
592 3300006847 Ga0075431_100036324 Ga0075431_1000363242 245
593 3300006847 Ga0075431_100052312 Ga0075431_1000523122 245
594 3300006847 Ga0075431_100113074 Ga0075431_1001130743 245
595 3300006847 Ga0075431_100388195 Ga0075431_1003881952 245
596 3300006852 Ga0075433_10001203 Ga0075433_1000120317 245
597 3300006852 Ga0075433_10002183 Ga0075433_100021832 245
598 3300006852 Ga0075433_10181153 Ga0075433_101811532 245
599 3300006852 Ga0075433_10291103 Ga0075433_102911032 245
600 3300006852 Ga0075433_10335109 Ga0075433_103351092 245
601 3300006871 Ga0075434_100002619 Ga0075434_10000261915 245
602 3300006871 Ga0075434_100013375 Ga0075434_1000133754 245
603 3300006871 Ga0075434_100023656 Ga0075434_1000236564 245
604 3300006871 Ga0075434_100068221 Ga0075434_1000682215 245
605 3300006871 Ga0075434_100086729 Ga0075434_1000867293 245
606 3300006871 Ga0075434_100223108 Ga0075434_1002231082 245
607 3300006871 Ga0075434_100461070 Ga0075434_1004610702 245
608 3300006880 Ga0075429_100000388 Ga0075429_1000003883 245
609 3300006880 Ga0075429_100049158 Ga0075429_1000491582 245
610 3300006880 Ga0075429_100194166 Ga0075429_1001941662 245
611 3300006880 Ga0075429_100197495 Ga0075429_1001974952 245
612 3300006880 Ga0075429_100552915 Ga0075429_1005529151 245
613 3300006880 Ga0075429_100740218 Ga0075429_1007402181 245
614 3300006881 Ga0068865_100003957 Ga0068865_1000039578 245
615 3300006881 Ga0068865_100009546 Ga0068865_1000095467 245
616 3300006881 Ga0068865_100062061 Ga0068865_1000620612 245
617 3300006881 Ga0068865_100109138 Ga0068865_1001091382 245
618 3300006881 Ga0068865_100172763 Ga0068865_1001727632 245
619 3300006914 Ga0075436_100014089 Ga0075436_1000140895 245
620 3300006914 Ga0075436_100147424 Ga0075436_1001474241 245
621 3300006914 Ga0075436_100267772 Ga0075436_1002677721 245
622 3300006914 Ga0075436_100335856 Ga0075436_1003358562 245
623 3300006931 Ga0097620_100000201 Ga0097620_10000020124 245
624 3300006931 Ga0097620_100072288 Ga0097620_1000722883 245
625 3300006931 Ga0097620_100209244 Ga0097620_1002092442 245
626 3300007076 Ga0075435_100002584 Ga0075435_10000258413 245
627 3300007076 Ga0075435_100038012 Ga0075435_1000380123 245
628 3300007076 Ga0075435_100039197 Ga0075435_1000391977 245
629 3300007076 Ga0075435_100100060 Ga0075435_1001000601 245
630 3300007076 Ga0075435_100488946 Ga0075435_1004889461 245
631 3300007076 Ga0075435_100519862 Ga0075435_1005198622 245
632 3300007076 Ga0075435_100544788 Ga0075435_1005447881 245
633 3300007265 Ga0099794_10012743 Ga0099794_100127432 245
634 3300007788 Ga0099795_10005183 Ga0099795_100051834 245
635 3300007788 Ga0099795_10037544 Ga0099795_100375442 245
636 3300009092 Ga0105250_10039487 Ga0105250_100394872 245
637 3300009093 Ga0105240_10010009 Ga0105240_1001000913 245
638 3300009093 Ga0105240_10019117 Ga0105240_100191176 245
639 3300009093 Ga0105240_10025571 Ga0105240_100255715 245
640 3300009093 Ga0105240_10061444 Ga0105240_100614442 245
641 3300009093 Ga0105240_10064374 Ga0105240_100643745 245
642 3300009093 Ga0105240_10071183 Ga0105240_100711832 245
643 3300009093 Ga0105240_10094766 Ga0105240_100947662 245
644 3300009093 Ga0105240_10121886 Ga0105240_101218863 245
645 3300009093 Ga0105240_10822380 Ga0105240_108223802 245
646 3300009094 Ga0111539_10002315 Ga0111539_1000231523 245
647 3300009094 Ga0111539_10002984 Ga0111539_100029842 245
648 3300009094 Ga0111539_10016144 Ga0111539_100161442 245
649 3300009094 Ga0111539_10017625 Ga0111539_100176256 245
650 3300009094 Ga0111539_10062101 Ga0111539_100621015 245
651 3300009094 Ga0111539_10091969 Ga0111539_100919695 245
652 3300009094 Ga0111539_10095868 Ga0111539_100958684 245
653 3300009094 Ga0111539_10747551 Ga0111539_107475512 245
654 3300009098 Ga0105245_10020211 Ga0105245_100202113 245
655 3300009098 Ga0105245_10060945 Ga0105245_100609452 245
656 3300009101 Ga0105247_10010893 Ga0105247_100108933 245
657 3300009101 Ga0105247_10080475 Ga0105247_100804753 245
658 3300009101 Ga0105247_10261384 Ga0105247_102613842 245
659 3300009101 Ga0105247_10267064 Ga0105247_102670641 245
660 3300009147 Ga0114129_10007449 Ga0114129_1000744915 245
661 3300009147 Ga0114129_10022955 Ga0114129_100229556 245
662 3300009147 Ga0114129_10061685 Ga0114129_100616854 245
663 3300009147 Ga0114129_10084546 Ga0114129_100845463 245
664 3300009147 Ga0114129_10143681 Ga0114129_101436813 245
665 3300009147 Ga0114129_10158787 Ga0114129_101587872 245
666 3300009147 Ga0114129_10274188 Ga0114129_102741882 245
667 3300009147 Ga0114129_10356521 Ga0114129_103565212 245
668 3300009147 Ga0114129_10623477 Ga0114129_106234771 245
669 3300009147 Ga0114129_10647632 Ga0114129_106476321 245
670 3300009147 Ga0114129_10976123 Ga0114129_109761232 245
671 3300009148 Ga0105243_10007058 Ga0105243_100070586 245
672 3300009148 Ga0105243_10026946 Ga0105243_100269462 245
673 3300009148 Ga0105243_10031318 Ga0105243_100313183 245
674 3300009148 Ga0105243_10048034 Ga0105243_100480343 245
675 3300009148 Ga0105243_10308137 Ga0105243_103081372 245
676 3300009174 Ga0105241_10009508 Ga0105241_100095083 245
677 3300009174 Ga0105241_10025068 Ga0105241_100250682 245
678 3300009176 Ga0105242_10057719 Ga0105242_100577193 245
679 3300009176 Ga0105242_10129187 Ga0105242_101291872 245
680 3300009176 Ga0105242_10523100 Ga0105242_105231001 245
681 3300009177 Ga0105248_10022900 Ga0105248_100229004 245
682 3300009177 Ga0105248_10045266 Ga0105248_100452662 245
683 3300009177 Ga0105248_10069700 Ga0105248_100697003 245
684 3300009177 Ga0105248_10084028 Ga0105248_100840283 245
685 3300009177 Ga0105248_10113516 Ga0105248_101135163 245
686 3300009177 Ga0105248_10139895 Ga0105248_101398952 245
687 3300009177 Ga0105248_10141427 Ga0105248_101414272 245
688 3300009177 Ga0105248_10151997 Ga0105248_101519973 245
689 3300009177 Ga0105248_10161153 Ga0105248_101611532 245
690 3300009177 Ga0105248_10241756 Ga0105248_102417563 245
691 3300009177 Ga0105248_10301458 Ga0105248_103014582 245
692 3300009177 Ga0105248_10405501 Ga0105248_104055011 245
693 3300009545 Ga0105237_10000847 Ga0105237_1000084718 245
694 3300009545 Ga0105237_10000915 Ga0105237_1000091515 245
695 3300009545 Ga0105237_10022783 Ga0105237_100227837 245
696 3300009545 Ga0105237_10269095 Ga0105237_102690952 245
697 3300009545 Ga0105237_10359159 Ga0105237_103591592 245
698 3300009551 Ga0105238_10003841 Ga0105238_1000384115 245
699 3300009551 Ga0105238_10031634 Ga0105238_100316344 245
700 3300009551 Ga0105238_10041248 Ga0105238_100412484 245
701 3300009551 Ga0105238_10051367 Ga0105238_100513672 245
702 3300009551 Ga0105238_10169050 Ga0105238_101690503 245
703 3300009551 Ga0105238_10373775 Ga0105238_103737751 245
704 3300009553 Ga0105249_10032614 Ga0105249_100326146 245
705 3300009553 Ga0105249_10128466 Ga0105249_101284662 245
706 3300009553 Ga0105249_10207932 Ga0105249_102079322 245
707 3300009553 Ga0105249_10327745 Ga0105249_103277452 245
708 3300009553 Ga0105249_10580285 Ga0105249_105802852 245
709 3300010375 Ga0105239_10027635 Ga0105239_100276358 245
710 3300010375 Ga0105239_10037879 Ga0105239_100378794 245
711 3300010375 Ga0105239_10101847 Ga0105239_101018473 245
712 3300010375 Ga0105239_10199484 Ga0105239_101994841 245
713 3300010375 Ga0105239_10228023 Ga0105239_102280232 245
714 3300010375 Ga0105239_10330372 Ga0105239_103303722 245
715 3300010375 Ga0105239_10343275 Ga0105239_103432751 245
716 3300011119 Ga0105246_10018900 Ga0105246_100189002 245
717 3300011119 Ga0105246_10020051 Ga0105246_100200515 245
718 3300011119 Ga0105246_10068357 Ga0105246_100683574 245
719 3300011119 Ga0105246_10071926 Ga0105246_100719262 245
720 3300011119 Ga0105246_10330228 Ga0105246_103302282 245
721 3300012500 Ga0157314_1000336 Ga0157314_10003364 245
722 3300013100 Ga0157373_10001433 Ga0157373_1000143317 245
723 3300013100 Ga0157373_10059119 Ga0157373_100591193 245
724 3300013102 Ga0157371_10033215 Ga0157371_100332153 245
725 3300013104 Ga0157370_10004330 Ga0157370_1000433014 245
726 3300013104 Ga0157370_10005321 Ga0157370_100053216 245
727 3300013104 Ga0157370_10012557 Ga0157370_100125572 245
728 3300013104 Ga0157370_10024107 Ga0157370_100241072 245
729 3300013104 Ga0157370_10095040 Ga0157370_100950402 245
730 3300013105 Ga0157369_10030815 Ga0157369_100308154 245
731 3300013105 Ga0157369_10032889 Ga0157369_100328893 245
732 3300013105 Ga0157369_10084641 Ga0157369_100846413 245
733 3300013296 Ga0157374_10008130 Ga0157374_100081309 245
734 3300013296 Ga0157374_10032314 Ga0157374_100323144 245
735 3300013296 Ga0157374_10121714 Ga0157374_101217143 245
736 3300013296 Ga0157374_10126224 Ga0157374_101262242 245
737 3300013296 Ga0157374_10151961 Ga0157374_101519611 245
738 3300013296 Ga0157374_10164769 Ga0157374_101647692 245
739 3300013296 Ga0157374_10357564 Ga0157374_103575641 245
740 3300013296 Ga0157374_10880860 Ga0157374_108808601 245
741 3300013297 Ga0157378_10036294 Ga0157378_100362945 245
742 3300013297 Ga0157378_10046583 Ga0157378_100465832 245
743 3300013297 Ga0157378_10056981 Ga0157378_100569812 245
744 3300013297 Ga0157378_10090985 Ga0157378_100909852 245
745 3300013297 Ga0157378_10092382 Ga0157378_100923822 245
746 3300013297 Ga0157378_10095877 Ga0157378_100958772 245
747 3300013297 Ga0157378_10209068 Ga0157378_102090682 245
748 3300013297 Ga0157378_10284117 Ga0157378_102841172 245
749 3300013297 Ga0157378_10586572 Ga0157378_105865722 245
750 3300013306 Ga0163162_10001714 Ga0163162_1000171412 245
751 3300013306 Ga0163162_10003918 Ga0163162_100039186 245
752 3300013306 Ga0163162_10007822 Ga0163162_100078228 245
753 3300013306 Ga0163162_10033766 Ga0163162_100337663 245
754 3300013306 Ga0163162_10036069 Ga0163162_100360692 245
755 3300013306 Ga0163162_10055718 Ga0163162_100557186 245
756 3300013306 Ga0163162_10376768 Ga0163162_103767682 245
757 3300013306 Ga0163162_10511858 Ga0163162_105118582 245
758 3300013306 Ga0163162_11020757 Ga0163162_110207572 245
759 3300013307 Ga0157372_10007187 Ga0157372_100071873 245
760 3300013307 Ga0157372_10011420 Ga0157372_100114207 245
761 3300013308 Ga0157375_10001397 Ga0157375_100013974 245
762 3300013308 Ga0157375_10017888 Ga0157375_100178883 245
763 3300013308 Ga0157375_10020474 Ga0157375_100204747 245
764 3300013308 Ga0157375_10028676 Ga0157375_100286764 245
765 3300013308 Ga0157375_10054953 Ga0157375_100549532 245
766 3300013308 Ga0157375_10066468 Ga0157375_100664683 245
767 3300013308 Ga0157375_10124417 Ga0157375_101244172 245
768 3300013308 Ga0157375_10213840 Ga0157375_102138402 245
769 3300013308 Ga0157375_11122074 Ga0157375_111220741 245
770 3300014325 Ga0163163_10007632 Ga0163163_100076322 245
771 3300014325 Ga0163163_10012078 Ga0163163_100120788 245
772 3300014326 Ga0157380_10067378 Ga0157380_100673783 245
773 3300014326 Ga0157380_10423601 Ga0157380_104236012 245
774 3300014326 Ga0157380_10523567 Ga0157380_105235671 245
775 3300014745 Ga0157377_10007033 Ga0157377_100070336 245
776 3300014745 Ga0157377_10015692 Ga0157377_100156923 245
777 3300014968 Ga0157379_10010447 Ga0157379_100104478 245
778 3300014968 Ga0157379_10010738 Ga0157379_100107381 245
779 3300014968 Ga0157379_10040992 Ga0157379_100409924 245
780 3300014968 Ga0157379_10051721 Ga0157379_100517213 245
781 3300014968 Ga0157379_10124964 Ga0157379_101249642 245
782 3300014968 Ga0157379_10125167 Ga0157379_101251675 245
783 3300014968 Ga0157379_10686952 Ga0157379_106869522 245
784 3300014969 Ga0157376_10022001 Ga0157376_100220012 245
785 3300014969 Ga0157376_10025325 Ga0157376_100253252 245
786 3300014969 Ga0157376_10050657 Ga0157376_100506573 245
787 3300017792 Ga0163161_10030285 Ga0163161_100302852 245
788 3300017792 Ga0163161_10032659 Ga0163161_100326592 245
789 3300017792 Ga0163161_10087344 Ga0163161_100873441 245
790 3300020080 Ga0206350_10220090 Ga0206350_102200902 245
791 3300021361 Ga0213872_10000118 Ga0213872_1000011856 245
792 3300021361 Ga0213872_10004098 Ga0213872_1000409810 245
793 3300021361 Ga0213872_10037061 Ga0213872_100370612 245
794 3300021361 Ga0213872_10075855 Ga0213872_100758552 245
795 3300021361 Ga0213872_10106399 Ga0213872_101063992 245
796 3300021361 Ga0213872_10129058 Ga0213872_101290582 245
797 3300021361 Ga0213872_10163022 Ga0213872_101630221 245
798 3300021377 Ga0213874_10001048 Ga0213874_100010483 245
799 3300021377 Ga0213874_10015836 Ga0213874_100158362 245
800 3300021384 Ga0213876_10042201 Ga0213876_100422012 245
801 3300021384 Ga0213876_10045680 Ga0213876_100456803 245
802 3300024227 Ga0228598_1025571 Ga0228598_10255711 245
803 3300025207 Ga0209760_100361 Ga0209760_1003612 245
804 3300025224 Ga0209784_100074 Ga0209784_100074117 245
805 3300025228 Ga0209672_100616 Ga0209672_1006167 245
806 3300025231 Ga0207427_100079 Ga0207427_100079117 245
807 3300025233 Ga0209437_100163 Ga0209437_100163117 245
808 3300025233 Ga0209437_102147 Ga0209437_1021472 245
809 3300025242 Ga0209258_100196 Ga0209258_100196101 245
810 3300025246 Ga0209646_1000369 Ga0209646_100036916 245
811 3300025250 Ga0209026_1000109 Ga0209026_100010921 245
812 3300025250 Ga0209026_1000184 Ga0209026_100018463 245
813 3300025254 Ga0209148_1000001 Ga0209148_100000121 245
814 3300025256 Ga0209759_1000414 Ga0209759_100041450 245
815 3300025256 Ga0209759_1000534 Ga0209759_10005345 245
816 3300025261 Ga0209233_1000002 Ga0209233_10000022210 245
817 3300025272 Ga0209455_1000155 Ga0209455_100015598 245
818 3300025272 Ga0209455_1012952 Ga0209455_10129522 245
819 3300025297 Ga0209758_1000028 Ga0209758_1000028183 245
820 3300025297 Ga0209758_1000088 Ga0209758_1000088192 245
821 3300025297 Ga0209758_1000723 Ga0209758_100072327 245
822 3300025297 Ga0209758_1017055 Ga0209758_10170553 245
823 3300025297 Ga0209758_1021417 Ga0209758_10214175 245
824 3300025297 Ga0209758_1038634 Ga0209758_10386343 245
825 3300025298 Ga0209050_1039333 Ga0209050_10393332 245
826 3300025302 Ga0207426_1024803 Ga0207426_10248032 245
827 3300025304 Ga0209257_1012625 Ga0209257_10126251 245
828 3300025315 Ga0207697_10019641 Ga0207697_100196413 245
829 3300025321 Ga0207656_10059819 Ga0207656_100598192 245
830 3300025321 Ga0207656_10086819 Ga0207656_100868192 245
831 3300025711 Ga0207696_1039058 Ga0207696_10390582 245
832 3300025885 Ga0207653_10044455 Ga0207653_100444551 245
833 3300025885 Ga0207653_10109620 Ga0207653_101096201 245
834 3300025893 Ga0207682_10001738 Ga0207682_100017386 245
835 3300025893 Ga0207682_10103027 Ga0207682_101030272 245
836 3300025898 Ga0207692_10004390 Ga0207692_100043906 245
837 3300025898 Ga0207692_10013154 Ga0207692_100131542 245
838 3300025898 Ga0207692_10119652 Ga0207692_101196522 245
839 3300025899 Ga0207642_10011242 Ga0207642_100112422 245
840 3300025899 Ga0207642_10070473 Ga0207642_100704732 245
841 3300025900 Ga0207710_10005521 Ga0207710_100055215 245
842 3300025900 Ga0207710_10021773 Ga0207710_100217732 245
843 3300025900 Ga0207710_10109341 Ga0207710_101093412 245
844 3300025900 Ga0207710_10150574 Ga0207710_101505742 245
845 3300025901 Ga0207688_10080165 Ga0207688_100801653 245
846 3300025903 Ga0207680_10001058 Ga0207680_100010582 245
847 3300025903 Ga0207680_10002416 Ga0207680_100024166 245
848 3300025903 Ga0207680_10016663 Ga0207680_100166633 245
849 3300025903 Ga0207680_10043946 Ga0207680_100439463 245
850 3300025903 Ga0207680_10067102 Ga0207680_100671022 245
851 3300025903 Ga0207680_10084727 Ga0207680_100847272 245
852 3300025904 Ga0207647_10018037 Ga0207647_100180376 245
853 3300025905 Ga0207685_10003238 Ga0207685_100032383 245
854 3300025905 Ga0207685_10012205 Ga0207685_100122053 245
855 3300025905 Ga0207685_10035038 Ga0207685_100350383 245
856 3300025906 Ga0207699_10024177 Ga0207699_100241772 245
857 3300025906 Ga0207699_10258203 Ga0207699_102582031 245
858 3300025907 Ga0207645_10003854 Ga0207645_100038546 245
859 3300025907 Ga0207645_10015977 Ga0207645_100159772 245
860 3300025907 Ga0207645_10018353 Ga0207645_100183532 245
861 3300025907 Ga0207645_10021110 Ga0207645_100211103 245
862 3300025907 Ga0207645_10038255 Ga0207645_100382552 245
863 3300025907 Ga0207645_10137135 Ga0207645_101371351 245
864 3300025908 Ga0207643_10000872 Ga0207643_100008727 245
865 3300025911 Ga0207654_10097443 Ga0207654_100974432 245
866 3300025912 Ga0207707_10000993 Ga0207707_1000099313 245
867 3300025912 Ga0207707_10133932 Ga0207707_101339321 245
868 3300025912 Ga0207707_10136128 Ga0207707_101361282 245
869 3300025912 Ga0207707_10178845 Ga0207707_101788452 245
870 3300025912 Ga0207707_10278092 Ga0207707_102780922 245
871 3300025913 Ga0207695_10002637 Ga0207695_1000263716 245
872 3300025913 Ga0207695_10012555 Ga0207695_100125554 245
873 3300025913 Ga0207695_10015602 Ga0207695_100156029 245
874 3300025913 Ga0207695_10046361 Ga0207695_100463612 245
875 3300025913 Ga0207695_10087600 Ga0207695_100876002 245
876 3300025913 Ga0207695_10102534 Ga0207695_101025342 245
877 3300025913 Ga0207695_10171050 Ga0207695_101710504 245
878 3300025914 Ga0207671_10000009 Ga0207671_1000000918 245
879 3300025914 Ga0207671_10012577 Ga0207671_100125772 245
880 3300025914 Ga0207671_10049241 Ga0207671_100492413 245
881 3300025914 Ga0207671_10072645 Ga0207671_100726453 245
882 3300025914 Ga0207671_10261439 Ga0207671_102614391 245
883 3300025915 Ga0207693_10010135 Ga0207693_1001013513 245
884 3300025915 Ga0207693_10014239 Ga0207693_100142397 245
885 3300025915 Ga0207693_10024667 Ga0207693_100246673 245
886 3300025915 Ga0207693_10033504 Ga0207693_100335045 245
887 3300025915 Ga0207693_10083884 Ga0207693_100838844 245
888 3300025915 Ga0207693_10116759 Ga0207693_101167592 245
889 3300025916 Ga0207663_10015515 Ga0207663_100155152 245
890 3300025916 Ga0207663_10139487 Ga0207663_101394872 245
891 3300025916 Ga0207663_10145972 Ga0207663_101459722 245
892 3300025916 Ga0207663_10401644 Ga0207663_104016441 245
893 3300025917 Ga0207660_10001443 Ga0207660_1000144315 245
894 3300025918 Ga0207662_10000929 Ga0207662_1000092910 245
895 3300025918 Ga0207662_10050630 Ga0207662_100506302 245
896 3300025919 Ga0207657_10000882 Ga0207657_100008823 245
897 3300025919 Ga0207657_10030389 Ga0207657_100303893 245
898 3300025919 Ga0207657_10054443 Ga0207657_100544432 245
899 3300025919 Ga0207657_10118675 Ga0207657_101186752 245
900 3300025919 Ga0207657_10512775 Ga0207657_105127751 245
901 3300025920 Ga0207649_10037866 Ga0207649_100378663 245
902 3300025920 Ga0207649_10088310 Ga0207649_100883101 245
903 3300025921 Ga0207652_10010460 Ga0207652_100104607 245
904 3300025921 Ga0207652_10013461 Ga0207652_100134612 245
905 3300025921 Ga0207652_10056791 Ga0207652_100567913 245
906 3300025921 Ga0207652_10078495 Ga0207652_100784952 245
907 3300025921 Ga0207652_10100762 Ga0207652_101007622 245
908 3300025922 Ga0207646_10086275 Ga0207646_100862753 245
909 3300025922 Ga0207646_10100674 Ga0207646_101006742 245
910 3300025923 Ga0207681_10062137 Ga0207681_100621372 245
911 3300025923 Ga0207681_10066034 Ga0207681_100660343 245
912 3300025924 Ga0207694_10027047 Ga0207694_100270474 245
913 3300025924 Ga0207694_10150962 Ga0207694_101509622 245
914 3300025924 Ga0207694_10272681 Ga0207694_102726811 245
915 3300025924 Ga0207694_10771553 Ga0207694_107715531 245
916 3300025925 Ga0207650_10002222 Ga0207650_100022227 245
917 3300025925 Ga0207650_10055690 Ga0207650_100556902 245
918 3300025925 Ga0207650_10204831 Ga0207650_102048312 245
919 3300025925 Ga0207650_10435653 Ga0207650_104356532 245
920 3300025926 Ga0207659_10026579 Ga0207659_100265793 245
921 3300025927 Ga0207687_10048743 Ga0207687_100487432 245
922 3300025927 Ga0207687_10067330 Ga0207687_100673302 245
923 3300025927 Ga0207687_10114550 Ga0207687_101145502 245
924 3300025927 Ga0207687_10203847 Ga0207687_102038472 245
925 3300025927 Ga0207687_10698783 Ga0207687_106987831 245
926 3300025928 Ga0207700_10000355 Ga0207700_100003559 245
927 3300025928 Ga0207700_10035401 Ga0207700_100354012 245
928 3300025928 Ga0207700_10050938 Ga0207700_100509383 245
929 3300025928 Ga0207700_10082293 Ga0207700_100822933 245
930 3300025928 Ga0207700_10256478 Ga0207700_102564781 245
931 3300025928 Ga0207700_10320186 Ga0207700_103201861 245
932 3300025928 Ga0207700_10325758 Ga0207700_103257582 245
933 3300025929 Ga0207664_10041119 Ga0207664_100411195 245
934 3300025929 Ga0207664_10105270 Ga0207664_101052702 245
935 3300025929 Ga0207664_10916463 Ga0207664_109164631 245
936 3300025931 Ga0207644_10000992 Ga0207644_100009926 245
937 3300025931 Ga0207644_10018949 Ga0207644_100189496 245
938 3300025931 Ga0207644_10069984 Ga0207644_100699843 245
939 3300025931 Ga0207644_10545659 Ga0207644_105456592 245
940 3300025932 Ga0207690_10007295 Ga0207690_100072954 245
941 3300025932 Ga0207690_10018571 Ga0207690_100185711 245
942 3300025932 Ga0207690_10240571 Ga0207690_102405712 245
943 3300025933 Ga0207706_10000820 Ga0207706_100008204 245
944 3300025933 Ga0207706_10023978 Ga0207706_100239786 245
945 3300025933 Ga0207706_10026374 Ga0207706_100263743 245
946 3300025933 Ga0207706_10120544 Ga0207706_101205442 245
947 3300025934 Ga0207686_10016093 Ga0207686_100160932 245
948 3300025934 Ga0207686_10147828 Ga0207686_101478282 245
949 3300025935 Ga0207709_10011118 Ga0207709_100111183 245
950 3300025935 Ga0207709_10020302 Ga0207709_100203022 245
951 3300025935 Ga0207709_10094916 Ga0207709_100949162 245
952 3300025935 Ga0207709_10201169 Ga0207709_102011692 245
953 3300025936 Ga0207670_10002275 Ga0207670_100022755 245
954 3300025936 Ga0207670_10167863 Ga0207670_101678631 245
955 3300025936 Ga0207670_10216132 Ga0207670_102161322 245
956 3300025936 Ga0207670_10282061 Ga0207670_102820611 245
957 3300025937 Ga0207669_10003927 Ga0207669_100039276 245
958 3300025938 Ga0207704_10037694 Ga0207704_100376942 245
959 3300025938 Ga0207704_10048800 Ga0207704_100488003 245
960 3300025938 Ga0207704_10069015 Ga0207704_100690153 245
961 3300025938 Ga0207704_10484342 Ga0207704_104843422 245
962 3300025939 Ga0207665_10001863 Ga0207665_100018639 245
963 3300025939 Ga0207665_10006295 Ga0207665_100062952 245
964 3300025939 Ga0207665_10105875 Ga0207665_101058751 245
965 3300025940 Ga0207691_10019811 Ga0207691_100198114 245
966 3300025940 Ga0207691_10056251 Ga0207691_100562512 245
967 3300025941 Ga0207711_10015709 Ga0207711_100157093 245
968 3300025941 Ga0207711_10026432 Ga0207711_100264325 245
969 3300025941 Ga0207711_10032690 Ga0207711_100326903 245
970 3300025941 Ga0207711_10111720 Ga0207711_101117202 245
971 3300025941 Ga0207711_10122103 Ga0207711_101221033 245
972 3300025941 Ga0207711_10258907 Ga0207711_102589073 245
973 3300025941 Ga0207711_10334788 Ga0207711_103347882 245
974 3300025941 Ga0207711_10380658 Ga0207711_103806582 245
975 3300025941 Ga0207711_10415157 Ga0207711_104151571 245
976 3300025942 Ga0207689_10035473 Ga0207689_100354732 245
977 3300025942 Ga0207689_10044726 Ga0207689_100447261 245
978 3300025942 Ga0207689_10052332 Ga0207689_100523322 245
979 3300025942 Ga0207689_10090393 Ga0207689_100903932 245
980 3300025944 Ga0207661_10028106 Ga0207661_100281065 245
981 3300025944 Ga0207661_10151152 Ga0207661_101511522 245
982 3300025944 Ga0207661_10174944 Ga0207661_101749441 245
983 3300025945 Ga0207679_10010584 Ga0207679_100105843 245
984 3300025945 Ga0207679_10032266 Ga0207679_100322662 245
985 3300025945 Ga0207679_10040139 Ga0207679_100401392 245
986 3300025945 Ga0207679_10268016 Ga0207679_102680162 245
987 3300025945 Ga0207679_10452267 Ga0207679_104522671 245
988 3300025949 Ga0207667_10000202 Ga0207667_1000020222 245
989 3300025949 Ga0207667_10000653 Ga0207667_1000065322 245
990 3300025949 Ga0207667_10001046 Ga0207667_1000104615 245
991 3300025949 Ga0207667_10005173 Ga0207667_100051734 245
992 3300025949 Ga0207667_10156429 Ga0207667_101564292 245
993 3300025949 Ga0207667_10199000 Ga0207667_101990002 245
994 3300025960 Ga0207651_10002984 Ga0207651_100029846 245
995 3300025960 Ga0207651_10021608 Ga0207651_100216083 245
996 3300025960 Ga0207651_10029451 Ga0207651_100294512 245
997 3300025960 Ga0207651_10029670 Ga0207651_100296703 245
998 3300025960 Ga0207651_10174125 Ga0207651_101741252 245
999 3300025961 Ga0207712_10046641 Ga0207712_100466415 245
1000 3300025961 Ga0207712_10176792 Ga0207712_101767922 245
1001 3300025961 Ga0207712_10240547 Ga0207712_102405472 245
1002 3300025961 Ga0207712_10273544 Ga0207712_102735442 245
1003 3300025972 Ga0207668_10009222 Ga0207668_100092222 245
1004 3300025972 Ga0207668_10018888 Ga0207668_100188885 245
1005 3300025972 Ga0207668_10051269 Ga0207668_100512692 245
1006 3300025972 Ga0207668_10061909 Ga0207668_100619093 245
1007 3300025981 Ga0207640_10000372 Ga0207640_1000037212 245
1008 3300025981 Ga0207640_10000373 Ga0207640_1000037312 245
1009 3300025981 Ga0207640_10088670 Ga0207640_100886702 245
1010 3300025981 Ga0207640_10094512 Ga0207640_100945122 245
1011 3300025981 Ga0207640_10182135 Ga0207640_101821353 245
1012 3300025986 Ga0207658_10020076 Ga0207658_100200764 245
1013 3300025986 Ga0207658_10025067 Ga0207658_100250675 245
1014 3300025986 Ga0207658_10198488 Ga0207658_101984881 245
1015 3300025986 Ga0207658_10359861 Ga0207658_103598612 245
1016 3300025986 Ga0207658_10933998 Ga0207658_109339981 245
1017 3300026023 Ga0207677_10103212 Ga0207677_101032122 245
1018 3300026023 Ga0207677_10139533 Ga0207677_101395331 245
1019 3300026023 Ga0207677_10228930 Ga0207677_102289302 245
1020 3300026023 Ga0207677_10403013 Ga0207677_104030132 245
1021 3300026035 Ga0207703_10026290 Ga0207703_100262904 245
1022 3300026035 Ga0207703_10042963 Ga0207703_100429632 245
1023 3300026035 Ga0207703_10162465 Ga0207703_101624653 245
1024 3300026035 Ga0207703_10361573 Ga0207703_103615732 245
1025 3300026035 Ga0207703_10401336 Ga0207703_104013362 245
1026 3300026041 Ga0207639_10012698 Ga0207639_100126987 245
1027 3300026041 Ga0207639_10019195 Ga0207639_100191954 245
1028 3300026041 Ga0207639_10166534 Ga0207639_101665342 245
1029 3300026067 Ga0207678_10001637 Ga0207678_1000163714 245
1030 3300026067 Ga0207678_10025729 Ga0207678_100257294 245
1031 3300026067 Ga0207678_10070505 Ga0207678_100705052 245
1032 3300026067 Ga0207678_10085361 Ga0207678_100853613 245
1033 3300026067 Ga0207678_10161769 Ga0207678_101617691 245
1034 3300026067 Ga0207678_10344358 Ga0207678_103443582 245
1035 3300026067 Ga0207678_10435723 Ga0207678_104357232 245
1036 3300026075 Ga0207708_10003553 Ga0207708_1000355311 245
1037 3300026075 Ga0207708_10030683 Ga0207708_100306836 245
1038 3300026075 Ga0207708_10044738 Ga0207708_100447383 245
1039 3300026078 Ga0207702_10077079 Ga0207702_100770792 245
1040 3300026078 Ga0207702_10121842 Ga0207702_101218422 245
1041 3300026078 Ga0207702_10443274 Ga0207702_104432742 245
1042 3300026088 Ga0207641_10265901 Ga0207641_102659012 245
1043 3300026088 Ga0207641_10573123 Ga0207641_105731232 245
1044 3300026089 Ga0207648_10004480 Ga0207648_100044806 245
1045 3300026089 Ga0207648_10026444 Ga0207648_100264446 245
1046 3300026089 Ga0207648_10049175 Ga0207648_100491753 245
1047 3300026089 Ga0207648_10076585 Ga0207648_100765852 245
1048 3300026089 Ga0207648_10082741 Ga0207648_100827413 245
1049 3300026095 Ga0207676_10007903 Ga0207676_100079034 245
1050 3300026095 Ga0207676_10029439 Ga0207676_100294392 245
1051 3300026116 Ga0207674_10001249 Ga0207674_1000124919 245
1052 3300026116 Ga0207674_10004693 Ga0207674_1000469312 245
1053 3300026116 Ga0207674_10009402 Ga0207674_1000940212 245
1054 3300026116 Ga0207674_10311217 Ga0207674_103112172 245
1055 3300026118 Ga0207675_100000047 Ga0207675_10000004732 245
1056 3300026118 Ga0207675_100037475 Ga0207675_1000374753 245
1057 3300026118 Ga0207675_100169747 Ga0207675_1001697472 245
1058 3300026118 Ga0207675_100201232 Ga0207675_1002012323 245
1059 3300026121 Ga0207683_10000110 Ga0207683_1000011044 245
1060 3300026121 Ga0207683_10000127 Ga0207683_1000012729 245
1061 3300026121 Ga0207683_10011148 Ga0207683_100111484 245
1062 3300026121 Ga0207683_10018285 Ga0207683_100182855 245
1063 3300026121 Ga0207683_10023599 Ga0207683_100235994 245
1064 3300026121 Ga0207683_10044111 Ga0207683_100441115 245
1065 3300026142 Ga0207698_10044661 Ga0207698_100446614 245
1066 3300026142 Ga0207698_10053714 Ga0207698_100537142 245
1067 3300026142 Ga0207698_10069684 Ga0207698_100696843 245
1068 3300026142 Ga0207698_10079775 Ga0207698_100797753 245
1069 3300026142 Ga0207698_10272862 Ga0207698_102728621 245
1070 3300027512 Ga0209179_1001228 Ga0209179_10012283 245
1071 3300027512 Ga0209179_1018420 Ga0209179_10184202 245
1072 3300027512 Ga0209179_1030870 Ga0209179_10308702 245
1073 3300027907 Ga0207428_10000272 Ga0207428_1000027242 245
1074 3300027907 Ga0207428_10070875 Ga0207428_100708752 245
1075 3300027907 Ga0207428_10089738 Ga0207428_100897382 245
1076 3300027907 Ga0207428_10132546 Ga0207428_101325462 245
1077 3300028379 Ga0268266_10000017 Ga0268266_10000017178 245
1078 3300028379 Ga0268266_10032322 Ga0268266_100323222 245
1079 3300028379 Ga0268266_10034799 Ga0268266_100347993 245
1080 3300028379 Ga0268266_10038608 Ga0268266_100386085 245
1081 3300028379 Ga0268266_10076202 Ga0268266_100762023 245
1082 3300028379 Ga0268266_10126042 Ga0268266_101260423 245
1083 3300028379 Ga0268266_10236486 Ga0268266_102364862 245
1084 3300028379 Ga0268266_10319614 Ga0268266_103196142 245
1085 3300028380 Ga0268265_10000509 Ga0268265_100005098 245
1086 3300028380 Ga0268265_10012550 Ga0268265_100125504 245
1087 3300028380 Ga0268265_10020054 Ga0268265_100200543 245
1088 3300028380 Ga0268265_10045406 Ga0268265_100454062 245
1089 3300028381 Ga0268264_10012140 Ga0268264_100121406 245
1090 3300028381 Ga0268264_10096735 Ga0268264_100967353 245
1091 3300028381 Ga0268264_10546799 Ga0268264_105467992 245
1092 3300028786 Ga0307517_10142677 Ga0307517_101426772 245
1093 3300028794 Ga0307515_10000154 Ga0307515_1000015417 245
1094 3300028794 Ga0307515_10003464 Ga0307515_1000346410 245
1095 3300030522 Ga0307512_10031032 Ga0307512_100310326 245
1096 3300031235 Ga0265330_10075275 Ga0265330_100752752 245
1097 3300031238 Ga0265332_10001645 Ga0265332_100016459 245
1098 3300031239 Ga0265328_10000069 Ga0265328_1000006943 245
1099 3300031239 Ga0265328_10094485 Ga0265328_100944852 245
1100 3300031239 Ga0265328_10128836 Ga0265328_101288361 245
1101 3300031241 Ga0265325_10001981 Ga0265325_1000198115 245
1102 3300031242 Ga0265329_10008979 Ga0265329_100089792 245
1103 3300031249 Ga0265339_10016519 Ga0265339_100165195 245
1104 3300031250 Ga0265331_10003158 Ga0265331_1000315811 245
1105 3300031250 Ga0265331_10003427 Ga0265331_1000342712 245
1106 3300031250 Ga0265331_10019627 Ga0265331_100196275 245
1107 3300031251 Ga0265327_10000116 Ga0265327_10000116161 245
1108 3300031251 Ga0265327_10011782 Ga0265327_100117822 245
1109 3300031251 Ga0265327_10021854 Ga0265327_100218545 245
1110 3300031251 Ga0265327_10024262 Ga0265327_100242622 245
1111 3300031251 Ga0265327_10066157 Ga0265327_100661572 245
1112 3300031251 Ga0265327_10089344 Ga0265327_100893442 245
1113 3300031344 Ga0265316_10021653 Ga0265316_100216533 245
1114 3300031344 Ga0265316_10032696 Ga0265316_100326963 245
1115 3300031344 Ga0265316_10052324 Ga0265316_100523245 245
1116 3300031456 Ga0307513_10005286 Ga0307513_1000528610 245
1117 3300031456 Ga0307513_10030576 Ga0307513_100305764 245
1118 3300031456 Ga0307513_10046000 Ga0307513_100460005 245
1119 3300031456 Ga0307513_10188666 Ga0307513_101886662 245
1120 3300031456 Ga0307513_10341002 Ga0307513_103410021 245
1121 3300031507 Ga0307509_10193154 Ga0307509_101931543 245
1122 3300031507 Ga0307509_10366695 Ga0307509_103666952 245
1123 3300031507 Ga0307509_10424351 Ga0307509_104243511 245
1124 3300031595 Ga0265313_10004677 Ga0265313_100046777 245
1125 3300031595 Ga0265313_10006105 Ga0265313_100061052 245
1126 3300031595 Ga0265313_10008556 Ga0265313_100085564 245
1127 3300031616 Ga0307508_10327842 Ga0307508_103278421 245
1128 3300031665 Ga0316575_10034796 Ga0316575_100347961 245
1129 3300031711 Ga0265314_10024605 Ga0265314_100246052 245
1130 3300031711 Ga0265314_10187385 Ga0265314_101873852 245
1131 3300031712 Ga0265342_10000487 Ga0265342_1000048729 245
1132 3300031712 Ga0265342_10155152 Ga0265342_101551522 245
1133 3300031852 Ga0307410_10186603 Ga0307410_101866032 245
1134 3300031852 Ga0307410_10202592 Ga0307410_102025922 245
1135 3300031911 Ga0307412_10021192 Ga0307412_100211924 245
1136 3300031995 Ga0307409_100465259 Ga0307409_1004652591 245
1137 3300032002 Ga0307416_100177260 Ga0307416_1001772604 245
1138 3300032005 Ga0307411_10238786 Ga0307411_102387861 245
1139 3300032126 Ga0307415_100242669 Ga0307415_1002426692 245
1140 3300032126 Ga0307415_100438802 Ga0307415_1004388022 245
1141 3300032133 Ga0316583_10023855 Ga0316583_100238552 245
1142 3300032133 Ga0316583_10034987 Ga0316583_100349872 245
1143 3300033180 Ga0307510_10112030 Ga0307510_101120303 245
1144 3300034819 Ga0373958_0002456 Ga0373958_0002456_657_1397 245
1145 3300034819 Ga0373958_0005498 Ga0373958_0005498_373_1110 245
1146 3300034819 Ga0373958_0027552 Ga0373958_0027552_131_871 245
1147 3300034820 Ga0373959_0007207 Ga0373959_0007207_69_809 245
1148 3300034957 Ga0373938_0022844 Ga0373938_0022844_248_988 245
1149 3300035086 Ga0373934_0040638 Ga0373934_0040638_272_1063 245
1150 3300035089 Ga0373944_0018497 Ga0373944_0018497_431_1171 245
1151 3300035091 Ga0373951_0014805 Ga0373951_0014805_113_850 245
1152 3300035091 Ga0373951_0037622 Ga0373951_0037622_282_1067 245
1153 3300035092 Ga0373952_0002856 Ga0373952_0002856_1297_2034 245
1154 3300035111 Ga0373923_0025144 Ga0373923_0025144_245_985 245
1155 3300035111 Ga0373923_0027365 Ga0373923_0027365_1355_2092 245
1156 3300035112 Ga0373932_0024794 Ga0373932_0024794_40_780 245
1157 3300035112 Ga0373932_0085748 Ga0373932_0085748_241_978 245
1158 3300035113 Ga0373936_0051268 Ga0373936_0051268_526_1263 245
1159 3300035114 Ga0373939_0047935 Ga0373939_0047935_144_881 245
1160 3300035115 Ga0373941_0006795 Ga0373941_0006795_1768_2508 245
1161 3300035117 Ga0373953_0062150 Ga0373953_0062150_166_903 245
1162 3300035118 Ga0373954_0002463 Ga0373954_0002463_6190_6930 245
1163 3300035118 Ga0373954_0008896 Ga0373954_0008896_2436_3173 245
1164 3300035118 Ga0373954_0062174 Ga0373954_0062174_183_920 245
1165 3300035119 Ga0373956_0009177 Ga0373956_0009177_2693_3430 245
1166 3300035119 Ga0373956_0081683 Ga0373956_0081683_501_1241 245
1167 3300035119 Ga0373956_0148965 Ga0373956_0148965_276_1013 245
1168 3300035120 Ga0373957_0036911 Ga0373957_0036911_1053_1790 245
1169 3300035120 Ga0373957_0123829 Ga0373957_0123829_153_890 245
1170 3300035121 Ga0373960_0010383 Ga0373960_0010383_653_1438 245
1171 3300035121 Ga0373960_0035789 Ga0373960_0035789_367_1152 245
1172 3300035170 Ga0373943_0058749 Ga0373943_0058749_375_1166 245
1173 3300035170 Ga0373943_0121080 Ga0373943_0121080_163_945 245
1174 3300035171 Ga0373946_0004147 Ga0373946_0004147_851_1588 245
1175 3300035171 Ga0373946_0064124 Ga0373946_0064124_718_1500 245
1176 3300035172 Ga0373955_0003655 Ga0373955_0003655_1407_2147 245
1177 3300035172 Ga0373955_0006391 Ga0373955_0006391_2252_2989 245
1178 3300035207 Ga0373942_0003016 Ga0373942_0003016_1463_2203 245
1179 3300035241 Ga0373961_0001242 Ga0373961_0001242_1521_2261 245
1180 3300035241 Ga0373961_0072195 Ga0373961_0072195_151_936 245
1181 3300035242 Ga0373962_0021718 Ga0373962_0021718_873_1610 245
1182 3300035410 Ga0373924_0069463 Ga0373924_0069463_32_769 245
1183 3300035410 Ga0373924_0134815 Ga0373924_0134815_314_1054 245
1184 3300035691 Ga0373931_0007171 Ga0373931_0007171_2030_2770 245
1185 3300035691 Ga0373931_0008109 Ga0373931_0008109_2035_2820 245
1186 3300035691 Ga0373931_0010866 Ga0373931_0010866_3620_4360 245
1187 3300035691 Ga0373931_0012753 Ga0373931_0012753_1776_2516 245
1188 3300035691 Ga0373931_0023347 Ga0373931_0023347_459_1199 245
1189 3300035691 Ga0373931_0036783 Ga0373931_0036783_852_1589 245
1190 3300035691 Ga0373931_0129952 Ga0373931_0129952_193_942 245
1191 3300035691 Ga0373931_0256390 Ga0373931_0256390_297_1034 245
1192 3300035691 Ga0373931_0277590 Ga0373931_0277590_16_753 245
1193 3300035692 Ga0373935_0007419 Ga0373935_0007419_608_1345 245
1194 3300035692 Ga0373935_0076284 Ga0373935_0076284_225_965 245
1195 3300035692 Ga0373935_0143045 Ga0373935_0143045_181_918 245
1196 3300035692 Ga0373935_0360173 Ga0373935_0360173_93_833 245
1197 3300035695 Ga0373927_0000350 Ga0373927_0000350_35195_35977 245
1198 3300035695 Ga0373927_0024395 Ga0373927_0024395_2378_3169 245
1199 3300035695 Ga0373927_0030825 Ga0373927_0030825_1183_1923 245
1200 3300035695 Ga0373927_0066728 Ga0373927_0066728_1062_1844 245
1201 3300035695 Ga0373927_0067750 Ga0373927_0067750_720_1457 245
1202 3300035695 Ga0373927_0178274 Ga0373927_0178274_131_1030 245
1203 3300035695 Ga0373927_0393633 Ga0373927_0393633_139_876 245
1204 3300035724 Ga0373933_0000453 Ga0373933_0000453_7563_8303 245
1205 3300035724 Ga0373933_0005374 Ga0373933_0005374_2339_3076 245
1206 3300035724 Ga0373933_0104901 Ga0373933_0104901_304_1041 245
1207 3300035724 Ga0373933_0226022 Ga0373933_0226022_283_1026 245
1208 3300035725 Ga0373947_0005323 Ga0373947_0005323_1012_1749 245
1209 3300035725 Ga0373947_0039019 Ga0373947_0039019_987_1769 245
1210 3300035725 Ga0373947_0071387 Ga0373947_0071387_33_824 245
1211 3300035725 Ga0373947_0297126 Ga0373947_0297126_52_951 245
1212 3300035725 Ga0373947_0532081 Ga0373947_0532081_36_776 245
1213 3300036401 Ga0373937_0001219 Ga0373937_0001219_4401_5138 245
1214 3300036401 Ga0373937_0003088 Ga0373937_0003088_5602_6342 245
1215 3300036401 Ga0373937_0012242 Ga0373937_0012242_3922_4713 245
1216 3300036401 Ga0373937_0118422 Ga0373937_0118422_921_1661 245
1217 3300036401 Ga0373937_0155724 Ga0373937_0155724_788_1525 245
1218 3300036401 Ga0373937_0184099 Ga0373937_0184099_556_1296 245
1219 3300036401 Ga0373937_0379420 Ga0373937_0379420_481_1218 245
1220 3300036712 Ga0316584_0036083 Ga0316584_0036083_2670_3413 245
1221 3300037068 Ga0373925_0010886 Ga0373925_0010886_4298_5035 245
1222 3300037068 Ga0373925_0032321 Ga0373925_0032321_182_919 245
1223 3300037068 Ga0373925_0064282 Ga0373925_0064282_1466_2206 245
1224 3300037068 Ga0373925_0071351 Ga0373925_0071351_516_1253 245
1225 3300037068 Ga0373925_0512523 Ga0373925_0512523_33_773 245
1226 3300037312 Ga0395899_0000026 Ga0395899_0000026_11143_11922 245
1227 3300037312 Ga0395899_0114348 Ga0395899_0114348_174_911 245
1228 3300037418 Ga0395900_0000047 Ga0395900_0000047_18721_19470 245
1229 3300037418 Ga0395900_0001503 Ga0395900_0001503_13328_14065 245
1230 3300037418 Ga0395900_0019723 Ga0395900_0019723_3237_3998 245
1231 3300037418 Ga0395900_0621338 Ga0395900_0621338_155_892 245
1232 3300037466 Ga0395898_0003490 Ga0395898_0003490_14748_15485 245
1233 3300037466 Ga0395898_0019076 Ga0395898_0019076_2968_3729 245
1234 3300037466 Ga0395898_0440253 Ga0395898_0440253_216_1013 245
1235 3300037471 Ga0395905_0004886 Ga0395905_0004886_3781_4542 245
1236 3300037471 Ga0395905_0199259 Ga0395905_0199259_656_1408 245
1237 3300037853 Ga0436364_0828448 Ga0436364_0828448_960_1697 245
1238 3300037853 Ga0436364_1393239 Ga0436364_1393239_307_1044 245
1239 3300038443 Ga0395901_0001226 Ga0395901_0001226_1792_2553 245
1240 3300038443 Ga0395901_0010022 Ga0395901_0010022_645_1382 245
1241 3300038443 Ga0395901_0209231 Ga0395901_0209231_1103_1900 245
1242 3300039437 Ga0436365_0151785 Ga0436365_0151785_711_1496 245
1243 3300039437 Ga0436365_0949599 Ga0436365_0949599_599_1336 245
1244 3300039437 Ga0436365_1641058 Ga0436365_1641058_338_1087 245
1245 3300039438 Ga0436360_0531912 Ga0436360_0531912_966_1718 245
1246 3300039438 Ga0436360_0891854 Ga0436360_0891854_115_864 245
1247 3300039438 Ga0436360_1009514 Ga0436360_1009514_614_1351 245
1248 3300039438 Ga0436360_1174607 Ga0436360_1174607_185_922 245
1249 3300039447 Ga0436361_0028081 Ga0436361_0028081_1375_2115 245
1250 3300039447 Ga0436361_0048059 Ga0436361_0048059_248_1033 245
1251 3300039447 Ga0436361_0127711 Ga0436361_0127711_18230_18967 245
1252 3300039447 Ga0436361_0418153 Ga0436361_0418153_10685_11515 245
1253 3300039447 Ga0436361_0638552 Ga0436361_0638552_1502_2242 245
1254 3300039447 Ga0436361_0755574 Ga0436361_0755574_559_1341 245
1255 3300039447 Ga0436361_0812671 Ga0436361_0812671_354_1091 245
1256 3300039447 Ga0436361_0853416 Ga0436361_0853416_155_907 245
1257 3300039447 Ga0436361_0860938 Ga0436361_0860938_792_1532 245
1258 3300039447 Ga0436361_0928183 Ga0436361_0928183_2345_3082 245
1259 3300039447 Ga0436361_1075749 Ga0436361_1075749_381_1121 245
1260 3300039447 Ga0436361_1093023 Ga0436361_1093023_354_1091 245
1261 3300039450 Ga0436363_0312802 Ga0436363_0312802_421_1203 245
1262 3300039450 Ga0436363_0352027 Ga0436363_0352027_498_1286 245
1263 3300039450 Ga0436363_0527007 Ga0436363_0527007_5880_6692 245
1264 3300039450 Ga0436363_0692197 Ga0436363_0692197_894_1655 245
1265 3300039450 Ga0436363_1416910 Ga0436363_1416910_73_810 245
1266 3300039453 Ga0436362_0105602 Ga0436362_0105602_248_985 245
1267 3300039453 Ga0436362_0370297 Ga0436362_0370297_1827_2639 245
1268 3300041404 Ga0439436_0002769 Ga0439436_0002769_4317_5057 245
1269 3300041405 Ga0439438_059149 Ga0439438_059149_112_852 245
1270 3300041406 Ga0439439_0020708 Ga0439439_0020708_59_799 245
1271 3300041408 Ga0439453_0003335 Ga0439453_0003335_884_1666 245
1272 3300041443 Ga0451789_0668365 Ga0451789_0668365_161_901 245
1273 3300041458 Ga0451798_0386068 Ga0451798_0386068_47_787 245
1274 3300041460 Ga0451802_1418806 Ga0451802_1418806_78_818 245
1275 3300041494 Ga0451837_0967515 Ga0451837_0967515_66_806 245
1276 3300041501 Ga0451845_0807564 Ga0451845_0807564_23_763 245
1277 3300041505 Ga0451849_1239345 Ga0451849_1239345_937_1677 245
1278 3300041509 Ga0451843_0494544 Ga0451843_0494544_203_943 245
1279 3300041512 Ga0451853_1654492 Ga0451853_1654492_38_829 245
1280 3300041997 Ga0439431_0019756 Ga0439431_0019756_34_774 245
1281 3300042121 Ga0450919_000339 Ga0450919_000339_2080_2817 245
1282 3300042145 Ga0450906_004168 Ga0450906_004168_1054_1794 245
1283 3300042531 Ga0450918_002696 Ga0450918_002696_293_1030 245
1284 3300044656 Ga0466969_0002458 Ga0466969_0002458_989_1780 245
1285 3300044656 Ga0466969_0014983 Ga0466969_0014983_1799_2590 245
1286 3300044656 Ga0466969_0079314 Ga0466969_0079314_686_1435 245
1287 3300044661 Ga0466975_0221082 Ga0466975_0221082_81_872 245
1288 3300044683 Ga0466965_0170339 Ga0466965_0170339_27_818 245
1289 3300044684 Ga0466966_0010009 Ga0466966_0010009_2331_3122 245
1290 3300044693 Ga0466961_0001657 Ga0466961_0001657_286_1077 245
1291 3300044693 Ga0466961_0001859 Ga0466961_0001859_12101_12850 245
1292 3300044693 Ga0466961_0114302 Ga0466961_0114302_476_1267 245
1293 3300044706 Ga0466964_0031808 Ga0466964_0031808_84_833 245
1294 3300044719 Ga0466971_0008342 Ga0466971_0008342_3531_4322 245
1295 3300044765 Ga0466970_0008475 Ga0466970_0008475_3210_3959 245
1296 3300044842 Ga0466957_0003055 Ga0466957_0003055_939_1688 245
1297 3300045049 Ga0466959_0006800 Ga0466959_0006800_5251_6042 245
1298 3300045836 Ga0466958_0023682 Ga0466958_0023682_854_1645 245
1299 3300045836 Ga0466958_0029015 Ga0466958_0029015_46_837 245
1300 3300046452 Ga0495617_000012 Ga0495617_000012_196838_197593 245
1301 3300046452 Ga0495617_010086 Ga0495617_010086_398_1150 245
1302 3300046452 Ga0495617_078309 Ga0495617_078309_76_831 245
1303 3300046453 Ga0495627_000118 Ga0495627_000118_39248_40003 245
1304 3300046453 Ga0495627_005412 Ga0495627_005412_2524_3279 245
1305 3300046454 Ga0495592_0008756 Ga0495592_0008756_5452_6192 245
1306 3300046454 Ga0495592_0016393 Ga0495592_0016393_1060_1797 245
1307 3300046454 Ga0495592_0034159 Ga0495592_0034159_1733_2473 245
1308 3300046454 Ga0495592_0068643 Ga0495592_0068643_290_1027 245
1309 3300046454 Ga0495592_0288772 Ga0495592_0288772_195_932 245
1310 3300046455 Ga0495603_0017270 Ga0495603_0017270_1154_1906 245
1311 3300046455 Ga0495603_0035288 Ga0495603_0035288_2131_2871 245
1312 3300046455 Ga0495603_0076850 Ga0495603_0076850_417_1208 245
1313 3300046455 Ga0495603_0093450 Ga0495603_0093450_157_966 245
1314 3300046455 Ga0495603_0134206 Ga0495603_0134206_568_1350 245
1315 3300046457 Ga0495590_0009969 Ga0495590_0009969_2258_3019 245
1316 3300046458 Ga0495591_050666 Ga0495591_050666_189_944 245
1317 3300046459 Ga0495629_0004167 Ga0495629_0004167_9021_9758 245
1318 3300046459 Ga0495629_0004691 Ga0495629_0004691_2792_3574 245
1319 3300046459 Ga0495629_0007672 Ga0495629_0007672_3051_3791 245
1320 3300046459 Ga0495629_0010101 Ga0495629_0010101_1133_1870 245
1321 3300046459 Ga0495629_0071685 Ga0495629_0071685_816_1568 245
1322 3300046459 Ga0495629_0095264 Ga0495629_0095264_1053_1790 245
1323 3300046459 Ga0495629_0096585 Ga0495629_0096585_375_1169 245
1324 3300046459 Ga0495629_0319679 Ga0495629_0319679_260_1003 245
1325 3300046459 Ga0495629_0406119 Ga0495629_0406119_31_771 245
1326 3300046460 Ga0495638_0000112 Ga0495638_0000112_2146_2886 245
1327 3300046460 Ga0495638_0002403 Ga0495638_0002403_11512_12252 245
1328 3300046460 Ga0495638_0011651 Ga0495638_0011651_2431_3186 245
1329 3300046460 Ga0495638_0015128 Ga0495638_0015128_2929_3777 245
1330 3300046460 Ga0495638_0039643 Ga0495638_0039643_1574_2326 245
1331 3300046460 Ga0495638_0113675 Ga0495638_0113675_349_1140 245
1332 3300046461 Ga0495641_0017267 Ga0495641_0017267_1281_2021 245
1333 3300046461 Ga0495641_0049229 Ga0495641_0049229_338_1075 245
1334 3300046461 Ga0495641_0063864 Ga0495641_0063864_284_1075 245
1335 3300046462 Ga0495651_0003142 Ga0495651_0003142_5396_6136 245
1336 3300046462 Ga0495651_0003731 Ga0495651_0003731_176_913 245
1337 3300046462 Ga0495651_0019238 Ga0495651_0019238_3691_4428 245
1338 3300046462 Ga0495651_0042479 Ga0495651_0042479_1047_1787 245
1339 3300046462 Ga0495651_0204534 Ga0495651_0204534_249_1031 245
1340 3300046463 Ga0495653_0000858 Ga0495653_0000858_22377_23114 245
1341 3300046463 Ga0495653_0006293 Ga0495653_0006293_1511_2293 245
1342 3300046463 Ga0495653_0008376 Ga0495653_0008376_6803_7543 245
1343 3300046463 Ga0495653_0019501 Ga0495653_0019501_3786_4526 245
1344 3300046463 Ga0495653_0286619 Ga0495653_0286619_153_890 245
1345 3300046471 Ga0495650_0067134 Ga0495650_0067134_227_982 245
1346 3300046472 Ga0495580_0000454 Ga0495580_0000454_31771_32511 245
1347 3300046472 Ga0495580_0081541 Ga0495580_0081541_1150_1890 245
1348 3300046472 Ga0495580_0196177 Ga0495580_0196177_186_1085 245
1349 3300046473 Ga0495582_0002722 Ga0495582_0002722_6093_6833 245
1350 3300046473 Ga0495582_0008025 Ga0495582_0008025_1426_2163 245
1351 3300046473 Ga0495582_0066256 Ga0495582_0066256_276_1013 245
1352 3300046473 Ga0495582_0124021 Ga0495582_0124021_601_1392 245
1353 3300046473 Ga0495582_0243164 Ga0495582_0243164_83_982 245
1354 3300046473 Ga0495582_0333198 Ga0495582_0333198_97_837 245
1355 3300046474 Ga0495605_0000072 Ga0495605_0000072_61596_62351 245
1356 3300046474 Ga0495605_0002665 Ga0495605_0002665_2909_3664 245
1357 3300046474 Ga0495605_0006147 Ga0495605_0006147_3984_4724 245
1358 3300046474 Ga0495605_0008015 Ga0495605_0008015_187_942 245
1359 3300046474 Ga0495605_0054683 Ga0495605_0054683_278_1126 245
1360 3300046475 Ga0495639_0066508 Ga0495639_0066508_784_1524 245
1361 3300046476 Ga0495662_0007894 Ga0495662_0007894_1380_2123 245
1362 3300046476 Ga0495662_0020129 Ga0495662_0020129_1930_2712 245
1363 3300046476 Ga0495662_0080776 Ga0495662_0080776_417_1208 245
1364 3300046476 Ga0495662_0135497 Ga0495662_0135497_75_815 245
1365 3300046476 Ga0495662_0168840 Ga0495662_0168840_47_784 245
1366 3300046477 Ga0495664_0001899 Ga0495664_0001899_1715_2455 245
1367 3300046477 Ga0495664_0002840 Ga0495664_0002840_4979_5719 245
1368 3300046477 Ga0495664_0032858 Ga0495664_0032858_798_1535 245
1369 3300046477 Ga0495664_0114409 Ga0495664_0114409_693_1430 245
1370 3300046491 Ga0495584_0001725 Ga0495584_0001725_3912_4664 245
1371 3300046491 Ga0495584_0011234 Ga0495584_0011234_850_1605 245
1372 3300046491 Ga0495584_0095832 Ga0495584_0095832_208_999 245
1373 3300046491 Ga0495584_0216217 Ga0495584_0216217_131_883 245
1374 3300046492 Ga0495585_0056771 Ga0495585_0056771_880_1635 245
1375 3300046492 Ga0495585_0127873 Ga0495585_0127873_298_1053 245
1376 3300046499 Ga0495594_0015588 Ga0495594_0015588_80_832 245
1377 3300046499 Ga0495594_0029906 Ga0495594_0029906_261_998 245
1378 3300046499 Ga0495594_0062099 Ga0495594_0062099_1209_1991 245
1379 3300046499 Ga0495594_0169618 Ga0495594_0169618_30_821 245
1380 3300046500 Ga0495596_0000124 Ga0495596_0000124_4580_5335 245
1381 3300046500 Ga0495596_0013465 Ga0495596_0013465_2309_3064 245
1382 3300046501 Ga0495607_0002863 Ga0495607_0002863_2068_2823 245
1383 3300046501 Ga0495607_0100506 Ga0495607_0100506_449_1204 245
1384 3300046506 Ga0495583_0009595 Ga0495583_0009595_384_1124 245
1385 3300046507 Ga0495606_0000134 Ga0495606_0000134_103327_104067 245
1386 3300046511 Ga0495608_0001345 Ga0495608_0001345_12040_12780 245
1387 3300046511 Ga0495608_0012348 Ga0495608_0012348_1998_2735 245
1388 3300046511 Ga0495608_0027649 Ga0495608_0027649_334_1071 245
1389 3300046513 Ga0495616_0001928 Ga0495616_0001928_10056_10811 245
1390 3300046513 Ga0495616_0004850 Ga0495616_0004850_5390_6145 245
1391 3300046513 Ga0495616_0013540 Ga0495616_0013540_2298_3053 245
1392 3300046513 Ga0495616_0043171 Ga0495616_0043171_935_1675 245
1393 3300046513 Ga0495616_0206606 Ga0495616_0206606_58_846 245
1394 3300046514 Ga0495618_0004528 Ga0495618_0004528_6764_7546 245
1395 3300046514 Ga0495618_0006192 Ga0495618_0006192_6218_6958 245
1396 3300046514 Ga0495618_0019953 Ga0495618_0019953_492_1232 245
1397 3300046514 Ga0495618_0027957 Ga0495618_0027957_1963_2706 245
1398 3300046514 Ga0495618_0037853 Ga0495618_0037853_660_1397 245
1399 3300046514 Ga0495618_0131332 Ga0495618_0131332_181_918 245
1400 3300046516 Ga0495628_0014868 Ga0495628_0014868_2719_3456 245
1401 3300046516 Ga0495628_0032039 Ga0495628_0032039_2413_3150 245
1402 3300046516 Ga0495628_0040628 Ga0495628_0040628_2025_2765 245
1403 3300046516 Ga0495628_0047209 Ga0495628_0047209_933_1673 245
1404 3300046516 Ga0495628_0047576 Ga0495628_0047576_2113_2853 245
1405 3300046516 Ga0495628_0290968 Ga0495628_0290968_254_1045 245
1406 3300046517 Ga0495630_0001787 Ga0495630_0001787_6483_7223 245
1407 3300046517 Ga0495630_0062504 Ga0495630_0062504_1722_2504 245
1408 3300046517 Ga0495630_0074315 Ga0495630_0074315_945_1682 245
1409 3300046517 Ga0495630_0273150 Ga0495630_0273150_295_1035 245
1410 3300046517 Ga0495630_0520008 Ga0495630_0520008_54_845 245
1411 3300046517 Ga0495630_0566084 Ga0495630_0566084_46_789 245
1412 3300046518 Ga0495631_0002621 Ga0495631_0002621_1697_2452 245
1413 3300046518 Ga0495631_0034872 Ga0495631_0034872_898_1653 245
1414 3300046518 Ga0495631_0063240 Ga0495631_0063240_312_1067 245
1415 3300046522 Ga0495643_0004593 Ga0495643_0004593_5710_6465 245
1416 3300046522 Ga0495643_0024947 Ga0495643_0024947_2329_3084 245
1417 3300046523 Ga0495644_0001837 Ga0495644_0001837_4308_5063 245
1418 3300046523 Ga0495644_0005452 Ga0495644_0005452_2796_3551 245
1419 3300046523 Ga0495644_0010415 Ga0495644_0010415_1598_2353 245
1420 3300046523 Ga0495644_0035468 Ga0495644_0035468_988_1743 245
1421 3300046524 Ga0495648_0000116 Ga0495648_0000116_42626_43381 245
1422 3300046524 Ga0495648_0004656 Ga0495648_0004656_9409_10149 245
1423 3300046524 Ga0495648_0058086 Ga0495648_0058086_925_1665 245
1424 3300046524 Ga0495648_0080473 Ga0495648_0080473_396_1151 245
1425 3300046525 Ga0495663_0008509 Ga0495663_0008509_1816_2571 245
1426 3300046526 Ga0495666_0002793 Ga0495666_0002793_1937_2677 245
1427 3300046526 Ga0495666_0011471 Ga0495666_0011471_1406_2197 245
1428 3300046526 Ga0495666_0056339 Ga0495666_0056339_753_1493 245
1429 3300046528 Ga0495642_0000010 Ga0495642_0000010_41403_42158 245
1430 3300046528 Ga0495642_0002701 Ga0495642_0002701_3714_4469 245
1431 3300046528 Ga0495642_0013318 Ga0495642_0013318_684_1439 245
1432 3300046528 Ga0495642_0165124 Ga0495642_0165124_178_930 245
1433 3300046529 Ga0495652_0003110 Ga0495652_0003110_1327_2064 245
1434 3300046529 Ga0495652_0008953 Ga0495652_0008953_6883_7623 245
1435 3300046529 Ga0495652_0012748 Ga0495652_0012748_5523_6263 245
1436 3300046529 Ga0495652_0054659 Ga0495652_0054659_2425_3207 245
1437 3300046529 Ga0495652_0076648 Ga0495652_0076648_144_884 245
1438 3300046530 Ga0495654_0015441 Ga0495654_0015441_2520_3275 245
1439 3300046531 Ga0495665_0003008 Ga0495665_0003008_6883_7623 245
1440 3300046531 Ga0495665_0070498 Ga0495665_0070498_31_771 245
1441 3300046531 Ga0495665_0155024 Ga0495665_0155024_290_1027 245
1442 3300046533 Ga0495640_0000872 Ga0495640_0000872_16225_16962 245
1443 3300046533 Ga0495640_0005321 Ga0495640_0005321_6807_7589 245
1444 3300046533 Ga0495640_0015206 Ga0495640_0015206_3329_4069 245
1445 3300046533 Ga0495640_0022059 Ga0495640_0022059_3784_4524 245
1446 3300046533 Ga0495640_0022510 Ga0495640_0022510_2817_3554 245
1447 3300046533 Ga0495640_0036578 Ga0495640_0036578_292_1035 245
1448 3300046533 Ga0495640_0064077 Ga0495640_0064077_138_878 245
1449 3300046533 Ga0495640_0124925 Ga0495640_0124925_327_1121 245
1450 3300046535 Ga0495586_0019213 Ga0495586_0019213_1944_2684 245
1451 3300046535 Ga0495586_0034358 Ga0495586_0034358_245_985 245
1452 3300046536 Ga0495587_0005549 Ga0495587_0005549_1873_2613 245
1453 3300046536 Ga0495587_0011186 Ga0495587_0011186_3016_3753 245
1454 3300046536 Ga0495587_0019846 Ga0495587_0019846_2069_2809 245
1455 3300046536 Ga0495587_0031092 Ga0495587_0031092_2231_3013 245
1456 3300046536 Ga0495587_0070193 Ga0495587_0070193_813_1604 245
1457 3300046537 Ga0495598_0048824 Ga0495598_0048824_466_1218 245
1458 3300046538 Ga0495609_0001620 Ga0495609_0001620_4097_4852 245
1459 3300046538 Ga0495609_0047891 Ga0495609_0047891_700_1599 245
1460 3300046538 Ga0495609_0161812 Ga0495609_0161812_152_904 245
1461 3300046542 Ga0495597_0000892 Ga0495597_0000892_16283_17038 245
1462 3300046542 Ga0495597_0076441 Ga0495597_0076441_279_1019 245
1463 3300046542 Ga0495597_0176235 Ga0495597_0176235_23_778 245
1464 3300046543 Ga0495645_0011301 Ga0495645_0011301_301_1041 245
1465 3300046543 Ga0495645_0019552 Ga0495645_0019552_1744_2484 245
1466 3300046543 Ga0495645_0133153 Ga0495645_0133153_847_1584 245
1467 3300046557 Ga0495622_0001829 Ga0495622_0001829_256_996 245
1468 3300046557 Ga0495622_0002339 Ga0495622_0002339_2771_3526 245
1469 3300046557 Ga0495622_0003505 Ga0495622_0003505_3986_4726 245
1470 3300046558 Ga0495633_0003061 Ga0495633_0003061_3076_3831 245
1471 3300046559 Ga0495667_0002046 Ga0495667_0002046_7021_7761 245
1472 3300046559 Ga0495667_0005031 Ga0495667_0005031_3681_4463 245
1473 3300046559 Ga0495667_0007416 Ga0495667_0007416_4415_5152 245
1474 3300046559 Ga0495667_0009714 Ga0495667_0009714_2605_3342 245
1475 3300046615 Ga0495656_0001373 Ga0495656_0001373_7157_7912 245
1476 3300046615 Ga0495656_0005200 Ga0495656_0005200_2163_2918 245
1477 3300046615 Ga0495656_0025740 Ga0495656_0025740_1580_2320 245
1478 3300046615 Ga0495656_0052512 Ga0495656_0052512_466_1218 245
1479 3300046616 Ga0495668_0000532 Ga0495668_0000532_42423_43178 245
1480 3300046616 Ga0495668_0003038 Ga0495668_0003038_8867_9622 245
1481 3300046616 Ga0495668_0032299 Ga0495668_0032299_12_752 245
1482 3300046616 Ga0495668_0078854 Ga0495668_0078854_328_1083 245
1483 3300046616 Ga0495668_0128930 Ga0495668_0128930_596_1336 245
1484 3300046642 Ga0495634_0002066 Ga0495634_0002066_10924_11661 245
1485 3300046642 Ga0495634_0002970 Ga0495634_0002970_5176_5958 245
1486 3300046642 Ga0495634_0006796 Ga0495634_0006796_1456_2196 245
1487 3300046642 Ga0495634_0024940 Ga0495634_0024940_2645_3385 245
1488 3300046642 Ga0495634_0035741 Ga0495634_0035741_2520_3257 245
1489 3300046648 Ga0495611_0010389 Ga0495611_0010389_2988_3743 245
1490 3300046648 Ga0495611_0019049 Ga0495611_0019049_246_1001 245
1491 3300046648 Ga0495611_0047800 Ga0495611_0047800_820_1668 245
1492 3300046648 Ga0495611_0066321 Ga0495611_0066321_301_1041 245
1493 3300046648 Ga0495611_0173094 Ga0495611_0173094_191_982 245
1494 3300046660 Ga0495625_0121343 Ga0495625_0121343_971_1711 245
1495 3300046660 Ga0495625_0142544 Ga0495625_0142544_809_1549 245
1496 3300046660 Ga0495625_0166412 Ga0495625_0166412_108_848 245
1497 3300046660 Ga0495625_0240300 Ga0495625_0240300_186_938 245
1498 3300046660 Ga0495625_0323007 Ga0495625_0323007_74_826 245
1499 3300046663 Ga0495635_0000696 Ga0495635_0000696_6497_7234 245
1500 3300046663 Ga0495635_0001315 Ga0495635_0001315_8170_8952 245
1501 3300046663 Ga0495635_0004092 Ga0495635_0004092_438_1178 245
1502 3300046663 Ga0495635_0040985 Ga0495635_0040985_177_914 245
1503 3300046663 Ga0495635_0055139 Ga0495635_0055139_1545_2285 245
1504 3300046663 Ga0495635_0062991 Ga0495635_0062991_435_1175 245
1505 3300046663 Ga0495635_0184885 Ga0495635_0184885_74_868 245
1506 3300046663 Ga0495635_0334767 Ga0495635_0334767_240_983 245
1507 3300046664 Ga0495659_0020746 Ga0495659_0020746_781_1521 245
1508 3300046665 Ga0495661_0007951 Ga0495661_0007951_3076_3831 245
1509 3300046665 Ga0495661_0017548 Ga0495661_0017548_2886_3626 245
1510 3300046665 Ga0495661_0063945 Ga0495661_0063945_404_1159 245
1511 3300046674 Ga0495588_0028816 Ga0495588_0028816_1952_2692 245
1512 3300046675 Ga0495657_0002369 Ga0495657_0002369_6206_6946 245
1513 3300046675 Ga0495657_0007156 Ga0495657_0007156_1550_2287 245
1514 3300046675 Ga0495657_0026208 Ga0495657_0026208_576_1313 245
1515 3300046678 Ga0495599_0002774 Ga0495599_0002774_3731_4471 245
1516 3300046678 Ga0495599_0014101 Ga0495599_0014101_69_806 245
1517 3300046678 Ga0495599_0031932 Ga0495599_0031932_241_978 245
1518 3300046679 Ga0495623_0002608 Ga0495623_0002608_958_1695 245
1519 3300046679 Ga0495623_0012517 Ga0495623_0012517_1957_2697 245
1520 3300046679 Ga0495623_0016001 Ga0495623_0016001_367_1107 245
1521 3300046680 Ga0495646_0004205 Ga0495646_0004205_7222_7959 245
1522 3300046680 Ga0495646_0017000 Ga0495646_0017000_2331_3071 245
1523 3300046680 Ga0495646_0024712 Ga0495646_0024712_1140_1880 245
1524 3300046680 Ga0495646_0035564 Ga0495646_0035564_120_857 245
1525 3300046681 Ga0495647_0011776 Ga0495647_0011776_840_1577 245
1526 3300046681 Ga0495647_0026257 Ga0495647_0026257_1325_2065 245
1527 3300046681 Ga0495647_0087113 Ga0495647_0087113_290_1027 245
1528 3300046683 Ga0495658_0002624 Ga0495658_0002624_4009_4791 245
1529 3300046683 Ga0495658_0029920 Ga0495658_0029920_2189_2926 245
1530 3300046683 Ga0495658_0074464 Ga0495658_0074464_677_1414 245
1531 3300046683 Ga0495658_0190627 Ga0495658_0190627_169_1068 245
1532 3300046684 Ga0495669_0008673 Ga0495669_0008673_1972_2769 245
1533 3300046684 Ga0495669_0010922 Ga0495669_0010922_1992_2780 245
1534 3300046684 Ga0495669_0013424 Ga0495669_0013424_2132_2872 245
1535 3300046684 Ga0495669_0034773 Ga0495669_0034773_616_1356 245
1536 3300046689 Ga0495613_0007671 Ga0495613_0007671_1249_1989 245
1537 3300046689 Ga0495613_0033396 Ga0495613_0033396_1948_2685 245
1538 3300046689 Ga0495613_0093555 Ga0495613_0093555_246_983 245
1539 3300046689 Ga0495613_0173871 Ga0495613_0173871_579_1319 245
1540 3300046689 Ga0495613_0201381 Ga0495613_0201381_249_1043 245
1541 3300046689 Ga0495613_0250465 Ga0495613_0250465_100_837 245
1542 3300046690 Ga0495624_0023551 Ga0495624_0023551_3049_3789 245
1543 3300046690 Ga0495624_0025805 Ga0495624_0025805_2943_3683 245
1544 3300046690 Ga0495624_0177805 Ga0495624_0177805_90_881 245
1545 3300046690 Ga0495624_0218682 Ga0495624_0218682_183_977 245
1546 3300046691 Ga0495670_0017003 Ga0495670_0017003_1680_2528 245
1547 3300046691 Ga0495670_0191988 Ga0495670_0191988_88_879 245
1548 3300046691 Ga0495670_0259471 Ga0495670_0259471_35_823 245
1549 3300046692 Ga0495671_0000092 Ga0495671_0000092_45800_46588 245
1550 3300046692 Ga0495671_0002678 Ga0495671_0002678_3591_4346 245
1551 3300046692 Ga0495671_0208591 Ga0495671_0208591_46_786 245
1552 3300046694 Ga0495649_0000173 Ga0495649_0000173_23825_24565 245
1553 3300046794 Ga0495589_0000654 Ga0495589_0000654_16426_17181 245
1554 3300046794 Ga0495589_0002574 Ga0495589_0002574_2704_3459 245
1555 3300046794 Ga0495589_0009631 Ga0495589_0009631_2923_3678 245
1556 3300046794 Ga0495589_0012369 Ga0495589_0012369_2682_3530 245
1557 3300046794 Ga0495589_0027440 Ga0495589_0027440_714_1469 245
1558 3300046809 Ga0495600_0005115 Ga0495600_0005115_222_959 245
1559 3300046809 Ga0495600_0007220 Ga0495600_0007220_4739_5521 245
1560 3300046809 Ga0495600_0023950 Ga0495600_0023950_627_1364 245
1561 3300046809 Ga0495600_0027544 Ga0495600_0027544_1930_2670 245
1562 3300046809 Ga0495600_0126790 Ga0495600_0126790_450_1187 245
1563 3300046809 Ga0495600_0177075 Ga0495600_0177075_542_1279 245
1564 3300046810 Ga0495660_0038746 Ga0495660_0038746_1414_2169 245
1565 3300047315 Ga0495581_0000308 Ga0495581_0000308_19643_20383 245
1566 3300047315 Ga0495581_0079626 Ga0495581_0079626_372_1115 245
1567 3300047315 Ga0495581_0211933 Ga0495581_0211933_85_978 245
1568 3300047317 Ga0495604_0001434 Ga0495604_0001434_11974_12711 245
1569 3300047317 Ga0495604_0004757 Ga0495604_0004757_5452_6192 245
1570 3300047317 Ga0495604_0040252 Ga0495604_0040252_303_1040 245
1571 3300047319 Ga0495674_0003647 Ga0495674_0003647_8861_9643 245
1572 3300047319 Ga0495674_0003993 Ga0495674_0003993_1326_2063 245
1573 3300047319 Ga0495674_0007036 Ga0495674_0007036_7431_8171 245
1574 3300047319 Ga0495674_0023927 Ga0495674_0023927_762_1502 245
1575 3300047319 Ga0495674_0060276 Ga0495674_0060276_2300_3040 245
1576 3300047319 Ga0495674_0069315 Ga0495674_0069315_582_1325 245
1577 3300047319 Ga0495674_0113100 Ga0495674_0113100_509_1246 245
1578 3300047319 Ga0495674_0270518 Ga0495674_0270518_61_801 245
1579 3300047320 Ga0495672_0017758 Ga0495672_0017758_21_776 245
1580 3300047320 Ga0495672_0032659 Ga0495672_0032659_1479_2219 245
1581 3300047320 Ga0495672_0110274 Ga0495672_0110274_691_1431 245
1582 3300047321 Ga0495676_0000007 Ga0495676_0000007_126459_127214 245
1583 3300047321 Ga0495676_0011866 Ga0495676_0011866_1023_1763 245
1584 3300047321 Ga0495676_0069462 Ga0495676_0069462_419_1156 245
1585 3300047321 Ga0495676_0132800 Ga0495676_0132800_623_1414 245
1586 3300047322 Ga0495680_0000697 Ga0495680_0000697_12985_13722 245
1587 3300047322 Ga0495680_0003025 Ga0495680_0003025_11630_12412 245
1588 3300047322 Ga0495680_0008817 Ga0495680_0008817_7995_8735 245
1589 3300047322 Ga0495680_0018135 Ga0495680_0018135_2662_3402 245
1590 3300047322 Ga0495680_0033222 Ga0495680_0033222_863_1600 245
1591 3300047322 Ga0495680_0040717 Ga0495680_0040717_1523_2260 245
1592 3300047323 Ga0495683_0042513 Ga0495683_0042513_1136_1891 245
1593 3300047444 Ga0495675_0002629 Ga0495675_0002629_9090_9830 245
1594 3300047444 Ga0495675_0011045 Ga0495675_0011045_1172_1909 245
1595 3300047444 Ga0495675_0024081 Ga0495675_0024081_1902_2642 245
1596 3300047445 Ga0495677_0000066 Ga0495677_0000066_12070_12825 245
1597 3300047445 Ga0495677_0000939 Ga0495677_0000939_3645_4400 245
1598 3300047445 Ga0495677_0007123 Ga0495677_0007123_2763_3518 245
1599 3300047445 Ga0495677_0010194 Ga0495677_0010194_1503_2258 245
1600 3300047445 Ga0495677_0042722 Ga0495677_0042722_752_1543 245
1601 3300047446 Ga0495679_000300 Ga0495679_000300_36594_37334 245
1602 3300047447 Ga0495685_046647 Ga0495685_046647_644_1447 245
1603 3300047469 Ga0495673_0002113 Ga0495673_0002113_9577_10332 245
1604 3300047470 Ga0495681_0010115 Ga0495681_0010115_2992_3747 245
1605 3300047471 Ga0495684_0000696 Ga0495684_0000696_23225_24007 245
1606 3300047471 Ga0495684_0026111 Ga0495684_0026111_2052_2792 245
1607 3300047471 Ga0495684_0032388 Ga0495684_0032388_3053_3796 245
1608 3300047471 Ga0495684_0314890 Ga0495684_0314890_47_784 245
1609 3300047471 Ga0495684_0332372 Ga0495684_0332372_181_918 245
1610 3300047472 Ga0495686_0001244 Ga0495686_0001244_7936_8676 245
1611 3300047673 Ga0495593_0007328 Ga0495593_0007328_3737_4477 245
1612 3300047673 Ga0495593_0058710 Ga0495593_0058710_886_1623 245
1613 3300047673 Ga0495593_0063353 Ga0495593_0063353_120_857 245
1614 3300048088 Ga0495602_0002150 Ga0495602_0002150_17609_18349 245
1615 3300048088 Ga0495602_0013408 Ga0495602_0013408_2701_3492 245
1616 3300048088 Ga0495602_0021271 Ga0495602_0021271_2712_3452 245
1617 3300048088 Ga0495602_0204247 Ga0495602_0204247_723_1460 245
1618 3300048088 Ga0495602_0277133 Ga0495602_0277133_254_994 245
1619 3300048088 Ga0495602_0450637 Ga0495602_0450637_32_769 245
1620 3300048089 Ga0495614_0005257 Ga0495614_0005257_1744_2484 245
1621 3300048089 Ga0495614_0058997 Ga0495614_0058997_44_838 245
1622 3300048089 Ga0495614_0120256 Ga0495614_0120256_66_803 245
1623 3300048091 Ga0495626_0015838 Ga0495626_0015838_999_1754 245
1624 3300048091 Ga0495626_0024780 Ga0495626_0024780_1334_2089 245
1625 3300048903 Ga0496100_0006802 Ga0496100_0006802_655_1437 245
1626 3300048903 Ga0496100_0045441 Ga0496100_0045441_1560_2297 245
1627 3300048903 Ga0496100_0064371 Ga0496100_0064371_259_999 245
1628 3300048903 Ga0496100_0090601 Ga0496100_0090601_1295_2035 245
1629 3300048903 Ga0496100_0139069 Ga0496100_0139069_164_958 245
1630 3300048903 Ga0496100_0208142 Ga0496100_0208142_531_1313 245
1631 3300048904 Ga0496101_0008609 Ga0496101_0008609_485_1267 245
1632 3300048904 Ga0496101_0009760 Ga0496101_0009760_2431_3171 245
1633 3300048904 Ga0496101_0018267 Ga0496101_0018267_1726_2466 245
1634 3300048904 Ga0496101_0020712 Ga0496101_0020712_3702_4484 245
1635 3300048904 Ga0496101_0061606 Ga0496101_0061606_1530_2324 245
1636 3300048904 Ga0496101_0114106 Ga0496101_0114106_907_1695 245
1637 3300048904 Ga0496101_0161084 Ga0496101_0161084_244_984 245
1638 3300048904 Ga0496101_0221864 Ga0496101_0221864_372_1109 245
1639 3300048904 Ga0496101_0229944 Ga0496101_0229944_515_1255 245
1640 3300048905 Ga0496102_0018387 Ga0496102_0018387_1559_2296 245
1641 3300048905 Ga0496102_0022286 Ga0496102_0022286_1279_2034 245
1642 3300048905 Ga0496102_0031350 Ga0496102_0031350_3443_4252 245
1643 3300048905 Ga0496102_0032411 Ga0496102_0032411_3496_4278 245
1644 3300048905 Ga0496102_0034017 Ga0496102_0034017_1940_2734 245
1645 3300048905 Ga0496102_0034379 Ga0496102_0034379_1016_1756 245
1646 3300048905 Ga0496102_0071555 Ga0496102_0071555_792_1529 245
1647 3300048905 Ga0496102_0093560 Ga0496102_0093560_590_1330 245
1648 3300048905 Ga0496102_0094360 Ga0496102_0094360_1404_2186 245
1649 3300048905 Ga0496102_0137229 Ga0496102_0137229_1162_1950 245
1650 3300048905 Ga0496102_0169809 Ga0496102_0169809_1046_1786 245
1651 3300048905 Ga0496102_0223604 Ga0496102_0223604_985_1725 245
1652 3300048905 Ga0496102_0304882 Ga0496102_0304882_533_1270 245
1653 3300048905 Ga0496102_0419678 Ga0496102_0419678_146_883 245
1654 3300048905 Ga0496102_0517654 Ga0496102_0517654_272_1054 245
1655 3300048906 Ga0496103_0004445 Ga0496103_0004445_2213_2953 245
1656 3300048906 Ga0496103_0015631 Ga0496103_0015631_2207_2944 245
1657 3300048906 Ga0496103_0024209 Ga0496103_0024209_2314_3054 245
1658 3300048906 Ga0496103_0027729 Ga0496103_0027729_1604_2386 245
1659 3300048906 Ga0496103_0055714 Ga0496103_0055714_1060_1800 245
1660 3300048906 Ga0496103_0058180 Ga0496103_0058180_1422_2213 245
1661 3300048906 Ga0496103_0065344 Ga0496103_0065344_1071_1811 245
1662 3300048907 Ga0496104_0000138 Ga0496104_0000138_35455_36192 245
1663 3300048907 Ga0496104_0003625 Ga0496104_0003625_10643_11380 245
1664 3300048907 Ga0496104_0003883 Ga0496104_0003883_110_847 245
1665 3300048907 Ga0496104_0003891 Ga0496104_0003891_1430_2224 245
1666 3300048907 Ga0496104_0004923 Ga0496104_0004923_10680_11462 245
1667 3300048907 Ga0496104_0014708 Ga0496104_0014708_5147_5884 245
1668 3300048907 Ga0496104_0092589 Ga0496104_0092589_450_1205 245
1669 3300048907 Ga0496104_0129111 Ga0496104_0129111_1059_1799 245
1670 3300048907 Ga0496104_0333943 Ga0496104_0333943_124_972 245
1671 3300048907 Ga0496104_0347063 Ga0496104_0347063_458_1195 245
1672 3300048908 Ga0496105_0000100 Ga0496105_0000100_37533_38270 245
1673 3300048908 Ga0496105_0001322 Ga0496105_0001322_7387_8181 245
1674 3300048908 Ga0496105_0002213 Ga0496105_0002213_257_994 245
1675 3300048908 Ga0496105_0023569 Ga0496105_0023569_1561_2301 245
1676 3300048908 Ga0496105_0030005 Ga0496105_0030005_3213_3950 245
1677 3300048908 Ga0496105_0037172 Ga0496105_0037172_318_1100 245
1678 3300048908 Ga0496105_0060095 Ga0496105_0060095_701_1441 245
1679 3300048908 Ga0496105_0072250 Ga0496105_0072250_1686_2426 245
1680 3300048908 Ga0496105_0121306 Ga0496105_0121306_1041_1889 245
1681 3300048908 Ga0496105_0400543 Ga0496105_0400543_284_1021 245
1682 3300048909 Ga0496106_0000001 Ga0496106_0000001_264045_264905 245
1683 3300048909 Ga0496106_0000763 Ga0496106_0000763_1636_2373 245
1684 3300048909 Ga0496106_0010825 Ga0496106_0010825_603_1385 245
1685 3300048909 Ga0496106_0034181 Ga0496106_0034181_2868_3623 245
1686 3300048909 Ga0496106_0054424 Ga0496106_0054424_113_853 245
1687 3300048909 Ga0496106_0079508 Ga0496106_0079508_1298_2038 245
1688 3300048909 Ga0496106_0106246 Ga0496106_0106246_383_1192 245
1689 3300048909 Ga0496106_0109146 Ga0496106_0109146_308_1096 245
1690 3300048909 Ga0496106_0109305 Ga0496106_0109305_237_977 245
1691 3300048909 Ga0496106_0207849 Ga0496106_0207849_679_1416 245
1692 3300048909 Ga0496106_0273851 Ga0496106_0273851_255_995 245
1693 3300048910 Ga0496107_0022544 Ga0496107_0022544_2142_2879 245
1694 3300048910 Ga0496107_0024599 Ga0496107_0024599_2927_3709 245
1695 3300048910 Ga0496107_0037478 Ga0496107_0037478_2209_3003 245
1696 3300048910 Ga0496107_0052994 Ga0496107_0052994_1606_2346 245
1697 3300048910 Ga0496107_0248666 Ga0496107_0248666_420_1157 245
1698 3300048910 Ga0496107_0273052 Ga0496107_0273052_407_1189 245
1699 3300048911 Ga0496108_0002238 Ga0496108_0002238_1619_2413 245
1700 3300048911 Ga0496108_0012386 Ga0496108_0012386_4794_5576 245
1701 3300048911 Ga0496108_0053995 Ga0496108_0053995_1382_2119 245
1702 3300048911 Ga0496108_0132968 Ga0496108_0132968_181_921 245
1703 3300048911 Ga0496108_0263615 Ga0496108_0263615_204_986 245
1704 3300048911 Ga0496108_0462275 Ga0496108_0462275_249_986 245
1705 3300048911 Ga0496108_0618334 Ga0496108_0618334_141_881 245
1706 3300048912 Ga0496109_0002809 Ga0496109_0002809_10651_11445 245
1707 3300048912 Ga0496109_0015267 Ga0496109_0015267_2908_3648 245
1708 3300048912 Ga0496109_0048271 Ga0496109_0048271_1235_1972 245
1709 3300048912 Ga0496109_0123466 Ga0496109_0123466_1117_1899 245
1710 3300048912 Ga0496109_0147505 Ga0496109_0147505_207_989 245
1711 3300048912 Ga0496109_0223610 Ga0496109_0223610_474_1256 245
1712 3300048912 Ga0496109_0465971 Ga0496109_0465971_28_810 245
1713 3300048913 Ga0496110_0024038 Ga0496110_0024038_2821_3561 245
1714 3300048913 Ga0496110_0024415 Ga0496110_0024415_1713_2507 245
1715 3300048913 Ga0496110_0033606 Ga0496110_0033606_2049_2831 245
1716 3300048913 Ga0496110_0069778 Ga0496110_0069778_732_1469 245
1717 3300048913 Ga0496110_0116400 Ga0496110_0116400_367_1149 245
1718 3300048913 Ga0496110_0141465 Ga0496110_0141465_147_887 245
1719 3300048913 Ga0496110_0310470 Ga0496110_0310470_481_1218 245
1720 3300048913 Ga0496110_0332341 Ga0496110_0332341_204_941 245
1721 3300048913 Ga0496110_0502085 Ga0496110_0502085_264_1004 245
1722 3300048914 Ga0496111_0036092 Ga0496111_0036092_609_1349 245
1723 3300048914 Ga0496111_0038968 Ga0496111_0038968_982_1776 245
1724 3300048914 Ga0496111_0065352 Ga0496111_0065352_1728_2510 245
1725 3300048914 Ga0496111_0090167 Ga0496111_0090167_800_1540 245
1726 3300048914 Ga0496111_0091598 Ga0496111_0091598_1000_1737 245
1727 3300048914 Ga0496111_0250611 Ga0496111_0250611_12_794 245
1728 3300048914 Ga0496111_0306932 Ga0496111_0306932_283_1020 245
1729 3300048914 Ga0496111_0491646 Ga0496111_0491646_102_839 245
1730 3300048915 Ga0496112_0015135 Ga0496112_0015135_1596_2378 245
1731 3300048915 Ga0496112_0033514 Ga0496112_0033514_1770_2564 245
1732 3300048915 Ga0496112_0049166 Ga0496112_0049166_3003_3740 245
1733 3300048915 Ga0496112_0063585 Ga0496112_0063585_258_1040 245
1734 3300048915 Ga0496112_0064350 Ga0496112_0064350_904_1644 245
1735 3300048915 Ga0496112_0067706 Ga0496112_0067706_1792_2532 245
1736 3300048915 Ga0496112_0079515 Ga0496112_0079515_1570_2307 245
1737 3300048915 Ga0496112_0142576 Ga0496112_0142576_1260_2042 245
1738 3300048915 Ga0496112_0187265 Ga0496112_0187265_609_1346 245
1739 3300048915 Ga0496112_0241931 Ga0496112_0241931_42_785 245
1740 3300048915 Ga0496112_0635042 Ga0496112_0635042_53_790 245
1741 3300048915 Ga0496112_0811694 Ga0496112_0811694_28_813 245
1742 3300048916 Ga0496113_0001266 Ga0496113_0001266_2453_3247 245
1743 3300048916 Ga0496113_0045105 Ga0496113_0045105_1862_2599 245
1744 3300048916 Ga0496113_0046997 Ga0496113_0046997_229_966 245
1745 3300048916 Ga0496113_0085093 Ga0496113_0085093_195_1067 245
1746 3300048916 Ga0496113_0129432 Ga0496113_0129432_1160_1900 245
1747 3300048916 Ga0496113_0272275 Ga0496113_0272275_501_1295 245
1748 3300048917 Ga0496114_0009768 Ga0496114_0009768_3835_4575 245
1749 3300048917 Ga0496114_0018456 Ga0496114_0018456_1608_2348 245
1750 3300048917 Ga0496114_0039940 Ga0496114_0039940_616_1398 245
1751 3300048917 Ga0496114_0093360 Ga0496114_0093360_1175_1969 245
1752 3300048917 Ga0496114_0115348 Ga0496114_0115348_1401_2138 245
1753 3300048917 Ga0496114_0115833 Ga0496114_0115833_157_966 245
1754 3300048917 Ga0496114_0117527 Ga0496114_0117527_961_1716 245
1755 3300048917 Ga0496114_0163724 Ga0496114_0163724_630_1367 245
1756 3300048917 Ga0496114_0450660 Ga0496114_0450660_80_820 245
1757 3300048917 Ga0496114_0555391 Ga0496114_0555391_22_762 245
1758 3300048917 Ga0496114_0736974 Ga0496114_0736974_22_759 245
1759 3300048918 Ga0496115_0000608 Ga0496115_0000608_19989_20729 245
1760 3300048918 Ga0496115_0021975 Ga0496115_0021975_3105_3845 245
1761 3300048918 Ga0496115_0022583 Ga0496115_0022583_3319_4113 245
1762 3300048918 Ga0496115_0028515 Ga0496115_0028515_160_897 245
1763 3300048918 Ga0496115_0052402 Ga0496115_0052402_655_1446 245
1764 3300048918 Ga0496115_0069119 Ga0496115_0069119_68_823 245
1765 3300048918 Ga0496115_0093601 Ga0496115_0093601_1273_2055 245
1766 3300048918 Ga0496115_0098438 Ga0496115_0098438_482_1219 245
1767 3300048918 Ga0496115_0108045 Ga0496115_0108045_768_1505 245
1768 3300048918 Ga0496115_0177138 Ga0496115_0177138_674_1414 245
1769 3300048918 Ga0496115_0189624 Ga0496115_0189624_395_1135 245
1770 3300048918 Ga0496115_0195672 Ga0496115_0195672_737_1477 245
1771 3300048918 Ga0496115_0246875 Ga0496115_0246875_332_1069 245
1772 3300048918 Ga0496115_0289646 Ga0496115_0289646_460_1197 245
1773 3300048918 Ga0496115_0389215 Ga0496115_0389215_227_1009 245
1774 3300048921 Ga0496118_0002912 Ga0496118_0002912_9331_10071 245
1775 3300048922 Ga0496119_0003321 Ga0496119_0003321_13972_14709 245
1776 3300048922 Ga0496119_0003757 Ga0496119_0003757_11521_12261 245
1777 3300048922 Ga0496119_0138127 Ga0496119_0138127_293_1030 245
1778 3300048924 Ga0496121_0001975 Ga0496121_0001975_12808_13548 245
1779 3300048924 Ga0496121_0020294 Ga0496121_0020294_3363_4103 245
1780 3300048924 Ga0496121_0039430 Ga0496121_0039430_2121_2924 245
1781 3300048924 Ga0496121_0055248 Ga0496121_0055248_1336_2076 245
1782 3300048924 Ga0496121_0093819 Ga0496121_0093819_1418_2155 245
1783 3300048926 Ga0496123_0009179 Ga0496123_0009179_5529_6395 245
1784 3300048928 Ga0496125_0002262 Ga0496125_0002262_20209_21003 245
1785 3300048928 Ga0496125_0144161 Ga0496125_0144161_779_1519 245
1786 3300048928 Ga0496125_0170523 Ga0496125_0170523_459_1196 245
1787 3300048929 Ga0496126_0010072 Ga0496126_0010072_5147_5887 245
1788 3300048929 Ga0496126_0089885 Ga0496126_0089885_1666_2406 245
1789 3300048929 Ga0496126_0112604 Ga0496126_0112604_1283_2086 245
1790 3300049459 Ga0495678_027259 Ga0495678_027259_624_1364 245
1791 3300049460 Ga0495682_0008940 Ga0495682_0008940_1069_1809 245
1792 3300049569 Ga0501032_0170654 Ga0501032_0170654_260_997 245
1793 3300049571 Ga0501034_0080607 Ga0501034_0080607_668_1453 245
1794 3300049574 Ga0501038_0100362 Ga0501038_0100362_698_1483 245
1795 3300049575 Ga0501039_0314579 Ga0501039_0314579_417_1202 245
1796 3300049578 Ga0501042_0244324 Ga0501042_0244324_269_1066 245
1797 3300049579 Ga0501043_0038510 Ga0501043_0038510_2922_3707 245
1798 3300049580 Ga0501046_0000127 Ga0501046_0000127_54216_54956 245
1799 3300049581 Ga0501047_0001112 Ga0501047_0001112_24534_25319 245
1800 3300049583 Ga0501067_0044144 Ga0501067_0044144_1213_1998 245
1801 3300049585 Ga0501069_0263549 Ga0501069_0263549_160_945 245
1802 3300049586 Ga0501070_0073920 Ga0501070_0073920_1567_2304 245
1803 3300049587 Ga0501071_0247565 Ga0501071_0247565_475_1272 245
1804 3300049588 Ga0501072_0437801 Ga0501072_0437801_31_768 245
1805 3300049589 Ga0501073_0409642 Ga0501073_0409642_16_753 245
1806 3300049591 Ga0501075_0180808 Ga0501075_0180808_521_1318 245
1807 3300049741 Ga0501079_0154586 Ga0501079_0154586_640_1437 245
1808 3300049742 Ga0501080_0082685 Ga0501080_0082685_1160_1945 245
1809 3300049744 Ga0501083_0118112 Ga0501083_0118112_370_1155 245
1810 3300049822 Ga0501035_0260857 Ga0501035_0260857_35_820 245
1811 3300049823 Ga0501044_0010863 Ga0501044_0010863_3972_4757 245
1812 3300049824 Ga0501045_0162896 Ga0501045_0162896_831_1568 245
1813 3300049824 Ga0501045_0318802 Ga0501045_0318802_236_1033 245
1814 3300050489 nmdc:mga03683_25804_c1 nmdc:mga03683_25804_c1_835_1572 245
1815 3300050492 nmdc:mga0yw44_131348_c1 nmdc:mga0yw44_131348_c1_224_1018 245
1816 3300050492 nmdc:mga0yw44_1559_c1 nmdc:mga0yw44_1559_c1_4729_5514 245
1817 3300050492 nmdc:mga0yw44_163892_c1 nmdc:mga0yw44_163892_c1_134_925 245
1818 3300050492 nmdc:mga0yw44_94279_c1 nmdc:mga0yw44_94279_c1_10_765 245
1819 3300050493 nmdc:mga0k408_174038_c1 nmdc:mga0k408_174038_c1_404_1144 245
1820 3300050493 nmdc:mga0k408_64358_c1 nmdc:mga0k408_64358_c1_884_1621 245
1821 3300050494 nmdc:mga06z11_43777_c1 nmdc:mga06z11_43777_c1_424_1215 245
1822 3300050495 nmdc:mga04h51_39450_c1 nmdc:mga04h51_39450_c1_70_810 245
1823 3300050496 nmdc:mga07m45_35015_c1 nmdc:mga07m45_35015_c1_422_1162 245
1824 3300050496 nmdc:mga07m45_6661_c1 nmdc:mga07m45_6661_c1_391_1128 245
1825 3300050507 nmdc:mga05p37_1740_c1 nmdc:mga05p37_1740_c1_2096_2833 245
1826 3300050507 nmdc:mga05p37_240426_c1 nmdc:mga05p37_240426_c1_792_1577 245
1827 3300050507 nmdc:mga05p37_25897_c1 nmdc:mga05p37_25897_c1_5959_6756 245
1828 3300050507 nmdc:mga05p37_30047_c1 nmdc:mga05p37_30047_c1_5855_6595 245
1829 3300050507 nmdc:mga05p37_316520_c1 nmdc:mga05p37_316520_c1_1035_1778 245
1830 3300050507 nmdc:mga05p37_44460_c1 nmdc:mga05p37_44460_c1_1697_2491 245
1831 3300050507 nmdc:mga05p37_499337_c1 nmdc:mga05p37_499337_c1_428_1165 245
1832 3300050507 nmdc:mga05p37_56465_c1 nmdc:mga05p37_56465_c1_328_1125 245
1833 3300050507 nmdc:mga05p37_740129_c1 nmdc:mga05p37_740129_c1_26_808 245
1834 3300050508 nmdc:mga09592_129203_c1 nmdc:mga09592_129203_c1_1360_2097 245
1835 3300050508 nmdc:mga09592_193314_c1 nmdc:mga09592_193314_c1_542_1282 245
1836 3300050508 nmdc:mga09592_428858_c1 nmdc:mga09592_428858_c1_169_966 245
1837 3300050508 nmdc:mga09592_49023_c1 nmdc:mga09592_49023_c1_2631_3368 245
1838 3300050509 nmdc:mga0qj67_208201_c1 nmdc:mga0qj67_208201_c1_98_895 245
1839 3300050509 nmdc:mga0qj67_2708_c1 nmdc:mga0qj67_2708_c1_10151_10888 245
1840 3300050509 nmdc:mga0qj67_70730_c1 nmdc:mga0qj67_70730_c1_1184_1981 245
1841 3300050509 nmdc:mga0qj67_7972_c1 nmdc:mga0qj67_7972_c1_4427_5164 245
1842 3300050510 nmdc:mga06r32_25454_c1 nmdc:mga06r32_25454_c1_2684_3481 245
1843 3300050510 nmdc:mga06r32_45300_c1 nmdc:mga06r32_45300_c1_1792_2589 245
1844 3300050510 nmdc:mga06r32_546_c1 nmdc:mga06r32_546_c1_18513_19250 245
1845 3300050510 nmdc:mga06r32_9960_c1 nmdc:mga06r32_9960_c1_5625_6362 245
1846 3300050511 nmdc:mga08y16_1229_c1 nmdc:mga08y16_1229_c1_22519_23256 245
1847 3300050511 nmdc:mga08y16_140040_c1 nmdc:mga08y16_140040_c1_288_1073 245
1848 3300050511 nmdc:mga08y16_147138_c1 nmdc:mga08y16_147138_c1_485_1225 245
1849 3300050511 nmdc:mga08y16_390719_c1 nmdc:mga08y16_390719_c1_373_1110 245
1850 3300050511 nmdc:mga08y16_407660_c1 nmdc:mga08y16_407660_c1_505_1242 245
1851 3300050511 nmdc:mga08y16_504823_c1 nmdc:mga08y16_504823_c1_101_838 245
1852 3300050511 nmdc:mga08y16_84713_c1 nmdc:mga08y16_84713_c1_1583_2377 245
1853 3300050512 nmdc:mga0n895_111129_c1 nmdc:mga0n895_111129_c1_1302_2084 245
1854 3300050512 nmdc:mga0n895_166244_c1 nmdc:mga0n895_166244_c1_169_912 245
1855 3300050512 nmdc:mga0n895_19447_c1 nmdc:mga0n895_19447_c1_2144_2929 245
1856 3300050512 nmdc:mga0n895_219747_c1 nmdc:mga0n895_219747_c1_1090_1878 245
1857 3300050512 nmdc:mga0n895_56236_c1 nmdc:mga0n895_56236_c1_1324_2061 245
1858 3300050512 nmdc:mga0n895_64693_c1 nmdc:mga0n895_64693_c1_2517_3302 245
1859 3300050512 nmdc:mga0n895_752206_c1 nmdc:mga0n895_752206_c1_64_804 245
1860 3300050512 nmdc:mga0n895_973618_c1 nmdc:mga0n895_973618_c1_73_810 245
1861 3300050513 nmdc:mga0rr50_1066_c1 nmdc:mga0rr50_1066_c1_3940_4677 245
1862 3300050513 nmdc:mga0rr50_191539_c1 nmdc:mga0rr50_191539_c1_195_932 245
1863 3300050513 nmdc:mga0rr50_206779_c1 nmdc:mga0rr50_206779_c1_655_1392 245
1864 3300050513 nmdc:mga0rr50_501799_c1 nmdc:mga0rr50_501799_c1_230_1015 245
1865 3300050513 nmdc:mga0rr50_504919_c1 nmdc:mga0rr50_504919_c1_66_806 245
1866 3300050513 nmdc:mga0rr50_515178_c1 nmdc:mga0rr50_515178_c1_83_871 245
1867 3300050513 nmdc:mga0rr50_60954_c1 nmdc:mga0rr50_60954_c1_1618_2403 245
1868 3300050514 nmdc:mga08x19_136078_c1 nmdc:mga08x19_136078_c1_905_1645 245
1869 3300050514 nmdc:mga08x19_217754_c1 nmdc:mga08x19_217754_c1_529_1266 245
1870 3300050514 nmdc:mga08x19_400190_c1 nmdc:mga08x19_400190_c1_143_880 245
1871 3300050514 nmdc:mga08x19_96425_c1 nmdc:mga08x19_96425_c1_658_1395 245
1872 3300050514 nmdc:mga08x19_9797_c1 nmdc:mga08x19_9797_c1_1299_2042 245
1873 3300050515 nmdc:mga0a205_1661_c1 nmdc:mga0a205_1661_c1_5956_6741 245
1874 3300050515 nmdc:mga0a205_170474_c1 nmdc:mga0a205_170474_c1_984_1721 245
1875 3300050515 nmdc:mga0a205_2299_c1 nmdc:mga0a205_2299_c1_14864_15649 245
1876 3300050515 nmdc:mga0a205_32270_c1 nmdc:mga0a205_32270_c1_1942_2679 245
1877 3300050515 nmdc:mga0a205_566370_c1 nmdc:mga0a205_566370_c1_74_814 245
1878 3300050515 nmdc:mga0a205_591270_c1 nmdc:mga0a205_591270_c1_145_936 245
1879 3300053077 Ga0495601_0000395 Ga0495601_0000395_9280_10062 245
1880 3300053077 Ga0495601_0007613 Ga0495601_0007613_4815_5555 245
1881 3300053077 Ga0495601_0011578 Ga0495601_0011578_2938_3678 245
1882 3300053077 Ga0495601_0022422 Ga0495601_0022422_2288_3025 245
1883 3300053077 Ga0495601_0035466 Ga0495601_0035466_1880_2617 245
1884 3300053077 Ga0495601_0350750 Ga0495601_0350750_182_919 245
1885 3300053078 Ga0495612_0005839 Ga0495612_0005839_576_1358 245
1886 3300053078 Ga0495612_0011638 Ga0495612_0011638_933_1673 245
1887 3300053078 Ga0495612_0096560 Ga0495612_0096560_263_1000 245
1888 3300053080 Ga0500635_0063807 Ga0500635_0063807_420_1160 245
1889 3300053083 Ga0495655_0030384 Ga0495655_0030384_471_1262 245
1890 3300053084 Ga0495595_0000431 Ga0495595_0000431_12569_13306 245
1891 3300053084 Ga0495595_0000818 Ga0495595_0000818_6779_7519 245
1892 3300053084 Ga0495595_0001047 Ga0495595_0001047_6317_7099 245
1893 3300053084 Ga0495595_0144249 Ga0495595_0144249_124_861 245
1894 3300053085 Ga0495619_0000335 Ga0495619_0000335_23441_24178 245
1895 3300053085 Ga0495619_0000398 Ga0495619_0000398_22033_22815 245
1896 3300053085 Ga0495619_0002289 Ga0495619_0002289_2592_3332 245
1897 3300053085 Ga0495619_0014953 Ga0495619_0014953_196_933 245
1898 3300053085 Ga0495619_0018656 Ga0495619_0018656_2638_3378 245
1899 3300053085 Ga0495619_0036794 Ga0495619_0036794_2161_2898 245
1900 3300053085 Ga0495619_0112498 Ga0495619_0112498_468_1205 245
1901 3300053090 Ga0500646_0041241 Ga0500646_0041241_122_910 245
1902 3300053093 Ga0500651_0276387 Ga0500651_0276387_131_883 245
1903 3300053094 Ga0500566_0011976 Ga0500566_0011976_1293_2033 245
1904 3300053096 Ga0500641_0002029 Ga0500641_0002029_4194_4931 245
1905 3300053102 Ga0500554_001642 Ga0500554_001642_2803_3546 245
1906 3300053104 Ga0500556_0000068 Ga0500556_0000068_31271_32011 245
1907 3300053119 Ga0500595_004799 Ga0500595_004799_3431_4171 245
1908 3300053119 Ga0500595_014120 Ga0500595_014120_2136_2873 245
1909 3300053119 Ga0500595_033589 Ga0500595_033589_466_1206 245
1910 3300053119 Ga0500595_036377 Ga0500595_036377_669_1406 245
1911 3300053125 Ga0500618_042029 Ga0500618_042029_115_855 245
1912 3300053130 Ga0500642_0000735 Ga0500642_0000735_3662_4471 245
1913 3300053130 Ga0500642_0095775 Ga0500642_0095775_303_1088 245
1914 3300053133 Ga0500655_016566 Ga0500655_016566_366_1118 245
1915 3300053134 Ga0500658_0014456 Ga0500658_0014456_181_918 245
1916 3300053134 Ga0500658_0255697 Ga0500658_0255697_42_779 245
1917 3300053139 Ga0500568_0061196 Ga0500568_0061196_48_785 245
1918 3300053148 Ga0500590_091923 Ga0500590_091923_239_979 245
1919 3300053151 Ga0500604_0000673 Ga0500604_0000673_689_1426 245
1920 3300053151 Ga0500604_0019995 Ga0500604_0019995_967_1704 245
1921 3300053151 Ga0500604_0032547 Ga0500604_0032547_450_1190 245
1922 3300053153 Ga0500616_0056629 Ga0500616_0056629_485_1225 245
1923 3300053155 Ga0500620_035500 Ga0500620_035500_855_1595 245
1924 3300053158 Ga0500627_0075505 Ga0500627_0075505_273_1010 245
1925 3300053162 Ga0500638_045806 Ga0500638_045806_717_1457 245
1926 3300053177 Ga0500636_0000232 Ga0500636_0000232_25369_26109 245
1927 3300053178 Ga0500637_0000080 Ga0500637_0000080_4072_4812 245
1928 3300053178 Ga0500637_0131142 Ga0500637_0131142_677_1417 245
1929 3300053731 Ga0500609_000148 Ga0500609_000148_2351_3139 245
1930 3300053736 Ga0500599_002319 Ga0500599_002319_1192_1929 245
1931 3300054114 Ga0501084_0325914 Ga0501084_0325914_206_991 245
1932 3300055283 Ga0500661_006305 Ga0500661_006305_272_1012 245
1933 3300060353 Ga0501082_0031005 Ga0501082_0031005_3028_3813 245
1934 3300060353 Ga0501082_0156238 Ga0501082_0156238_964_1761 245
1935 3300061719 Ga0466962_0005581 Ga0466962_0005581_1152_1943 245
1936 iso_pu_bacteria 2513020051 2513226711 245
1937 iso_pu_bacteria 2599185214 2599625042 245
1938 iso_pu_bacteria 2599185226 2599673054 245
1939 iso_pu_bacteria 2599185227 2599682496 245
1940 iso_pu_bacteria 2599185229 2599694662 245
1941 iso_pu_bacteria 2643221609 2644061784 245
1942 iso_pu_bacteria 2643221611 2644073628 245
1943 iso_pu_bacteria 2643221658 2644329346 245
1944 iso_pu_bacteria 2643221672 2644401221 245
1945 iso_pu_bacteria 2738541277 2738717485 245
1946 iso_pu_bacteria 2738541307 2738879087 245
1947 iso_pu_bacteria 2738543013 2739248951 245
1948 iso_pu_bacteria 2738543019 2739278171 245
1949 iso_pu_bacteria 2818991446 2819596996 245
1950 iso_pu_bacteria 2831265667 2831266079 245
1951 iso_pu_bacteria 2838054893 2838057793 245
1952 iso_pu_bacteria 2885198086 2885203738 245
1953 iso_pu_bacteria 2885211737 2885216912 245
1954 iso_pu_bacteria 2899924645 2899930262 245
1955 iso_pu_bacteria 2904541872 2904543626 245
1956 iso_pu_bacteria 2928037797 2928039375 245
1957 iso_pu_bacteria 2928044640 2928045020 245
1958 iso_pu_bacteria 2928051484 2928052821 245
1959 iso_pu_bacteria 2928064002 2928064506 245
1960 iso_pu_bacteria 2928070936 2928075079 245
1961 iso_pu_bacteria 2928084124 2928088257 245
1962 iso_pu_bacteria 2928115317 2928118606 245
1963 iso_pu_bacteria 2929160207 2929162823 245
1964 iso_pu_bacteria 2945909444 2945911337 245
1965 iso_pu_bacteria 2945945610 2945947347 245
1966 iso_pu_bacteria 2945984333 2945986375 245
1967 3300021361 Ga0213872_10047045 Ga0213872_100470453 248
1968 3300039447 Ga0436361_0835659 Ga0436361_0835659_1723_2475 248
1969 3300042115 Ga0450911_000479 Ga0450911_000479_4586_5332 248
1970 3300046530 Ga0495654_0017612 Ga0495654_0017612_2915_3664 248
1971 3300048903 Ga0496100_0469418 Ga0496100_0469418_33_779 248
1972 3300048905 Ga0496102_0480880 Ga0496102_0480880_122_868 248
1973 3300048924 Ga0496121_0024049 Ga0496121_0024049_2240_2986 248
1974 3300048927 Ga0496124_0215429 Ga0496124_0215429_378_1124 248
1975 3300048928 Ga0496125_0015921 Ga0496125_0015921_606_1352 248
1976 3300048928 Ga0496125_0052757 Ga0496125_0052757_524_1270 248
1977 3300048928 Ga0496125_0125656 Ga0496125_0125656_430_1176 248
1978 3300048929 Ga0496126_0126748 Ga0496126_0126748_377_1123 248
1979 3300001979 JGI24740J21852_10012904 JGI24740J21852_100129043 249
1980 3300002739 JGI25158J39367_1002019 JGI25158J39367_10020194 249
1981 3300002774 JGI25150J39212_1002312 JGI25150J39212_10023122 249
1982 3300002774 JGI25150J39212_1011368 JGI25150J39212_10113682 249
1983 3300002987 JGI25159J45721_1016148 JGI25159J45721_10161481 249
1984 3300003187 JGI25151J46595_10008596 JGI25151J46595_100085962 249
1985 3300003354 JGI25160J50197_1026311 JGI25160J50197_10263111 249
1986 3300003374 JGI25161J50226_1006439 JGI25161J50226_10064391 249
1987 3300003374 JGI25161J50226_1008356 JGI25161J50226_10083561 249
1988 3300003758 Ga0055532_1009791 Ga0055532_10097911 249
1989 3300003761 Ga0055535_1004621 Ga0055535_10046212 249
1990 3300003762 Ga0055542_1000027 Ga0055542_100002748 249
1991 3300003771 Ga0055526_1029740 Ga0055526_10297401 249
1992 3300003771 Ga0055526_1029826 Ga0055526_10298261 249
1993 3300003773 Ga0055537_1002045 Ga0055537_10020459 249
1994 3300003773 Ga0055537_1012862 Ga0055537_10128621 249
1995 3300003775 Ga0055524_1029525 Ga0055524_10295252 249
1996 3300003775 Ga0055524_1029734 Ga0055524_10297341 249
1997 3300003781 Ga0055536_1038424 Ga0055536_10384241 249
1998 3300003784 Ga0055534_1004617 Ga0055534_10046171 249
1999 3300003784 Ga0055534_1013090 Ga0055534_10130901 249
2000 3300003790 Ga0055528_1027366 Ga0055528_10273661 249
2001 3300003791 Ga0055530_10001422 Ga0055530_1000142220 249
2002 3300003792 Ga0055540_1001616 Ga0055540_10016164 249
2003 3300003792 Ga0055540_1022181 Ga0055540_10221812 249
2004 3300003792 Ga0055540_1030708 Ga0055540_10307081 249
2005 3300003794 Ga0055531_10002054 Ga0055531_100020544 249
2006 3300003794 Ga0055531_10007043 Ga0055531_100070431 249
2007 3300004625 Ga0055543_1012645 Ga0055543_10126452 249
2008 3300005262 Ga0065165_1032220 Ga0065165_10322202 249
2009 3300005344 Ga0070661_100578633 Ga0070661_1005786331 249
2010 3300005366 Ga0070659_100591571 Ga0070659_1005915711 249
2011 3300005457 Ga0070662_100014380 Ga0070662_1000143802 249
2012 3300005539 Ga0068853_100003807 Ga0068853_1000038072 249
2013 3300005563 Ga0068855_100090949 Ga0068855_1000909492 249
2014 3300005564 Ga0070664_100268029 Ga0070664_1002680292 249
2015 3300005577 Ga0068857_100147209 Ga0068857_1001472092 249
2016 3300005578 Ga0068854_100148639 Ga0068854_1001486392 249
2017 3300005834 Ga0068851_10029940 Ga0068851_100299402 249
2018 3300006353 Ga0075370_10009939 Ga0075370_100099396 249
2019 3300006353 Ga0075370_10010060 Ga0075370_100100603 249
2020 3300009036 Ga0105244_10002722 Ga0105244_1000272218 249
2021 3300009093 Ga0105240_10075391 Ga0105240_100753914 249
2022 3300009093 Ga0105240_10490541 Ga0105240_104905412 249
2023 3300009148 Ga0105243_10000527 Ga0105243_1000052732 249
2024 3300009176 Ga0105242_10000946 Ga0105242_1000094612 249
2025 3300009176 Ga0105242_10531531 Ga0105242_105315311 249
2026 3300009545 Ga0105237_10074412 Ga0105237_100744124 249
2027 3300010375 Ga0105239_10184745 Ga0105239_101847452 249
2028 3300013100 Ga0157373_10137393 Ga0157373_101373932 249
2029 3300013104 Ga0157370_10192623 Ga0157370_101926232 249
2030 3300013104 Ga0157370_10366060 Ga0157370_103660601 249
2031 3300014497 Ga0182008_10005378 Ga0182008_100053784 249
2032 3300015261 Ga0182006_1004665 Ga0182006_10046654 249
2033 3300015262 Ga0182007_10001047 Ga0182007_1000104715 249
2034 3300017792 Ga0163161_10000065 Ga0163161_1000006525 249
2035 3300017792 Ga0163161_10007474 Ga0163161_100074748 249
2036 3300025228 Ga0209672_104312 Ga0209672_1043122 249
2037 3300025229 Ga0209147_101025 Ga0209147_10102512 249
2038 3300025242 Ga0209258_100048 Ga0209258_100048327 249
2039 3300025245 Ga0207425_1000275 Ga0207425_10002754 249
2040 3300025245 Ga0207425_1017078 Ga0207425_10170781 249
2041 3300025245 Ga0207425_1022293 Ga0207425_10222931 249
2042 3300025254 Ga0209148_1000040 Ga0209148_1000040327 249
2043 3300025258 Ga0209129_1000007 Ga0209129_1000007215 249
2044 3300025258 Ga0209129_1003907 Ga0209129_10039074 249
2045 3300025258 Ga0209129_1004952 Ga0209129_10049524 249
2046 3300025263 Ga0209565_1000105 Ga0209565_100010534 249
2047 3300025263 Ga0209565_1001643 Ga0209565_10016434 249
2048 3300025273 Ga0209673_1005800 Ga0209673_10058002 249
2049 3300025284 Ga0209130_1000172 Ga0209130_100017250 249
2050 3300025284 Ga0209130_1000329 Ga0209130_100032951 249
2051 3300025291 Ga0209675_1005938 Ga0209675_10059384 249
2052 3300025291 Ga0209675_1005974 Ga0209675_10059744 249
2053 3300025292 Ga0209676_1000004 Ga0209676_1000004966 249
2054 3300025292 Ga0209676_1001472 Ga0209676_10014724 249
2055 3300025292 Ga0209676_1041658 Ga0209676_10416582 249
2056 3300025294 Ga0209025_1000111 Ga0209025_100011151 249
2057 3300025294 Ga0209025_1000624 Ga0209025_10006244 249
2058 3300025294 Ga0209025_1027909 Ga0209025_10279092 249
2059 3300025294 Ga0209025_1031167 Ga0209025_10311672 249
2060 3300025295 Ga0209564_1000153 Ga0209564_1000153140 249
2061 3300025295 Ga0209564_1000337 Ga0209564_100033768 249
2062 3300025297 Ga0209758_1000025 Ga0209758_1000025311 249
2063 3300025297 Ga0209758_1003925 Ga0209758_100392517 249
2064 3300025298 Ga0209050_1000002 Ga0209050_10000021476 249
2065 3300025298 Ga0209050_1000412 Ga0209050_100041239 249
2066 3300025298 Ga0209050_1003041 Ga0209050_10030413 249
2067 3300025299 Ga0209256_1000425 Ga0209256_100042547 249
2068 3300025299 Ga0209256_1003613 Ga0209256_100361310 249
2069 3300025302 Ga0207426_1000001 Ga0207426_1000001267 249
2070 3300025302 Ga0207426_1000028 Ga0207426_1000028158 249
2071 3300025303 Ga0209051_1000002 Ga0209051_10000021246 249
2072 3300025303 Ga0209051_1000150 Ga0209051_1000150104 249
2073 3300025303 Ga0209051_1030888 Ga0209051_10308882 249
2074 3300025303 Ga0209051_1057350 Ga0209051_10573501 249
2075 3300025304 Ga0209257_1000002 Ga0209257_10000021387 249
2076 3300025304 Ga0209257_1000275 Ga0209257_100027558 249
2077 3300025304 Ga0209257_1020979 Ga0209257_10209792 249
2078 3300025728 Ga0207655_1000936 Ga0207655_100093611 249
2079 3300025913 Ga0207695_10153138 Ga0207695_101531382 249
2080 3300025924 Ga0207694_10233204 Ga0207694_102332042 249
2081 3300025932 Ga0207690_10234412 Ga0207690_102344122 249
2082 3300025933 Ga0207706_10174332 Ga0207706_101743322 249
2083 3300025934 Ga0207686_10024527 Ga0207686_100245271 249
2084 3300025935 Ga0207709_10000815 Ga0207709_1000081511 249
2085 3300025981 Ga0207640_10226290 Ga0207640_102262902 249
2086 3300025986 Ga0207658_10047610 Ga0207658_100476102 249
2087 3300026041 Ga0207639_10040927 Ga0207639_100409274 249
2088 3300026142 Ga0207698_10331152 Ga0207698_103311522 249
2089 3300026142 Ga0207698_10691043 Ga0207698_106910431 249
2090 3300028794 Ga0307515_10270563 Ga0307515_102705632 249
2091 3300031235 Ga0265330_10016489 Ga0265330_100164892 249
2092 3300031711 Ga0265314_10017569 Ga0265314_100175694 249
2093 3300031911 Ga0307412_10085148 Ga0307412_100851482 249
2094 3300032002 Ga0307416_100168118 Ga0307416_1001681182 249
2095 3300044683 Ga0466965_0028638 Ga0466965_0028638_521_1270 249
2096 3300044901 Ga0466960_0011337 Ga0466960_0011337_2814_3563 249
2097 3300046453 Ga0495627_018115 Ga0495627_018115_255_1010 249
2098 3300046453 Ga0495627_032407 Ga0495627_032407_243_998 249
2099 3300046512 Ga0495610_0008493 Ga0495610_0008493_2744_3493 249
2100 3300046513 Ga0495616_0014929 Ga0495616_0014929_365_1114 249
2101 3300046515 Ga0495620_0028522 Ga0495620_0028522_429_1178 249
2102 3300046515 Ga0495620_0135337 Ga0495620_0135337_183_938 249
2103 3300046517 Ga0495630_0451649 Ga0495630_0451649_214_966 249
2104 3300046518 Ga0495631_0002075 Ga0495631_0002075_10_759 249
2105 3300046520 Ga0495637_0000813 Ga0495637_0000813_19174_19929 249
2106 3300046522 Ga0495643_0202120 Ga0495643_0202120_88_837 249
2107 3300046530 Ga0495654_0176708 Ga0495654_0176708_144_893 249
2108 3300046558 Ga0495633_0126257 Ga0495633_0126257_258_1013 249
2109 3300046660 Ga0495625_0012893 Ga0495625_0012893_1947_2696 249
2110 3300046692 Ga0495671_0003738 Ga0495671_0003738_567_1322 249
2111 3300047321 Ga0495676_0029229 Ga0495676_0029229_3651_4400 249
2112 3300048089 Ga0495614_0127077 Ga0495614_0127077_238_987 249
2113 3300048903 Ga0496100_0435515 Ga0496100_0435515_103_852 249
2114 3300048904 Ga0496101_0057291 Ga0496101_0057291_56_805 249
2115 3300048910 Ga0496107_0119764 Ga0496107_0119764_1068_1817 249
2116 3300048919 Ga0496116_0029838 Ga0496116_0029838_49_804 249
2117 3300048920 Ga0496117_0020744 Ga0496117_0020744_515_1264 249
2118 3300048920 Ga0496117_0183564 Ga0496117_0183564_207_962 249
2119 3300048921 Ga0496118_0009889 Ga0496118_0009889_7321_8070 249
2120 3300048921 Ga0496118_0043712 Ga0496118_0043712_157_912 249
2121 3300048924 Ga0496121_0067710 Ga0496121_0067710_2084_2833 249
2122 3300048924 Ga0496121_0150065 Ga0496121_0150065_709_1458 249
2123 3300048924 Ga0496121_0458540 Ga0496121_0458540_11_760 249
2124 3300048925 Ga0496122_0089213 Ga0496122_0089213_109_858 249
2125 3300048925 Ga0496122_0170236 Ga0496122_0170236_449_1204 249
2126 3300048926 Ga0496123_0051410 Ga0496123_0051410_590_1345 249
2127 3300048927 Ga0496124_0040078 Ga0496124_0040078_567_1316 249
2128 3300048927 Ga0496124_0069053 Ga0496124_0069053_1920_2675 249
2129 3300048928 Ga0496125_0016127 Ga0496125_0016127_3132_3881 249
2130 3300048928 Ga0496125_0027260 Ga0496125_0027260_3383_4138 249
2131 3300049573 Ga0501037_0069565 Ga0501037_0069565_1353_2102 249
2132 3300049823 Ga0501044_0174492 Ga0501044_0174492_654_1403 249
2133 3300050496 nmdc:mga07m45_1493_c1 nmdc:mga07m45_1493_c1_449_1204 249
2134 3300050496 nmdc:mga07m45_2441_c1 nmdc:mga07m45_2441_c1_4986_5741 249
2135 3300050496 nmdc:mga07m45_52599_c1 nmdc:mga07m45_52599_c1_240_989 249
2136 3300053079 Ga0500610_0007129 Ga0500610_0007129_1871_2626 249
2137 3300053079 Ga0500610_0038192 Ga0500610_0038192_1413_2168 249
2138 3300053079 Ga0500610_0093117 Ga0500610_0093117_510_1259 249
2139 3300053087 Ga0500643_003076 Ga0500643_003076_2359_3108 249
2140 3300053093 Ga0500651_0000042 Ga0500651_0000042_32513_33262 249
2141 3300053094 Ga0500566_0094857 Ga0500566_0094857_850_1599 249
2142 3300053110 Ga0500571_000385 Ga0500571_000385_16205_16954 249
2143 3300053117 Ga0500593_000583 Ga0500593_000583_508_1263 249
2144 3300053121 Ga0500607_001690 Ga0500607_001690_406_1161 249
2145 3300053121 Ga0500607_049496 Ga0500607_049496_1373_2128 249
2146 3300053133 Ga0500655_002140 Ga0500655_002140_2271_3026 249
2147 3300053134 Ga0500658_0000641 Ga0500658_0000641_12561_13310 249
2148 3300053134 Ga0500658_0001086 Ga0500658_0001086_1226_1975 249
2149 3300053136 Ga0500559_0002630 Ga0500559_0002630_219_974 249
2150 3300053138 Ga0500564_009533 Ga0500564_009533_3145_3894 249
2151 3300053139 Ga0500568_0015825 Ga0500568_0015825_1433_2182 249
2152 3300053141 Ga0500574_023631 Ga0500574_023631_272_1027 249
2153 3300053161 Ga0500634_0036870 Ga0500634_0036870_1509_2258 249
2154 3300053735 Ga0500596_011587 Ga0500596_011587_53_802 249

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06314

ADC

Acetoacetate decarboxylase (ADC)

50

282

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bgt-assembly1.cif.gz_D structural studies of acetoacetate decarboxylase 0.9415 1 249
3bgt-assembly1.cif.gz_D structural studies of acetoacetate decarboxylase 0.9378 1 249
3c8w-assembly1.cif.gz_A crystal structure of acetoacetate decarboxylase (adc) (yp_094708.1) from legionella pneumophila subsp. pneumophila str. philadelphia 1 at 1.60 a resolution 0.9298 6 249
3bh2-assembly1.cif.gz_A structural studies of acetoacetate decarboxylase 0.927 1 249
3bh2-assembly1.cif.gz_A structural studies of acetoacetate decarboxylase 0.9234 1 249
ID Description Score Start End Superfamily
3bgtC01 Mainly Beta;Beta Barrel;Acetoacetate decarboxylase-like;Acetoacetate decarboxylase-like 0.9685 14 247 2.40.400.10
3bgtC01 Mainly Beta;Beta Barrel;Acetoacetate decarboxylase-like;Acetoacetate decarboxylase-like 0.9601 14 247 2.40.400.10
3cmbA00 Mainly Beta;Beta Barrel;Acetoacetate decarboxylase-like;Acetoacetate decarboxylase-like 0.862 20 243 2.40.400.10
4jmcB00 Mainly Beta;Beta Barrel;Acetoacetate decarboxylase-like;Acetoacetate decarboxylase-like 0.8545 10 247 2.40.400.10
4zbtD00 Mainly Beta;Beta Barrel;Acetoacetate decarboxylase-like;Acetoacetate decarboxylase-like 0.845 10 244 2.40.400.10
ID Description Score Start End GO Terms
AF-A0A7R6YC57-F1-model_v4 deleted 0.9787 117 249
AF-A0A258SIP7-F1-model_v4 Acetoacetate decarboxylase 0.9774 118 249 GO:0016829
AF-A0A839U1V7-F1-model_v4 Acetoacetate decarboxylase 0.9764 136 249 GO:0016829
AF-A0A535EX24-F1-model_v4 Acetoacetate decarboxylase (EC 4.1.1.4) 0.9759 99 249 GO:0047602
AF-A0A1M7UM95-F1-model_v4 Acetoacetate decarboxylase (ADC) 0.9758 102 249 GO:0016829

Feature Viewer

pLDDT pTM Quality
94.23 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map