metagRoot

F496363

General Info

Members	Datasets	Scaffolds	Average Seq Length
2078	725	1887	275

Family's Representative Sequence

Representative Sequence	3300009147\|Ga0114129_10132506\|Ga0114129_101325063
Length	319
Sequence	MDHDHETGKVQAFCGSKDKETARGLAARADRPESGLSGGCGVTSADGAGRLPAAFMTPGTPSFSDFLGSYAPDLLPGRRTPPSEQIEVPHGTTIVAVTFPGGVVMAGDRRATTGNVIAQRDIEKVYPADEYSCVGIAGAAGVAVELVRLFQVELEHYEKIEGTVLSLDGKANRLAMMIRGNLALAMQGLAVVPLFAGYDLETGDGRIFSYDVTGGRYEEHEFHSVGSGSPFARGALKKLFRDDLQEVDAVTACVQALYDAADDDSATGGPDLSRRIYPVVAAVTAAGYSRMPDDQVGGIVDAVIAGRMTNPNGPQAPLR

Samples

	Sample ID	Description	Type	Environment
1	2501939600	Micromonospora sp. L5	Isolate	Unclassified
2	2506783011	Frankia datiscae Dg1	Isolate	Nodule
3	2515154088	Salinispora arenicola CNT800	Isolate	Rhizosphere
4	2515154129	Salinispora pacifica CNS103	Isolate	Rhizosphere
5	2515154137	Salinispora arenicola CNX482	Isolate	Rhizosphere
6	2515154155	Actinopolymorpha alba DSM 45243	Isolate	Rhizosphere
7	2515154202	Salinispora pacifica CNT084	Isolate	Rhizosphere
8	2515154203	Salinispora arenicola CNR921	Isolate	Rhizosphere
9	2527291627	Frankia casuarinae Thr	Isolate	Nodule
10	2527291629	Frankia sp. BMG5.23	Isolate	Nodule
11	2546825537	Frankia sp. CcI6	Isolate	Rhizoplane
12	2547132424	Nocardia nova SH22a	Isolate	Unclassified
13	2551306166	Nocardia tenerifensis NBRC 101015	Isolate	Rhizosphere
14	2554235005	Streptomyces violaceusniger SPC6	Isolate	Rhizosphere
15	2576861822	Frankia sp. CeD	Isolate	Nodule
16	2579778521	Frankia torreyi CpI1-S	Isolate	Unclassified
17	2582580736	Prauserella sp. Am3	Isolate	Unclassified
18	2585427649	Amycolatopsis japonica MG417-CF17, DSM 44213	Isolate	Unclassified
19	2619618881	Frankia sp. ACN1ag	Isolate	Unclassified
20	2619619003	Frankia sp. CpI1-P	Isolate	Nodule
21	2622736605	Geodermatophilus ruber DSM 45317	Isolate	Rhizosphere
22	2622736626	Micromonospora rhizosphaerae DSM 45431	Isolate	Rhizosphere
23	2626541554	Frankia sp. AvcI.1	Isolate	Nodule
24	2643221578	Streptomyces sp. Root63	Isolate	Unclassified
25	2643221587	Streptomyces sp. Root66D1	Isolate	Unclassified
26	2643221601	Kitasatospora sp. Root187	Isolate	Unclassified
27	2643221613	Oerskovia sp. Root22	Isolate	Unclassified
28	2643221615	Nocardioides sp. Root224	Isolate	Unclassified
29	2643221631	Kitasatospora sp. Root107	Isolate	Unclassified
30	2643221657	Nocardioides sp. Root1257	Isolate	Unclassified
31	2643221670	Streptomyces sp. Root431	Isolate	Unclassified
32	2643221673	Streptomyces sp. Root1295	Isolate	Unclassified
33	2643221677	Streptomyces sp. Root1304	Isolate	Unclassified
34	2643221681	Aeromicrobium sp. Root472D3	Isolate	Unclassified
35	2643221692	Nocardia sp. Root136	Isolate	Unclassified
36	2643221696	Nocardioides sp. Root140	Isolate	Unclassified
37	2643221721	Oerskovia sp. Root918	Isolate	Unclassified
38	2643221961	Aeromicrobium sp. Root236	Isolate	Unclassified
39	2643221962	Aeromicrobium sp. Root344	Isolate	Unclassified
40	2671180195	Frankia sp. CcI49	Isolate	Nodule
41	2675902999	Frankia asymbiotica NRRL B-16386	Isolate	Nodule
42	2675903058	Actinopolymorpha cephalotaxi CPCC 202808	Isolate	Rhizosphere
43	2675903059	Asanoa hainanensis CGMCC 4.5593	Isolate	Rhizosphere
44	2684623035	Frankia sp. NRRL B-16219	Isolate	Rhizosphere
45	2684623036	Frankia sp. CgIM4	Isolate	Nodule
46	2687453737	Frankia sp. BMG5.36	Isolate	Nodule
47	2687453743	Frankia colletiae Cc1.17	Isolate	Nodule
48	2690315906	Arthrobacter sp. OY3WO11	Isolate	Unclassified
49	2710264753	Frankia sp. KB5	Isolate	Nodule
50	2731639228	Motilibacter peucedani DSM 45328	Isolate	Rhizosphere
51	2751185734	Saccharothrix sp. NRRL B-16314	Isolate	Rhizosphere
52	2751185782	Actinoplanes subtropicus NRRL B-24665	Isolate	Rhizosphere
53	2767802112	Streptomyces avicenniae NRRL B-24776	Isolate	Rhizosphere
54	2772190715	Micromonospora chokoriensis NRRL B-24750	Isolate	Unclassified
55	2773857921	Frankia asymbiotica NRRL B-16386	Isolate	Nodule
56	2773857922	Frankia sp. CcI49	Isolate	Nodule
57	2773857924	Frankia sp. CgIS1	Isolate	Nodule
58	2773857933	Frankia sp. BMG5.30	Isolate	Nodule
59	2775506735	Arthrobacter sp. S95 1704	Isolate	Unclassified
60	2775506925	Saccharopolyspora phatthalungensis NRRL B-24798	Isolate	Rhizosphere
61	2784132148	Streptomyces sp. E5N91 SAI-083	Isolate	Unclassified
62	2799112218	Motilibacter rhizosphaerae DSM 45622	Isolate	Rhizosphere
63	2802429296	Streptomyces sampsonii KJ40	Isolate	Rhizosphere
64	2808606357	Arthrobacter sp. SLBN-122	Isolate	Unclassified
65	2808606360	Arthrobacter sp. SLBN-112	Isolate	Unclassified
66	2808606365	Phycicoccus sp. SLBN-51	Isolate	Unclassified
67	2808606366	Arthrobacter sp. SLBN-83	Isolate	Unclassified
68	2808606370	Arthrobacter sp. SLBN-100	Isolate	Unclassified
69	2808606371	Arthrobacter sp. SLBN-53	Isolate	Unclassified
70	2808606448	Streptomyces sp. 193411	Isolate	Unclassified
71	2808606522	Amycolatopsis sp. BJA-103	Isolate	Unclassified
72	2808606982	Streptomyces sp. SLBN-118	Isolate	Unclassified
73	2811994871	Arthrobacter sp. SLBN-179	Isolate	Unclassified
74	2811994874	Nocardioides sp. SLBN-35	Isolate	Unclassified
75	2811994880	Cellulomonas sp. SLBN-39	Isolate	Unclassified
76	2811994917	Streptomyces sp. SLBN-134	Isolate	Unclassified
77	2818991472	Kitasatospora viridis DSM 44826	Isolate	Rhizosphere
78	2827628540	Actinopolymorpha cephalotaxi DSM 45117	Isolate	Rhizosphere
79	2831935698	Jishengella sp. AZ1-13	Isolate	Unclassified
80	2832004796	Micromonospora endophytica JCM 18317	Isolate	Unclassified
81	2837268691	Jiangella endophytica KE2-3	Isolate	Rhizosphere
82	2839986021	Cellulosimicrobium cellulans JZ5	Isolate	Unclassified
83	2844849076	Arthrobacter cupressi DSM 24664	Isolate	Rhizosphere
84	2855386786	Nocardioides ferulae EGI 63112	Isolate	Unclassified
85	2855670206	Micromonospora noduli Lupac 07	Isolate	Nodule
86	2855676851	Micromonospora saelicesensis GAR05	Isolate	Unclassified
87	2855683550	Micromonospora sp. RP3T	Isolate	Unclassified
88	2856858025	Micromonospora aurantiaca 110B(2018)	Isolate	Unclassified
89	2857288857	Micromonospora noduli ONO23	Isolate	Unclassified
90	2857481737	Nocardioides sp. R-74106	Isolate	Unclassified
91	2857710386	Brevibacterium sp. R-73093	Isolate	Unclassified
92	2858848962	Micromonospora saelicesensis GAR06	Isolate	Unclassified
93	2858868258	Micromonospora sp. MH33	Isolate	Unclassified
94	2858882152	Micromonospora noduli MED15	Isolate	Nodule
95	2858888857	Micromonospora saelicesensis Lupac 06	Isolate	Unclassified
96	2858895516	Micromonospora saelicesensis PSN13	Isolate	Unclassified
97	2858902515	Micromonospora sp. MW-13	Isolate	Rhizosphere
98	2862178590	Streptomyces sp. SDr-06	Isolate	Rhizosphere
99	2862705112	Streptomyces triticirhizae NEAU-YY642	Isolate	Rhizosphere
100	2863067949	Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2)	Isolate	Rhizosphere
101	2866065130	Micromonospora endophytica DSM 45430	Isolate	Unclassified
102	2866552031	Saccharopolyspora rhizosphaerae H219	Isolate	Unclassified
103	2867302475	Micromonospora globbae WPS1-2	Isolate	Unclassified
104	2867312974	Micromonospora musae NGC1-4	Isolate	Unclassified
105	2867319477	Micromonospora musae MS1-9	Isolate	Unclassified
106	2867369537	Streptomyces sp. Z26	Isolate	Unclassified
107	2867475112	Streptomyces sp. TM32	Isolate	Unclassified
108	2869048445	Micromonospora saelicesensis PSN01	Isolate	Unclassified
109	2869061728	Micromonospora noduli ONO86	Isolate	Unclassified
110	2869068681	Micromonospora noduli GUI43	Isolate	Unclassified
111	2870721527	Saccharothrix ecbatanensis DSM 45486	Isolate	Rhizosphere
112	2875391855	Streptomyces cavourensis 1AS2a	Isolate	Rhizosphere
113	2880489317	Micromonospora ureilytica DSM 101692	Isolate	Unclassified
114	2880495981	Micromonospora vinacea DSM 101695	Isolate	Unclassified
115	2884994152	Cellulomonas sp. H30R-01	Isolate	Rhizosphere
116	2891395885	Microbispora catharanthi CR1-09	Isolate	Unclassified
117	2891554331	Microbispora sp. CL1-1	Isolate	Unclassified
118	2891562705	Microbispora tritici MT50	Isolate	Unclassified
119	2895880812	Frankia sp. BMG5.11	Isolate	Unclassified
120	2899359706	Amycolatopsis anabasis EGI 650086	Isolate	Unclassified
121	2902582711	Micromonospora sp. AP08	Isolate	Unclassified
122	2905926851	Arthrobacter sedimenti MIC A30	Isolate	Rhizosphere
123	2912757875	Streptomyces sp. S4.7	Isolate	Rhizosphere
124	2917736166	Amycolatopsis dendrobii DR6-1	Isolate	Unclassified
125	2918501144	Streptomyces sp. PvR006	Isolate	Rhizosphere
126	2919391150	Arthrobacter ipis 2973	Isolate	Unclassified
127	2919713450	Nocardia kruczakiae 4272	Isolate	Rhizosphere
128	2929219909	Micromonospora sp. R-75348 Hybrid assembly	Isolate	Unclassified
129	2929226422	Micromonospora sp. R-74116 Hybrid assembly	Isolate	Unclassified
130	2939598168	Arthrobacter sp. 754	Isolate	Rhizosphere
131	2945916053	Arthrobacter ulcerisalmonis W1I2	Isolate	Rhizosphere
132	2945920336	Pseudarthrobacter siccitolerans W1I3	Isolate	Rhizosphere
133	2945941187	Arthrobacter pascens W1I14	Isolate	Rhizosphere
134	2945956166	Arthrobacter globiformus W2I3	Isolate	Rhizosphere
135	2946003308	Arthrobacter agilis W3I6	Isolate	Rhizosphere
136	2946037020	Arthrobacter sp. W4I7	Isolate	Rhizosphere
137	2946045630	Streptomyces sp. W4I9-2	Isolate	Rhizosphere
138	2946059875	Arthrobacter sp. SLBN-112	Isolate	Rhizosphere
139	2947224130	Streptomyces afghaniensis W1I20	Isolate	Rhizosphere
140	2953998280	Pseudarthrobacter sp. W1I19	Isolate	Rhizosphere
141	2966598605	Kitasatospora papulosa SLBN-177	Isolate	Rhizosphere
142	2974302888	Pseudarthrobacter sp. SORGH_AS 212	Isolate	Unclassified
143	2984592036	Aeromicrobium sp. SORGH_AS981	Isolate	Aerial Root
144	2990044586	Streptomyces sedi JCM 16909	Isolate	Unclassified
145	2990088156	Streptomyces albidus CAP 215	Isolate	Unclassified
146	2990256926	Nocardioides zeae SORGH_AS885	Isolate	Aerial Root
147	2995463766	Streptacidiphilus fuscans NEAU-YB345	Isolate	Unclassified
148	2996221748	Micromonospora veneta CAP181	Isolate	Unclassified
149	3002998708	Actinomadura barringtoniae GKU 128	Isolate	Unclassified
150	3006493962	Streptomyces grisecoloratus TRM S81-3	Isolate	Rhizosphere
151	3300000549	Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled	Metagenome	Rhizosphere
152	3300001977	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5	Metagenome	Rhizosphere
153	3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Metagenome	Rhizosphere
154	3300001991	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2	Metagenome	Rhizosphere
155	3300002067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1	Metagenome	Rhizosphere
156	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
157	3300003285	Grassland soil microbial communities from Hopland, California, USA - Sample H3_Rhizo_39 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
158	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
159	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
160	3300003323	Sugarcane root Sample H1	Metagenome	Unclassified
161	3300003373	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
162	3300003578	Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Unclassified
163	3300004799	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
164	3300004803	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
165	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
166	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
167	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
168	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
169	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
170	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
171	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
172	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
173	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
174	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
175	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
176	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
177	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
178	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
179	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
180	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
181	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
182	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
183	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
184	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
185	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
186	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
187	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
188	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
189	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
190	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
191	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
192	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
193	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
194	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
195	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
196	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
197	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
198	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
199	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
200	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
201	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
202	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
203	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
204	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
205	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
206	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
207	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
208	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
209	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
210	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
211	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
212	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
213	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
214	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
215	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
216	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
217	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
218	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
219	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
220	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
221	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
222	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
223	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
224	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
225	3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
226	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
227	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
228	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
229	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
230	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
231	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
232	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
233	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
234	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
235	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
236	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
237	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
238	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
239	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
240	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
241	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
242	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
243	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
244	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
245	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
246	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
247	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
248	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
249	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
250	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
251	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
252	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
253	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
254	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
255	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
256	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
257	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
258	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
259	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
260	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
261	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
262	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
263	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
264	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
265	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
266	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
267	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
268	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
269	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
270	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
271	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
272	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
273	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
274	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
275	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
276	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
277	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
278	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
279	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
280	3300015688	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01	Metagenome	Rhizosphere
281	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
282	3300020069	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
283	3300020070	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
284	3300020075	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
285	3300020077	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
286	3300020078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
287	3300020080	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
288	3300020081	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
289	3300020082	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
290	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
291	3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Metagenome	Unclassified
292	3300022467	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
293	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
294	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
295	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
296	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
297	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
298	3300025728	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
299	3300025735	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
300	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
301	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
302	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
303	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
304	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
305	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
306	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
307	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
308	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
309	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
310	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
311	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
312	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
313	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
314	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
315	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
316	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
317	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
318	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
319	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
320	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
321	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
322	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
323	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
324	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
325	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
326	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
327	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
328	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
329	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
330	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
331	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
332	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
333	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
334	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
335	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
336	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
337	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
338	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
339	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
340	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
341	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
342	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
343	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
344	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
345	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
346	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
347	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
348	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
349	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
350	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
351	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
352	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
353	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
354	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
355	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
356	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
357	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
358	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
359	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
360	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
361	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
362	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
363	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
364	3300028573	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG	Metagenome	Rhizosphere
365	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
366	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
367	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
368	3300030500	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3)	Metagenome	Rhizosphere
369	3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Metagenome	Unclassified
370	3300030522	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM	Metagenome	Unclassified
371	3300030732	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1	Metagenome	Rhizosphere
372	3300030733	Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2	Metagenome	Rhizosphere
373	3300030742	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9	Metagenome	Rhizosphere
374	3300030744	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7	Metagenome	Rhizosphere
375	3300030836	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
376	3300030877	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
377	3300031239	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG	Metagenome	Rhizosphere
378	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
379	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
380	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
381	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
382	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
383	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
384	3300031614	Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI4 (Metagenome Metatranscriptome)	Metatranscriptome	Unclassified
385	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
386	3300031649	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM	Metagenome	Unclassified
387	3300031665	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3	Metagenome	Rhizosphere
388	3300031691	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA	Metagenome	Rhizosphere
389	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
390	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
391	3300031727	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5	Metagenome	Rhizosphere
392	3300031728	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC	Metagenome	Rhizosphere
393	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
394	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
395	3300031733	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1	Metagenome	Rhizosphere
396	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
397	3300031838	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM	Metagenome	Unclassified
398	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
399	3300031889	Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO	Metagenome	Rhizosphere
400	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
401	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
402	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
403	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
404	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
405	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
406	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
407	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
408	3300032139	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB	Metagenome	Rhizosphere
409	3300033179	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM	Metagenome	Unclassified
410	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
411	3300034957	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2	Metagenome	Rhizosphere
412	3300035083	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17	Metagenome	Rhizosphere
413	3300035086	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4	Metagenome	Rhizosphere
414	3300035091	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4	Metagenome	Rhizosphere
415	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
416	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
417	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
418	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
419	3300035120	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5	Metagenome	Rhizosphere
420	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
421	3300035207	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16	Metagenome	Rhizosphere
422	3300035242	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11	Metagenome	Rhizosphere
423	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
424	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
425	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
426	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
427	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
428	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
429	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
430	3300036457	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
431	3300036647	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA	Metagenome	Rhizosphere
432	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
433	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
434	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
435	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
436	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
437	3300037588	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA	Metagenome	Rhizosphere
438	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
439	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
440	3300038735	Seagrass microbial communities from Seahorse Key, FL, USA - SH0319	Metagenome	Unclassified
441	3300038742	Seagrass microbial communities from Seahorse Key, FL, USA - SH0818	Metagenome	Unclassified
442	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
443	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
444	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
445	3300041404	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272	Metagenome	Rhizosphere
446	3300041405	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414	Metagenome	Rhizosphere
447	3300041406	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284	Metagenome	Rhizosphere
448	3300041407	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416	Metagenome	Rhizosphere
449	3300041410	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596	Metagenome	Rhizosphere
450	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
451	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
452	3300041451	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG	Metagenome	Rhizoplane
453	3300041453	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG	Metagenome	Rhizoplane
454	3300041460	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG	Metagenome	Rhizoplane
455	3300041494	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG	Metagenome	Unclassified
456	3300041496	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG	Metagenome	Unclassified
457	3300041498	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG	Metagenome	Unclassified
458	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
459	3300041997	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607	Metagenome	Rhizosphere
460	3300041999	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297	Metagenome	Rhizosphere
461	3300042002	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616	Metagenome	Rhizosphere
462	3300042004	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619	Metagenome	Rhizosphere
463	3300042006	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437	Metagenome	Rhizosphere
464	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
465	3300042010	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431	Metagenome	Rhizosphere
466	3300042014	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275	Metagenome	Rhizosphere
467	3300042122	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496	Metagenome	Rhizosphere
468	3300042125	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472	Metagenome	Rhizosphere
469	3300042136	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294	Metagenome	Rhizosphere
470	3300042145	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581	Metagenome	Rhizosphere
471	3300042146	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979	Metagenome	Rhizosphere
472	3300042156	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593	Metagenome	Rhizosphere
473	3300042435	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613	Metagenome	Rhizosphere
474	3300042531	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253	Metagenome	Rhizosphere
475	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
476	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
477	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
478	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
479	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
480	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
481	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
482	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
483	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
484	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
485	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
486	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
487	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
488	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
489	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
490	3300046452	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere	Metagenome	Rhizosphere
491	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
492	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
493	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
494	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
495	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
496	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
497	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
498	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
499	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
500	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
501	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
502	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
503	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
504	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
505	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
506	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
507	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
508	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
509	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
510	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
511	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
512	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
513	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
514	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
515	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
516	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
517	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
518	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
519	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
520	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
521	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
522	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
523	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
524	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
525	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
526	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
527	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
528	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
529	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
530	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
531	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
532	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
533	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
534	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
535	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
536	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
537	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
538	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
539	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
540	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
541	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
542	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
543	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
544	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
545	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
546	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
547	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
548	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
549	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
550	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
551	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
552	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
553	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
554	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
555	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
556	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
557	3300047447	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere	Metagenome	Rhizosphere
558	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
559	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
560	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
561	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
562	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
563	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
564	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
565	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
566	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
567	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
568	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
569	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
570	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
571	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
572	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
573	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
574	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
575	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
576	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
577	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
578	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
579	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
580	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
581	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
582	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
583	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
584	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
585	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
586	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
587	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
588	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
589	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
590	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
591	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
592	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
593	3300049539	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
594	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
595	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
596	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
597	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
598	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
599	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
600	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
601	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
602	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
603	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
604	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
605	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
606	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
607	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
608	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
609	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
610	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
611	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
612	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
613	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
614	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
615	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
616	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
617	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
618	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
619	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
620	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
621	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
622	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
623	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
624	3300049775	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought	Metagenome	Rhizosphere
625	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
626	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
627	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
628	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
629	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
630	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
631	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
632	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
633	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
634	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
635	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
636	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
637	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
638	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
639	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
640	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
641	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
642	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
643	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
644	3300053079	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere	Metagenome	Endosphere
645	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
646	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
647	3300053086	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere	Metagenome	Endosphere
648	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
649	3300053088	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere	Metagenome	Endosphere
650	3300053090	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere	Metagenome	Endosphere
651	3300053092	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere	Metagenome	Endosphere
652	3300053095	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere	Metagenome	Endosphere
653	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
654	3300053104	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere	Metagenome	Endosphere
655	3300053107	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere	Metagenome	Endosphere
656	3300053117	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere	Metagenome	Endosphere
657	3300053123	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere	Metagenome	Endosphere
658	3300053129	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere	Metagenome	Endosphere
659	3300053131	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere	Metagenome	Endosphere
660	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
661	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
662	3300053137	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere	Metagenome	Endosphere
663	3300053140	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere	Metagenome	Endosphere
664	3300053143	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere	Metagenome	Endosphere
665	3300053146	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere	Metagenome	Endosphere
666	3300053149	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere	Metagenome	Endosphere
667	3300053151	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere	Metagenome	Endosphere
668	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
669	3300053157	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere	Metagenome	Endosphere
670	3300053161	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere	Metagenome	Endosphere
671	3300053739	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere	Metagenome	Endosphere
672	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
673	3300059424	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
674	3300059492	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
675	3300059505	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
676	3300059508	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
677	3300059626	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
678	3300059628	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
679	3300059630	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
680	3300059640	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
681	3300059643	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
682	3300059660	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
683	3300060346	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
684	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
685	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
686	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere
687	637000116	Frankia casuarinae CcI3	Isolate	Nodule
688	649633069	Micromonospora sp. L5	Isolate	Unclassified
689	8001781756	Catellatospora tritici NEAU-YM18	Isolate	Rhizosphere
690	8002775197	Frankia nepalensis CN7	Isolate	Nodule
691	8003314358	Amycolatopsis sp. MtRt-6	Isolate	Unclassified
692	8003830390	Micromonospora parastrephiae STR1_7	Isolate	Rhizosphere
693	8003856774	Micromonospora echinofusca MPMI6	Isolate	Unclassified
694	8003870546	Micromonospora tarensis STR1s_6	Isolate	Rhizosphere
695	8004021418	Arthrobacter sp. SDTb3-6	Isolate	Rhizosphere
696	8004025490	Arthrobacter wenxiniae AETb3-4	Isolate	Rhizosphere
697	8008485437	Streptomyces mimosae 3MP-10	Isolate	Unclassified
698	8023623736	Streptomyces sp. 111WW2	Isolate	Unclassified
699	8025413630	Streptomyces sp. CAI-17	Isolate	Rhizosphere
700	8025524527	Streptomyces sp. 3MP-14	Isolate	Unclassified
701	8025530807	Streptomyces sp. 4R-3d	Isolate	Unclassified
702	8033684223	Streptomyces phytophilus PIP175	Isolate	Unclassified
703	8047710418	Umezawaea endophytica DSM 103496	Isolate	Unclassified
704	8047893842	Streptomyces cangkringensis DSM 41769	Isolate	Rhizosphere
705	8048127548	Streptomyces samsunensis DSM 42010	Isolate	Rhizosphere
706	8048356638	Streptomyces rhizosphaericus DSM 41760	Isolate	Rhizosphere
707	8048369669	Streptomyces indonesiensis DSM 41759	Isolate	Rhizoplane
708	8048379754	Streptomyces asiaticus DSM 41761	Isolate	Rhizosphere
709	8053945823	Actinomadura terrae OS3-83	Isolate	Rhizosphere
710	8054107350	Arthrobacter rhizosphaerae CCNWLXL 1-35	Isolate	Rhizosphere
711	8054160619	Streptomyces rhizoryzae RS10V-4	Isolate	Rhizosphere
712	8054472261	Pseudonocardia terrae RS11V-5	Isolate	Rhizosphere
713	8054704163	Micromonospora trifolii NIE79	Isolate	Nodule
714	8054727385	Micromonospora alfalfae MED01	Isolate	Nodule
715	8054734606	Micromonospora hortensis NIE111	Isolate	Nodule
716	8054913762	Frankia gtarii Agncl-10	Isolate	Nodule
717	8054920844	Frankia tisae Agncl-8	Isolate	Nodule
718	8055157932	Frankia umida Ag45/Mut15	Isolate	Nodule
719	8055412473	Micromonospora phytophila DSM 105363	Isolate	Nodule
720	8056054917	Glycomyces luteolus NEAU-A15	Isolate	Rhizosphere
721	8056207758	Saccharopolyspora indica KCTC 29208	Isolate	Rhizosphere
722	8056447290	Streptomyces huiliensis SCA2-4	Isolate	Rhizosphere
723	8056579771	Promicromonospora iranensis UTMC 00792	Isolate	Rhizosphere
724	8056667051	Streptomyces sichuanensis SCA3-4	Isolate	Rhizosphere
725	8057568493	Actinorhabdospora filicis NBRC 111898	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	87.3
Metatranscriptomes	3.51
Isolates	9.19

Biome Distribution

Category	Percentage (%)
Aerial Root	0.1
Bulb	0
Endosphere	4.14
Nodule	1.3
Rhizoplane	5.05
Rhizosphere	79.4
Stem	0
Stem Tuber	0
Unclassified	10.01

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	LJQas_1001039	3300000549	Bacteria	4243
2	LJQas_1006053	3300000549	Bacteria	1515
3	LJQas_1006786	3300000549	Bacteria	1419
4	JGI24746J21847_1008500	3300001977	Bacteria	1546
5	JGI24739J22299_10015454	3300001989	Bacteria	2774
6	JGI24739J22299_10030486	3300001989	Bacteria	1869
7	JGI24743J22301_10007050	3300001991	Bacteria	1938
8	JGI24735J21928_10014696	3300002067	Bacteria	2451
9	JGI25153J46596_10025062	3300003215	Bacteria	2139
10	Ga0007423J48922_100319	3300003285	Bacteria	1345
11	rootH2_10067782	3300003320	Bacteria	1655
12	rootH2_10159480	3300003320	Bacteria	1860
13	rootL2_10044287	3300003322	Bacteria	4934
14	rootH1_10043838	3300003323	Bacteria	1500
15	JGI25407J50210_10020927	3300003373	Bacteria	1701
16	Ga0006562J51391_1005944	3300003578	Bacteria	6123
17	Ga0006562J51391_1095372	3300003578	Bacteria	1173
18	Ga0058863_11842216	3300004799	Bacteria	1915
19	Ga0058863_11975701	3300004799	Bacteria	1085
20	Ga0058862_10012331	3300004803	Bacteria	1399
21	Ga0058862_12659626	3300004803	Bacteria	1942
22	Ga0070658_10000233	3300005327	Bacteria	49543
23	Ga0070658_10000677	3300005327	Bacteria	29445
24	Ga0070658_10001229	3300005327	Bacteria	21956
25	Ga0070658_10015639	3300005327	Bacteria	6068
26	Ga0070658_10054472	3300005327	Bacteria	3248
27	Ga0070658_10122061	3300005327	Bacteria	2165
28	Ga0070683_100001768	3300005329	Bacteria	16825
29	Ga0070683_100008738	3300005329	Bacteria	8610
30	Ga0070683_100028402	3300005329	Bacteria	5054
31	Ga0070683_100050602	3300005329	Bacteria	3847
32	Ga0070683_100059163	3300005329	Bacteria	3560
33	Ga0070683_100151411	3300005329	Bacteria	2199
34	Ga0070683_100284937	3300005329	Bacteria	1572
35	Ga0070683_100563494	3300005329	Bacteria	1089
36	Ga0070683_100608806	3300005329	Bacteria	1046
37	Ga0070677_10045510	3300005333	Bacteria	1751
38	Ga0068869_100018324	3300005334	Bacteria	4764
39	Ga0068869_100040788	3300005334	Bacteria	3321
40	Ga0070666_10087304	3300005335	Bacteria	2138
41	Ga0070680_100001286	3300005336	Bacteria	18164
42	Ga0070680_100015626	3300005336	Bacteria	5955
43	Ga0070680_100132158	3300005336	Bacteria	2089
44	Ga0070680_100213782	3300005336	Bacteria	1627
45	Ga0070680_100230724	3300005336	Bacteria	1563
46	Ga0070680_100317335	3300005336	Bacteria	1323
47	Ga0070682_100239559	3300005337	Bacteria	1301
48	Ga0068868_100010132	3300005338	Bacteria	6811
49	Ga0068868_100023431	3300005338	Bacteria	4672
50	Ga0068868_100280350	3300005338	Bacteria	1410
51	Ga0070660_100026658	3300005339	Bacteria	4305
52	Ga0070660_100030882	3300005339	Bacteria	4020
53	Ga0070660_100176312	3300005339	Bacteria	1729
54	Ga0070660_100282446	3300005339	Bacteria	1358
55	Ga0070691_10058637	3300005341	Bacteria	1849
56	Ga0070687_100192220	3300005343	Bacteria	1231
57	Ga0070661_100025133	3300005344	Bacteria	4278
58	Ga0070661_100086439	3300005344	Bacteria	2318
59	Ga0070692_10001617	3300005345	Bacteria	8292
60	Ga0070692_10009211	3300005345	Bacteria	4441
61	Ga0070668_100001496	3300005347	Bacteria	16884
62	Ga0070668_100010237	3300005347	Bacteria	6957
63	Ga0070668_100077717	3300005347	Bacteria	2595
64	Ga0070668_100211477	3300005347	Bacteria	1596
65	Ga0070675_100003384	3300005354	Bacteria	12083
66	Ga0070675_100006320	3300005354	Bacteria	9095
67	Ga0070671_100241204	3300005355	Bacteria	1534
68	Ga0070671_100352126	3300005355	Bacteria	1257
69	Ga0070674_100011097	3300005356	Bacteria	5470
70	Ga0070674_100103342	3300005356	Bacteria	2080
71	Ga0070673_100129595	3300005364	Bacteria	2114
72	Ga0070659_100000851	3300005366	Bacteria	22256
73	Ga0070659_100019900	3300005366	Bacteria	5094
74	Ga0070659_100166391	3300005366	Bacteria	1804
75	Ga0070659_100364992	3300005366	Bacteria	1214
76	Ga0070659_100532681	3300005366	Bacteria	1004
77	Ga0070667_100030035	3300005367	Bacteria	4533
78	Ga0070667_100451382	3300005367	Bacteria	1175
79	Ga0070709_10064622	3300005434	Bacteria	2340
80	Ga0070714_100001437	3300005435	Bacteria	17329
81	Ga0070714_100009154	3300005435	Bacteria	7772
82	Ga0070714_100189745	3300005435	Bacteria	1875
83	Ga0070714_100218458	3300005435	Bacteria	1751
84	Ga0070714_100219792	3300005435	Bacteria	1745
85	Ga0070714_100630833	3300005435	Bacteria	1031
86	Ga0070713_100008012	3300005436	Bacteria	7467
87	Ga0070713_100032424	3300005436	Bacteria	4173
88	Ga0070713_100277108	3300005436	Bacteria	1538
89	Ga0070713_100401837	3300005436	Bacteria	1280
90	Ga0070710_10010214	3300005437	Bacteria	4607
91	Ga0070710_10069572	3300005437	Bacteria	2025
92	Ga0070700_100028989	3300005441	Bacteria	3297
93	Ga0070708_100443841	3300005445	Bacteria	1224
94	Ga0070663_100262056	3300005455	Bacteria	1371
95	Ga0070678_100016286	3300005456	Bacteria	4752
96	Ga0070678_100237295	3300005456	Bacteria	1523
97	Ga0070662_100019265	3300005457	Bacteria	4631
98	Ga0070681_10000165	3300005458	Bacteria	50320
99	Ga0070681_10026426	3300005458	Bacteria	5833
100	Ga0070681_10053790	3300005458	Bacteria	4011
101	Ga0070681_10109038	3300005458	Bacteria	2709
102	Ga0068867_100007096	3300005459	Bacteria	7917
103	Ga0070707_100038943	3300005468	Bacteria	4542
104	Ga0070707_100168168	3300005468	Bacteria	2137
105	Ga0070698_100003596	3300005471	Bacteria	17034
106	Ga0070698_100015209	3300005471	Bacteria	8136
107	Ga0070699_100332033	3300005518	Bacteria	1368
108	Ga0070679_100000350	3300005530	Bacteria	39216
109	Ga0070679_100003768	3300005530	Bacteria	13910
110	Ga0070679_100008566	3300005530	Bacteria	9636
111	Ga0070679_100108881	3300005530	Bacteria	2757
112	Ga0070679_100112031	3300005530	Bacteria	2714
113	Ga0070679_100118058	3300005530	Bacteria	2637
114	Ga0070679_100118956	3300005530	Bacteria	2627
115	Ga0070679_100175553	3300005530	Bacteria	2115
116	Ga0070684_100013088	3300005535	Bacteria	6677
117	Ga0070684_100043060	3300005535	Bacteria	3898
118	Ga0070684_100110080	3300005535	Bacteria	2469
119	Ga0070684_100487894	3300005535	Bacteria	1141
120	Ga0068853_100025739	3300005539	Bacteria	4938
121	Ga0068853_100481019	3300005539	Bacteria	1170
122	Ga0070672_100010916	3300005543	Bacteria	6320
123	Ga0070672_100040153	3300005543	Bacteria	3588
124	Ga0070686_100252855	3300005544	Bacteria	1288
125	Ga0070696_100071229	3300005546	Bacteria	2446
126	Ga0070696_100156087	3300005546	Bacteria	1679
127	Ga0070693_100106548	3300005547	Bacteria	1717
128	Ga0070665_100000522	3300005548	Bacteria	54684
129	Ga0070665_100027333	3300005548	Bacteria	5747
130	Ga0070665_100041870	3300005548	Bacteria	4604
131	Ga0070665_100066770	3300005548	Bacteria	3608
132	Ga0070665_100168930	3300005548	Bacteria	2189
133	Ga0070704_100219254	3300005549	Bacteria	1546
134	Ga0068855_100013737	3300005563	Bacteria	9760
135	Ga0068855_100017586	3300005563	Bacteria	8598
136	Ga0068855_100151727	3300005563	Bacteria	2634
137	Ga0068855_100483907	3300005563	Bacteria	1347
138	Ga0070664_100000503	3300005564	Bacteria	29613
139	Ga0070664_100063419	3300005564	Bacteria	3151
140	Ga0070664_100081088	3300005564	Bacteria	2796
141	Ga0070664_100172026	3300005564	Bacteria	1922
142	Ga0068857_100049843	3300005577	Bacteria	3715
143	Ga0068857_100068851	3300005577	Bacteria	3150
144	Ga0068857_100104913	3300005577	Bacteria	2538
145	Ga0068857_100121028	3300005577	Bacteria	2356
146	Ga0068857_100158133	3300005577	Bacteria	2055
147	Ga0068854_100001572	3300005578	Bacteria	13875
148	Ga0068856_100130124	3300005614	Bacteria	2521
149	Ga0068856_100175749	3300005614	Bacteria	2153
150	Ga0068856_100304655	3300005614	Bacteria	1611
151	Ga0068856_100672866	3300005614	Bacteria	1055
152	Ga0070702_100055420	3300005615	Bacteria	2286
153	Ga0068852_100003280	3300005616	Bacteria	11294
154	Ga0068852_100059469	3300005616	Bacteria	3314
155	Ga0068852_100179369	3300005616	Bacteria	1991
156	Ga0068852_100252324	3300005616	Bacteria	1690
157	Ga0068852_100350377	3300005616	Bacteria	1442
158	Ga0068859_100000219	3300005617	Bacteria	56772
159	Ga0068859_100248712	3300005617	Bacteria	1868
160	Ga0068864_100171036	3300005618	Bacteria	1981
161	Ga0068864_100201463	3300005618	Bacteria	1829
162	Ga0068864_100253463	3300005618	Bacteria	1635
163	Ga0068866_10029352	3300005718	Bacteria	2630
164	Ga0068866_10042279	3300005718	Bacteria	2267
165	Ga0068866_10129639	3300005718	Bacteria	1432
166	Ga0068861_100208031	3300005719	Bacteria	1646
167	Ga0068870_10047274	3300005840	Bacteria	2262
168	Ga0068863_100000326	3300005841	Bacteria	48264
169	Ga0068863_100043158	3300005841	Bacteria	4281
170	Ga0068863_100274132	3300005841	Bacteria	1633
171	Ga0068863_100277925	3300005841	Bacteria	1622
172	Ga0068863_100675259	3300005841	Bacteria	1026
173	Ga0068858_100000014	3300005842	Bacteria	214686
174	Ga0068858_100000021	3300005842	Bacteria	172933
175	Ga0068858_100052104	3300005842	Bacteria	3786
176	Ga0068858_100063462	3300005842	Bacteria	3418
177	Ga0068860_100427199	3300005843	Bacteria	1314
178	Ga0068862_100000106	3300005844	Bacteria	99778
179	Ga0068862_100012690	3300005844	Bacteria	6973
180	Ga0068862_100120004	3300005844	Bacteria	2317
181	Ga0068862_100123283	3300005844	Bacteria	2286
182	Ga0068862_100263286	3300005844	Bacteria	1575
183	Ga0081455_10000054	3300005937	Bacteria	121980
184	Ga0081455_10000174	3300005937	Bacteria	80174
185	Ga0081455_10028079	3300005937	Bacteria	5144
186	Ga0081455_10034592	3300005937	Bacteria	4526
187	Ga0081455_10156199	3300005937	Bacteria	1753
188	Ga0081538_10000016	3300005981	Bacteria	147022
189	Ga0081538_10020067	3300005981	Bacteria	4937
190	Ga0081540_1000270	3300005983	Bacteria	54211
191	Ga0081540_1001282	3300005983	Bacteria	21929
192	Ga0081540_1015910	3300005983	Bacteria	4740
193	Ga0081540_1051686	3300005983	Bacteria	2030
194	Ga0081539_10000895	3300005985	Bacteria	56919
195	Ga0081539_10001312	3300005985	Bacteria	43508
196	Ga0081539_10001535	3300005985	Bacteria	38621
197	Ga0081539_10003385	3300005985	Bacteria	19741
198	Ga0081539_10003678	3300005985	Bacteria	18372
199	Ga0081539_10026036	3300005985	Bacteria	3747
200	Ga0081539_10041701	3300005985	Bacteria	2680
201	Ga0081539_10087459	3300005985	Bacteria	1619
202	Ga0070717_10036917	3300006028	Bacteria	3965
203	Ga0070717_10104265	3300006028	Bacteria	2412
204	Ga0070717_10155318	3300006028	Bacteria	1982
205	Ga0070717_10171449	3300006028	Bacteria	1887
206	Ga0070717_10346707	3300006028	Bacteria	1327
207	Ga0075365_10026381	3300006038	Bacteria	3688
208	Ga0075365_10074979	3300006038	Bacteria	2282
209	Ga0075365_10105700	3300006038	Bacteria	1931
210	Ga0075365_10249054	3300006038	Bacteria	1248
211	Ga0075368_10000710	3300006042	Bacteria	10172
212	Ga0075363_100003958	3300006048	Bacteria	6400
213	Ga0075363_100004282	3300006048	Bacteria	6207
214	Ga0075363_100033964	3300006048	Bacteria	2661
215	Ga0075364_10010913	3300006051	Bacteria	5505
216	Ga0075364_10026128	3300006051	Bacteria	3722
217	Ga0075364_10079323	3300006051	Bacteria	2169
218	Ga0075364_10114018	3300006051	Bacteria	1806
219	Ga0075432_10001543	3300006058	Bacteria	7560
220	Ga0070716_100024579	3300006173	Bacteria	3207
221	Ga0070712_100014957	3300006175	Bacteria	4989
222	Ga0075367_10000437	3300006178	Bacteria	15467
223	Ga0075367_10016586	3300006178	Bacteria	4023
224	Ga0075367_10026488	3300006178	Bacteria	3289
225	Ga0075367_10066850	3300006178	Bacteria	2155
226	Ga0097621_100562870	3300006237	Bacteria	1039
227	Ga0075370_10013081	3300006353	Bacteria	4403
228	Ga0075370_10036163	3300006353	Bacteria	2773
229	Ga0075428_100003697	3300006844	Bacteria	16769
230	Ga0075428_100009074	3300006844	Bacteria	11037
231	Ga0075428_100013776	3300006844	Bacteria	9007
232	Ga0075428_100171371	3300006844	Bacteria	2352
233	Ga0075428_100268480	3300006844	Bacteria	1836
234	Ga0075428_100457702	3300006844	Bacteria	1366
235	Ga0075428_100727264	3300006844	Bacteria	1057
236	Ga0075430_100000563	3300006846	Bacteria	28139
237	Ga0075430_100002069	3300006846	Bacteria	16570
238	Ga0075430_100005254	3300006846	Bacteria	10919
239	Ga0075431_100000653	3300006847	Bacteria	29443
240	Ga0075431_100005257	3300006847	Bacteria	12750
241	Ga0075431_100181395	3300006847	Bacteria	2160
242	Ga0075431_100270941	3300006847	Bacteria	1720
243	Ga0075431_100407751	3300006847	Bacteria	1359
244	Ga0075431_100535396	3300006847	Bacteria	1160
245	Ga0075433_10151960	3300006852	Bacteria	2059
246	Ga0075434_100547877	3300006871	Bacteria	1176
247	Ga0075429_100000905	3300006880	Bacteria	23462
248	Ga0075429_100002232	3300006880	Bacteria	16193
249	Ga0075429_100002285	3300006880	Bacteria	16083
250	Ga0075429_100054527	3300006880	Bacteria	3477
251	Ga0075429_100352353	3300006880	Bacteria	1289
252	Ga0068865_100026105	3300006881	Bacteria	3849
253	Ga0068865_100030584	3300006881	Bacteria	3583
254	Ga0068865_100129774	3300006881	Bacteria	1887
255	Ga0068865_100131443	3300006881	Bacteria	1876
256	Ga0068865_100541281	3300006881	Bacteria	977
257	Ga0075436_100051016	3300006914	Bacteria	2855
258	Ga0075436_100240066	3300006914	Bacteria	1289
259	Ga0097620_100000219	3300006931	Bacteria	56772
260	Ga0097620_100023061	3300006931	Bacteria	6242
261	Ga0097620_100248751	3300006931	Bacteria	1868
262	Ga0105251_10052686	3300009011	Bacteria	1936
263	Ga0105244_10015543	3300009036	Bacteria	4362
264	Ga0105240_10027024	3300009093	Bacteria	7523
265	Ga0105240_10260576	3300009093	Bacteria	2000
266	Ga0105240_10319992	3300009093	Bacteria	1768
267	Ga0105240_10325643	3300009093	Bacteria	1750
268	Ga0111539_10025105	3300009094	Bacteria	7304
269	Ga0111539_10036997	3300009094	Bacteria	5898
270	Ga0111539_10164856	3300009094	Bacteria	2591
271	Ga0105245_10026455	3300009098	Bacteria	5106
272	Ga0105245_10260479	3300009098	Bacteria	1688
273	Ga0105247_10000178	3300009101	Bacteria	61996
274	Ga0105247_10001130	3300009101	Bacteria	19770
275	Ga0114129_10004238	3300009147	Bacteria	20253
276	Ga0114129_10004600	3300009147	Bacteria	19479
277	Ga0114129_10046862	3300009147	Bacteria	6075
278	Ga0114129_10051063	3300009147	Bacteria	5806
279	Ga0114129_10061917	3300009147	Bacteria	5229
280	Ga0114129_10090488	3300009147	Bacteria	4242
281	Ga0114129_10132506	3300009147	Bacteria	3422
282	Ga0114129_10202578	3300009147	Bacteria	2687
283	Ga0114129_10245819	3300009147	Bacteria	2404
284	Ga0114129_10271244	3300009147	Bacteria	2270
285	Ga0105243_10019058	3300009148	Bacteria	5202
286	Ga0105243_10048303	3300009148	Bacteria	3354
287	Ga0105243_10243718	3300009148	Bacteria	1601
288	Ga0105243_10372972	3300009148	Bacteria	1317
289	Ga0105241_10004353	3300009174	Bacteria	10469
290	Ga0105242_10015166	3300009176	Bacteria	5983
291	Ga0105248_10000018	3300009177	Bacteria	294894
292	Ga0105248_10001340	3300009177	Bacteria	27437
293	Ga0105248_10005986	3300009177	Bacteria	13352
294	Ga0105248_10042139	3300009177	Bacteria	5120
295	Ga0105248_10407856	3300009177	Bacteria	1530
296	Ga0105237_10057128	3300009545	Bacteria	3905
297	Ga0105237_10137298	3300009545	Bacteria	2439
298	Ga0105238_10040700	3300009551	Bacteria	4709
299	Ga0105238_10130262	3300009551	Bacteria	2494
300	Ga0105238_10188565	3300009551	Bacteria	2038
301	Ga0105238_10277603	3300009551	Bacteria	1656
302	Ga0105238_10412009	3300009551	Bacteria	1345
303	Ga0105249_10026776	3300009553	Bacteria	5200
304	Ga0105249_10042078	3300009553	Bacteria	4154
305	Ga0105249_10042483	3300009553	Bacteria	4135
306	Ga0105249_10282426	3300009553	Bacteria	1658
307	Ga0105239_10030750	3300010375	Bacteria	5905
308	Ga0105239_10061504	3300010375	Bacteria	4121
309	Ga0105239_10099924	3300010375	Bacteria	3208
310	Ga0105239_10143184	3300010375	Bacteria	2665
311	Ga0105239_10700539	3300010375	Bacteria	1158
312	Ga0105239_11092419	3300010375	Bacteria	918
313	Ga0105246_10008635	3300011119	Bacteria	6267
314	Ga0105246_10011505	3300011119	Bacteria	5492
315	Ga0105246_10024523	3300011119	Bacteria	3920
316	Ga0105246_10042492	3300011119	Bacteria	3079
317	Ga0105246_10388413	3300011119	Bacteria	1155
318	Ga0157373_10379516	3300013100	Bacteria	1011
319	Ga0157371_10088259	3300013102	Bacteria	2196
320	Ga0157370_10000875	3300013104	Bacteria	38190
321	Ga0157370_10004504	3300013104	Bacteria	15969
322	Ga0157369_10002851	3300013105	Bacteria	20653
323	Ga0157369_10008156	3300013105	Bacteria	12015
324	Ga0157369_10008751	3300013105	Bacteria	11593
325	Ga0157369_10026026	3300013105	Bacteria	6492
326	Ga0157369_10032317	3300013105	Bacteria	5757
327	Ga0157369_10060928	3300013105	Bacteria	4069
328	Ga0157369_10075678	3300013105	Bacteria	3609
329	Ga0157369_10101819	3300013105	Bacteria	3061
330	Ga0157369_10178056	3300013105	Bacteria	2238
331	Ga0157369_10209350	3300013105	Bacteria	2044
332	Ga0157369_10564802	3300013105	Bacteria	1175
333	Ga0157369_10773891	3300013105	Bacteria	987
334	Ga0157374_10061665	3300013296	Bacteria	3513
335	Ga0157374_10228136	3300013296	Bacteria	1829
336	Ga0157374_10553011	3300013296	Bacteria	1159
337	Ga0157378_10006006	3300013297	Bacteria	10637
338	Ga0163162_10039098	3300013306	Bacteria	4738
339	Ga0163162_10080325	3300013306	Bacteria	3328
340	Ga0163162_10331086	3300013306	Bacteria	1655
341	Ga0157372_10000022	3300013307	Bacteria	206038
342	Ga0157372_10057617	3300013307	Bacteria	4343
343	Ga0157372_10129667	3300013307	Bacteria	2900
344	Ga0157372_10191644	3300013307	Bacteria	2368
345	Ga0157372_10225311	3300013307	Bacteria	2173
346	Ga0157372_10385490	3300013307	Bacteria	1633
347	Ga0157375_10011867	3300013308	Bacteria	7708
348	Ga0157375_10037667	3300013308	Bacteria	4635
349	Ga0157375_10117296	3300013308	Bacteria	2767
350	Ga0157375_10144606	3300013308	Bacteria	2508
351	Ga0163163_10010243	3300014325	Bacteria	8419
352	Ga0163163_10021459	3300014325	Bacteria	6095
353	Ga0163163_10075978	3300014325	Bacteria	3353
354	Ga0163163_10106601	3300014325	Bacteria	2828
355	Ga0163163_10159988	3300014325	Bacteria	2297
356	Ga0163163_10163814	3300014325	Bacteria	2269
357	Ga0163163_10175938	3300014325	Bacteria	2187
358	Ga0163163_10194202	3300014325	Bacteria	2078
359	Ga0163163_10273772	3300014325	Bacteria	1739
360	Ga0163163_10581477	3300014325	Bacteria	1183
361	Ga0157380_10101988	3300014326	Bacteria	2392
362	Ga0157380_10581319	3300014326	Bacteria	1105
363	Ga0182008_10000469	3300014497	Bacteria	30895
364	Ga0157379_10000005	3300014968	Bacteria	172948
365	Ga0157379_10000548	3300014968	Bacteria	30342
366	Ga0157379_10045488	3300014968	Bacteria	3917
367	Ga0157379_10066551	3300014968	Bacteria	3221
368	Ga0157379_10245219	3300014968	Bacteria	1625
369	Ga0157379_10411355	3300014968	Bacteria	1245
370	Ga0157376_10043603	3300014969	Bacteria	3682
371	Ga0157376_10700459	3300014969	Bacteria	1018
372	Ga0182006_1017588	3300015261	Bacteria	3034
373	Ga0182007_10000272	3300015262	Bacteria	34359
374	Ga0183367_1010	3300015688	Bacteria	416164
375	Ga0163161_10115007	3300017792	Bacteria	2016
376	Ga0197907_10178223	3300020069	Bacteria	5466
377	Ga0197907_10180487	3300020069	Bacteria	3318
378	Ga0197907_10353420	3300020069	Bacteria	4756
379	Ga0197907_10358070	3300020069	Bacteria	1951
380	Ga0197907_10365046	3300020069	Bacteria	2775
381	Ga0197907_11390963	3300020069	Bacteria	1369
382	Ga0206356_10227963	3300020070	Bacteria	1860
383	Ga0206356_10259801	3300020070	Bacteria	2530
384	Ga0206356_10927010	3300020070	Bacteria	2519
385	Ga0206356_11227796	3300020070	Bacteria	1974
386	Ga0206356_11913027	3300020070	Bacteria	4173
387	Ga0206349_1503277	3300020075	Bacteria	1834
388	Ga0206349_1533574	3300020075	Bacteria	1684
389	Ga0206349_1880295	3300020075	Bacteria	2173
390	Ga0206349_1928857	3300020075	Bacteria	2319
391	Ga0206351_10074211	3300020077	Bacteria	2188
392	Ga0206351_10155792	3300020077	Bacteria	1868
393	Ga0206351_10824409	3300020077	Bacteria	1493
394	Ga0206352_10084809	3300020078	Bacteria	2003
395	Ga0206352_10135391	3300020078	Bacteria	1876
396	Ga0206352_10322057	3300020078	Bacteria	2041
397	Ga0206352_11047585	3300020078	Bacteria	3036
398	Ga0206350_10199153	3300020080	Bacteria	2364
399	Ga0206350_10284203	3300020080	Bacteria	1445
400	Ga0206350_10550104	3300020080	Bacteria	1818
401	Ga0206350_11421160	3300020080	Bacteria	2472
402	Ga0206350_11630717	3300020080	Bacteria	1800
403	Ga0206354_10169974	3300020081	Bacteria	3489
404	Ga0206354_10208976	3300020081	Bacteria	1153
405	Ga0206354_10515985	3300020081	Bacteria	3025
406	Ga0206354_10973233	3300020081	Bacteria	2503
407	Ga0206354_11004666	3300020081	Bacteria	1085
408	Ga0206354_11185805	3300020081	Bacteria	5874
409	Ga0206354_11403644	3300020081	Bacteria	1348
410	Ga0206354_11431865	3300020081	Bacteria	1736
411	Ga0206353_10312407	3300020082	Bacteria	3042
412	Ga0206353_10372181	3300020082	Bacteria	1600
413	Ga0206353_10896784	3300020082	Bacteria	4710
414	Ga0206353_10973797	3300020082	Bacteria	2320
415	Ga0206353_10997031	3300020082	Bacteria	2822
416	Ga0206353_11164031	3300020082	Bacteria	3420
417	Ga0206353_11535168	3300020082	Bacteria	952
418	Ga0206353_11908902	3300020082	Bacteria	1385
419	Ga0213876_10001518	3300021384	Bacteria	14361
420	Ga0213875_10000129	3300021388	Bacteria	83647
421	Ga0213875_10027890	3300021388	Bacteria	2686
422	Ga0224712_10000207	3300022467	Bacteria	10606
423	Ga0224712_10003635	3300022467	Bacteria	4042
424	Ga0224712_10004543	3300022467	Bacteria	3755
425	Ga0224712_10007467	3300022467	Bacteria	3186
426	Ga0224712_10063066	3300022467	Bacteria	1482
427	Ga0224712_10073693	3300022467	Bacteria	1393
428	Ga0224712_10078301	3300022467	Bacteria	1359
429	Ga0207425_1002748	3300025245	Bacteria	5984
430	Ga0209129_1000067	3300025258	Bacteria	219974
431	Ga0209025_1001150	3300025294	Bacteria	37667
432	Ga0209758_1003473	3300025297	Bacteria	14282
433	Ga0207426_1003780	3300025302	Bacteria	7860
434	Ga0207426_1007787	3300025302	Bacteria	4435
435	Ga0207655_1013450	3300025728	Bacteria	4698
436	Ga0207713_1043593	3300025735	Bacteria	1852
437	Ga0207692_10021744	3300025898	Bacteria	2939
438	Ga0207692_10033113	3300025898	Bacteria	2490
439	Ga0207642_10011825	3300025899	Bacteria	3129
440	Ga0207642_10017156	3300025899	Bacteria	2747
441	Ga0207710_10000035	3300025900	Bacteria	253729
442	Ga0207710_10000109	3300025900	Bacteria	104351
443	Ga0207688_10119007	3300025901	Bacteria	1540
444	Ga0207688_10128888	3300025901	Bacteria	1482
445	Ga0207680_10010557	3300025903	Bacteria	4625
446	Ga0207647_10066511	3300025904	Bacteria	2185
447	Ga0207685_10083550	3300025905	Bacteria	1327
448	Ga0207699_10197865	3300025906	Bacteria	1360
449	Ga0207645_10010252	3300025907	Bacteria	6439
450	Ga0207643_10127017	3300025908	Bacteria	1514
451	Ga0207705_10000566	3300025909	Bacteria	31021
452	Ga0207705_10001683	3300025909	Bacteria	17599
453	Ga0207705_10043144	3300025909	Bacteria	3239
454	Ga0207705_10049873	3300025909	Bacteria	3013
455	Ga0207705_10050550	3300025909	Bacteria	2993
456	Ga0207705_10141486	3300025909	Bacteria	1797
457	Ga0207705_10269669	3300025909	Bacteria	1301
458	Ga0207705_10280835	3300025909	Bacteria	1275
459	Ga0207684_10051479	3300025910	Bacteria	3494
460	Ga0207684_10164797	3300025910	Bacteria	1909
461	Ga0207654_10007091	3300025911	Bacteria	5648
462	Ga0207707_10000324	3300025912	Bacteria	50333
463	Ga0207707_10007997	3300025912	Bacteria	9185
464	Ga0207707_10042682	3300025912	Bacteria	3957
465	Ga0207707_10060544	3300025912	Bacteria	3293
466	Ga0207707_10449952	3300025912	Bacteria	1102
467	Ga0207695_10002775	3300025913	Bacteria	25490
468	Ga0207695_10028354	3300025913	Bacteria	6213
469	Ga0207695_10376307	3300025913	Bacteria	1306
470	Ga0207671_10000492	3300025914	Bacteria	53745
471	Ga0207671_10262182	3300025914	Bacteria	1360
472	Ga0207660_10016397	3300025917	Bacteria	4903
473	Ga0207660_10124163	3300025917	Bacteria	1959
474	Ga0207660_10164200	3300025917	Bacteria	1715
475	Ga0207660_10224860	3300025917	Bacteria	1474
476	Ga0207660_10254752	3300025917	Bacteria	1386
477	Ga0207660_10275030	3300025917	Bacteria	1335
478	Ga0207662_10160958	3300025918	Bacteria	1434
479	Ga0207657_10011227	3300025919	Bacteria	8902
480	Ga0207657_10038868	3300025919	Bacteria	4231
481	Ga0207657_10073107	3300025919	Bacteria	2899
482	Ga0207657_10122663	3300025919	Bacteria	2137
483	Ga0207657_10128940	3300025919	Bacteria	2075
484	Ga0207657_10152718	3300025919	Bacteria	1880
485	Ga0207649_10096843	3300025920	Bacteria	1945
486	Ga0207652_10000308	3300025921	Bacteria	50308
487	Ga0207652_10001488	3300025921	Bacteria	20709
488	Ga0207652_10044362	3300025921	Bacteria	3788
489	Ga0207652_10052928	3300025921	Bacteria	3486
490	Ga0207652_10072712	3300025921	Bacteria	2990
491	Ga0207652_10112865	3300025921	Bacteria	2412
492	Ga0207646_10073926	3300025922	Bacteria	3045
493	Ga0207646_10276518	3300025922	Bacteria	1517
494	Ga0207681_10096762	3300025923	Bacteria	2120
495	Ga0207681_10370374	3300025923	Bacteria	1151
496	Ga0207694_10003311	3300025924	Bacteria	12823
497	Ga0207694_10101152	3300025924	Bacteria	2284
498	Ga0207694_10210050	3300025924	Bacteria	1585
499	Ga0207694_10337867	3300025924	Bacteria	1245
500	Ga0207650_10036061	3300025925	Bacteria	3596
501	Ga0207659_10028765	3300025926	Bacteria	3779
502	Ga0207659_10113175	3300025926	Bacteria	2066
503	Ga0207687_10013342	3300025927	Bacteria	5365
504	Ga0207687_10070144	3300025927	Bacteria	2501
505	Ga0207687_10107163	3300025927	Bacteria	2067
506	Ga0207687_10364100	3300025927	Bacteria	1181
507	Ga0207700_10050886	3300025928	Bacteria	3089
508	Ga0207700_10164859	3300025928	Bacteria	1843
509	Ga0207700_10551035	3300025928	Bacteria	1024
510	Ga0207664_10000986	3300025929	Bacteria	19093
511	Ga0207664_10004553	3300025929	Bacteria	9397
512	Ga0207664_10020080	3300025929	Bacteria	4946
513	Ga0207664_10140603	3300025929	Bacteria	2042
514	Ga0207664_10165613	3300025929	Bacteria	1888
515	Ga0207664_10169828	3300025929	Bacteria	1866
516	Ga0207664_10185397	3300025929	Bacteria	1789
517	Ga0207664_10397339	3300025929	Bacteria	1226
518	Ga0207644_10511065	3300025931	Bacteria	992
519	Ga0207690_10000357	3300025932	Bacteria	30373
520	Ga0207690_10011598	3300025932	Bacteria	5266
521	Ga0207690_10025349	3300025932	Bacteria	3722
522	Ga0207690_10048998	3300025932	Bacteria	2813
523	Ga0207706_10028805	3300025933	Bacteria	4958
524	Ga0207709_10010199	3300025935	Bacteria	5174
525	Ga0207709_10062550	3300025935	Bacteria	2330
526	Ga0207709_10141400	3300025935	Bacteria	1655
527	Ga0207704_10013357	3300025938	Bacteria	4106
528	Ga0207704_10172618	3300025938	Bacteria	1553
529	Ga0207704_10388448	3300025938	Bacteria	1098
530	Ga0207665_10059811	3300025939	Bacteria	2579
531	Ga0207691_10000197	3300025940	Bacteria	57903
532	Ga0207691_10014193	3300025940	Bacteria	7601
533	Ga0207691_10386575	3300025940	Bacteria	1194
534	Ga0207711_10000240	3300025941	Bacteria	58554
535	Ga0207711_10000976	3300025941	Bacteria	27399
536	Ga0207711_10003513	3300025941	Bacteria	13565
537	Ga0207711_10346196	3300025941	Bacteria	1376
538	Ga0207689_10022400	3300025942	Bacteria	5313
539	Ga0207689_10212967	3300025942	Bacteria	1596
540	Ga0207661_10000844	3300025944	Bacteria	20079
541	Ga0207661_10006613	3300025944	Bacteria	8192
542	Ga0207661_10018582	3300025944	Bacteria	5166
543	Ga0207661_10035086	3300025944	Bacteria	3906
544	Ga0207661_10056643	3300025944	Bacteria	3147
545	Ga0207661_10077538	3300025944	Bacteria	2733
546	Ga0207661_10287728	3300025944	Bacteria	1470
547	Ga0207661_10590899	3300025944	Bacteria	1019
548	Ga0207679_10019490	3300025945	Bacteria	4558
549	Ga0207679_10025033	3300025945	Bacteria	4100
550	Ga0207679_10610576	3300025945	Bacteria	984
551	Ga0207667_10020621	3300025949	Bacteria	7325
552	Ga0207667_10064105	3300025949	Bacteria	3838
553	Ga0207667_10244272	3300025949	Bacteria	1837
554	Ga0207667_10251437	3300025949	Bacteria	1808
555	Ga0207667_10266449	3300025949	Bacteria	1752
556	Ga0207667_10494725	3300025949	Bacteria	1241
557	Ga0207651_10050953	3300025960	Bacteria	2815
558	Ga0207712_10035098	3300025961	Bacteria	3404
559	Ga0207712_10047412	3300025961	Bacteria	2983
560	Ga0207712_10320436	3300025961	Bacteria	1279
561	Ga0207712_10414315	3300025961	Bacteria	1135
562	Ga0207668_10005290	3300025972	Bacteria	7594
563	Ga0207668_10018474	3300025972	Bacteria	4388
564	Ga0207668_10082304	3300025972	Bacteria	2338
565	Ga0207668_10328299	3300025972	Bacteria	1272
566	Ga0207640_10016160	3300025981	Bacteria	4335
567	Ga0207658_10095179	3300025986	Bacteria	2320
568	Ga0207658_10139232	3300025986	Bacteria	1961
569	Ga0207677_10002872	3300026023	Bacteria	9088
570	Ga0207677_10060891	3300026023	Bacteria	2612
571	Ga0207677_10099061	3300026023	Bacteria	2139
572	Ga0207677_10100073	3300026023	Bacteria	2131
573	Ga0207677_10337950	3300026023	Bacteria	1257
574	Ga0207677_10345156	3300026023	Bacteria	1245
575	Ga0207703_10000001	3300026035	Bacteria	822925
576	Ga0207703_10000005	3300026035	Bacteria	506356
577	Ga0207703_10047822	3300026035	Bacteria	3450
578	Ga0207703_10222534	3300026035	Bacteria	1688
579	Ga0207639_10049534	3300026041	Bacteria	3186
580	Ga0207639_10050540	3300026041	Bacteria	3158
581	Ga0207678_10000220	3300026067	Bacteria	50961
582	Ga0207678_10006294	3300026067	Bacteria	10543
583	Ga0207678_10119406	3300026067	Bacteria	2250
584	Ga0207708_10001305	3300026075	Bacteria	18769
585	Ga0207708_10028997	3300026075	Bacteria	4192
586	Ga0207708_10057739	3300026075	Bacteria	2961
587	Ga0207708_10143291	3300026075	Bacteria	1876
588	Ga0207702_10085179	3300026078	Bacteria	2753
589	Ga0207702_10121776	3300026078	Bacteria	2336
590	Ga0207702_10167651	3300026078	Bacteria	2011
591	Ga0207702_10321469	3300026078	Bacteria	1474
592	Ga0207702_10601227	3300026078	Bacteria	1079
593	Ga0207702_10606629	3300026078	Bacteria	1074
594	Ga0207641_10016239	3300026088	Bacteria	6097
595	Ga0207641_10404852	3300026088	Bacteria	1311
596	Ga0207648_10033415	3300026089	Bacteria	4537
597	Ga0207648_10101962	3300026089	Bacteria	2515
598	Ga0207648_10288791	3300026089	Bacteria	1468
599	Ga0207676_10290988	3300026095	Bacteria	1487
600	Ga0207676_10307815	3300026095	Bacteria	1449
601	Ga0207676_10325163	3300026095	Bacteria	1413
602	Ga0207676_10465662	3300026095	Bacteria	1194
603	Ga0207674_10025323	3300026116	Bacteria	6330
604	Ga0207674_10049442	3300026116	Bacteria	4300
605	Ga0207674_10051121	3300026116	Bacteria	4218
606	Ga0207674_10159506	3300026116	Bacteria	2210
607	Ga0207674_10200147	3300026116	Bacteria	1947
608	Ga0207674_10220224	3300026116	Bacteria	1846
609	Ga0207675_100041354	3300026118	Bacteria	4305
610	Ga0207675_100063254	3300026118	Bacteria	3457
611	Ga0207675_100216507	3300026118	Bacteria	1844
612	Ga0207683_10031377	3300026121	Bacteria	4611
613	Ga0207683_10206801	3300026121	Bacteria	1785
614	Ga0207683_10251984	3300026121	Bacteria	1611
615	Ga0207683_10508241	3300026121	Bacteria	1113
616	Ga0207698_10024639	3300026142	Bacteria	4227
617	Ga0207698_10094654	3300026142	Bacteria	2456
618	Ga0207698_10099992	3300026142	Bacteria	2401
619	Ga0209813_10001624	3300027866	Bacteria	5057
620	Ga0209813_10007060	3300027866	Bacteria	2789
621	Ga0207428_10002817	3300027907	Bacteria	17273
622	Ga0207428_10005610	3300027907	Bacteria	11667
623	Ga0207428_10055861	3300027907	Bacteria	3138
624	Ga0207428_10057782	3300027907	Bacteria	3079
625	Ga0207428_10187158	3300027907	Bacteria	1562
626	Ga0207428_10188664	3300027907	Bacteria	1555
627	Ga0268266_10001311	3300028379	Bacteria	30195
628	Ga0268266_10017119	3300028379	Bacteria	6190
629	Ga0268266_10049402	3300028379	Bacteria	3608
630	Ga0268266_10140630	3300028379	Bacteria	2166
631	Ga0268266_10257943	3300028379	Bacteria	1615
632	Ga0268265_10000008	3300028380	Bacteria	417328
633	Ga0268265_10040402	3300028380	Bacteria	3445
634	Ga0268265_10102727	3300028380	Bacteria	2313
635	Ga0268265_10103230	3300028380	Bacteria	2308
636	Ga0268264_10000320	3300028381	Bacteria	75931
637	Ga0265334_10025018	3300028573	Bacteria	2419
638	Ga0307517_10014852	3300028786	Bacteria	10412
639	Ga0307515_10000526	3300028794	Bacteria	91263
640	Ga0307515_10049346	3300028794	Bacteria	6336
641	Ga0307515_10052077	3300028794	Bacteria	6082
642	Ga0307515_10188910	3300028794	Bacteria	1978
643	Ga0265338_10102739	3300028800	Bacteria	2324
644	Ga0268256_1028373	3300030500	Bacteria	1383
645	Ga0307511_10001036	3300030521	Bacteria	29519
646	Ga0307511_10012825	3300030521	Bacteria	8203
647	Ga0307511_10028133	3300030521	Bacteria	5112
648	Ga0307511_10037099	3300030521	Bacteria	4218
649	Ga0307511_10073703	3300030521	Bacteria	2467
650	Ga0307511_10089554	3300030521	Bacteria	2096
651	Ga0307511_10133687	3300030521	Bacteria	1484
652	Ga0307512_10013870	3300030522	Bacteria	7529
653	Ga0307512_10018636	3300030522	Bacteria	6338
654	Ga0307512_10038202	3300030522	Bacteria	4043
655	Ga0307512_10049284	3300030522	Bacteria	3398
656	Ga0307512_10149662	3300030522	Bacteria	1401
657	Ga0316176_1099645	3300030732	Bacteria	2252
658	Ga0316176_1195156	3300030732	Bacteria	2555
659	Ga0314311_1209599	3300030733	Bacteria	3101
660	Ga0316183_1156084	3300030742	Bacteria	1430
661	Ga0316181_1007646	3300030744	Bacteria	1173
662	Ga0316181_1038614	3300030744	Bacteria	3539
663	Ga0265767_101273	3300030836	Bacteria	1213
664	Ga0265777_101586	3300030877	Bacteria	1235
665	Ga0265328_10019656	3300031239	Bacteria	2592
666	Ga0265325_10106819	3300031241	Bacteria	1364
667	Ga0265325_10107992	3300031241	Bacteria	1355
668	Ga0265340_10005901	3300031247	Bacteria	6770
669	Ga0265340_10034334	3300031247	Bacteria	2523
670	Ga0307513_10000005	3300031456	Bacteria	553227
671	Ga0307513_10004909	3300031456	Bacteria	17759
672	Ga0307513_10020118	3300031456	Bacteria	7921
673	Ga0307513_10023650	3300031456	Bacteria	7173
674	Ga0307513_10032752	3300031456	Bacteria	5855
675	Ga0307513_10060423	3300031456	Bacteria	4018
676	Ga0307513_10074276	3300031456	Bacteria	3536
677	Ga0307513_10225709	3300031456	Bacteria	1690
678	Ga0307509_10010346	3300031507	Bacteria	11455
679	Ga0307509_10033543	3300031507	Bacteria	5650
680	Ga0307509_10171486	3300031507	Bacteria	2048
681	Ga0307509_10310406	3300031507	Bacteria	1320
682	Ga0307408_100011496	3300031548	Bacteria	5847
683	Ga0307408_100017973	3300031548	Bacteria	4742
684	Ga0307408_100036058	3300031548	Bacteria	3474
685	Ga0307408_100047443	3300031548	Bacteria	3076
686	Ga0307408_100070907	3300031548	Bacteria	2574
687	Ga0307408_100106862	3300031548	Bacteria	2142
688	Ga0307408_100166454	3300031548	Bacteria	1756
689	Ga0307408_100183608	3300031548	Bacteria	1679
690	Ga0265313_10038256	3300031595	Bacteria	2391
691	Ga0265313_10044614	3300031595	Bacteria	2163
692	Ga0310103_105103	3300031614	Bacteria	1725
693	Ga0307508_10004108	3300031616	Bacteria	14353
694	Ga0307508_10023752	3300031616	Bacteria	5567
695	Ga0307508_10027175	3300031616	Bacteria	5184
696	Ga0307508_10035747	3300031616	Bacteria	4477
697	Ga0307508_10173209	3300031616	Bacteria	1761
698	Ga0307514_10059386	3300031649	Bacteria	2922
699	Ga0307514_10083498	3300031649	Bacteria	2353
700	Ga0307514_10201336	3300031649	Bacteria	1251
701	Ga0316575_10023585	3300031665	Bacteria	2379
702	Ga0316579_10000517	3300031691	Bacteria	12658
703	Ga0316579_10007179	3300031691	Bacteria	4588
704	Ga0265314_10016200	3300031711	Bacteria	5900
705	Ga0265342_10053973	3300031712	Bacteria	2390
706	Ga0316576_10018850	3300031727	Bacteria	4719
707	Ga0316576_10075482	3300031727	Bacteria	2494
708	Ga0316576_10102483	3300031727	Bacteria	2140
709	Ga0316578_10087169	3300031728	Bacteria	1861
710	Ga0307516_10000947	3300031730	Bacteria	40032
711	Ga0307516_10008573	3300031730	Bacteria	11542
712	Ga0307516_10022988	3300031730	Bacteria	6397
713	Ga0307516_10030823	3300031730	Bacteria	5409
714	Ga0307516_10031561	3300031730	Bacteria	5340
715	Ga0307516_10090276	3300031730	Bacteria	2893
716	Ga0307516_10202777	3300031730	Bacteria	1702
717	Ga0307516_10295257	3300031730	Bacteria	1298
718	Ga0307405_10007813	3300031731	Bacteria	5382
719	Ga0307405_10011554	3300031731	Bacteria	4636
720	Ga0307405_10145634	3300031731	Bacteria	1659
721	Ga0307405_10213212	3300031731	Bacteria	1411
722	Ga0307405_10597067	3300031731	Bacteria	900
723	Ga0316577_10013102	3300031733	Bacteria	4526
724	Ga0307413_10006600	3300031824	Bacteria	5317
725	Ga0307413_10042666	3300031824	Bacteria	2667
726	Ga0307413_10050477	3300031824	Bacteria	2500
727	Ga0307413_10053800	3300031824	Bacteria	2439
728	Ga0307413_10063621	3300031824	Bacteria	2288
729	Ga0307413_10067921	3300031824	Bacteria	2231
730	Ga0307413_10137039	3300031824	Bacteria	1685
731	Ga0307413_10141287	3300031824	Bacteria	1664
732	Ga0307413_10176420	3300031824	Bacteria	1519
733	Ga0307413_10284940	3300031824	Bacteria	1245
734	Ga0307413_10427511	3300031824	Bacteria	1045
735	Ga0307518_10001750	3300031838	Bacteria	16032
736	Ga0307518_10006455	3300031838	Bacteria	8408
737	Ga0307518_10073878	3300031838	Bacteria	2467
738	Ga0307518_10116972	3300031838	Bacteria	1892
739	Ga0307410_10001470	3300031852	Bacteria	10655
740	Ga0307410_10007099	3300031852	Bacteria	6108
741	Ga0307410_10008427	3300031852	Bacteria	5714
742	Ga0307410_10013557	3300031852	Bacteria	4761
743	Ga0307410_10035438	3300031852	Bacteria	3241
744	Ga0307410_10052402	3300031852	Bacteria	2756
745	Ga0307410_10057795	3300031852	Bacteria	2642
746	Ga0307410_10066120	3300031852	Bacteria	2489
747	Ga0307410_10309046	3300031852	Bacteria	1250
748	Ga0326468_10000304	3300031889	Bacteria	5202
749	Ga0326468_10004175	3300031889	Bacteria	1252
750	Ga0307406_10004776	3300031901	Bacteria	7382
751	Ga0307406_10037392	3300031901	Bacteria	2998
752	Ga0307406_10091695	3300031901	Bacteria	2047
753	Ga0307406_10093272	3300031901	Bacteria	2032
754	Ga0307406_10221090	3300031901	Bacteria	1408
755	Ga0307406_10348769	3300031901	Bacteria	1156
756	Ga0307406_10558092	3300031901	Bacteria	938
757	Ga0307407_10009801	3300031903	Bacteria	4482
758	Ga0307407_10010022	3300031903	Bacteria	4447
759	Ga0307407_10014243	3300031903	Bacteria	3888
760	Ga0307407_10047932	3300031903	Bacteria	2428
761	Ga0307407_10109211	3300031903	Bacteria	1733
762	Ga0307407_10119931	3300031903	Bacteria	1666
763	Ga0307407_10295168	3300031903	Bacteria	1128
764	Ga0307407_10468608	3300031903	Bacteria	918
765	Ga0307412_10009929	3300031911	Bacteria	5475
766	Ga0307412_10019857	3300031911	Bacteria	4079
767	Ga0307412_10020020	3300031911	Bacteria	4064
768	Ga0307412_10029789	3300031911	Bacteria	3428
769	Ga0307412_10046813	3300031911	Bacteria	2836
770	Ga0307412_10056301	3300031911	Bacteria	2620
771	Ga0307412_10064770	3300031911	Bacteria	2470
772	Ga0307412_10070214	3300031911	Bacteria	2387
773	Ga0307412_10092360	3300031911	Bacteria	2121
774	Ga0307412_10098323	3300031911	Bacteria	2064
775	Ga0307412_10103140	3300031911	Bacteria	2021
776	Ga0307412_10125100	3300031911	Bacteria	1858
777	Ga0307412_10171441	3300031911	Bacteria	1623
778	Ga0307412_10354234	3300031911	Bacteria	1179
779	Ga0307409_100000394	3300031995	Bacteria	18541
780	Ga0307409_100003253	3300031995	Bacteria	8764
781	Ga0307409_100005085	3300031995	Bacteria	7501
782	Ga0307409_100014305	3300031995	Bacteria	5154
783	Ga0307409_100064476	3300031995	Bacteria	2878
784	Ga0307409_100093910	3300031995	Bacteria	2466
785	Ga0307409_100114288	3300031995	Bacteria	2271
786	Ga0307409_100164064	3300031995	Bacteria	1947
787	Ga0307409_100180235	3300031995	Bacteria	1869
788	Ga0307409_100263648	3300031995	Bacteria	1583
789	Ga0307409_100284931	3300031995	Bacteria	1529
790	Ga0307409_100447147	3300031995	Bacteria	1246
791	Ga0307416_100003533	3300032002	Bacteria	9211
792	Ga0307416_100007799	3300032002	Bacteria	6841
793	Ga0307416_100012983	3300032002	Bacteria	5641
794	Ga0307416_100013856	3300032002	Bacteria	5497
795	Ga0307416_100017383	3300032002	Bacteria	5032
796	Ga0307416_100021316	3300032002	Bacteria	4649
797	Ga0307416_100023109	3300032002	Bacteria	4505
798	Ga0307416_100039970	3300032002	Bacteria	3637
799	Ga0307416_100059261	3300032002	Bacteria	3110
800	Ga0307416_100070841	3300032002	Bacteria	2893
801	Ga0307416_100139647	3300032002	Bacteria	2199
802	Ga0307416_100227497	3300032002	Bacteria	1795
803	Ga0307416_100280323	3300032002	Bacteria	1643
804	Ga0307416_100340967	3300032002	Bacteria	1511
805	Ga0307416_100383266	3300032002	Bacteria	1437
806	Ga0307416_100507591	3300032002	Bacteria	1271
807	Ga0307416_100689769	3300032002	Bacteria	1109
808	Ga0307416_100818743	3300032002	Bacteria	1028
809	Ga0307414_10014562	3300032004	Bacteria	4721
810	Ga0307414_10037719	3300032004	Bacteria	3239
811	Ga0307414_10228083	3300032004	Bacteria	1534
812	Ga0307414_10228956	3300032004	Bacteria	1531
813	Ga0307414_10289273	3300032004	Bacteria	1381
814	Ga0307414_10463477	3300032004	Bacteria	1114
815	Ga0307411_10000900	3300032005	Bacteria	11260
816	Ga0307411_10036356	3300032005	Bacteria	3085
817	Ga0307411_10040060	3300032005	Bacteria	2969
818	Ga0307411_10043612	3300032005	Bacteria	2871
819	Ga0307411_10264974	3300032005	Bacteria	1359
820	Ga0307411_10268148	3300032005	Bacteria	1352
821	Ga0307411_10317285	3300032005	Bacteria	1257
822	Ga0307415_100000418	3300032126	Bacteria	18196
823	Ga0307415_100002687	3300032126	Bacteria	8881
824	Ga0307415_100010522	3300032126	Bacteria	5244
825	Ga0307415_100028238	3300032126	Bacteria	3566
826	Ga0307415_100047054	3300032126	Bacteria	2902
827	Ga0307415_100079874	3300032126	Bacteria	2332
828	Ga0307415_100082340	3300032126	Bacteria	2302
829	Ga0307415_100127888	3300032126	Bacteria	1918
830	Ga0307415_100134018	3300032126	Bacteria	1880
831	Ga0307415_100209027	3300032126	Bacteria	1555
832	Ga0307415_100237398	3300032126	Bacteria	1472
833	Ga0307415_100239874	3300032126	Bacteria	1466
834	Ga0307415_100353429	3300032126	Bacteria	1238
835	Ga0307415_100431773	3300032126	Bacteria	1133
836	Ga0316580_10000435	3300032139	Bacteria	9538
837	Ga0307507_10000081	3300033179	Bacteria	148079
838	Ga0307507_10043419	3300033179	Bacteria	4461
839	Ga0307507_10101532	3300033179	Bacteria	2404
840	Ga0307507_10104686	3300033179	Bacteria	2347
841	Ga0307510_10030880	3300033180	Bacteria	6065
842	Ga0307510_10045416	3300033180	Bacteria	4743
843	Ga0307510_10090016	3300033180	Bacteria	2918
844	Ga0307510_10129047	3300033180	Bacteria	2208
845	Ga0307510_10143279	3300033180	Bacteria	2028
846	Ga0373938_0003486	3300034957	Bacteria	2581
847	Ga0373926_0048372	3300035083	Bacteria	1529
848	Ga0373934_0000020	3300035086	Bacteria	54608
849	Ga0373934_0011863	3300035086	Bacteria	3284
850	Ga0373951_0000015	3300035091	Bacteria	69872
851	Ga0373923_0000682	3300035111	Bacteria	8632
852	Ga0373923_0128679	3300035111	Bacteria	1136
853	Ga0373953_0000511	3300035117	Bacteria	10796
854	Ga0373953_0013800	3300035117	Bacteria	2892
855	Ga0373954_0007499	3300035118	Bacteria	4773
856	Ga0373954_0036073	3300035118	Bacteria	2294
857	Ga0373956_0000343	3300035119	Bacteria	18786
858	Ga0373956_0079700	3300035119	Bacteria	1501
859	Ga0373957_0000053	3300035120	Bacteria	29105
860	Ga0373957_0009772	3300035120	Bacteria	3147
861	Ga0373955_0000192	3300035172	Bacteria	25125
862	Ga0373955_0034352	3300035172	Bacteria	2677
863	Ga0373942_0000111	3300035207	Bacteria	18723
864	Ga0373962_0005136	3300035242	Bacteria	3163
865	Ga0316574_0001081	3300035398	Bacteria	12449
866	Ga0316574_0028215	3300035398	Bacteria	3384
867	Ga0373924_0008311	3300035410	Bacteria	3767
868	Ga0373924_0032740	3300035410	Bacteria	2095
869	Ga0373935_0000390	3300035692	Bacteria	22602
870	Ga0373935_0004209	3300035692	Bacteria	8432
871	Ga0373935_0200858	3300035692	Bacteria	1377
872	Ga0373927_0300718	3300035695	Bacteria	1056
873	Ga0373933_0000024	3300035724	Bacteria	93753
874	Ga0373947_0000001	3300035725	Bacteria	510932
875	Ga0373937_0000029	3300036401	Bacteria	123547
876	Ga0373937_0086609	3300036401	Bacteria	2898
877	Ga0265778_004304	3300036457	Bacteria	1468
878	Ga0316582_0004544	3300036647	Bacteria	7024
879	Ga0373925_0285509	3300037068	Bacteria	1330
880	Ga0395899_0008630	3300037312	Bacteria	7840
881	Ga0395899_0014599	3300037312	Bacteria	5994
882	Ga0395899_0174166	3300037312	Bacteria	1514
883	Ga0395899_0300690	3300037312	Bacteria	1086
884	Ga0395900_0016656	3300037418	Bacteria	7497
885	Ga0395900_0029730	3300037418	Bacteria	5607
886	Ga0395900_0088456	3300037418	Bacteria	3184
887	Ga0395900_0090663	3300037418	Bacteria	3142
888	Ga0395900_0145529	3300037418	Bacteria	2423
889	Ga0395900_0156565	3300037418	Bacteria	2327
890	Ga0395898_0007197	3300037466	Bacteria	11812
891	Ga0395898_0007813	3300037466	Bacteria	11355
892	Ga0395898_0018877	3300037466	Bacteria	7026
893	Ga0395898_0030595	3300037466	Bacteria	5386
894	Ga0395898_0051702	3300037466	Bacteria	4017
895	Ga0395898_0090963	3300037466	Bacteria	2936
896	Ga0395898_0105863	3300037466	Bacteria	2697
897	Ga0395898_0174687	3300037466	Bacteria	2053
898	Ga0395898_0268549	3300037466	Bacteria	1627
899	Ga0395898_0328137	3300037466	Bacteria	1459
900	Ga0395898_0338596	3300037466	Bacteria	1435
901	Ga0395898_0423520	3300037466	Bacteria	1268
902	Ga0395905_0037423	3300037471	Bacteria	4555
903	Ga0395905_0122240	3300037471	Bacteria	2448
904	Ga0395905_0305478	3300037471	Bacteria	1479
905	Ga0316581_0046488	3300037588	Bacteria	1327
906	Ga0436364_0187669	3300037853	Bacteria	5769
907	Ga0436364_0271152	3300037853	Bacteria	65396
908	Ga0436364_0703567	3300037853	Bacteria	11840
909	Ga0436364_1031667	3300037853	Bacteria	2099
910	Ga0436364_1142319	3300037853	Bacteria	112398
911	Ga0395901_0021270	3300038443	Bacteria	6644
912	Ga0395901_0026900	3300038443	Bacteria	5906
913	Ga0395901_0029836	3300038443	Bacteria	5616
914	Ga0395901_0039390	3300038443	Bacteria	4890
915	Ga0395901_0099429	3300038443	Bacteria	3050
916	Ga0395901_0100791	3300038443	Bacteria	3030
917	Ga0395901_0128704	3300038443	Bacteria	2661
918	Ga0395901_0192534	3300038443	Bacteria	2138
919	Ga0395901_0328740	3300038443	Bacteria	1581
920	Ga0395901_0584686	3300038443	Bacteria	1128
921	Ga0400485_12668	3300038735	Bacteria	25450
922	Ga0400486_19783	3300038742	Bacteria	43066
923	Ga0436365_0205930	3300039437	Bacteria	55519
924	Ga0436363_0097891	3300039450	Bacteria	1545
925	Ga0436363_1120548	3300039450	Bacteria	1147
926	Ga0436362_0336459	3300039453	Bacteria	994
927	Ga0439436_0007450	3300041404	Bacteria	3367
928	Ga0439436_0010450	3300041404	Bacteria	2831
929	Ga0439436_0047557	3300041404	Bacteria	1217
930	Ga0439438_007076	3300041405	Bacteria	3876
931	Ga0439438_020174	3300041405	Bacteria	1874
932	Ga0439438_026310	3300041405	Bacteria	1578
933	Ga0439439_0000031	3300041406	Bacteria	18303
934	Ga0439439_0004207	3300041406	Bacteria	3227
935	Ga0439439_0012446	3300041406	Bacteria	2057
936	Ga0439447_009854	3300041407	Bacteria	2870
937	Ga0439447_024706	3300041407	Bacteria	1554
938	Ga0439461_0002599	3300041410	Bacteria	2906
939	Ga0439466_0002280	3300041411	Bacteria	7523
940	Ga0439465_0049835	3300041413	Bacteria	1369
941	Ga0451791_0115779	3300041451	Bacteria	1687
942	Ga0451797_0145845	3300041453	Bacteria	4419
943	Ga0451802_1056664	3300041460	Bacteria	1807
944	Ga0451802_1425841	3300041460	Bacteria	838
945	Ga0451837_0252531	3300041494	Bacteria	2981
946	Ga0451837_0668465	3300041494	Bacteria	1911
947	Ga0451837_1526648	3300041494	Bacteria	1347
948	Ga0451839_1129246	3300041496	Bacteria	3231
949	Ga0451841_0838973	3300041498	Bacteria	964
950	Ga0451853_0097575	3300041512	Bacteria	4232
951	Ga0439431_0001715	3300041997	Bacteria	4824
952	Ga0439433_0000116	3300041999	Bacteria	11449
953	Ga0439433_0037618	3300041999	Bacteria	1120
954	Ga0439442_000007	3300042002	Bacteria	57689
955	Ga0439442_000013	3300042002	Bacteria	48856
956	Ga0439442_005726	3300042002	Bacteria	2489
957	Ga0439442_012818	3300042002	Bacteria	1716
958	Ga0439442_022417	3300042002	Bacteria	1310
959	Ga0439442_033218	3300042002	Bacteria	1078
960	Ga0439445_0010181	3300042004	Bacteria	2223
961	Ga0439445_0028381	3300042004	Bacteria	1442
962	Ga0439432_000214	3300042006	Bacteria	20720
963	Ga0439449_0002467	3300042007	Bacteria	7229
964	Ga0439449_0013094	3300042007	Bacteria	3120
965	Ga0439449_0068274	3300042007	Bacteria	1310
966	Ga0439449_0092995	3300042007	Bacteria	1113
967	Ga0439452_005946	3300042010	Bacteria	3866
968	Ga0439457_000801	3300042014	Bacteria	9385
969	Ga0439457_001420	3300042014	Bacteria	7200
970	Ga0439457_003242	3300042014	Bacteria	4469
971	Ga0439457_011937	3300042014	Bacteria	1964
972	Ga0439457_018679	3300042014	Bacteria	1540
973	Ga0450920_000392	3300042122	Bacteria	6836
974	Ga0450920_001761	3300042122	Bacteria	3629
975	Ga0450923_057005	3300042125	Bacteria	847
976	Ga0450900_023100	3300042136	Bacteria	877
977	Ga0450906_003507	3300042145	Bacteria	3371
978	Ga0450906_019958	3300042145	Bacteria	1200
979	Ga0450907_000059	3300042146	Bacteria	43871
980	Ga0450907_007309	3300042146	Bacteria	1846
981	Ga0450907_016484	3300042146	Bacteria	1233
982	Ga0439446_0001523	3300042156	Bacteria	5316
983	Ga0439434_0000080	3300042435	Bacteria	24363
984	Ga0450918_000243	3300042531	Bacteria	12451
985	Ga0450918_004368	3300042531	Bacteria	2579
986	Ga0466969_0002812	3300044656	Bacteria	9298
987	Ga0466969_0016026	3300044656	Bacteria	3927
988	Ga0466972_0002080	3300044658	Bacteria	9801
989	Ga0466972_0004074	3300044658	Bacteria	7297
990	Ga0466972_0005439	3300044658	Bacteria	6380
991	Ga0466972_0005869	3300044658	Bacteria	6157
992	Ga0466972_0014500	3300044658	Bacteria	3947
993	Ga0466972_0033382	3300044658	Bacteria	2524
994	Ga0466972_0044714	3300044658	Bacteria	2147
995	Ga0466972_0067431	3300044658	Bacteria	1709
996	Ga0466972_0074262	3300044658	Bacteria	1620
997	Ga0466972_0084392	3300044658	Bacteria	1510
998	Ga0466972_0098476	3300044658	Bacteria	1385
999	Ga0466972_0120854	3300044658	Bacteria	1235
1000	Ga0466972_0164998	3300044658	Bacteria	1040
1001	Ga0466965_0001805	3300044683	Bacteria	8875
1002	Ga0466965_0004028	3300044683	Bacteria	6515
1003	Ga0466965_0008652	3300044683	Bacteria	4710
1004	Ga0466965_0012601	3300044683	Bacteria	3980
1005	Ga0466965_0018739	3300044683	Bacteria	3321
1006	Ga0466965_0026386	3300044683	Bacteria	2816
1007	Ga0466965_0063178	3300044683	Bacteria	1853
1008	Ga0466965_0223458	3300044683	Bacteria	1004
1009	Ga0466966_0001765	3300044684	Bacteria	14021
1010	Ga0466966_0027735	3300044684	Bacteria	3692
1011	Ga0466966_0044462	3300044684	Bacteria	2843
1012	Ga0466966_0061164	3300044684	Bacteria	2376
1013	Ga0466966_0071840	3300044684	Bacteria	2168
1014	Ga0466966_0072428	3300044684	Bacteria	2157
1015	Ga0466966_0080597	3300044684	Bacteria	2027
1016	Ga0466966_0118351	3300044684	Bacteria	1629
1017	Ga0466966_0184619	3300044684	Bacteria	1265
1018	Ga0466966_0241548	3300044684	Bacteria	1089
1019	Ga0466961_0006181	3300044693	Bacteria	7603
1020	Ga0466961_0009975	3300044693	Bacteria	6052
1021	Ga0466961_0012258	3300044693	Bacteria	5482
1022	Ga0466961_0016340	3300044693	Bacteria	4766
1023	Ga0466961_0032643	3300044693	Bacteria	3346
1024	Ga0466961_0035607	3300044693	Bacteria	3196
1025	Ga0466961_0047585	3300044693	Bacteria	2742
1026	Ga0466961_0063854	3300044693	Bacteria	2340
1027	Ga0466961_0097369	3300044693	Bacteria	1855
1028	Ga0466963_0001031	3300044694	Bacteria	14468
1029	Ga0466963_0001757	3300044694	Bacteria	11812
1030	Ga0466963_0011813	3300044694	Bacteria	5327
1031	Ga0466963_0028001	3300044694	Bacteria	3613
1032	Ga0466963_0035727	3300044694	Bacteria	3238
1033	Ga0466963_0083603	3300044694	Bacteria	2165
1034	Ga0466963_0094973	3300044694	Bacteria	2034
1035	Ga0466963_0100523	3300044694	Bacteria	1979
1036	Ga0466963_0126915	3300044694	Bacteria	1759
1037	Ga0466963_0180179	3300044694	Bacteria	1475
1038	Ga0466963_0187817	3300044694	Bacteria	1444
1039	Ga0466963_0376235	3300044694	Bacteria	1001
1040	Ga0466963_0404264	3300044694	Bacteria	963
1041	Ga0466963_0467103	3300044694	Bacteria	890
1042	Ga0466964_0007192	3300044706	Bacteria	4164
1043	Ga0466964_0024434	3300044706	Bacteria	2355
1044	Ga0466964_0031907	3300044706	Bacteria	2091
1045	Ga0466964_0062638	3300044706	Bacteria	1551
1046	Ga0466964_0166104	3300044706	Bacteria	1035
1047	Ga0466971_0000573	3300044719	Bacteria	14551
1048	Ga0466971_0006292	3300044719	Bacteria	5155
1049	Ga0466971_0008614	3300044719	Bacteria	4449
1050	Ga0466971_0014934	3300044719	Bacteria	3417
1051	Ga0466971_0019833	3300044719	Bacteria	2987
1052	Ga0466971_0036447	3300044719	Bacteria	2206
1053	Ga0466971_0062645	3300044719	Bacteria	1683
1054	Ga0466971_0070489	3300044719	Bacteria	1587
1055	Ga0466971_0166417	3300044719	Bacteria	1033
1056	Ga0466971_0181456	3300044719	Bacteria	990
1057	Ga0466968_0017595	3300044735	Bacteria	2859
1058	Ga0466968_0218282	3300044735	Bacteria	897
1059	Ga0466970_0004123	3300044765	Bacteria	7143
1060	Ga0466970_0025489	3300044765	Bacteria	3096
1061	Ga0466970_0027408	3300044765	Bacteria	2990
1062	Ga0466970_0044154	3300044765	Bacteria	2373
1063	Ga0466970_0077497	3300044765	Bacteria	1792
1064	Ga0466970_0085531	3300044765	Bacteria	1708
1065	Ga0466970_0127495	3300044765	Bacteria	1396
1066	Ga0466970_0170268	3300044765	Bacteria	1207
1067	Ga0466957_0001250	3300044842	Bacteria	13254
1068	Ga0466957_0004053	3300044842	Bacteria	8109
1069	Ga0466957_0005644	3300044842	Bacteria	7035
1070	Ga0466957_0006364	3300044842	Bacteria	6662
1071	Ga0466957_0020957	3300044842	Bacteria	3846
1072	Ga0466957_0052722	3300044842	Bacteria	2478
1073	Ga0466957_0070025	3300044842	Bacteria	2167
1074	Ga0466957_0307550	3300044842	Bacteria	1066
1075	Ga0466960_0000332	3300044901	Bacteria	16149
1076	Ga0466960_0001392	3300044901	Bacteria	8806
1077	Ga0466960_0004134	3300044901	Bacteria	5645
1078	Ga0466960_0009284	3300044901	Bacteria	4049
1079	Ga0466960_0011192	3300044901	Bacteria	3744
1080	Ga0466960_0030189	3300044901	Bacteria	2493
1081	Ga0466960_0096084	3300044901	Bacteria	1518
1082	Ga0466960_0108016	3300044901	Bacteria	1442
1083	Ga0466960_0140513	3300044901	Bacteria	1282
1084	Ga0466960_0149301	3300044901	Bacteria	1247
1085	Ga0466960_0167736	3300044901	Bacteria	1183
1086	Ga0466960_0201973	3300044901	Bacteria	1086
1087	Ga0466960_0265021	3300044901	Bacteria	958
1088	Ga0466959_0002294	3300045049	Bacteria	12200
1089	Ga0466959_0004961	3300045049	Bacteria	9018
1090	Ga0466959_0025087	3300045049	Bacteria	4416
1091	Ga0466959_0039266	3300045049	Bacteria	3498
1092	Ga0466959_0043431	3300045049	Bacteria	3313
1093	Ga0466959_0079305	3300045049	Bacteria	2367
1094	Ga0466959_0138220	3300045049	Bacteria	1723
1095	Ga0466959_0362472	3300045049	Bacteria	987
1096	Ga0466958_0000028	3300045836	Bacteria	41097
1097	Ga0466958_0005908	3300045836	Bacteria	6617
1098	Ga0466958_0006908	3300045836	Bacteria	6207
1099	Ga0466958_0007788	3300045836	Bacteria	5912
1100	Ga0466958_0011511	3300045836	Bacteria	4982
1101	Ga0466958_0029242	3300045836	Bacteria	3269
1102	Ga0466958_0029765	3300045836	Bacteria	3240
1103	Ga0466958_0052690	3300045836	Bacteria	2467
1104	Ga0466958_0129458	3300045836	Bacteria	1584
1105	Ga0466958_0134159	3300045836	Bacteria	1556
1106	Ga0466958_0193377	3300045836	Bacteria	1293
1107	Ga0466958_0313508	3300045836	Bacteria	1008
1108	Ga0466967_0004670	3300045976	Bacteria	9297
1109	Ga0466967_0008745	3300045976	Bacteria	7460
1110	Ga0466967_0009220	3300045976	Bacteria	7305
1111	Ga0466967_0026666	3300045976	Bacteria	4790
1112	Ga0466967_0033310	3300045976	Bacteria	4359
1113	Ga0466967_0040911	3300045976	Bacteria	3992
1114	Ga0466967_0041743	3300045976	Bacteria	3959
1115	Ga0466967_0051219	3300045976	Bacteria	3617
1116	Ga0466967_0058139	3300045976	Bacteria	3417
1117	Ga0466967_0098772	3300045976	Bacteria	2665
1118	Ga0466967_0194790	3300045976	Bacteria	1917
1119	Ga0466967_0214569	3300045976	Bacteria	1826
1120	Ga0466967_0225951	3300045976	Bacteria	1781
1121	Ga0466967_0233117	3300045976	Bacteria	1753
1122	Ga0466967_0241587	3300045976	Bacteria	1723
1123	Ga0466967_0279706	3300045976	Bacteria	1601
1124	Ga0466967_0287395	3300045976	Bacteria	1579
1125	Ga0466967_0349279	3300045976	Bacteria	1431
1126	Ga0466967_0407084	3300045976	Bacteria	1324
1127	Ga0466967_0557100	3300045976	Bacteria	1128
1128	Ga0466967_0721430	3300045976	Bacteria	988
1129	Ga0495617_018698	3300046452	Bacteria	2343
1130	Ga0495592_0000040	3300046454	Bacteria	123599
1131	Ga0495592_0004278	3300046454	Bacteria	10437
1132	Ga0495592_0033577	3300046454	Bacteria	3869
1133	Ga0495592_0094156	3300046454	Bacteria	2144
1134	Ga0495592_0112825	3300046454	Bacteria	1921
1135	Ga0495592_0115524	3300046454	Bacteria	1894
1136	Ga0495603_0002914	3300046455	Bacteria	10119
1137	Ga0495603_0050725	3300046455	Bacteria	2467
1138	Ga0495590_0014915	3300046457	Bacteria	2831
1139	Ga0495629_0003350	3300046459	Bacteria	12102
1140	Ga0495629_0005267	3300046459	Bacteria	9666
1141	Ga0495629_0102998	3300046459	Bacteria	1991
1142	Ga0495629_0135632	3300046459	Bacteria	1713
1143	Ga0495629_0254608	3300046459	Bacteria	1207
1144	Ga0495629_0295341	3300046459	Bacteria	1110
1145	Ga0495629_0334057	3300046459	Bacteria	1035
1146	Ga0495638_0039267	3300046460	Bacteria	3005
1147	Ga0495638_0042477	3300046460	Bacteria	2872
1148	Ga0495638_0147065	3300046460	Bacteria	1370
1149	Ga0495638_0165081	3300046460	Bacteria	1274
1150	Ga0495641_0018286	3300046461	Bacteria	3620
1151	Ga0495641_0077411	3300046461	Bacteria	1491
1152	Ga0495641_0110321	3300046461	Bacteria	1228
1153	Ga0495651_0000017	3300046462	Bacteria	124010
1154	Ga0495651_0000944	3300046462	Bacteria	22528
1155	Ga0495651_0004632	3300046462	Bacteria	10515
1156	Ga0495651_0013655	3300046462	Bacteria	6276
1157	Ga0495651_0057878	3300046462	Bacteria	2975
1158	Ga0495651_0065701	3300046462	Bacteria	2769
1159	Ga0495653_0000567	3300046463	Bacteria	28326
1160	Ga0495653_0001614	3300046463	Bacteria	17713
1161	Ga0495653_0001737	3300046463	Bacteria	17182
1162	Ga0495653_0021207	3300046463	Bacteria	5264
1163	Ga0495653_0030696	3300046463	Bacteria	4277
1164	Ga0495580_0008618	3300046472	Bacteria	8087
1165	Ga0495580_0020131	3300046472	Bacteria	4945
1166	Ga0495580_0169557	3300046472	Bacteria	1509
1167	Ga0495582_0024756	3300046473	Bacteria	3286
1168	Ga0495582_0112567	3300046473	Bacteria	1529
1169	Ga0495582_0123211	3300046473	Bacteria	1462
1170	Ga0495582_0227480	3300046473	Bacteria	1068
1171	Ga0495639_0004134	3300046475	Bacteria	6218
1172	Ga0495639_0148164	3300046475	Bacteria	1131
1173	Ga0495662_0000201	3300046476	Bacteria	24705
1174	Ga0495662_0005657	3300046476	Bacteria	6248
1175	Ga0495662_0016224	3300046476	Bacteria	3611
1176	Ga0495662_0032552	3300046476	Bacteria	2519
1177	Ga0495662_0047268	3300046476	Bacteria	2077
1178	Ga0495662_0195422	3300046476	Bacteria	997
1179	Ga0495664_0001719	3300046477	Bacteria	11640
1180	Ga0495664_0002564	3300046477	Bacteria	9769
1181	Ga0495664_0094295	3300046477	Bacteria	1801
1182	Ga0495664_0099220	3300046477	Bacteria	1754
1183	Ga0495584_0265373	3300046491	Bacteria	873
1184	Ga0495585_0037769	3300046492	Bacteria	2719
1185	Ga0495585_0141198	3300046492	Bacteria	1261
1186	Ga0495594_0000664	3300046499	Bacteria	17708
1187	Ga0495594_0039450	3300046499	Bacteria	2583
1188	Ga0495594_0044060	3300046499	Bacteria	2446
1189	Ga0495594_0052668	3300046499	Bacteria	2241
1190	Ga0495594_0110881	3300046499	Bacteria	1547
1191	Ga0495596_0096775	3300046500	Bacteria	1146
1192	Ga0495607_0045690	3300046501	Bacteria	2574
1193	Ga0495607_0060344	3300046501	Bacteria	2159
1194	Ga0495583_0061689	3300046506	Bacteria	1671
1195	Ga0495608_0000053	3300046511	Bacteria	93787
1196	Ga0495608_0001533	3300046511	Bacteria	16461
1197	Ga0495608_0025580	3300046511	Bacteria	4029
1198	Ga0495618_0045003	3300046514	Bacteria	2784
1199	Ga0495628_0000984	3300046516	Bacteria	26045
1200	Ga0495628_0055615	3300046516	Bacteria	3116
1201	Ga0495628_0057127	3300046516	Bacteria	3070
1202	Ga0495628_0061754	3300046516	Bacteria	2938
1203	Ga0495628_0112387	3300046516	Bacteria	2094
1204	Ga0495628_0174346	3300046516	Bacteria	1629
1205	Ga0495630_0004418	3300046517	Bacteria	9872
1206	Ga0495630_0011312	3300046517	Bacteria	6455
1207	Ga0495630_0018301	3300046517	Bacteria	5144
1208	Ga0495631_0037287	3300046518	Bacteria	2166
1209	Ga0495632_0137195	3300046519	Bacteria	1136
1210	Ga0495643_0004988	3300046522	Bacteria	9099
1211	Ga0495643_0081622	3300046522	Bacteria	1681
1212	Ga0495666_0003643	3300046526	Bacteria	7783
1213	Ga0495666_0028274	3300046526	Bacteria	2758
1214	Ga0495652_0000233	3300046529	Bacteria	65263
1215	Ga0495652_0005113	3300046529	Bacteria	12396
1216	Ga0495652_0006889	3300046529	Bacteria	10522
1217	Ga0495652_0009875	3300046529	Bacteria	8650
1218	Ga0495652_0071550	3300046529	Bacteria	2894
1219	Ga0495654_0031547	3300046530	Bacteria	2690
1220	Ga0495665_0000692	3300046531	Bacteria	17329
1221	Ga0495665_0001548	3300046531	Bacteria	12272
1222	Ga0495665_0021417	3300046531	Bacteria	3473
1223	Ga0495665_0069046	3300046531	Bacteria	1863
1224	Ga0495640_0006184	3300046533	Bacteria	9487
1225	Ga0495640_0025320	3300046533	Bacteria	4306
1226	Ga0495640_0027560	3300046533	Bacteria	4095
1227	Ga0495640_0111419	3300046533	Bacteria	1788
1228	Ga0495586_0001074	3300046535	Bacteria	15430
1229	Ga0495586_0004035	3300046535	Bacteria	7869
1230	Ga0495586_0035165	3300046535	Bacteria	2691
1231	Ga0495587_0000079	3300046536	Bacteria	76330
1232	Ga0495587_0001467	3300046536	Bacteria	15720
1233	Ga0495587_0003360	3300046536	Bacteria	10668
1234	Ga0495587_0019434	3300046536	Bacteria	4203
1235	Ga0495587_0037356	3300046536	Bacteria	2916
1236	Ga0495609_0054283	3300046538	Bacteria	1779
1237	Ga0495597_0024988	3300046542	Bacteria	2753
1238	Ga0495645_0000694	3300046543	Bacteria	23131
1239	Ga0495645_0008653	3300046543	Bacteria	7108
1240	Ga0495645_0074573	3300046543	Bacteria	2443
1241	Ga0495645_0092279	3300046543	Bacteria	2162
1242	Ga0495645_0176467	3300046543	Bacteria	1467
1243	Ga0495622_0009455	3300046557	Bacteria	4509
1244	Ga0495633_0060508	3300046558	Bacteria	1774
1245	Ga0495667_0000063	3300046559	Bacteria	93832
1246	Ga0495667_0000440	3300046559	Bacteria	26598
1247	Ga0495667_0002498	3300046559	Bacteria	12284
1248	Ga0495667_0017309	3300046559	Bacteria	4868
1249	Ga0495667_0197370	3300046559	Bacteria	1288
1250	Ga0495667_0284373	3300046559	Bacteria	1050
1251	Ga0495667_0305959	3300046559	Bacteria	1007
1252	Ga0495668_0172908	3300046616	Bacteria	1183
1253	Ga0495634_0001800	3300046642	Bacteria	18513
1254	Ga0495634_0007726	3300046642	Bacteria	8046
1255	Ga0495634_0041631	3300046642	Bacteria	3119
1256	Ga0495634_0062541	3300046642	Bacteria	2471
1257	Ga0495634_0092299	3300046642	Bacteria	1964
1258	Ga0495634_0265835	3300046642	Bacteria	1045
1259	Ga0495625_0100891	3300046660	Bacteria	1983
1260	Ga0495635_0005541	3300046663	Bacteria	8784
1261	Ga0495635_0007200	3300046663	Bacteria	7771
1262	Ga0495635_0010170	3300046663	Bacteria	6580
1263	Ga0495635_0124795	3300046663	Bacteria	1756
1264	Ga0495588_0002261	3300046674	Bacteria	8241
1265	Ga0495588_0002386	3300046674	Bacteria	8035
1266	Ga0495588_0052386	3300046674	Bacteria	2103
1267	Ga0495588_0183763	3300046674	Bacteria	1105
1268	Ga0495657_0000032	3300046675	Bacteria	123599
1269	Ga0495657_0001382	3300046675	Bacteria	21050
1270	Ga0495657_0005293	3300046675	Bacteria	10207
1271	Ga0495657_0041423	3300046675	Bacteria	3151
1272	Ga0495657_0053715	3300046675	Bacteria	2694
1273	Ga0495657_0055631	3300046675	Bacteria	2638
1274	Ga0495657_0065371	3300046675	Bacteria	2392
1275	Ga0495657_0066034	3300046675	Bacteria	2378
1276	Ga0495599_0000047	3300046678	Bacteria	85391
1277	Ga0495599_0090962	3300046678	Bacteria	1904
1278	Ga0495599_0095180	3300046678	Bacteria	1857
1279	Ga0495599_0234632	3300046678	Bacteria	1120
1280	Ga0495623_0001393	3300046679	Bacteria	16426
1281	Ga0495623_0020285	3300046679	Bacteria	4295
1282	Ga0495623_0068063	3300046679	Bacteria	2221
1283	Ga0495623_0091764	3300046679	Bacteria	1863
1284	Ga0495646_0003075	3300046680	Bacteria	10346
1285	Ga0495646_0007273	3300046680	Bacteria	7031
1286	Ga0495658_0146435	3300046683	Bacteria	1448
1287	Ga0495658_0320536	3300046683	Bacteria	982
1288	Ga0495669_0052901	3300046684	Bacteria	1825
1289	Ga0495613_0001606	3300046689	Bacteria	17171
1290	Ga0495613_0009408	3300046689	Bacteria	7248
1291	Ga0495613_0009524	3300046689	Bacteria	7210
1292	Ga0495613_0009893	3300046689	Bacteria	7088
1293	Ga0495613_0072375	3300046689	Bacteria	2512
1294	Ga0495613_0161692	3300046689	Bacteria	1592
1295	Ga0495613_0170234	3300046689	Bacteria	1546
1296	Ga0495613_0206525	3300046689	Bacteria	1383
1297	Ga0495624_0026820	3300046690	Bacteria	3775
1298	Ga0495649_0088435	3300046694	Bacteria	1652
1299	Ga0495589_0082113	3300046794	Bacteria	1567
1300	Ga0495589_0152220	3300046794	Bacteria	1104
1301	Ga0495600_0000661	3300046809	Bacteria	17933
1302	Ga0495600_0011977	3300046809	Bacteria	5416
1303	Ga0495600_0038029	3300046809	Bacteria	3130
1304	Ga0495600_0098739	3300046809	Bacteria	1903
1305	Ga0495660_0101205	3300046810	Bacteria	1483
1306	Ga0495581_0000457	3300047315	Bacteria	20896
1307	Ga0495581_0016635	3300047315	Bacteria	4275
1308	Ga0495581_0020175	3300047315	Bacteria	3869
1309	Ga0495581_0025008	3300047315	Bacteria	3460
1310	Ga0495581_0099686	3300047315	Bacteria	1687
1311	Ga0495581_0126477	3300047315	Bacteria	1488
1312	Ga0495604_0000124	3300047317	Bacteria	65311
1313	Ga0495604_0001052	3300047317	Bacteria	22924
1314	Ga0495604_0003776	3300047317	Bacteria	12056
1315	Ga0495604_0005533	3300047317	Bacteria	10016
1316	Ga0495604_0028587	3300047317	Bacteria	4436
1317	Ga0495604_0077373	3300047317	Bacteria	2500
1318	Ga0495604_0080130	3300047317	Bacteria	2447
1319	Ga0495604_0101150	3300047317	Bacteria	2117
1320	Ga0495604_0382844	3300047317	Bacteria	929
1321	Ga0495604_0536753	3300047317	Bacteria	755
1322	Ga0495636_0063199	3300047318	Bacteria	1568
1323	Ga0495674_0006635	3300047319	Bacteria	11089
1324	Ga0495674_0016544	3300047319	Bacteria	6882
1325	Ga0495674_0072084	3300047319	Bacteria	2980
1326	Ga0495674_0094019	3300047319	Bacteria	2558
1327	Ga0495674_0179425	3300047319	Bacteria	1764
1328	Ga0495674_0224223	3300047319	Bacteria	1553
1329	Ga0495672_0048304	3300047320	Bacteria	2524
1330	Ga0495676_0001568	3300047321	Bacteria	19832
1331	Ga0495676_0006231	3300047321	Bacteria	10973
1332	Ga0495676_0022829	3300047321	Bacteria	5437
1333	Ga0495676_0083198	3300047321	Bacteria	2419
1334	Ga0495676_0166810	3300047321	Bacteria	1552
1335	Ga0495680_0000085	3300047322	Bacteria	83333
1336	Ga0495680_0039070	3300047322	Bacteria	3788
1337	Ga0495680_0071914	3300047322	Bacteria	2631
1338	Ga0495683_0000282	3300047323	Bacteria	43998
1339	Ga0495687_024522	3300047443	Bacteria	2865
1340	Ga0495675_0000087	3300047444	Bacteria	65472
1341	Ga0495675_0002376	3300047444	Bacteria	11241
1342	Ga0495675_0006434	3300047444	Bacteria	7192
1343	Ga0495675_0020253	3300047444	Bacteria	4229
1344	Ga0495675_0027104	3300047444	Bacteria	3652
1345	Ga0495675_0042531	3300047444	Bacteria	2894
1346	Ga0495675_0127529	3300047444	Bacteria	1583
1347	Ga0495685_000083	3300047447	Bacteria	35318
1348	Ga0495685_003900	3300047447	Bacteria	4790
1349	Ga0495685_012628	3300047447	Bacteria	2861
1350	Ga0495681_0004869	3300047470	Bacteria	9076
1351	Ga0495681_0064321	3300047470	Bacteria	1680
1352	Ga0495684_0032407	3300047471	Bacteria	4012
1353	Ga0495684_0165710	3300047471	Bacteria	1646
1354	Ga0495686_0077803	3300047472	Bacteria	2031
1355	Ga0495593_0000347	3300047673	Bacteria	25594
1356	Ga0495593_0008513	3300047673	Bacteria	5964
1357	Ga0495593_0034819	3300047673	Bacteria	2736
1358	Ga0495602_0000226	3300048088	Bacteria	52782
1359	Ga0495602_0017010	3300048088	Bacteria	7295
1360	Ga0495602_0021527	3300048088	Bacteria	6343
1361	Ga0495602_0038949	3300048088	Bacteria	4385
1362	Ga0495602_0108164	3300048088	Bacteria	2264
1363	Ga0495614_0002065	3300048089	Bacteria	8850
1364	Ga0495614_0010448	3300048089	Bacteria	4093
1365	Ga0495626_0013932	3300048091	Bacteria	4163
1366	Ga0496100_0000513	3300048903	Bacteria	18623
1367	Ga0496100_0087950	3300048903	Bacteria	2114
1368	Ga0496100_0309644	3300048903	Bacteria	1184
1369	Ga0496101_0002355	3300048904	Bacteria	11596
1370	Ga0496101_0018774	3300048904	Bacteria	4708
1371	Ga0496101_0068892	3300048904	Bacteria	2587
1372	Ga0496101_0082909	3300048904	Bacteria	2373
1373	Ga0496101_0291104	3300048904	Bacteria	1278
1374	Ga0496102_0000020	3300048905	Bacteria	260823
1375	Ga0496102_0011659	3300048905	Bacteria	7587
1376	Ga0496102_0034915	3300048905	Bacteria	4525
1377	Ga0496102_0078930	3300048905	Bacteria	3030
1378	Ga0496102_0080153	3300048905	Bacteria	3007
1379	Ga0496102_0105127	3300048905	Bacteria	2627
1380	Ga0496102_0201872	3300048905	Bacteria	1874
1381	Ga0496102_0216061	3300048905	Bacteria	1807
1382	Ga0496102_0226059	3300048905	Bacteria	1764
1383	Ga0496102_0226432	3300048905	Bacteria	1763
1384	Ga0496103_0000011	3300048906	Bacteria	304506
1385	Ga0496103_0004411	3300048906	Bacteria	8539
1386	Ga0496103_0009295	3300048906	Bacteria	5823
1387	Ga0496103_0075821	3300048906	Bacteria	2110
1388	Ga0496104_0015012	3300048907	Bacteria	7006
1389	Ga0496104_0042236	3300048907	Bacteria	4278
1390	Ga0496104_0162968	3300048907	Bacteria	2139
1391	Ga0496104_0380315	3300048907	Bacteria	1324
1392	Ga0496105_0001162	3300048908	Bacteria	18334
1393	Ga0496105_0007259	3300048908	Bacteria	8559
1394	Ga0496105_0027020	3300048908	Bacteria	4685
1395	Ga0496105_0028176	3300048908	Bacteria	4593
1396	Ga0496105_0258863	3300048908	Bacteria	1408
1397	Ga0496106_0094462	3300048909	Bacteria	2312
1398	Ga0496106_0126509	3300048909	Bacteria	2001
1399	Ga0496107_0148777	3300048910	Bacteria	1732
1400	Ga0496107_0150279	3300048910	Bacteria	1722
1401	Ga0496108_0000161	3300048911	Bacteria	63802
1402	Ga0496108_0019332	3300048911	Bacteria	5593
1403	Ga0496108_0034958	3300048911	Bacteria	4175
1404	Ga0496108_0099070	3300048911	Bacteria	2484
1405	Ga0496108_0109905	3300048911	Bacteria	2356
1406	Ga0496108_0145447	3300048911	Bacteria	2043
1407	Ga0496108_0222559	3300048911	Bacteria	1640
1408	Ga0496108_0241292	3300048911	Bacteria	1572
1409	Ga0496108_0263339	3300048911	Bacteria	1500
1410	Ga0496108_0280815	3300048911	Bacteria	1450
1411	Ga0496108_0347408	3300048911	Bacteria	1294
1412	Ga0496108_0371338	3300048911	Bacteria	1249
1413	Ga0496108_0400128	3300048911	Bacteria	1199
1414	Ga0496109_0007598	3300048912	Bacteria	9190
1415	Ga0496109_0083232	3300048912	Bacteria	2950
1416	Ga0496109_0098691	3300048912	Bacteria	2708
1417	Ga0496109_0100978	3300048912	Bacteria	2677
1418	Ga0496109_0175837	3300048912	Bacteria	2009
1419	Ga0496109_0361467	3300048912	Bacteria	1371
1420	Ga0496109_0437534	3300048912	Bacteria	1235
1421	Ga0496109_0525471	3300048912	Bacteria	1117
1422	Ga0496110_0007669	3300048913	Bacteria	8635
1423	Ga0496110_0020585	3300048913	Bacteria	5572
1424	Ga0496110_0033047	3300048913	Bacteria	4473
1425	Ga0496110_0052473	3300048913	Bacteria	3583
1426	Ga0496110_0090566	3300048913	Bacteria	2734
1427	Ga0496110_0113261	3300048913	Bacteria	2439
1428	Ga0496110_0205642	3300048913	Bacteria	1789
1429	Ga0496110_0215807	3300048913	Bacteria	1745
1430	Ga0496110_0219958	3300048913	Bacteria	1727
1431	Ga0496111_0051927	3300048914	Bacteria	2960
1432	Ga0496111_0061349	3300048914	Bacteria	2726
1433	Ga0496111_0147345	3300048914	Bacteria	1745
1434	Ga0496111_0183049	3300048914	Bacteria	1558
1435	Ga0496111_0206825	3300048914	Bacteria	1458
1436	Ga0496111_0460276	3300048914	Bacteria	938
1437	Ga0496112_0057290	3300048915	Bacteria	3836
1438	Ga0496112_0064962	3300048915	Bacteria	3601
1439	Ga0496112_0113280	3300048915	Bacteria	2683
1440	Ga0496112_0127272	3300048915	Bacteria	2518
1441	Ga0496112_0246873	3300048915	Bacteria	1737
1442	Ga0496112_0260500	3300048915	Bacteria	1683
1443	Ga0496112_0291625	3300048915	Bacteria	1577
1444	Ga0496112_0589519	3300048915	Bacteria	1044
1445	Ga0496113_0003600	3300048916	Bacteria	9308
1446	Ga0496113_0055612	3300048916	Bacteria	2967
1447	Ga0496113_0061251	3300048916	Bacteria	2839
1448	Ga0496113_0259303	3300048916	Bacteria	1389
1449	Ga0496113_0302240	3300048916	Bacteria	1281
1450	Ga0496114_0002004	3300048917	Bacteria	15480
1451	Ga0496114_0002258	3300048917	Bacteria	14671
1452	Ga0496114_0010851	3300048917	Bacteria	7254
1453	Ga0496114_0048942	3300048917	Bacteria	3516
1454	Ga0496114_0086718	3300048917	Bacteria	2653
1455	Ga0496114_0090113	3300048917	Bacteria	2603
1456	Ga0496114_0091525	3300048917	Bacteria	2583
1457	Ga0496114_0169515	3300048917	Bacteria	1902
1458	Ga0496114_0196803	3300048917	Bacteria	1764
1459	Ga0496114_0214131	3300048917	Bacteria	1690
1460	Ga0496114_0281178	3300048917	Bacteria	1467
1461	Ga0496114_0285883	3300048917	Bacteria	1454
1462	Ga0496114_0592813	3300048917	Bacteria	977
1463	Ga0496115_0114953	3300048918	Bacteria	2212
1464	Ga0496115_0123752	3300048918	Bacteria	2129
1465	Ga0496116_0000067	3300048919	Bacteria	260793
1466	Ga0496116_0001289	3300048919	Bacteria	28831
1467	Ga0496117_0000192	3300048920	Bacteria	124451
1468	Ga0496117_0118562	3300048920	Bacteria	1631
1469	Ga0496118_0000076	3300048921	Bacteria	193263
1470	Ga0496118_0006671	3300048921	Bacteria	12590
1471	Ga0496118_0008596	3300048921	Bacteria	10510
1472	Ga0496119_0001952	3300048922	Bacteria	23480
1473	Ga0496119_0002215	3300048922	Bacteria	21716
1474	Ga0496119_0013979	3300048922	Bacteria	6327
1475	Ga0496119_0036032	3300048922	Bacteria	3234
1476	Ga0496119_0101845	3300048922	Bacteria	1611
1477	Ga0496120_0000203	3300048923	Bacteria	101935
1478	Ga0496120_0015280	3300048923	Bacteria	5074
1479	Ga0496121_0008493	3300048924	Bacteria	12053
1480	Ga0496122_0000271	3300048925	Bacteria	115696
1481	Ga0496122_0000548	3300048925	Bacteria	77737
1482	Ga0496122_0039579	3300048925	Bacteria	3758
1483	Ga0496122_0087340	3300048925	Bacteria	2143
1484	Ga0496123_0000279	3300048926	Bacteria	100723
1485	Ga0496124_0000243	3300048927	Bacteria	105789
1486	Ga0496124_0004620	3300048927	Bacteria	15947
1487	Ga0496124_0051714	3300048927	Bacteria	3494
1488	Ga0496124_0096223	3300048927	Bacteria	2405
1489	Ga0496124_0130919	3300048927	Bacteria	1993
1490	Ga0496124_0213654	3300048927	Bacteria	1457
1491	Ga0496125_0000025	3300048928	Bacteria	440074
1492	Ga0496125_0005551	3300048928	Bacteria	13958
1493	Ga0496125_0024559	3300048928	Bacteria	5540
1494	Ga0496126_0000036	3300048929	Bacteria	354901
1495	Ga0496126_0000080	3300048929	Bacteria	221672
1496	Ga0496126_0020671	3300048929	Bacteria	6448
1497	Ga0496126_0271319	3300048929	Bacteria	1408
1498	Ga0495678_018257	3300049459	Bacteria	3158
1499	Ga0501323_018938	3300049539	Bacteria	894
1500	Ga0501031_0002419	3300049568	Bacteria	11869
1501	Ga0501031_0003677	3300049568	Bacteria	9866
1502	Ga0501031_0006610	3300049568	Bacteria	7563
1503	Ga0501031_0009903	3300049568	Bacteria	6206
1504	Ga0501031_0015282	3300049568	Bacteria	4985
1505	Ga0501031_0033966	3300049568	Bacteria	3328
1506	Ga0501031_0097666	3300049568	Bacteria	1917
1507	Ga0501031_0153441	3300049568	Bacteria	1505
1508	Ga0501031_0182415	3300049568	Bacteria	1371
1509	Ga0501031_0293592	3300049568	Bacteria	1054
1510	Ga0501032_0000531	3300049569	Bacteria	30950
1511	Ga0501032_0001631	3300049569	Bacteria	17843
1512	Ga0501032_0003807	3300049569	Bacteria	11451
1513	Ga0501032_0037176	3300049569	Bacteria	3320
1514	Ga0501032_0064767	3300049569	Bacteria	2446
1515	Ga0501032_0065459	3300049569	Bacteria	2431
1516	Ga0501032_0090854	3300049569	Bacteria	2026
1517	Ga0501032_0249146	3300049569	Bacteria	1153
1518	Ga0501032_0277604	3300049569	Bacteria	1085
1519	Ga0501032_0368664	3300049569	Bacteria	924
1520	Ga0501033_0002898	3300049570	Bacteria	14353
1521	Ga0501033_0009944	3300049570	Bacteria	7303
1522	Ga0501033_0013481	3300049570	Bacteria	6221
1523	Ga0501033_0013555	3300049570	Bacteria	6206
1524	Ga0501033_0014590	3300049570	Bacteria	5965
1525	Ga0501033_0063437	3300049570	Bacteria	2719
1526	Ga0501033_0113581	3300049570	Bacteria	1969
1527	Ga0501033_0193076	3300049570	Bacteria	1456
1528	Ga0501034_0010356	3300049571	Bacteria	9716
1529	Ga0501034_0021243	3300049571	Bacteria	6620
1530	Ga0501034_0022814	3300049571	Bacteria	6376
1531	Ga0501034_0035341	3300049571	Bacteria	5066
1532	Ga0501034_0043852	3300049571	Bacteria	4524
1533	Ga0501034_0044053	3300049571	Bacteria	4513
1534	Ga0501034_0061036	3300049571	Bacteria	3787
1535	Ga0501034_0063482	3300049571	Bacteria	3707
1536	Ga0501034_0420769	3300049571	Bacteria	1257
1537	Ga0501034_0431225	3300049571	Bacteria	1238
1538	Ga0501034_0555234	3300049571	Bacteria	1057
1539	Ga0501036_0003908	3300049572	Bacteria	11959
1540	Ga0501036_0005617	3300049572	Bacteria	10172
1541	Ga0501036_0010598	3300049572	Bacteria	7618
1542	Ga0501036_0017334	3300049572	Bacteria	6019
1543	Ga0501036_0038253	3300049572	Bacteria	4060
1544	Ga0501036_0091102	3300049572	Bacteria	2576
1545	Ga0501036_0285008	3300049572	Bacteria	1382
1546	Ga0501036_0537336	3300049572	Bacteria	972
1547	Ga0501037_0000485	3300049573	Bacteria	32176
1548	Ga0501037_0001214	3300049573	Bacteria	19070
1549	Ga0501037_0007121	3300049573	Bacteria	8173
1550	Ga0501037_0007251	3300049573	Bacteria	8102
1551	Ga0501037_0013065	3300049573	Bacteria	6122
1552	Ga0501037_0037762	3300049573	Bacteria	3561
1553	Ga0501037_0091919	3300049573	Bacteria	2195
1554	Ga0501037_0106295	3300049573	Bacteria	2023
1555	Ga0501038_0000985	3300049574	Bacteria	25579
1556	Ga0501038_0002967	3300049574	Bacteria	15813
1557	Ga0501038_0006642	3300049574	Bacteria	10696
1558	Ga0501038_0006916	3300049574	Bacteria	10473
1559	Ga0501038_0048801	3300049574	Bacteria	3662
1560	Ga0501038_0058636	3300049574	Bacteria	3300
1561	Ga0501038_0065903	3300049574	Bacteria	3085
1562	Ga0501038_0069237	3300049574	Bacteria	2997
1563	Ga0501038_0078801	3300049574	Bacteria	2779
1564	Ga0501038_0089475	3300049574	Bacteria	2582
1565	Ga0501038_0118916	3300049574	Bacteria	2181
1566	Ga0501038_0312870	3300049574	Bacteria	1230
1567	Ga0501038_0322781	3300049574	Bacteria	1207
1568	Ga0501038_0351702	3300049574	Bacteria	1147
1569	Ga0501038_0354121	3300049574	Bacteria	1143
1570	Ga0501039_0007366	3300049575	Bacteria	8388
1571	Ga0501039_0010009	3300049575	Bacteria	7230
1572	Ga0501039_0034656	3300049575	Bacteria	3894
1573	Ga0501039_0065755	3300049575	Bacteria	2813
1574	Ga0501039_0097538	3300049575	Bacteria	2292
1575	Ga0501039_0150695	3300049575	Bacteria	1827
1576	Ga0501039_0215384	3300049575	Bacteria	1510
1577	Ga0501039_0404742	3300049575	Bacteria	1072
1578	Ga0501040_0004698	3300049576	Bacteria	8866
1579	Ga0501040_0033875	3300049576	Bacteria	3461
1580	Ga0501040_0080688	3300049576	Bacteria	2254
1581	Ga0501040_0131421	3300049576	Bacteria	1761
1582	Ga0501041_0020711	3300049577	Bacteria	3934
1583	Ga0501041_0029059	3300049577	Bacteria	3335
1584	Ga0501042_0018743	3300049578	Bacteria	4796
1585	Ga0501042_0030634	3300049578	Bacteria	3801
1586	Ga0501042_0032718	3300049578	Bacteria	3683
1587	Ga0501042_0071597	3300049578	Bacteria	2480
1588	Ga0501042_0209320	3300049578	Bacteria	1406
1589	Ga0501042_0233827	3300049578	Bacteria	1326
1590	Ga0501043_0001629	3300049579	Bacteria	19526
1591	Ga0501043_0007425	3300049579	Bacteria	8701
1592	Ga0501043_0010036	3300049579	Bacteria	7427
1593	Ga0501043_0015670	3300049579	Bacteria	5941
1594	Ga0501043_0016273	3300049579	Bacteria	5833
1595	Ga0501043_0023547	3300049579	Bacteria	4829
1596	Ga0501043_0023753	3300049579	Bacteria	4809
1597	Ga0501043_0027031	3300049579	Bacteria	4503
1598	Ga0501043_0030641	3300049579	Bacteria	4228
1599	Ga0501043_0055245	3300049579	Bacteria	3119
1600	Ga0501043_0055657	3300049579	Bacteria	3108
1601	Ga0501043_0214637	3300049579	Bacteria	1490
1602	Ga0501046_0000052	3300049580	Bacteria	132914
1603	Ga0501046_0001931	3300049580	Bacteria	19689
1604	Ga0501046_0004382	3300049580	Bacteria	12830
1605	Ga0501046_0016785	3300049580	Bacteria	6121
1606	Ga0501046_0028693	3300049580	Bacteria	4530
1607	Ga0501046_0029126	3300049580	Bacteria	4492
1608	Ga0501046_0372037	3300049580	Bacteria	1035
1609	Ga0501047_0000110	3300049581	Bacteria	99745
1610	Ga0501047_0000483	3300049581	Bacteria	43278
1611	Ga0501047_0004931	3300049581	Bacteria	12532
1612	Ga0501047_0022113	3300049581	Bacteria	6109
1613	Ga0501047_0029536	3300049581	Bacteria	5285
1614	Ga0501047_0029859	3300049581	Bacteria	5254
1615	Ga0501047_0033000	3300049581	Bacteria	4998
1616	Ga0501047_0070274	3300049581	Bacteria	3371
1617	Ga0501047_0075739	3300049581	Bacteria	3238
1618	Ga0501047_0083217	3300049581	Bacteria	3075
1619	Ga0501047_0116647	3300049581	Bacteria	2551
1620	Ga0501047_0315693	3300049581	Bacteria	1403
1621	Ga0501048_0001468	3300049582	Bacteria	17870
1622	Ga0501048_0116050	3300049582	Bacteria	1891
1623	Ga0501048_0124804	3300049582	Bacteria	1820
1624	Ga0501048_0480639	3300049582	Bacteria	890
1625	Ga0501067_0002905	3300049583	Bacteria	9439
1626	Ga0501067_0005959	3300049583	Bacteria	6758
1627	Ga0501067_0010213	3300049583	Bacteria	5194
1628	Ga0501067_0045210	3300049583	Bacteria	2445
1629	Ga0501067_0151252	3300049583	Bacteria	1293
1630	Ga0501067_0158844	3300049583	Bacteria	1259
1631	Ga0501068_0005310	3300049584	Bacteria	7038
1632	Ga0501068_0006190	3300049584	Bacteria	6584
1633	Ga0501068_0023008	3300049584	Bacteria	3650
1634	Ga0501068_0046760	3300049584	Bacteria	2609
1635	Ga0501069_0001134	3300049585	Bacteria	12850
1636	Ga0501069_0005471	3300049585	Bacteria	6607
1637	Ga0501069_0059936	3300049585	Bacteria	2124
1638	Ga0501069_0103414	3300049585	Bacteria	1618
1639	Ga0501069_0163465	3300049585	Bacteria	1282
1640	Ga0501070_0004150	3300049586	Bacteria	12465
1641	Ga0501070_0005367	3300049586	Bacteria	10931
1642	Ga0501070_0006073	3300049586	Bacteria	10291
1643	Ga0501070_0009717	3300049586	Bacteria	8134
1644	Ga0501070_0012225	3300049586	Bacteria	7243
1645	Ga0501070_0014651	3300049586	Bacteria	6598
1646	Ga0501070_0014789	3300049586	Bacteria	6566
1647	Ga0501070_0022117	3300049586	Bacteria	5326
1648	Ga0501070_0024820	3300049586	Bacteria	5027
1649	Ga0501070_0055213	3300049586	Bacteria	3292
1650	Ga0501070_0059692	3300049586	Bacteria	3162
1651	Ga0501070_0086112	3300049586	Bacteria	2601
1652	Ga0501070_0113434	3300049586	Bacteria	2240
1653	Ga0501070_0290148	3300049586	Bacteria	1333
1654	Ga0501070_0570685	3300049586	Bacteria	904
1655	Ga0501071_0000661	3300049587	Bacteria	17999
1656	Ga0501071_0010299	3300049587	Bacteria	6261
1657	Ga0501071_0031605	3300049587	Bacteria	3754
1658	Ga0501071_0108601	3300049587	Bacteria	2049
1659	Ga0501071_0130859	3300049587	Bacteria	1864
1660	Ga0501071_0155648	3300049587	Bacteria	1706
1661	Ga0501071_0254626	3300049587	Bacteria	1325
1662	Ga0501071_0366067	3300049587	Bacteria	1098
1663	Ga0501072_0002157	3300049588	Bacteria	14696
1664	Ga0501072_0033696	3300049588	Bacteria	4013
1665	Ga0501072_0043340	3300049588	Bacteria	3536
1666	Ga0501072_0388438	3300049588	Bacteria	1107
1667	Ga0501072_0432947	3300049588	Bacteria	1042
1668	Ga0501073_0006766	3300049589	Bacteria	8535
1669	Ga0501073_0015310	3300049589	Bacteria	5560
1670	Ga0501073_0056195	3300049589	Bacteria	2753
1671	Ga0501073_0116307	3300049589	Bacteria	1853
1672	Ga0501073_0223703	3300049589	Bacteria	1300
1673	Ga0501074_0000774	3300049590	Bacteria	20174
1674	Ga0501074_0001119	3300049590	Bacteria	17523
1675	Ga0501074_0003072	3300049590	Bacteria	11774
1676	Ga0501074_0004669	3300049590	Bacteria	9813
1677	Ga0501074_0014093	3300049590	Bacteria	5811
1678	Ga0501074_0028095	3300049590	Bacteria	4076
1679	Ga0501074_0029590	3300049590	Bacteria	3967
1680	Ga0501074_0062111	3300049590	Bacteria	2691
1681	Ga0501074_0074569	3300049590	Bacteria	2436
1682	Ga0501074_0207951	3300049590	Bacteria	1394
1683	Ga0501075_0003435	3300049591	Bacteria	10603
1684	Ga0501075_0029730	3300049591	Bacteria	4042
1685	Ga0501075_0056086	3300049591	Bacteria	2966
1686	Ga0501075_0146973	3300049591	Bacteria	1796
1687	Ga0501076_0003294	3300049592	Bacteria	11311
1688	Ga0501076_0004072	3300049592	Bacteria	10338
1689	Ga0501076_0004561	3300049592	Bacteria	9866
1690	Ga0501076_0035913	3300049592	Bacteria	3880
1691	Ga0501076_0228464	3300049592	Bacteria	1521
1692	Ga0501076_0311628	3300049592	Bacteria	1291
1693	Ga0501076_0458871	3300049592	Bacteria	1049
1694	Ga0501077_0016129	3300049593	Bacteria	4707
1695	Ga0501077_0030382	3300049593	Bacteria	3437
1696	Ga0501077_0052291	3300049593	Bacteria	2595
1697	Ga0501077_0068241	3300049593	Bacteria	2254
1698	Ga0501079_0019808	3300049741	Bacteria	5141
1699	Ga0501079_0020827	3300049741	Bacteria	5014
1700	Ga0501079_0070902	3300049741	Bacteria	2691
1701	Ga0501079_0091274	3300049741	Bacteria	2360
1702	Ga0501079_0174061	3300049741	Bacteria	1678
1703	Ga0501079_0442136	3300049741	Bacteria	1021
1704	Ga0501080_0000195	3300049742	Bacteria	44301
1705	Ga0501080_0000233	3300049742	Bacteria	41803
1706	Ga0501080_0004103	3300049742	Bacteria	12910
1707	Ga0501080_0014610	3300049742	Bacteria	7232
1708	Ga0501080_0027086	3300049742	Bacteria	5329
1709	Ga0501080_0052365	3300049742	Bacteria	3799
1710	Ga0501080_0065121	3300049742	Bacteria	3390
1711	Ga0501080_0103447	3300049742	Bacteria	2641
1712	Ga0501080_0280959	3300049742	Bacteria	1513
1713	Ga0501081_0003904	3300049743	Bacteria	9551
1714	Ga0501081_0186382	3300049743	Bacteria	1502
1715	Ga0501081_0424646	3300049743	Bacteria	986
1716	Ga0501083_0012430	3300049744	Bacteria	5956
1717	Ga0501083_0023050	3300049744	Bacteria	4320
1718	Ga0501083_0036282	3300049744	Bacteria	3363
1719	Ga0501083_0093236	3300049744	Bacteria	1988
1720	Ga0501083_0178401	3300049744	Bacteria	1387
1721	Ga0501083_0197281	3300049744	Bacteria	1313
1722	Ga0501083_0249076	3300049744	Bacteria	1156
1723	Ga0501279_001738	3300049775	Bacteria	2866
1724	Ga0501035_0001036	3300049822	Bacteria	29178
1725	Ga0501035_0004238	3300049822	Bacteria	13625
1726	Ga0501035_0005136	3300049822	Bacteria	12387
1727	Ga0501035_0005855	3300049822	Bacteria	11592
1728	Ga0501035_0024538	3300049822	Bacteria	5529
1729	Ga0501035_0033898	3300049822	Bacteria	4642
1730	Ga0501035_0037083	3300049822	Bacteria	4416
1731	Ga0501035_0064820	3300049822	Bacteria	3246
1732	Ga0501035_0087017	3300049822	Bacteria	2753
1733	Ga0501035_0256304	3300049822	Bacteria	1484
1734	Ga0501044_0000571	3300049823	Bacteria	44736
1735	Ga0501044_0007521	3300049823	Bacteria	11982
1736	Ga0501044_0011630	3300049823	Bacteria	9539
1737	Ga0501044_0019737	3300049823	Bacteria	7202
1738	Ga0501044_0034584	3300049823	Bacteria	5298
1739	Ga0501044_0044118	3300049823	Bacteria	4630
1740	Ga0501044_0053455	3300049823	Bacteria	4155
1741	Ga0501044_0064716	3300049823	Bacteria	3731
1742	Ga0501044_0074358	3300049823	Bacteria	3452
1743	Ga0501044_0090124	3300049823	Bacteria	3094
1744	Ga0501044_0114677	3300049823	Bacteria	2700
1745	Ga0501044_0290999	3300049823	Bacteria	1565
1746	Ga0501044_0560852	3300049823	Bacteria	1038
1747	Ga0501045_0005932	3300049824	Bacteria	8448
1748	Ga0501045_0007508	3300049824	Bacteria	7576
1749	Ga0501045_0048612	3300049824	Bacteria	3092
1750	Ga0501045_0273482	3300049824	Bacteria	1257
1751	Ga0501045_0342312	3300049824	Bacteria	1113
1752	Ga0501045_0353697	3300049824	Bacteria	1093
1753	nmdc:mga03683_5322_c1	3300050489	Bacteria	4343
1754	nmdc:mga03n38_55356_c1	3300050490	Bacteria	1787
1755	nmdc:mga03n38_81812_c1	3300050490	Bacteria	1519
1756	nmdc:mga00v17_114072_c1	3300050491	Bacteria	1716
1757	nmdc:mga00v17_1426_c2	3300050491	Bacteria	5555
1758	nmdc:mga00v17_247399_c1	3300050491	Bacteria	1156
1759	nmdc:mga00v17_37231_c1	3300050491	Bacteria	2904
1760	nmdc:mga00v17_42883_c1	3300050491	Bacteria	2722
1761	nmdc:mga00v17_6924_c1	3300050491	Bacteria	6027
1762	nmdc:mga0yw44_113626_c1	3300050492	Bacteria	1737
1763	nmdc:mga0yw44_121649_c1	3300050492	Bacteria	1682
1764	nmdc:mga0yw44_3490_c1	3300050492	Bacteria	6992
1765	nmdc:mga0yw44_40880_c1	3300050492	Bacteria	2758
1766	nmdc:mga0yw44_4161_c1	3300050492	Bacteria	6576
1767	nmdc:mga0yw44_80861_c1	3300050492	Bacteria	2036
1768	nmdc:mga06z11_14464_c1	3300050494	Bacteria	3495
1769	nmdc:mga06z11_308_c1	3300050494	Bacteria	18574
1770	nmdc:mga06z11_54108_c1	3300050494	Bacteria	2068
1771	nmdc:mga04h51_121695_c1	3300050495	Bacteria	973
1772	nmdc:mga04h51_5122_c1	3300050495	Bacteria	3321
1773	nmdc:mga07m45_12853_c1	3300050496	Bacteria	4429
1774	nmdc:mga07m45_1420_c1	3300050496	Bacteria	10979
1775	nmdc:mga07m45_155084_c1	3300050496	Bacteria	1328
1776	nmdc:mga07m45_9228_c1	3300050496	Bacteria	5106
1777	nmdc:mga05p37_14467_c1	3300050507	Bacteria	9474
1778	nmdc:mga05p37_279632_c1	3300050507	Bacteria	1991
1779	nmdc:mga05p37_346018_c1	3300050507	Bacteria	1752
1780	nmdc:mga05p37_381_c1	3300050507	Bacteria	47835
1781	nmdc:mga05p37_4687_c1	3300050507	Bacteria	15974
1782	nmdc:mga09592_3_c1	3300050508	Bacteria	144376
1783	nmdc:mga09592_453572_c1	3300050508	Bacteria	1106
1784	nmdc:mga09592_48021_c1	3300050508	Bacteria	3598
1785	nmdc:mga09592_862_c1	3300050508	Bacteria	23697
1786	nmdc:mga0qj67_12966_c1	3300050509	Bacteria	6290
1787	nmdc:mga0qj67_286_c1	3300050509	Bacteria	35189
1788	nmdc:mga0qj67_393_c1	3300050509	Bacteria	30195
1789	nmdc:mga06r32_10211_c1	3300050510	Bacteria	8475
1790	nmdc:mga06r32_129_c1	3300050510	Bacteria	55137
1791	nmdc:mga06r32_205848_c1	3300050510	Bacteria	1956
1792	nmdc:mga06r32_437432_c1	3300050510	Bacteria	1288
1793	nmdc:mga06r32_460_c1	3300050510	Bacteria	34832
1794	nmdc:mga06r32_5145_c1	3300050510	Bacteria	11764
1795	nmdc:mga06r32_566330_c1	3300050510	Bacteria	1109
1796	nmdc:mga06r32_75420_c1	3300050510	Bacteria	3272
1797	nmdc:mga06r32_8828_c1	3300050510	Bacteria	9081
1798	nmdc:mga08y16_198615_c1	3300050511	Bacteria	2079
1799	nmdc:mga0n895_87729_c1	3300050512	Bacteria	3110
1800	nmdc:mga0rr50_74572_c1	3300050513	Bacteria	2598
1801	Ga0495601_0006528	3300053077	Bacteria	6821
1802	Ga0495601_0040077	3300053077	Bacteria	2933
1803	Ga0495601_0084351	3300053077	Bacteria	2041
1804	Ga0495612_0003533	3300053078	Bacteria	6480
1805	Ga0495612_0014531	3300053078	Bacteria	3165
1806	Ga0495612_0018413	3300053078	Bacteria	2797
1807	Ga0500610_0041201	3300053079	Bacteria	2388
1808	Ga0495595_0001268	3300053084	Bacteria	9830
1809	Ga0495595_0049816	3300053084	Bacteria	1938
1810	Ga0495619_0047849	3300053085	Bacteria	2817
1811	Ga0495619_0053280	3300053085	Bacteria	2676
1812	Ga0495619_0088477	3300053085	Bacteria	2095
1813	Ga0495619_0256203	3300053085	Bacteria	1213
1814	Ga0495619_0266460	3300053085	Bacteria	1187
1815	Ga0500578_0315688	3300053086	Bacteria	922
1816	Ga0500643_000369	3300053087	Bacteria	35468
1817	Ga0500644_0000389	3300053088	Bacteria	21299
1818	Ga0500644_0057180	3300053088	Bacteria	1360
1819	Ga0500644_0141879	3300053088	Bacteria	955
1820	Ga0500646_0000289	3300053090	Bacteria	15420
1821	Ga0500646_0020404	3300053090	Bacteria	1761
1822	Ga0500583_0057937	3300053092	Bacteria	1820
1823	Ga0500640_000125	3300053095	Bacteria	14526
1824	Ga0500641_0025016	3300053096	Bacteria	2307
1825	Ga0500556_0001187	3300053104	Bacteria	12371
1826	Ga0500560_016244	3300053107	Bacteria	2026
1827	Ga0500593_000401	3300053117	Bacteria	17288
1828	Ga0500614_006505	3300053123	Bacteria	2457
1829	Ga0500614_057278	3300053123	Bacteria	1039
1830	Ga0500628_004016	3300053129	Bacteria	2430
1831	Ga0500652_039746	3300053131	Bacteria	1887
1832	Ga0500658_0007410	3300053134	Bacteria	4054
1833	Ga0500559_0002092	3300053136	Bacteria	10649
1834	Ga0500561_0001076	3300053137	Bacteria	4397
1835	Ga0500573_0024851	3300053140	Bacteria	3445
1836	Ga0500573_0036971	3300053140	Bacteria	2820
1837	Ga0500573_0132999	3300053140	Bacteria	1376
1838	Ga0500579_019295	3300053143	Bacteria	4420
1839	Ga0500579_050803	3300053143	Bacteria	2537
1840	Ga0500588_0006010	3300053146	Bacteria	2724
1841	Ga0500600_0054051	3300053149	Bacteria	2265
1842	Ga0500604_0048022	3300053151	Bacteria	1310
1843	Ga0500616_0009436	3300053153	Bacteria	5936
1844	Ga0500616_0010802	3300053153	Bacteria	5443
1845	Ga0500616_0025938	3300053153	Bacteria	3249
1846	Ga0500624_008893	3300053157	Bacteria	1416
1847	Ga0500634_0056624	3300053161	Bacteria	2094
1848	Ga0500587_002765	3300053739	Bacteria	2479
1849	Ga0501084_0001800	3300054114	Bacteria	17086
1850	Ga0501084_0004824	3300054114	Bacteria	11020
1851	Ga0501084_0015712	3300054114	Bacteria	6276
1852	Ga0501084_0020544	3300054114	Bacteria	5507
1853	Ga0501084_0163470	3300054114	Bacteria	1878
1854	Ga0501084_0167230	3300054114	Bacteria	1856
1855	Ga0501084_0287517	3300054114	Bacteria	1388
1856	Ga0501084_0337969	3300054114	Bacteria	1272
1857	Ga0501084_0381549	3300054114	Bacteria	1191
1858	Ga0590075_036428	3300059424	Bacteria	1254
1859	Ga0587073_0013569	3300059492	Bacteria	1434
1860	Ga0587083_0010966	3300059505	Bacteria	1484
1861	Ga0587088_005016	3300059508	Bacteria	1716
1862	Ga0587115_009474	3300059626	Bacteria	1196
1863	Ga0587122_006961	3300059628	Bacteria	992
1864	Ga0587128_009923	3300059630	Bacteria	1268
1865	Ga0587067_006521	3300059640	Bacteria	1631
1866	Ga0587072_010082	3300059643	Bacteria	1521
1867	Ga0587072_018113	3300059643	Bacteria	1221
1868	Ga0587124_001993	3300059660	Bacteria	1394
1869	Ga0587111_0025640	3300060346	Bacteria	1169
1870	Ga0501082_0001376	3300060353	Bacteria	21386
1871	Ga0501082_0009212	3300060353	Bacteria	8509
1872	Ga0501082_0033765	3300060353	Bacteria	4413
1873	Ga0501082_0055844	3300060353	Bacteria	3401
1874	Ga0501082_0081600	3300060353	Bacteria	2790
1875	Ga0466962_0000797	3300061719	Bacteria	14212
1876	Ga0466962_0001502	3300061719	Bacteria	10881
1877	Ga0466962_0003535	3300061719	Bacteria	7447
1878	Ga0466962_0009029	3300061719	Bacteria	4774
1879	Ga0466962_0014471	3300061719	Bacteria	3803
1880	Ga0466962_0019181	3300061719	Bacteria	3284
1881	Ga0466962_0118615	3300061719	Bacteria	1276
1882	Ga0466962_0135343	3300061719	Bacteria	1192
1883	Ga0530510_0003106	3300061734	Bacteria	11397
1884	Ga0530510_0006083	3300061734	Bacteria	8381
1885	Ga0530510_0013690	3300061734	Bacteria	5709
1886	Ga0530510_0185350	3300061734	Bacteria	1544
1887	Ga0530510_0396600	3300061734	Bacteria	1040

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300047317	Ga0495604_0536753	Ga0495604_0536753_13_735	213
2	3300049586	Ga0501070_0570685	Ga0501070_0570685_83_808	224
3	3300031456	Ga0307513_10225709	Ga0307513_102257092	226
4	iso_pu_bacteria	2867302475	2867303319	226
5	3300041460	Ga0451802_1425841	Ga0451802_1425841_100_807	229
6	3300042125	Ga0450923_057005	Ga0450923_057005_89_796	229
7	3300048903	Ga0496100_0309644	Ga0496100_0309644_414_1127	229
8	3300044719	Ga0466971_0181456	Ga0466971_0181456_30_782	232
9	3300005356	Ga0070674_100103342	Ga0070674_1001033423	233
10	3300025901	Ga0207688_10128888	Ga0207688_101288882	233
11	3300049587	Ga0501071_0155648	Ga0501071_0155648_28_750	236
12	3300049591	Ga0501075_0056086	Ga0501075_0056086_1376_2098	236
13	3300049592	Ga0501076_0004561	Ga0501076_0004561_3747_4469	236
14	3300049593	Ga0501077_0052291	Ga0501077_0052291_1502_2224	236
15	3300061734	Ga0530510_0185350	Ga0530510_0185350_28_750	236
16	iso_pu_bacteria	2832004796	2832007927	236
17	iso_pu_bacteria	2856858025	2856862648	236
18	iso_pu_bacteria	2858868258	2858868662	236
19	iso_pu_bacteria	2858902515	2858904401	236
20	iso_pu_bacteria	2866065130	2866065161	236
21	iso_pu_bacteria	2902582711	2902585493	236
22	3300005338	Ga0068868_100010132	Ga0068868_1000101327	237
23	3300026023	Ga0207677_10099061	Ga0207677_100990613	237
24	3300045976	Ga0466967_0721430	Ga0466967_0721430_30_761	237
25	3300044694	Ga0466963_0376235	Ga0466963_0376235_252_986	238
26	3300049569	Ga0501032_0368664	Ga0501032_0368664_174_908	238
27	3300049742	Ga0501080_0014610	Ga0501080_0014610_1889_2623	238
28	3300048917	Ga0496114_0002258	Ga0496114_0002258_2975_3856	239
29	3300005366	Ga0070659_100000851	Ga0070659_1000008515	240
30	3300013102	Ga0157371_10088259	Ga0157371_100882592	240
31	3300013105	Ga0157369_10178056	Ga0157369_101780563	240
32	3300025932	Ga0207690_10000357	Ga0207690_1000035725	240
33	iso_pu_bacteria	2831935698	2831936023	240
34	iso_pu_bacteria	2855670206	2855673525	240
35	iso_pu_bacteria	2855676851	2855680230	240
36	iso_pu_bacteria	2857288857	2857289852	240
37	iso_pu_bacteria	2858848962	2858852651	240
38	iso_pu_bacteria	2858882152	2858886658	240
39	iso_pu_bacteria	2858888857	2858890081	240
40	iso_pu_bacteria	2858895516	2858896228	240
41	iso_pu_bacteria	2869061728	2869066935	240
42	iso_pu_bacteria	2869068681	2869072190	240
43	iso_pu_bacteria	2880489317	2880491506	240
44	iso_pu_bacteria	2880495981	2880500950	240
45	iso_pu_bacteria	2929226422	2929229471	240
46	iso_pu_bacteria	8003830390	8003830802	240
47	3300020070	Ga0206356_10227963	Ga0206356_102279632	241
48	3300020078	Ga0206352_10135391	Ga0206352_101353911	241
49	3300020081	Ga0206354_11185805	Ga0206354_111858053	241
50	3300020082	Ga0206353_11908902	Ga0206353_119089022	241
51	3300022467	Ga0224712_10000207	Ga0224712_100002076	241
52	3300046473	Ga0495582_0112567	Ga0495582_0112567_56_874	242
53	3300046477	Ga0495664_0099220	Ga0495664_0099220_280_1098	242
54	3300046543	Ga0495645_0176467	Ga0495645_0176467_638_1456	242
55	3300048905	Ga0496102_0011659	Ga0496102_0011659_5207_6025	242
56	3300048907	Ga0496104_0015012	Ga0496104_0015012_615_1433	242
57	3300048908	Ga0496105_0001162	Ga0496105_0001162_17286_18104	242
58	3300048911	Ga0496108_0109905	Ga0496108_0109905_962_1780	242
59	3300048912	Ga0496109_0007598	Ga0496109_0007598_122_940	242
60	3300048913	Ga0496110_0007669	Ga0496110_0007669_7241_8059	242
61	3300048914	Ga0496111_0051927	Ga0496111_0051927_550_1368	242
62	3300048916	Ga0496113_0055612	Ga0496113_0055612_868_1686	242
63	3300048917	Ga0496114_0091525	Ga0496114_0091525_1127_1945	242
64	3300005327	Ga0070658_10054472	Ga0070658_100544723	245
65	3300013105	Ga0157369_10101819	Ga0157369_101018193	245
66	3300020069	Ga0197907_10353420	Ga0197907_103534203	245
67	3300025909	Ga0207705_10269669	Ga0207705_102696692	245
68	3300031730	Ga0307516_10295257	Ga0307516_102952572	246
69	3300041404	Ga0439436_0007450	Ga0439436_0007450_2192_2950	246
70	3300041406	Ga0439439_0012446	Ga0439439_0012446_624_1382	246
71	3300041411	Ga0439466_0002280	Ga0439466_0002280_2495_3253	246
72	3300042007	Ga0439449_0002467	Ga0439449_0002467_4521_5279	246
73	3300042014	Ga0439457_001420	Ga0439457_001420_4493_5251	246
74	iso_pu_bacteria	2869048445	2869052522	246
75	3300009545	Ga0105237_10057128	Ga0105237_100571283	247
76	3300013105	Ga0157369_10008156	Ga0157369_1000815612	247
77	3300013105	Ga0157369_10060928	Ga0157369_100609285	247
78	3300025912	Ga0207707_10449952	Ga0207707_104499522	247
79	3300013105	Ga0157369_10032317	Ga0157369_100323173	249
80	3300003578	Ga0006562J51391_1095372	Ga0006562J51391_10953721	250
81	3300022467	Ga0224712_10003635	Ga0224712_100036353	250
82	iso_pu_bacteria	2784132148	2784586889	251
83	iso_pu_bacteria	2808606448	2809230456	251
84	iso_pu_bacteria	2862178590	2862186115	251
85	iso_pu_bacteria	2912757875	2912759030	251
86	iso_pu_bacteria	2947224130	2947231663	251
87	iso_pu_bacteria	3006493962	3006495196	251
88	iso_pu_bacteria	8023623736	8023628218	251
89	3300013308	Ga0157375_10117296	Ga0157375_101172963	252
90	3300014968	Ga0157379_10411355	Ga0157379_104113551	252
91	3300014969	Ga0157376_10043603	Ga0157376_100436034	252
92	3300014969	Ga0157376_10700459	Ga0157376_107004591	252
93	3300025927	Ga0207687_10107163	Ga0207687_101071632	252
94	3300031616	Ga0307508_10173209	Ga0307508_101732093	252
95	3300046519	Ga0495632_0137195	Ga0495632_0137195_277_1122	252
96	3300046674	Ga0495588_0183763	Ga0495588_0183763_140_1015	252
97	3300046810	Ga0495660_0101205	Ga0495660_0101205_534_1379	252
98	3300047447	Ga0495685_000083	Ga0495685_000083_17937_18782	252
99	3300047470	Ga0495681_0064321	Ga0495681_0064321_126_971	252
100	3300048917	Ga0496114_0592813	Ga0496114_0592813_62_937	252
101	3300053079	Ga0500610_0041201	Ga0500610_0041201_62_907	252
102	3300053085	Ga0495619_0088477	Ga0495619_0088477_916_1791	252
103	3300053086	Ga0500578_0315688	Ga0500578_0315688_42_887	252
104	3300053090	Ga0500646_0020404	Ga0500646_0020404_365_1210	252
105	3300053123	Ga0500614_006505	Ga0500614_006505_26_871	252
106	3300053129	Ga0500628_004016	Ga0500628_004016_734_1579	252
107	3300053131	Ga0500652_039746	Ga0500652_039746_862_1707	252
108	3300053134	Ga0500658_0007410	Ga0500658_0007410_752_1597	252
109	3300053137	Ga0500561_0001076	Ga0500561_0001076_857_1702	252
110	3300053143	Ga0500579_050803	Ga0500579_050803_780_1625	252
111	3300053149	Ga0500600_0054051	Ga0500600_0054051_1240_2085	252
112	3300053153	Ga0500616_0010802	Ga0500616_0010802_3606_4451	252
113	3300053161	Ga0500634_0056624	Ga0500634_0056624_817_1662	252
114	3300053739	Ga0500587_002765	Ga0500587_002765_614_1459	252
115	3300006844	Ga0075428_100013776	Ga0075428_1000137768	253
116	3300009551	Ga0105238_10188565	Ga0105238_101885652	253
117	3300013105	Ga0157369_10564802	Ga0157369_105648021	253
118	3300013307	Ga0157372_10000022	Ga0157372_1000002229	253
119	3300037312	Ga0395899_0174166	Ga0395899_0174166_599_1387	253
120	3300037418	Ga0395900_0090663	Ga0395900_0090663_597_1385	253
121	3300037466	Ga0395898_0051702	Ga0395898_0051702_3056_3844	253
122	3300037466	Ga0395898_0268549	Ga0395898_0268549_223_1011	253
123	3300037466	Ga0395898_0338596	Ga0395898_0338596_606_1394	253
124	3300038443	Ga0395901_0021270	Ga0395901_0021270_229_1017	253
125	3300038443	Ga0395901_0100791	Ga0395901_0100791_1294_2082	253
126	3300038443	Ga0395901_0584686	Ga0395901_0584686_195_983	253
127	3300044658	Ga0466972_0164998	Ga0466972_0164998_172_960	253
128	3300044694	Ga0466963_0100523	Ga0466963_0100523_540_1373	253
129	3300044901	Ga0466960_0009284	Ga0466960_0009284_1975_2763	253
130	3300044901	Ga0466960_0265021	Ga0466960_0265021_82_870	253
131	3300045049	Ga0466959_0138220	Ga0466959_0138220_850_1638	253
132	3300045836	Ga0466958_0134159	Ga0466958_0134159_152_940	253
133	3300045976	Ga0466967_0287395	Ga0466967_0287395_85_873	253
134	3300045976	Ga0466967_0557100	Ga0466967_0557100_201_989	253
135	3300046476	Ga0495662_0195422	Ga0495662_0195422_21_794	253
136	3300046559	Ga0495667_0305959	Ga0495667_0305959_155_928	253
137	3300047317	Ga0495604_0003776	Ga0495604_0003776_171_944	253
138	3300047444	Ga0495675_0042531	Ga0495675_0042531_178_951	253
139	3300048915	Ga0496112_0589519	Ga0496112_0589519_175_963	253
140	3300050510	nmdc:mga06r32_205848_c1	nmdc:mga06r32_205848_c1_951_1733	253
141	iso_pu_bacteria	2547132424	2548695668	253
142	iso_pu_bacteria	2773857933	2774905010	253
143	3300044684	Ga0466966_0184619	Ga0466966_0184619_96_890	254
144	3300044901	Ga0466960_0140513	Ga0466960_0140513_373_1164	254
145	3300045836	Ga0466958_0129458	Ga0466958_0129458_698_1504	254
146	3300045976	Ga0466967_0279706	Ga0466967_0279706_536_1369	254
147	3300046683	Ga0495658_0146435	Ga0495658_0146435_473_1258	254
148	3300061719	Ga0466962_0135343	Ga0466962_0135343_209_1015	254
149	3300001989	JGI24739J22299_10015454	JGI24739J22299_100154543	255
150	3300001989	JGI24739J22299_10030486	JGI24739J22299_100304863	255
151	3300002067	JGI24735J21928_10014696	JGI24735J21928_100146963	255
152	3300003215	JGI25153J46596_10025062	JGI25153J46596_100250621	255
153	3300003320	rootH2_10159480	rootH2_101594802	255
154	3300003322	rootL2_10044287	rootL2_100442877	255
155	3300003323	rootH1_10043838	rootH1_100438381	255
156	3300003578	Ga0006562J51391_1005944	Ga0006562J51391_10059444	255
157	3300004803	Ga0058862_12659626	Ga0058862_126596263	255
158	3300005539	Ga0068853_100481019	Ga0068853_1004810192	255
159	3300005983	Ga0081540_1051686	Ga0081540_10516862	255
160	3300006048	Ga0075363_100033964	Ga0075363_1000339642	255
161	3300006178	Ga0075367_10000437	Ga0075367_100004378	255
162	3300006847	Ga0075431_100535396	Ga0075431_1005353961	255
163	3300009551	Ga0105238_10277603	Ga0105238_102776032	255
164	3300010375	Ga0105239_11092419	Ga0105239_110924191	255
165	3300011119	Ga0105246_10008635	Ga0105246_100086355	255
166	3300014497	Ga0182008_10000469	Ga0182008_1000046916	255
167	3300015261	Ga0182006_1017588	Ga0182006_10175884	255
168	3300015262	Ga0182007_10000272	Ga0182007_1000027224	255
169	3300015688	Ga0183367_1010	Ga0183367_1010211	255
170	3300020077	Ga0206351_10155792	Ga0206351_101557922	255
171	3300020080	Ga0206350_10199153	Ga0206350_101991532	255
172	3300025297	Ga0209758_1003473	Ga0209758_10034738	255
173	3300025302	Ga0207426_1003780	Ga0207426_10037804	255
174	3300025302	Ga0207426_1007787	Ga0207426_10077871	255
175	3300025924	Ga0207694_10337867	Ga0207694_103378672	255
176	3300028786	Ga0307517_10014852	Ga0307517_100148524	255
177	3300028794	Ga0307515_10049346	Ga0307515_100493465	255
178	3300030500	Ga0268256_1028373	Ga0268256_10283732	255
179	3300030521	Ga0307511_10028133	Ga0307511_100281332	255
180	3300030521	Ga0307511_10037099	Ga0307511_100370994	255
181	3300030521	Ga0307511_10133687	Ga0307511_101336872	255
182	3300030522	Ga0307512_10038202	Ga0307512_100382022	255
183	3300031456	Ga0307513_10032752	Ga0307513_100327523	255
184	3300031507	Ga0307509_10171486	Ga0307509_101714863	255
185	3300031649	Ga0307514_10059386	Ga0307514_100593862	255
186	3300031730	Ga0307516_10008573	Ga0307516_100085739	255
187	3300031730	Ga0307516_10022988	Ga0307516_100229885	255
188	3300031838	Ga0307518_10073878	Ga0307518_100738783	255
189	3300031838	Ga0307518_10116972	Ga0307518_101169722	255
190	3300032002	Ga0307416_100383266	Ga0307416_1003832662	255
191	3300033179	Ga0307507_10101532	Ga0307507_101015323	255
192	3300033180	Ga0307510_10030880	Ga0307510_100308805	255
193	3300033180	Ga0307510_10045416	Ga0307510_100454162	255
194	3300037466	Ga0395898_0007813	Ga0395898_0007813_2095_2871	255
195	3300037466	Ga0395898_0090963	Ga0395898_0090963_971_1747	255
196	3300037853	Ga0436364_0703567	Ga0436364_0703567_10844_11620	255
197	3300038443	Ga0395901_0026900	Ga0395901_0026900_1559_2335	255
198	3300041404	Ga0439436_0010450	Ga0439436_0010450_468_1244	255
199	3300041406	Ga0439439_0004207	Ga0439439_0004207_255_1031	255
200	3300041494	Ga0451837_0668465	Ga0451837_0668465_1007_1783	255
201	3300041498	Ga0451841_0838973	Ga0451841_0838973_33_809	255
202	3300041999	Ga0439433_0037618	Ga0439433_0037618_85_861	255
203	3300042002	Ga0439442_033218	Ga0439442_033218_259_1035	255
204	3300042007	Ga0439449_0013094	Ga0439449_0013094_1626_2402	255
205	3300042007	Ga0439449_0092995	Ga0439449_0092995_255_1031	255
206	3300042014	Ga0439457_003242	Ga0439457_003242_3233_4009	255
207	3300042145	Ga0450906_003507	Ga0450906_003507_2147_2923	255
208	3300044658	Ga0466972_0002080	Ga0466972_0002080_8944_9720	255
209	3300044658	Ga0466972_0014500	Ga0466972_0014500_1235_2011	255
210	3300044658	Ga0466972_0067431	Ga0466972_0067431_33_809	255
211	3300044683	Ga0466965_0001805	Ga0466965_0001805_7763_8539	255
212	3300044684	Ga0466966_0027735	Ga0466966_0027735_1155_1931	255
213	3300044693	Ga0466961_0012258	Ga0466961_0012258_120_896	255
214	3300044693	Ga0466961_0063854	Ga0466961_0063854_782_1558	255
215	3300044694	Ga0466963_0001757	Ga0466963_0001757_7910_8686	255
216	3300044694	Ga0466963_0011813	Ga0466963_0011813_2189_2965	255
217	3300044694	Ga0466963_0126915	Ga0466963_0126915_593_1369	255
218	3300044706	Ga0466964_0007192	Ga0466964_0007192_1973_2749	255
219	3300044719	Ga0466971_0062645	Ga0466971_0062645_123_899	255
220	3300044735	Ga0466968_0218282	Ga0466968_0218282_46_822	255
221	3300044765	Ga0466970_0004123	Ga0466970_0004123_3773_4549	255
222	3300044765	Ga0466970_0127495	Ga0466970_0127495_170_946	255
223	3300044842	Ga0466957_0006364	Ga0466957_0006364_3802_4578	255
224	3300044901	Ga0466960_0004134	Ga0466960_0004134_4583_5359	255
225	3300045049	Ga0466959_0002294	Ga0466959_0002294_337_1113	255
226	3300045836	Ga0466958_0006908	Ga0466958_0006908_3466_4242	255
227	3300045836	Ga0466958_0313508	Ga0466958_0313508_156_932	255
228	3300045976	Ga0466967_0008745	Ga0466967_0008745_1621_2397	255
229	3300045976	Ga0466967_0026666	Ga0466967_0026666_2548_3324	255
230	3300045976	Ga0466967_0194790	Ga0466967_0194790_225_1001	255
231	3300045976	Ga0466967_0233117	Ga0466967_0233117_948_1724	255
232	3300046452	Ga0495617_018698	Ga0495617_018698_459_1235	255
233	3300046454	Ga0495592_0094156	Ga0495592_0094156_298_1074	255
234	3300046454	Ga0495592_0115524	Ga0495592_0115524_658_1434	255
235	3300046455	Ga0495603_0002914	Ga0495603_0002914_207_983	255
236	3300046457	Ga0495590_0014915	Ga0495590_0014915_909_1685	255
237	3300046459	Ga0495629_0003350	Ga0495629_0003350_9112_9888	255
238	3300046459	Ga0495629_0005267	Ga0495629_0005267_2235_3011	255
239	3300046459	Ga0495629_0102998	Ga0495629_0102998_289_1065	255
240	3300046459	Ga0495629_0135632	Ga0495629_0135632_241_1017	255
241	3300046460	Ga0495638_0039267	Ga0495638_0039267_1505_2281	255
242	3300046460	Ga0495638_0147065	Ga0495638_0147065_212_988	255
243	3300046460	Ga0495638_0165081	Ga0495638_0165081_425_1201	255
244	3300046462	Ga0495651_0000944	Ga0495651_0000944_7271_8047	255
245	3300046462	Ga0495651_0057878	Ga0495651_0057878_1993_2769	255
246	3300046472	Ga0495580_0169557	Ga0495580_0169557_45_821	255
247	3300046473	Ga0495582_0024756	Ga0495582_0024756_815_1591	255
248	3300046473	Ga0495582_0123211	Ga0495582_0123211_383_1159	255
249	3300046476	Ga0495662_0005657	Ga0495662_0005657_3350_4126	255
250	3300046476	Ga0495662_0016224	Ga0495662_0016224_2596_3372	255
251	3300046477	Ga0495664_0002564	Ga0495664_0002564_6963_7739	255
252	3300046477	Ga0495664_0094295	Ga0495664_0094295_553_1329	255
253	3300046492	Ga0495585_0141198	Ga0495585_0141198_136_912	255
254	3300046499	Ga0495594_0000664	Ga0495594_0000664_14849_15625	255
255	3300046499	Ga0495594_0044060	Ga0495594_0044060_1518_2294	255
256	3300046499	Ga0495594_0110881	Ga0495594_0110881_63_839	255
257	3300046500	Ga0495596_0096775	Ga0495596_0096775_225_1001	255
258	3300046501	Ga0495607_0045690	Ga0495607_0045690_873_1649	255
259	3300046506	Ga0495583_0061689	Ga0495583_0061689_203_979	255
260	3300046516	Ga0495628_0057127	Ga0495628_0057127_83_859	255
261	3300046517	Ga0495630_0018301	Ga0495630_0018301_69_845	255
262	3300046518	Ga0495631_0037287	Ga0495631_0037287_193_969	255
263	3300046522	Ga0495643_0004988	Ga0495643_0004988_5778_6554	255
264	3300046526	Ga0495666_0003643	Ga0495666_0003643_6842_7618	255
265	3300046529	Ga0495652_0006889	Ga0495652_0006889_7664_8440	255
266	3300046529	Ga0495652_0071550	Ga0495652_0071550_903_1679	255
267	3300046530	Ga0495654_0031547	Ga0495654_0031547_487_1263	255
268	3300046533	Ga0495640_0025320	Ga0495640_0025320_3094_3870	255
269	3300046536	Ga0495587_0003360	Ga0495587_0003360_4649_5425	255
270	3300046538	Ga0495609_0054283	Ga0495609_0054283_568_1344	255
271	3300046542	Ga0495597_0024988	Ga0495597_0024988_557_1333	255
272	3300046543	Ga0495645_0074573	Ga0495645_0074573_1057_1833	255
273	3300046543	Ga0495645_0092279	Ga0495645_0092279_465_1241	255
274	3300046557	Ga0495622_0009455	Ga0495622_0009455_3583_4359	255
275	3300046558	Ga0495633_0060508	Ga0495633_0060508_62_838	255
276	3300046559	Ga0495667_0197370	Ga0495667_0197370_45_821	255
277	3300046642	Ga0495634_0001800	Ga0495634_0001800_16666_17442	255
278	3300046642	Ga0495634_0092299	Ga0495634_0092299_960_1736	255
279	3300046660	Ga0495625_0100891	Ga0495625_0100891_66_842	255
280	3300046663	Ga0495635_0007200	Ga0495635_0007200_4344_5120	255
281	3300046674	Ga0495588_0002386	Ga0495588_0002386_1576_2352	255
282	3300046675	Ga0495657_0001382	Ga0495657_0001382_4335_5111	255
283	3300046675	Ga0495657_0055631	Ga0495657_0055631_310_1086	255
284	3300046675	Ga0495657_0066034	Ga0495657_0066034_683_1459	255
285	3300046678	Ga0495599_0090962	Ga0495599_0090962_621_1397	255
286	3300046680	Ga0495646_0003075	Ga0495646_0003075_9201_9977	255
287	3300046683	Ga0495658_0320536	Ga0495658_0320536_97_873	255
288	3300046689	Ga0495613_0009408	Ga0495613_0009408_6340_7116	255
289	3300046689	Ga0495613_0009524	Ga0495613_0009524_4091_4867	255
290	3300046689	Ga0495613_0072375	Ga0495613_0072375_884_1660	255
291	3300046689	Ga0495613_0161692	Ga0495613_0161692_660_1436	255
292	3300046694	Ga0495649_0088435	Ga0495649_0088435_720_1496	255
293	3300046794	Ga0495589_0082113	Ga0495589_0082113_91_867	255
294	3300046794	Ga0495589_0152220	Ga0495589_0152220_201_977	255
295	3300046809	Ga0495600_0038029	Ga0495600_0038029_1658_2434	255
296	3300047315	Ga0495581_0016635	Ga0495581_0016635_2883_3659	255
297	3300047315	Ga0495581_0126477	Ga0495581_0126477_71_847	255
298	3300047317	Ga0495604_0001052	Ga0495604_0001052_9823_10599	255
299	3300047317	Ga0495604_0077373	Ga0495604_0077373_653_1429	255
300	3300047318	Ga0495636_0063199	Ga0495636_0063199_758_1534	255
301	3300047319	Ga0495674_0094019	Ga0495674_0094019_1685_2461	255
302	3300047319	Ga0495674_0179425	Ga0495674_0179425_259_1035	255
303	3300047320	Ga0495672_0048304	Ga0495672_0048304_504_1280	255
304	3300047321	Ga0495676_0001568	Ga0495676_0001568_10344_11120	255
305	3300047321	Ga0495676_0022829	Ga0495676_0022829_342_1118	255
306	3300047321	Ga0495676_0083198	Ga0495676_0083198_1458_2234	255
307	3300047321	Ga0495676_0166810	Ga0495676_0166810_694_1470	255
308	3300047322	Ga0495680_0039070	Ga0495680_0039070_1980_2756	255
309	3300047443	Ga0495687_024522	Ga0495687_024522_927_1703	255
310	3300047444	Ga0495675_0006434	Ga0495675_0006434_4351_5127	255
311	3300047444	Ga0495675_0027104	Ga0495675_0027104_80_856	255
312	3300047447	Ga0495685_003900	Ga0495685_003900_2251_3027	255
313	3300047447	Ga0495685_012628	Ga0495685_012628_1231_2007	255
314	3300047470	Ga0495681_0004869	Ga0495681_0004869_4609_5385	255
315	3300047472	Ga0495686_0077803	Ga0495686_0077803_795_1571	255
316	3300047673	Ga0495593_0000347	Ga0495593_0000347_1010_1786	255
317	3300047673	Ga0495593_0034819	Ga0495593_0034819_734_1510	255
318	3300048088	Ga0495602_0021527	Ga0495602_0021527_4561_5337	255
319	3300048088	Ga0495602_0038949	Ga0495602_0038949_236_1012	255
320	3300048089	Ga0495614_0002065	Ga0495614_0002065_6326_7102	255
321	3300048089	Ga0495614_0010448	Ga0495614_0010448_2664_3440	255
322	3300048091	Ga0495626_0013932	Ga0495626_0013932_2556_3332	255
323	3300048909	Ga0496106_0094462	Ga0496106_0094462_738_1514	255
324	3300049459	Ga0495678_018257	Ga0495678_018257_918_1694	255
325	3300049568	Ga0501031_0003677	Ga0501031_0003677_642_1418	255
326	3300049568	Ga0501031_0293592	Ga0501031_0293592_259_1035	255
327	3300049569	Ga0501032_0037176	Ga0501032_0037176_2525_3301	255
328	3300049570	Ga0501033_0013555	Ga0501033_0013555_2539_3315	255
329	3300049570	Ga0501033_0063437	Ga0501033_0063437_1114_1890	255
330	3300049571	Ga0501034_0021243	Ga0501034_0021243_3474_4250	255
331	3300049571	Ga0501034_0022814	Ga0501034_0022814_2157_2933	255
332	3300049573	Ga0501037_0013065	Ga0501037_0013065_3408_4184	255
333	3300049574	Ga0501038_0002967	Ga0501038_0002967_7533_8309	255
334	3300049574	Ga0501038_0118916	Ga0501038_0118916_234_1010	255
335	3300049575	Ga0501039_0150695	Ga0501039_0150695_501_1277	255
336	3300049578	Ga0501042_0030634	Ga0501042_0030634_2155_2931	255
337	3300049579	Ga0501043_0030641	Ga0501043_0030641_2013_2789	255
338	3300049580	Ga0501046_0029126	Ga0501046_0029126_2590_3366	255
339	3300049581	Ga0501047_0033000	Ga0501047_0033000_1765_2541	255
340	3300049581	Ga0501047_0116647	Ga0501047_0116647_1640_2416	255
341	3300049582	Ga0501048_0480639	Ga0501048_0480639_82_858	255
342	3300049742	Ga0501080_0280959	Ga0501080_0280959_505_1281	255
343	3300049744	Ga0501083_0197281	Ga0501083_0197281_29_820	255
344	3300049744	Ga0501083_0249076	Ga0501083_0249076_306_1082	255
345	3300049822	Ga0501035_0005855	Ga0501035_0005855_1127_1903	255
346	3300049822	Ga0501035_0064820	Ga0501035_0064820_619_1395	255
347	3300049823	Ga0501044_0019737	Ga0501044_0019737_2349_3125	255
348	3300049823	Ga0501044_0064716	Ga0501044_0064716_2458_3234	255
349	3300049823	Ga0501044_0090124	Ga0501044_0090124_2095_2871	255
350	3300050492	nmdc:mga0yw44_113626_c1	nmdc:mga0yw44_113626_c1_499_1275	255
351	3300050494	nmdc:mga06z11_308_c1	nmdc:mga06z11_308_c1_8110_8886	255
352	3300050510	nmdc:mga06r32_437432_c1	nmdc:mga06r32_437432_c1_123_908	255
353	3300053078	Ga0495612_0014531	Ga0495612_0014531_445_1221	255
354	3300053088	Ga0500644_0057180	Ga0500644_0057180_459_1235	255
355	3300053095	Ga0500640_000125	Ga0500640_000125_11996_12772	255
356	3300053123	Ga0500614_057278	Ga0500614_057278_244_1020	255
357	3300053140	Ga0500573_0132999	Ga0500573_0132999_437_1213	255
358	3300053157	Ga0500624_008893	Ga0500624_008893_127_903	255
359	3300059643	Ga0587072_018113	Ga0587072_018113_143_919	255
360	3300061719	Ga0466962_0003535	Ga0466962_0003535_4309_5085	255
361	iso_pu_bacteria	2684623035	2686537079	255
362	iso_pu_bacteria	2684623036	2686544588	255
363	iso_pu_bacteria	2687453737	2689960064	255
364	iso_pu_bacteria	2687453743	2689991945	255
365	iso_pu_bacteria	2710264753	2710603382	255
366	iso_pu_bacteria	2919713450	2919714272	255
367	3300005329	Ga0070683_100008738	Ga0070683_1000087384	256
368	3300005334	Ga0068869_100040788	Ga0068869_1000407883	256
369	3300005338	Ga0068868_100023431	Ga0068868_1000234313	256
370	3300005344	Ga0070661_100025133	Ga0070661_1000251333	256
371	3300005345	Ga0070692_10009211	Ga0070692_100092112	256
372	3300005354	Ga0070675_100003384	Ga0070675_1000033843	256
373	3300005441	Ga0070700_100028989	Ga0070700_1000289892	256
374	3300005457	Ga0070662_100019265	Ga0070662_1000192654	256
375	3300005535	Ga0070684_100013088	Ga0070684_1000130883	256
376	3300005564	Ga0070664_100000503	Ga0070664_10000050312	256
377	3300005577	Ga0068857_100049843	Ga0068857_1000498434	256
378	3300005616	Ga0068852_100059469	Ga0068852_1000594693	256
379	3300005842	Ga0068858_100000014	Ga0068858_10000001430	256
380	3300005844	Ga0068862_100012690	Ga0068862_1000126903	256
381	3300005983	Ga0081540_1000270	Ga0081540_100027021	256
382	3300006881	Ga0068865_100030584	Ga0068865_1000305843	256
383	3300009094	Ga0111539_10036997	Ga0111539_100369974	256
384	3300009098	Ga0105245_10026455	Ga0105245_100264553	256
385	3300009101	Ga0105247_10001130	Ga0105247_1000113015	256
386	3300014968	Ga0157379_10000548	Ga0157379_1000054820	256
387	3300025900	Ga0207710_10000035	Ga0207710_10000035164	256
388	3300025901	Ga0207688_10119007	Ga0207688_101190071	256
389	3300025920	Ga0207649_10096843	Ga0207649_100968432	256
390	3300025926	Ga0207659_10028765	Ga0207659_100287654	256
391	3300025927	Ga0207687_10013342	Ga0207687_100133424	256
392	3300025932	Ga0207690_10011598	Ga0207690_100115981	256
393	3300025933	Ga0207706_10028805	Ga0207706_100288054	256
394	3300025940	Ga0207691_10386575	Ga0207691_103865752	256
395	3300025942	Ga0207689_10022400	Ga0207689_100224003	256
396	3300025944	Ga0207661_10056643	Ga0207661_100566433	256
397	3300025945	Ga0207679_10019490	Ga0207679_100194902	256
398	3300026023	Ga0207677_10002872	Ga0207677_100028722	256
399	3300026035	Ga0207703_10000005	Ga0207703_10000005149	256
400	3300026067	Ga0207678_10006294	Ga0207678_100062944	256
401	3300026075	Ga0207708_10028997	Ga0207708_100289973	256
402	3300026088	Ga0207641_10404852	Ga0207641_104048522	256
403	3300026116	Ga0207674_10025323	Ga0207674_100253232	256
404	3300026121	Ga0207683_10206801	Ga0207683_102068013	256
405	3300026142	Ga0207698_10099992	Ga0207698_100999923	256
406	3300027907	Ga0207428_10057782	Ga0207428_100577821	256
407	3300028380	Ga0268265_10040402	Ga0268265_100404023	256
408	3300039450	Ga0436363_0097891	Ga0436363_0097891_69_893	256
409	3300046501	Ga0495607_0060344	Ga0495607_0060344_159_983	256
410	3300047323	Ga0495683_0000282	Ga0495683_0000282_11917_12741	256
411	3300048922	Ga0496119_0013979	Ga0496119_0013979_4032_4808	256
412	3300048924	Ga0496121_0008493	Ga0496121_0008493_803_1579	256
413	3300049568	Ga0501031_0009903	Ga0501031_0009903_905_1750	256
414	3300049568	Ga0501031_0033966	Ga0501031_0033966_2166_3014	256
415	3300049568	Ga0501031_0182415	Ga0501031_0182415_65_910	256
416	3300049569	Ga0501032_0001631	Ga0501032_0001631_15657_16502	256
417	3300049570	Ga0501033_0013481	Ga0501033_0013481_4920_5765	256
418	3300049570	Ga0501033_0193076	Ga0501033_0193076_590_1438	256
419	3300049571	Ga0501034_0010356	Ga0501034_0010356_7502_8347	256
420	3300049572	Ga0501036_0003908	Ga0501036_0003908_4457_5302	256
421	3300049572	Ga0501036_0038253	Ga0501036_0038253_891_1739	256
422	3300049573	Ga0501037_0000485	Ga0501037_0000485_5541_6386	256
423	3300049574	Ga0501038_0006916	Ga0501038_0006916_1987_2832	256
424	3300049574	Ga0501038_0078801	Ga0501038_0078801_1031_1879	256
425	3300049576	Ga0501040_0033875	Ga0501040_0033875_1317_2162	256
426	3300049576	Ga0501040_0131421	Ga0501040_0131421_289_1086	256
427	3300049577	Ga0501041_0029059	Ga0501041_0029059_1188_2033	256
428	3300049579	Ga0501043_0001629	Ga0501043_0001629_1987_2832	256
429	3300049579	Ga0501043_0016273	Ga0501043_0016273_1261_2109	256
430	3300049580	Ga0501046_0004382	Ga0501046_0004382_1061_1906	256
431	3300049581	Ga0501047_0000483	Ga0501047_0000483_27323_28168	256
432	3300049581	Ga0501047_0022113	Ga0501047_0022113_441_1289	256
433	3300049584	Ga0501068_0005310	Ga0501068_0005310_5068_5913	256
434	3300049586	Ga0501070_0014789	Ga0501070_0014789_1265_2110	256
435	3300049587	Ga0501071_0108601	Ga0501071_0108601_50_895	256
436	3300049588	Ga0501072_0002157	Ga0501072_0002157_1173_2018	256
437	3300049590	Ga0501074_0028095	Ga0501074_0028095_1342_2187	256
438	3300049592	Ga0501076_0035913	Ga0501076_0035913_2843_3688	256
439	3300049593	Ga0501077_0068241	Ga0501077_0068241_1380_2225	256
440	3300049822	Ga0501035_0001036	Ga0501035_0001036_4566_5411	256
441	3300049822	Ga0501035_0005136	Ga0501035_0005136_9869_10717	256
442	3300049823	Ga0501044_0000571	Ga0501044_0000571_27408_28253	256
443	3300049823	Ga0501044_0074358	Ga0501044_0074358_2312_3160	256
444	3300050510	nmdc:mga06r32_8828_c1	nmdc:mga06r32_8828_c1_19_810	256
445	3300054114	Ga0501084_0004824	Ga0501084_0004824_7480_8325	256
446	3300060353	Ga0501082_0001376	Ga0501082_0001376_14134_14979	256
447	3300061734	Ga0530510_0006083	Ga0530510_0006083_6369_7214	256
448	iso_pu_bacteria	2501939600	2501944436	256
449	iso_pu_bacteria	2772190715	2772646471	256
450	iso_pu_bacteria	2855683550	2855688377	256
451	iso_pu_bacteria	2867312974	2867317875	256
452	iso_pu_bacteria	2867319477	2867319571	256
453	iso_pu_bacteria	2929219909	2929223121	256
454	iso_pu_bacteria	2996221748	2996223252	256
455	iso_pu_bacteria	8054704163	8054708053	256
456	iso_pu_bacteria	8055412473	8055414915	256
457	3300005445	Ga0070708_100443841	Ga0070708_1004438411	257
458	3300005468	Ga0070707_100038943	Ga0070707_1000389433	257
459	3300005617	Ga0068859_100000219	Ga0068859_1000002196	257
460	3300005844	Ga0068862_100000106	Ga0068862_10000010624	257
461	3300006931	Ga0097620_100000219	Ga0097620_1000002196	257
462	3300009101	Ga0105247_10000178	Ga0105247_1000017819	257
463	3300009177	Ga0105248_10000018	Ga0105248_10000018155	257
464	3300009177	Ga0105248_10005986	Ga0105248_100059869	257
465	3300009553	Ga0105249_10042078	Ga0105249_100420781	257
466	3300014325	Ga0163163_10010243	Ga0163163_100102434	257
467	3300014325	Ga0163163_10175938	Ga0163163_101759382	257
468	3300014968	Ga0157379_10045488	Ga0157379_100454884	257
469	3300025922	Ga0207646_10276518	Ga0207646_102765182	257
470	3300028380	Ga0268265_10000008	Ga0268265_1000000857	257
471	3300030521	Ga0307511_10012825	Ga0307511_100128259	257
472	3300031548	Ga0307408_100106862	Ga0307408_1001068622	257
473	3300031616	Ga0307508_10035747	Ga0307508_100357473	257
474	3300031852	Ga0307410_10035438	Ga0307410_100354381	257
475	3300031903	Ga0307407_10047932	Ga0307407_100479322	257
476	3300033180	Ga0307510_10129047	Ga0307510_101290473	257
477	3300048919	Ga0496116_0001289	Ga0496116_0001289_4113_4892	257
478	3300048920	Ga0496117_0118562	Ga0496117_0118562_323_1102	257
479	3300048921	Ga0496118_0006671	Ga0496118_0006671_4118_4897	257
480	3300048921	Ga0496118_0008596	Ga0496118_0008596_813_1592	257
481	3300048922	Ga0496119_0002215	Ga0496119_0002215_16790_17569	257
482	3300048923	Ga0496120_0000203	Ga0496120_0000203_63471_64250	257
483	3300049579	Ga0501043_0055245	Ga0501043_0055245_2103_3014	257
484	3300053153	Ga0500616_0025938	Ga0500616_0025938_1396_2175	257
485	3300005338	Ga0068868_100280350	Ga0068868_1002803502	258
486	3300005435	Ga0070714_100630833	Ga0070714_1006308331	258
487	3300005937	Ga0081455_10034592	Ga0081455_100345924	258
488	3300031507	Ga0307509_10010346	Ga0307509_100103466	258
489	3300032126	Ga0307415_100353429	Ga0307415_1003534292	258
490	3300042145	Ga0450906_019958	Ga0450906_019958_49_843	258
491	3300042146	Ga0450907_016484	Ga0450907_016484_73_867	258
492	3300046461	Ga0495641_0018286	Ga0495641_0018286_806_1594	258
493	3300046684	Ga0495669_0052901	Ga0495669_0052901_419_1222	258
494	3300049570	Ga0501033_0113581	Ga0501033_0113581_207_1118	258
495	3300049571	Ga0501034_0043852	Ga0501034_0043852_3540_4451	258
496	3300049581	Ga0501047_0029536	Ga0501047_0029536_2978_3889	258
497	3300049586	Ga0501070_0024820	Ga0501070_0024820_3822_4733	258
498	3300049588	Ga0501072_0432947	Ga0501072_0432947_10_921	258
499	3300049824	Ga0501045_0353697	Ga0501045_0353697_142_1053	258
500	iso_pu_bacteria	8047710418	8047720059	258
501	3300005456	Ga0070678_100016286	Ga0070678_1000162866	259
502	3300005530	Ga0070679_100108881	Ga0070679_1001088812	259
503	3300005549	Ga0070704_100219254	Ga0070704_1002192542	259
504	3300005983	Ga0081540_1001282	Ga0081540_10012828	259
505	3300009148	Ga0105243_10048303	Ga0105243_100483032	259
506	3300009176	Ga0105242_10015166	Ga0105242_100151663	259
507	3300009551	Ga0105238_10130262	Ga0105238_101302622	259
508	3300009553	Ga0105249_10026776	Ga0105249_100267763	259
509	3300013297	Ga0157378_10006006	Ga0157378_100060064	259
510	3300013306	Ga0163162_10039098	Ga0163162_100390983	259
511	3300013307	Ga0157372_10385490	Ga0157372_103854902	259
512	3300013308	Ga0157375_10037667	Ga0157375_100376674	259
513	3300014326	Ga0157380_10101988	Ga0157380_101019882	259
514	3300017792	Ga0163161_10115007	Ga0163161_101150073	259
515	3300025899	Ga0207642_10017156	Ga0207642_100171563	259
516	3300025921	Ga0207652_10112865	Ga0207652_101128653	259
517	3300025924	Ga0207694_10101152	Ga0207694_101011522	259
518	3300025927	Ga0207687_10364100	Ga0207687_103641002	259
519	3300025935	Ga0207709_10062550	Ga0207709_100625502	259
520	3300025938	Ga0207704_10013357	Ga0207704_100133573	259
521	3300025961	Ga0207712_10035098	Ga0207712_100350983	259
522	3300026078	Ga0207702_10167651	Ga0207702_101676513	259
523	3300026121	Ga0207683_10251984	Ga0207683_102519843	259
524	3300031456	Ga0307513_10020118	Ga0307513_100201186	259
525	3300031901	Ga0307406_10348769	Ga0307406_103487692	259
526	3300032126	Ga0307415_100047054	Ga0307415_1000470542	259
527	3300045049	Ga0466959_0039266	Ga0466959_0039266_2390_3220	259
528	iso_pu_bacteria	2551306166	2552108603	259
529	iso_pu_bacteria	2643221692	2644512166	259
530	iso_pu_bacteria	2844849076	2844852762	259
531	3300004799	Ga0058863_11975701	Ga0058863_119757011	260
532	3300004803	Ga0058862_10012331	Ga0058862_100123312	260
533	3300005327	Ga0070658_10122061	Ga0070658_101220613	260
534	3300005329	Ga0070683_100563494	Ga0070683_1005634942	260
535	3300005336	Ga0070680_100230724	Ga0070680_1002307242	260
536	3300005339	Ga0070660_100176312	Ga0070660_1001763122	260
537	3300005344	Ga0070661_100086439	Ga0070661_1000864392	260
538	3300005436	Ga0070713_100032424	Ga0070713_1000324244	260
539	3300005458	Ga0070681_10053790	Ga0070681_100537903	260
540	3300005530	Ga0070679_100118058	Ga0070679_1001180581	260
541	3300005535	Ga0070684_100110080	Ga0070684_1001100802	260
542	3300005539	Ga0068853_100025739	Ga0068853_1000257393	260
543	3300005564	Ga0070664_100172026	Ga0070664_1001720263	260
544	3300005577	Ga0068857_100068851	Ga0068857_1000688513	260
545	3300005614	Ga0068856_100304655	Ga0068856_1003046553	260
546	3300005616	Ga0068852_100179369	Ga0068852_1001793693	260
547	3300005985	Ga0081539_10003385	Ga0081539_1000338511	260
548	3300005985	Ga0081539_10003678	Ga0081539_1000367815	260
549	3300005985	Ga0081539_10041701	Ga0081539_100417014	260
550	3300006844	Ga0075428_100727264	Ga0075428_1007272641	260
551	3300009551	Ga0105238_10040700	Ga0105238_100407002	260
552	3300013105	Ga0157369_10075678	Ga0157369_100756781	260
553	3300013307	Ga0157372_10129667	Ga0157372_101296673	260
554	3300014325	Ga0163163_10194202	Ga0163163_101942022	260
555	3300014325	Ga0163163_10273772	Ga0163163_102737723	260
556	3300014325	Ga0163163_10581477	Ga0163163_105814771	260
557	3300020069	Ga0197907_11390963	Ga0197907_113909632	260
558	3300020070	Ga0206356_10927010	Ga0206356_109270102	260
559	3300020077	Ga0206351_10824409	Ga0206351_108244092	260
560	3300020078	Ga0206352_10322057	Ga0206352_103220572	260
561	3300020080	Ga0206350_11421160	Ga0206350_114211602	260
562	3300020081	Ga0206354_11431865	Ga0206354_114318653	260
563	3300020082	Ga0206353_10973797	Ga0206353_109737972	260
564	3300022467	Ga0224712_10063066	Ga0224712_100630661	260
565	3300025906	Ga0207699_10197865	Ga0207699_101978652	260
566	3300025924	Ga0207694_10210050	Ga0207694_102100502	260
567	3300025928	Ga0207700_10050886	Ga0207700_100508863	260
568	3300025944	Ga0207661_10000844	Ga0207661_1000084412	260
569	3300026041	Ga0207639_10049534	Ga0207639_100495343	260
570	3300026078	Ga0207702_10321469	Ga0207702_103214692	260
571	3300026142	Ga0207698_10024639	Ga0207698_100246394	260
572	3300028573	Ga0265334_10025018	Ga0265334_100250183	260
573	3300030521	Ga0307511_10001036	Ga0307511_1000103623	260
574	3300031241	Ga0265325_10107992	Ga0265325_101079922	260
575	3300031247	Ga0265340_10034334	Ga0265340_100343342	260
576	3300031548	Ga0307408_100036058	Ga0307408_1000360583	260
577	3300031595	Ga0265313_10038256	Ga0265313_100382562	260
578	3300031616	Ga0307508_10027175	Ga0307508_100271755	260
579	3300031711	Ga0265314_10016200	Ga0265314_100162005	260
580	3300031712	Ga0265342_10053973	Ga0265342_100539733	260
581	3300031730	Ga0307516_10030823	Ga0307516_100308236	260
582	3300031730	Ga0307516_10031561	Ga0307516_100315614	260
583	3300031852	Ga0307410_10013557	Ga0307410_100135572	260
584	3300031995	Ga0307409_100014305	Ga0307409_1000143053	260
585	3300032002	Ga0307416_100012983	Ga0307416_1000129832	260
586	3300032002	Ga0307416_100507591	Ga0307416_1005075912	260
587	3300032004	Ga0307414_10228083	Ga0307414_102280832	260
588	3300032005	Ga0307411_10043612	Ga0307411_100436123	260
589	3300032126	Ga0307415_100010522	Ga0307415_1000105225	260
590	3300032126	Ga0307415_100134018	Ga0307415_1001340182	260
591	3300032126	Ga0307415_100237398	Ga0307415_1002373982	260
592	3300035091	Ga0373951_0000015	Ga0373951_0000015_4579_5379	260
593	3300037418	Ga0395900_0156565	Ga0395900_0156565_68_871	260
594	3300037466	Ga0395898_0007197	Ga0395898_0007197_10082_10885	260
595	3300037471	Ga0395905_0122240	Ga0395905_0122240_730_1533	260
596	3300038443	Ga0395901_0099429	Ga0395901_0099429_1316_2119	260
597	3300041451	Ga0451791_0115779	Ga0451791_0115779_533_1333	260
598	3300044656	Ga0466969_0016026	Ga0466969_0016026_2461_3294	260
599	3300048915	Ga0496112_0260500	Ga0496112_0260500_746_1543	260
600	3300048916	Ga0496113_0003600	Ga0496113_0003600_6198_7010	260
601	3300049743	Ga0501081_0424646	Ga0501081_0424646_146_946	260
602	3300050509	nmdc:mga0qj67_393_c1	nmdc:mga0qj67_393_c1_1540_2340	260
603	3300053143	Ga0500579_019295	Ga0500579_019295_1446_2246	260
604	iso_pu_bacteria	2857710386	2857711663	260
605	iso_pu_bacteria	2899359706	2899368541	260
606	3300005435	Ga0070714_100001437	Ga0070714_10000143714	261
607	3300013105	Ga0157369_10209350	Ga0157369_102093503	261
608	3300025245	Ga0207425_1002748	Ga0207425_10027482	261
609	3300025258	Ga0209129_1000067	Ga0209129_1000067158	261
610	3300025294	Ga0209025_1001150	Ga0209025_100115011	261
611	3300025928	Ga0207700_10551035	Ga0207700_105510351	261
612	3300025929	Ga0207664_10000986	Ga0207664_1000098613	261
613	3300031247	Ga0265340_10005901	Ga0265340_100059017	261
614	3300035398	Ga0316574_0028215	Ga0316574_0028215_944_1762	261
615	3300037418	Ga0395900_0029730	Ga0395900_0029730_3094_3981	261
616	3300037853	Ga0436364_0187669	Ga0436364_0187669_4221_5033	261
617	3300038443	Ga0395901_0328740	Ga0395901_0328740_518_1327	261
618	3300041404	Ga0439436_0047557	Ga0439436_0047557_341_1150	261
619	3300041405	Ga0439438_007076	Ga0439438_007076_1491_2300	261
620	3300041406	Ga0439439_0000031	Ga0439439_0000031_7035_7844	261
621	3300041407	Ga0439447_009854	Ga0439447_009854_1510_2319	261
622	3300041999	Ga0439433_0000116	Ga0439433_0000116_10173_10982	261
623	3300042002	Ga0439442_022417	Ga0439442_022417_337_1146	261
624	3300042006	Ga0439432_000214	Ga0439432_000214_934_1743	261
625	3300042007	Ga0439449_0068274	Ga0439449_0068274_337_1146	261
626	3300042010	Ga0439452_005946	Ga0439452_005946_753_1562	261
627	3300042014	Ga0439457_000801	Ga0439457_000801_1290_2099	261
628	3300042122	Ga0450920_001761	Ga0450920_001761_198_1007	261
629	3300042156	Ga0439446_0001523	Ga0439446_0001523_570_1379	261
630	3300042531	Ga0450918_004368	Ga0450918_004368_1259_2068	261
631	3300048905	Ga0496102_0034915	Ga0496102_0034915_596_1438	261
632	3300048905	Ga0496102_0078930	Ga0496102_0078930_519_1361	261
633	3300048906	Ga0496103_0009295	Ga0496103_0009295_4386_5228	261
634	3300048911	Ga0496108_0145447	Ga0496108_0145447_1036_1878	261
635	3300048913	Ga0496110_0090566	Ga0496110_0090566_596_1438	261
636	3300048915	Ga0496112_0057290	Ga0496112_0057290_2786_3595	261
637	3300048929	Ga0496126_0271319	Ga0496126_0271319_122_952	261
638	3300049579	Ga0501043_0055657	Ga0501043_0055657_1080_1889	261
639	3300050510	nmdc:mga06r32_75420_c1	nmdc:mga06r32_75420_c1_447_1271	261
640	iso_pu_bacteria	2585427649	2586061330	261
641	iso_pu_bacteria	2808606522	2809589579	261
642	iso_pu_bacteria	8004021418	8004024868	261
643	iso_pu_bacteria	8004025490	8004027293	261
644	iso_pu_bacteria	8054472261	8054473017	261
645	iso_pu_bacteria	8056207758	8056208661	261
646	3300013104	Ga0157370_10004504	Ga0157370_1000450410	262
647	3300035692	Ga0373935_0000390	Ga0373935_0000390_10379_11275	262
648	3300035725	Ga0373947_0000001	Ga0373947_0000001_73418_74314	262
649	3300044694	Ga0466963_0467103	Ga0466963_0467103_35_865	262
650	3300044719	Ga0466971_0166417	Ga0466971_0166417_167_985	262
651	3300044842	Ga0466957_0307550	Ga0466957_0307550_76_894	262
652	3300046472	Ga0495580_0008618	Ga0495580_0008618_1211_2044	262
653	3300046475	Ga0495639_0004134	Ga0495639_0004134_3937_4770	262
654	3300046531	Ga0495665_0021417	Ga0495665_0021417_2369_3202	262
655	3300046535	Ga0495586_0004035	Ga0495586_0004035_497_1330	262
656	3300046674	Ga0495588_0002261	Ga0495588_0002261_6207_7040	262
657	3300047315	Ga0495581_0000457	Ga0495581_0000457_13753_14586	262
658	3300053136	Ga0500559_0002092	Ga0500559_0002092_9473_10321	262
659	iso_pu_bacteria	2622736605	2623498837	262
660	iso_pu_bacteria	2690315906	2691513916	262
661	iso_pu_bacteria	2751185734	2753074720	262
662	iso_pu_bacteria	2775506735	2775656862	262
663	iso_pu_bacteria	2808606357	2808831180	262
664	iso_pu_bacteria	2808606360	2808852447	262
665	iso_pu_bacteria	2808606366	2808879264	262
666	iso_pu_bacteria	2808606370	2808891301	262
667	iso_pu_bacteria	2808606371	2808896497	262
668	iso_pu_bacteria	2811994871	2812321127	262
669	iso_pu_bacteria	2870721527	2870725360	262
670	iso_pu_bacteria	2919391150	2919394707	262
671	iso_pu_bacteria	2939598168	2939601269	262
672	iso_pu_bacteria	2945916053	2945918867	262
673	iso_pu_bacteria	2945920336	2945920762	262
674	iso_pu_bacteria	2945941187	2945943038	262
675	iso_pu_bacteria	2945956166	2945959206	262
676	iso_pu_bacteria	2946037020	2946038918	262
677	iso_pu_bacteria	2946059875	2946062735	262
678	iso_pu_bacteria	2953998280	2954000362	262
679	iso_pu_bacteria	2974302888	2974306869	262
680	iso_pu_bacteria	8054107350	8054107819	262
681	3300005437	Ga0070710_10010214	Ga0070710_100102144	263
682	3300025898	Ga0207692_10021744	Ga0207692_100217442	263
683	3300030732	Ga0316176_1195156	Ga0316176_11951562	263
684	3300030733	Ga0314311_1209599	Ga0314311_12095993	263
685	3300031456	Ga0307513_10023650	Ga0307513_100236506	263
686	3300031838	Ga0307518_10001750	Ga0307518_1000175011	263
687	3300035086	Ga0373934_0000020	Ga0373934_0000020_19004_19897	263
688	3300035111	Ga0373923_0128679	Ga0373923_0128679_114_1007	263
689	3300035117	Ga0373953_0000511	Ga0373953_0000511_7419_8312	263
690	3300035118	Ga0373954_0036073	Ga0373954_0036073_1368_2261	263
691	3300035119	Ga0373956_0000343	Ga0373956_0000343_16551_17444	263
692	3300035120	Ga0373957_0000053	Ga0373957_0000053_1174_2067	263
693	3300035172	Ga0373955_0000192	Ga0373955_0000192_4032_4925	263
694	3300035410	Ga0373924_0008311	Ga0373924_0008311_963_1856	263
695	3300035724	Ga0373933_0000024	Ga0373933_0000024_54274_55167	263
696	3300036401	Ga0373937_0000029	Ga0373937_0000029_54308_55201	263
697	3300044658	Ga0466972_0004074	Ga0466972_0004074_3749_4597	263
698	3300044658	Ga0466972_0044714	Ga0466972_0044714_1027_1875	263
699	3300044683	Ga0466965_0012601	Ga0466965_0012601_3086_3934	263
700	3300044683	Ga0466965_0026386	Ga0466965_0026386_1267_2115	263
701	3300044684	Ga0466966_0118351	Ga0466966_0118351_110_907	263
702	3300044735	Ga0466968_0017595	Ga0466968_0017595_320_1168	263
703	3300044901	Ga0466960_0001392	Ga0466960_0001392_5294_6142	263
704	3300046454	Ga0495592_0000040	Ga0495592_0000040_68399_69292	263
705	3300046454	Ga0495592_0004278	Ga0495592_0004278_6128_6928	263
706	3300046459	Ga0495629_0334057	Ga0495629_0334057_199_999	263
707	3300046462	Ga0495651_0000017	Ga0495651_0000017_68810_69703	263
708	3300046462	Ga0495651_0013655	Ga0495651_0013655_3495_4295	263
709	3300046463	Ga0495653_0000567	Ga0495653_0000567_25243_26136	263
710	3300046463	Ga0495653_0001737	Ga0495653_0001737_12302_13102	263
711	3300046472	Ga0495580_0020131	Ga0495580_0020131_2275_3075	263
712	3300046476	Ga0495662_0000201	Ga0495662_0000201_14022_14822	263
713	3300046477	Ga0495664_0001719	Ga0495664_0001719_5836_6636	263
714	3300046511	Ga0495608_0000053	Ga0495608_0000053_38587_39480	263
715	3300046511	Ga0495608_0001533	Ga0495608_0001533_9849_10649	263
716	3300046514	Ga0495618_0045003	Ga0495618_0045003_816_1616	263
717	3300046516	Ga0495628_0000984	Ga0495628_0000984_13600_14493	263
718	3300046516	Ga0495628_0174346	Ga0495628_0174346_556_1356	263
719	3300046517	Ga0495630_0004418	Ga0495630_0004418_8938_9738	263
720	3300046526	Ga0495666_0028274	Ga0495666_0028274_756_1556	263
721	3300046529	Ga0495652_0000233	Ga0495652_0000233_23286_24179	263
722	3300046531	Ga0495665_0001548	Ga0495665_0001548_7410_8210	263
723	3300046533	Ga0495640_0027560	Ga0495640_0027560_658_1458	263
724	3300046535	Ga0495586_0035165	Ga0495586_0035165_584_1384	263
725	3300046536	Ga0495587_0000079	Ga0495587_0000079_38586_39479	263
726	3300046536	Ga0495587_0037356	Ga0495587_0037356_135_935	263
727	3300046559	Ga0495667_0000063	Ga0495667_0000063_54308_55201	263
728	3300046559	Ga0495667_0002498	Ga0495667_0002498_11182_11982	263
729	3300046642	Ga0495634_0062541	Ga0495634_0062541_341_1141	263
730	3300046663	Ga0495635_0010170	Ga0495635_0010170_5606_6406	263
731	3300046675	Ga0495657_0000032	Ga0495657_0000032_68410_69303	263
732	3300046675	Ga0495657_0053715	Ga0495657_0053715_1720_2520	263
733	3300046678	Ga0495599_0000047	Ga0495599_0000047_43830_44723	263
734	3300046678	Ga0495599_0095180	Ga0495599_0095180_400_1200	263
735	3300046679	Ga0495623_0001393	Ga0495623_0001393_9020_9913	263
736	3300046679	Ga0495623_0020285	Ga0495623_0020285_2638_3438	263
737	3300046689	Ga0495613_0001606	Ga0495613_0001606_5850_6650	263
738	3300046809	Ga0495600_0011977	Ga0495600_0011977_1383_2276	263
739	3300047315	Ga0495581_0025008	Ga0495581_0025008_906_1706	263
740	3300047317	Ga0495604_0000124	Ga0495604_0000124_25788_26681	263
741	3300047317	Ga0495604_0005533	Ga0495604_0005533_3941_4741	263
742	3300047319	Ga0495674_0006635	Ga0495674_0006635_5276_6076	263
743	3300047322	Ga0495680_0000085	Ga0495680_0000085_45590_46483	263
744	3300047444	Ga0495675_0000087	Ga0495675_0000087_23005_23898	263
745	3300047444	Ga0495675_0020253	Ga0495675_0020253_2594_3394	263
746	3300047673	Ga0495593_0008513	Ga0495593_0008513_3340_4140	263
747	3300048088	Ga0495602_0000226	Ga0495602_0000226_38641_39534	263
748	3300048088	Ga0495602_0017010	Ga0495602_0017010_658_1458	263
749	3300048911	Ga0496108_0222559	Ga0496108_0222559_664_1530	263
750	3300050495	nmdc:mga04h51_5122_c1	nmdc:mga04h51_5122_c1_10_813	263
751	3300053077	Ga0495601_0006528	Ga0495601_0006528_4491_5291	263
752	3300053084	Ga0495595_0001268	Ga0495595_0001268_8156_9049	263
753	3300053085	Ga0495619_0047849	Ga0495619_0047849_323_1123	263
754	iso_pu_bacteria	2506783011	2506866775	263
755	iso_pu_bacteria	2527291627	2528203932	263
756	iso_pu_bacteria	2527291629	2528214058	263
757	iso_pu_bacteria	2546825537	2546949513	263
758	iso_pu_bacteria	2576861822	2579749243	263
759	iso_pu_bacteria	2579778521	2579854660	263
760	iso_pu_bacteria	2619618881	2619856667	263
761	iso_pu_bacteria	2619619003	2620349281	263
762	iso_pu_bacteria	2626541554	2626636480	263
763	iso_pu_bacteria	2671180195	2671837053	263
764	iso_pu_bacteria	2675902999	2676198778	263
765	iso_pu_bacteria	2773857921	2774843356	263
766	iso_pu_bacteria	2773857922	2774855209	263
767	iso_pu_bacteria	2773857924	2774865362	263
768	iso_pu_bacteria	2895880812	2895890046	263
769	iso_pu_bacteria	2905926851	2905930842	263
770	iso_pu_bacteria	2946003308	2946004623	263
771	iso_pu_bacteria	8002775197	8002779233	263
772	iso_pu_bacteria	8054913762	8054918909	263
773	iso_pu_bacteria	8054920844	8054922338	263
774	iso_pu_bacteria	8055157932	8055158963	263
775	3300005333	Ga0070677_10045510	Ga0070677_100455101	264
776	3300005335	Ga0070666_10087304	Ga0070666_100873043	264
777	3300005354	Ga0070675_100006320	Ga0070675_1000063205	264
778	3300005355	Ga0070671_100241204	Ga0070671_1002412042	264
779	3300005356	Ga0070674_100011097	Ga0070674_1000110974	264
780	3300005364	Ga0070673_100129595	Ga0070673_1001295953	264
781	3300005543	Ga0070672_100010916	Ga0070672_1000109164	264
782	3300005841	Ga0068863_100277925	Ga0068863_1002779252	264
783	3300005844	Ga0068862_100263286	Ga0068862_1002632863	264
784	3300006058	Ga0075432_10001543	Ga0075432_100015432	264
785	3300009011	Ga0105251_10052686	Ga0105251_100526863	264
786	3300009036	Ga0105244_10015543	Ga0105244_100155433	264
787	3300009148	Ga0105243_10019058	Ga0105243_100190584	264
788	3300011119	Ga0105246_10011505	Ga0105246_100115053	264
789	3300013105	Ga0157369_10773891	Ga0157369_107738911	264
790	3300013306	Ga0163162_10080325	Ga0163162_100803253	264
791	3300013306	Ga0163162_10331086	Ga0163162_103310862	264
792	3300013308	Ga0157375_10011867	Ga0157375_100118673	264
793	3300025728	Ga0207655_1013450	Ga0207655_10134504	264
794	3300025735	Ga0207713_1043593	Ga0207713_10435933	264
795	3300025903	Ga0207680_10010557	Ga0207680_100105573	264
796	3300025907	Ga0207645_10010252	Ga0207645_100102524	264
797	3300025923	Ga0207681_10096762	Ga0207681_100967622	264
798	3300025925	Ga0207650_10036061	Ga0207650_100360613	264
799	3300025926	Ga0207659_10113175	Ga0207659_101131753	264
800	3300025935	Ga0207709_10141400	Ga0207709_101414003	264
801	3300025940	Ga0207691_10000197	Ga0207691_1000019737	264
802	3300025960	Ga0207651_10050953	Ga0207651_100509532	264
803	3300025972	Ga0207668_10082304	Ga0207668_100823043	264
804	3300025986	Ga0207658_10095179	Ga0207658_100951793	264
805	3300027907	Ga0207428_10002817	Ga0207428_100028177	264
806	3300027907	Ga0207428_10188664	Ga0207428_101886643	264
807	3300031548	Ga0307408_100011496	Ga0307408_1000114965	264
808	3300031548	Ga0307408_100017973	Ga0307408_1000179732	264
809	3300031548	Ga0307408_100047443	Ga0307408_1000474433	264
810	3300031548	Ga0307408_100070907	Ga0307408_1000709073	264
811	3300031548	Ga0307408_100183608	Ga0307408_1001836082	264
812	3300031691	Ga0316579_10000517	Ga0316579_100005176	264
813	3300031824	Ga0307413_10006600	Ga0307413_100066003	264
814	3300031824	Ga0307413_10042666	Ga0307413_100426663	264
815	3300031824	Ga0307413_10053800	Ga0307413_100538002	264
816	3300031824	Ga0307413_10063621	Ga0307413_100636211	264
817	3300031824	Ga0307413_10176420	Ga0307413_101764202	264
818	3300031852	Ga0307410_10001470	Ga0307410_100014706	264
819	3300031852	Ga0307410_10008427	Ga0307410_100084276	264
820	3300031852	Ga0307410_10057795	Ga0307410_100577953	264
821	3300031901	Ga0307406_10558092	Ga0307406_105580921	264
822	3300031903	Ga0307407_10119931	Ga0307407_101199312	264
823	3300031903	Ga0307407_10468608	Ga0307407_104686081	264
824	3300031911	Ga0307412_10020020	Ga0307412_100200202	264
825	3300031911	Ga0307412_10029789	Ga0307412_100297893	264
826	3300031911	Ga0307412_10046813	Ga0307412_100468133	264
827	3300031911	Ga0307412_10064770	Ga0307412_100647702	264
828	3300031911	Ga0307412_10070214	Ga0307412_100702143	264
829	3300031911	Ga0307412_10103140	Ga0307412_101031402	264
830	3300031911	Ga0307412_10125100	Ga0307412_101251002	264
831	3300031911	Ga0307412_10354234	Ga0307412_103542342	264
832	3300031995	Ga0307409_100005085	Ga0307409_1000050856	264
833	3300031995	Ga0307409_100093910	Ga0307409_1000939102	264
834	3300031995	Ga0307409_100164064	Ga0307409_1001640642	264
835	3300031995	Ga0307409_100263648	Ga0307409_1002636483	264
836	3300032002	Ga0307416_100007799	Ga0307416_1000077995	264
837	3300032002	Ga0307416_100021316	Ga0307416_1000213164	264
838	3300032002	Ga0307416_100039970	Ga0307416_1000399703	264
839	3300032002	Ga0307416_100139647	Ga0307416_1001396473	264
840	3300032002	Ga0307416_100340967	Ga0307416_1003409672	264
841	3300032002	Ga0307416_100689769	Ga0307416_1006897692	264
842	3300032004	Ga0307414_10014562	Ga0307414_100145623	264
843	3300032004	Ga0307414_10037719	Ga0307414_100377193	264
844	3300032004	Ga0307414_10228956	Ga0307414_102289561	264
845	3300032004	Ga0307414_10463477	Ga0307414_104634772	264
846	3300032005	Ga0307411_10000900	Ga0307411_100009006	264
847	3300032005	Ga0307411_10036356	Ga0307411_100363563	264
848	3300032005	Ga0307411_10268148	Ga0307411_102681481	264
849	3300032126	Ga0307415_100028238	Ga0307415_1000282382	264
850	3300032126	Ga0307415_100082340	Ga0307415_1000823402	264
851	3300037312	Ga0395899_0014599	Ga0395899_0014599_3301_4122	264
852	3300037418	Ga0395900_0088456	Ga0395900_0088456_1420_2241	264
853	3300037418	Ga0395900_0145529	Ga0395900_0145529_835_1656	264
854	3300037466	Ga0395898_0030595	Ga0395898_0030595_1270_2091	264
855	3300037466	Ga0395898_0423520	Ga0395898_0423520_143_964	264
856	3300038443	Ga0395901_0128704	Ga0395901_0128704_108_929	264
857	3300038735	Ga0400485_12668	Ga0400485_12668_21039_21863	264
858	3300038742	Ga0400486_19783	Ga0400486_19783_11086_11910	264
859	3300041405	Ga0439438_020174	Ga0439438_020174_312_1133	264
860	3300041407	Ga0439447_024706	Ga0439447_024706_718_1536	264
861	3300042002	Ga0439442_000007	Ga0439442_000007_39583_40404	264
862	3300042002	Ga0439442_000013	Ga0439442_000013_41558_42376	264
863	3300042014	Ga0439457_011937	Ga0439457_011937_557_1375	264
864	3300042122	Ga0450920_000392	Ga0450920_000392_5984_6802	264
865	3300042146	Ga0450907_000059	Ga0450907_000059_5928_6746	264
866	3300042435	Ga0439434_0000080	Ga0439434_0000080_18150_18968	264
867	3300042531	Ga0450918_000243	Ga0450918_000243_4057_4875	264
868	3300044658	Ga0466972_0005869	Ga0466972_0005869_3897_4835	264
869	3300044658	Ga0466972_0098476	Ga0466972_0098476_220_1020	264
870	3300044683	Ga0466965_0004028	Ga0466965_0004028_1929_2867	264
871	3300044842	Ga0466957_0070025	Ga0466957_0070025_135_1073	264
872	3300044901	Ga0466960_0000332	Ga0466960_0000332_3997_4935	264
873	3300046463	Ga0495653_0001614	Ga0495653_0001614_11040_11882	264
874	3300046475	Ga0495639_0148164	Ga0495639_0148164_183_1025	264
875	3300046476	Ga0495662_0047268	Ga0495662_0047268_182_1024	264
876	3300046491	Ga0495584_0265373	Ga0495584_0265373_56_850	264
877	3300046499	Ga0495594_0052668	Ga0495594_0052668_651_1493	264
878	3300046517	Ga0495630_0011312	Ga0495630_0011312_355_1197	264
879	3300046522	Ga0495643_0081622	Ga0495643_0081622_634_1476	264
880	3300046531	Ga0495665_0000692	Ga0495665_0000692_11489_12331	264
881	3300046535	Ga0495586_0001074	Ga0495586_0001074_5913_6755	264
882	3300046536	Ga0495587_0001467	Ga0495587_0001467_11676_12518	264
883	3300046543	Ga0495645_0000694	Ga0495645_0000694_14083_14925	264
884	3300046559	Ga0495667_0000440	Ga0495667_0000440_24981_25823	264
885	3300046616	Ga0495668_0172908	Ga0495668_0172908_212_1054	264
886	3300046674	Ga0495588_0052386	Ga0495588_0052386_256_1098	264
887	3300046675	Ga0495657_0041423	Ga0495657_0041423_574_1416	264
888	3300046809	Ga0495600_0000661	Ga0495600_0000661_11703_12545	264
889	3300047315	Ga0495581_0020175	Ga0495581_0020175_1339_2181	264
890	3300047315	Ga0495581_0099686	Ga0495581_0099686_327_1169	264
891	3300047317	Ga0495604_0101150	Ga0495604_0101150_192_1034	264
892	3300047319	Ga0495674_0072084	Ga0495674_0072084_1801_2643	264
893	3300047444	Ga0495675_0002376	Ga0495675_0002376_8677_9519	264
894	3300047471	Ga0495684_0165710	Ga0495684_0165710_156_998	264
895	3300048904	Ga0496101_0018774	Ga0496101_0018774_988_1830	264
896	3300048904	Ga0496101_0068892	Ga0496101_0068892_1529_2371	264
897	3300048905	Ga0496102_0080153	Ga0496102_0080153_500_1321	264
898	3300048905	Ga0496102_0201872	Ga0496102_0201872_259_1101	264
899	3300048908	Ga0496105_0028176	Ga0496105_0028176_464_1306	264
900	3300048911	Ga0496108_0019332	Ga0496108_0019332_860_1702	264
901	3300048911	Ga0496108_0371338	Ga0496108_0371338_68_889	264
902	3300048914	Ga0496111_0206825	Ga0496111_0206825_510_1352	264
903	3300048915	Ga0496112_0291625	Ga0496112_0291625_394_1236	264
904	3300048916	Ga0496113_0302240	Ga0496113_0302240_308_1129	264
905	3300048917	Ga0496114_0048942	Ga0496114_0048942_1772_2614	264
906	3300048922	Ga0496119_0036032	Ga0496119_0036032_286_1128	264
907	3300048927	Ga0496124_0213654	Ga0496124_0213654_106_948	264
908	3300049539	Ga0501323_018938	Ga0501323_018938_26_847	264
909	3300049569	Ga0501032_0003807	Ga0501032_0003807_2967_3788	264
910	3300049569	Ga0501032_0064767	Ga0501032_0064767_860_1681	264
911	3300049569	Ga0501032_0277604	Ga0501032_0277604_38_859	264
912	3300049573	Ga0501037_0007121	Ga0501037_0007121_3697_4518	264
913	3300049574	Ga0501038_0058636	Ga0501038_0058636_328_1149	264
914	3300049574	Ga0501038_0065903	Ga0501038_0065903_1437_2258	264
915	3300049574	Ga0501038_0069237	Ga0501038_0069237_54_875	264
916	3300049574	Ga0501038_0322781	Ga0501038_0322781_17_838	264
917	3300049574	Ga0501038_0351702	Ga0501038_0351702_17_838	264
918	3300049575	Ga0501039_0065755	Ga0501039_0065755_1012_1833	264
919	3300049579	Ga0501043_0023547	Ga0501043_0023547_891_1712	264
920	3300049579	Ga0501043_0214637	Ga0501043_0214637_83_904	264
921	3300049775	Ga0501279_001738	Ga0501279_001738_1001_1822	264
922	3300059424	Ga0590075_036428	Ga0590075_036428_200_1021	264
923	3300059492	Ga0587073_0013569	Ga0587073_0013569_347_1195	264
924	3300059505	Ga0587083_0010966	Ga0587083_0010966_296_1144	264
925	3300059508	Ga0587088_005016	Ga0587088_005016_296_1144	264
926	3300059626	Ga0587115_009474	Ga0587115_009474_300_1148	264
927	3300059630	Ga0587128_009923	Ga0587128_009923_418_1239	264
928	3300059640	Ga0587067_006521	Ga0587067_006521_289_1137	264
929	3300059643	Ga0587072_010082	Ga0587072_010082_510_1331	264
930	3300059660	Ga0587124_001993	Ga0587124_001993_397_1218	264
931	3300060346	Ga0587111_0025640	Ga0587111_0025640_320_1141	264
932	iso_pu_bacteria	2866552031	2866556727	264
933	3300005329	Ga0070683_100151411	Ga0070683_1001514112	265
934	3300005334	Ga0068869_100018324	Ga0068869_1000183245	265
935	3300005336	Ga0070680_100317335	Ga0070680_1003173352	265
936	3300005347	Ga0070668_100001496	Ga0070668_1000014967	265
937	3300005347	Ga0070668_100211477	Ga0070668_1002114773	265
938	3300005435	Ga0070714_100189745	Ga0070714_1001897452	265
939	3300005436	Ga0070713_100401837	Ga0070713_1004018371	265
940	3300005471	Ga0070698_100003596	Ga0070698_1000035968	265
941	3300005841	Ga0068863_100675259	Ga0068863_1006752592	265
942	3300006028	Ga0070717_10036917	Ga0070717_100369172	265
943	3300009094	Ga0111539_10164856	Ga0111539_101648562	265
944	3300014968	Ga0157379_10066551	Ga0157379_100665513	265
945	3300020069	Ga0197907_10358070	Ga0197907_103580703	265
946	3300020082	Ga0206353_10312407	Ga0206353_103124072	265
947	3300021388	Ga0213875_10027890	Ga0213875_100278902	265
948	3300025910	Ga0207684_10051479	Ga0207684_100514793	265
949	3300025917	Ga0207660_10275030	Ga0207660_102750302	265
950	3300025929	Ga0207664_10140603	Ga0207664_101406032	265
951	3300025929	Ga0207664_10165613	Ga0207664_101656132	265
952	3300025944	Ga0207661_10077538	Ga0207661_100775383	265
953	3300025972	Ga0207668_10018474	Ga0207668_100184745	265
954	3300026023	Ga0207677_10100073	Ga0207677_101000732	265
955	3300026067	Ga0207678_10000220	Ga0207678_1000022016	265
956	3300026088	Ga0207641_10016239	Ga0207641_100162393	265
957	3300026121	Ga0207683_10031377	Ga0207683_100313772	265
958	3300030522	Ga0307512_10049284	Ga0307512_100492841	265
959	3300030877	Ga0265777_101586	Ga0265777_1015861	265
960	3300031507	Ga0307509_10033543	Ga0307509_100335433	265
961	3300031731	Ga0307405_10145634	Ga0307405_101456342	265
962	3300031852	Ga0307410_10052402	Ga0307410_100524023	265
963	3300031852	Ga0307410_10309046	Ga0307410_103090462	265
964	3300031889	Ga0326468_10004175	Ga0326468_100041752	265
965	3300031901	Ga0307406_10093272	Ga0307406_100932723	265
966	3300031911	Ga0307412_10019857	Ga0307412_100198573	265
967	3300031995	Ga0307409_100114288	Ga0307409_1001142883	265
968	3300031995	Ga0307409_100180235	Ga0307409_1001802351	265
969	3300031995	Ga0307409_100284931	Ga0307409_1002849312	265
970	3300032005	Ga0307411_10317285	Ga0307411_103172852	265
971	3300032126	Ga0307415_100079874	Ga0307415_1000798742	265
972	3300033179	Ga0307507_10043419	Ga0307507_100434196	265
973	3300035083	Ga0373926_0048372	Ga0373926_0048372_175_1071	265
974	3300041453	Ga0451797_0145845	Ga0451797_0145845_2690_3565	265
975	3300044658	Ga0466972_0005439	Ga0466972_0005439_2369_3223	265
976	3300044683	Ga0466965_0063178	Ga0466965_0063178_197_1051	265
977	3300044684	Ga0466966_0061164	Ga0466966_0061164_123_962	265
978	3300044693	Ga0466961_0035607	Ga0466961_0035607_1974_2846	265
979	3300044706	Ga0466964_0062638	Ga0466964_0062638_618_1472	265
980	3300044765	Ga0466970_0027408	Ga0466970_0027408_1464_2336	265
981	3300044765	Ga0466970_0085531	Ga0466970_0085531_358_1212	265
982	3300044901	Ga0466960_0149301	Ga0466960_0149301_197_1036	265
983	3300045049	Ga0466959_0079305	Ga0466959_0079305_883_1755	265
984	3300045049	Ga0466959_0362472	Ga0466959_0362472_134_973	265
985	3300045836	Ga0466958_0193377	Ga0466958_0193377_208_1047	265
986	3300045976	Ga0466967_0349279	Ga0466967_0349279_133_972	265
987	3300046461	Ga0495641_0077411	Ga0495641_0077411_262_1137	265
988	3300048903	Ga0496100_0000513	Ga0496100_0000513_3358_4251	265
989	3300048904	Ga0496101_0002355	Ga0496101_0002355_3800_4693	265
990	3300048905	Ga0496102_0000020	Ga0496102_0000020_7048_7941	265
991	3300048906	Ga0496103_0000011	Ga0496103_0000011_118291_119184	265
992	3300048907	Ga0496104_0042236	Ga0496104_0042236_2938_3831	265
993	3300048908	Ga0496105_0027020	Ga0496105_0027020_1967_2860	265
994	3300048910	Ga0496107_0148777	Ga0496107_0148777_587_1480	265
995	3300048911	Ga0496108_0099070	Ga0496108_0099070_1527_2420	265
996	3300048912	Ga0496109_0100978	Ga0496109_0100978_1768_2661	265
997	3300048913	Ga0496110_0052473	Ga0496110_0052473_41_934	265
998	3300048917	Ga0496114_0169515	Ga0496114_0169515_671_1561	265
999	3300048919	Ga0496116_0000067	Ga0496116_0000067_7033_7926	265
1000	3300048920	Ga0496117_0000192	Ga0496117_0000192_116616_117509	265
1001	3300048921	Ga0496118_0000076	Ga0496118_0000076_7022_7915	265
1002	3300048922	Ga0496119_0001952	Ga0496119_0001952_14635_15528	265
1003	3300048922	Ga0496119_0101845	Ga0496119_0101845_583_1401	265
1004	3300048923	Ga0496120_0015280	Ga0496120_0015280_4073_4966	265
1005	3300048925	Ga0496122_0087340	Ga0496122_0087340_596_1489	265
1006	3300048927	Ga0496124_0004620	Ga0496124_0004620_11992_12885	265
1007	3300048928	Ga0496125_0024559	Ga0496125_0024559_3402_4295	265
1008	3300048929	Ga0496126_0000080	Ga0496126_0000080_213784_214677	265
1009	3300049584	Ga0501068_0046760	Ga0501068_0046760_916_1713	265
1010	3300049587	Ga0501071_0366067	Ga0501071_0366067_149_946	265
1011	3300049592	Ga0501076_0311628	Ga0501076_0311628_409_1248	265
1012	3300053088	Ga0500644_0141879	Ga0500644_0141879_17_871	265
1013	iso_pu_bacteria	2917736166	2917737876	265
1014	iso_pu_bacteria	8003314358	8003323588	265
1015	3300005339	Ga0070660_100282446	Ga0070660_1002824461	266
1016	3300005547	Ga0070693_100106548	Ga0070693_1001065481	266
1017	3300005614	Ga0068856_100672866	Ga0068856_1006728661	266
1018	3300005842	Ga0068858_100000021	Ga0068858_100000021128	266
1019	3300005937	Ga0081455_10000054	Ga0081455_1000005433	266
1020	3300009177	Ga0105248_10001340	Ga0105248_100013403	266
1021	3300009545	Ga0105237_10137298	Ga0105237_101372982	266
1022	3300010375	Ga0105239_10061504	Ga0105239_100615041	266
1023	3300011119	Ga0105246_10042492	Ga0105246_100424922	266
1024	3300013105	Ga0157369_10026026	Ga0157369_100260263	266
1025	3300013296	Ga0157374_10228136	Ga0157374_102281361	266
1026	3300013307	Ga0157372_10057617	Ga0157372_100576173	266
1027	3300013308	Ga0157375_10144606	Ga0157375_101446063	266
1028	3300014325	Ga0163163_10021459	Ga0163163_100214592	266
1029	3300014968	Ga0157379_10000005	Ga0157379_1000000547	266
1030	3300020082	Ga0206353_11535168	Ga0206353_115351681	266
1031	3300021388	Ga0213875_10000129	Ga0213875_1000012949	266
1032	3300025917	Ga0207660_10224860	Ga0207660_102248602	266
1033	3300025919	Ga0207657_10122663	Ga0207657_101226631	266
1034	3300025941	Ga0207711_10000976	Ga0207711_100009763	266
1035	3300026035	Ga0207703_10000001	Ga0207703_10000001754	266
1036	3300026078	Ga0207702_10601227	Ga0207702_106012271	266
1037	3300031838	Ga0307518_10006455	Ga0307518_100064555	266
1038	3300033180	Ga0307510_10090016	Ga0307510_100900162	266
1039	3300037853	Ga0436364_1142319	Ga0436364_1142319_32425_33285	266
1040	3300044694	Ga0466963_0001031	Ga0466963_0001031_3082_3942	266
1041	3300044719	Ga0466971_0014934	Ga0466971_0014934_2079_2939	266
1042	3300044842	Ga0466957_0005644	Ga0466957_0005644_3902_4762	266
1043	3300045049	Ga0466959_0025087	Ga0466959_0025087_1607_2467	266
1044	3300045836	Ga0466958_0000028	Ga0466958_0000028_36642_37502	266
1045	3300045976	Ga0466967_0009220	Ga0466967_0009220_2071_2871	266
1046	3300045976	Ga0466967_0040911	Ga0466967_0040911_1811_2611	266
1047	3300048904	Ga0496101_0082909	Ga0496101_0082909_86_886	266
1048	3300048905	Ga0496102_0216061	Ga0496102_0216061_315_1115	266
1049	3300048906	Ga0496103_0075821	Ga0496103_0075821_1183_1983	266
1050	3300048908	Ga0496105_0007259	Ga0496105_0007259_1071_1871	266
1051	3300048909	Ga0496106_0126509	Ga0496106_0126509_260_1060	266
1052	3300048910	Ga0496107_0150279	Ga0496107_0150279_701_1501	266
1053	3300048911	Ga0496108_0241292	Ga0496108_0241292_74_874	266
1054	3300048911	Ga0496108_0347408	Ga0496108_0347408_448_1248	266
1055	3300048911	Ga0496108_0400128	Ga0496108_0400128_132_932	266
1056	3300048912	Ga0496109_0175837	Ga0496109_0175837_719_1519	266
1057	3300048913	Ga0496110_0219958	Ga0496110_0219958_107_907	266
1058	3300048917	Ga0496114_0002004	Ga0496114_0002004_12939_13739	266
1059	3300048917	Ga0496114_0010851	Ga0496114_0010851_5404_6204	266
1060	3300048917	Ga0496114_0086718	Ga0496114_0086718_218_1018	266
1061	3300048917	Ga0496114_0196803	Ga0496114_0196803_35_835	266
1062	3300048918	Ga0496115_0114953	Ga0496115_0114953_1056_1856	266
1063	3300048918	Ga0496115_0123752	Ga0496115_0123752_799_1599	266
1064	3300049575	Ga0501039_0404742	Ga0501039_0404742_30_872	266
1065	3300050489	nmdc:mga03683_5322_c1	nmdc:mga03683_5322_c1_1414_2220	266
1066	3300050492	nmdc:mga0yw44_3490_c1	nmdc:mga0yw44_3490_c1_4036_4842	266
1067	3300050494	nmdc:mga06z11_54108_c1	nmdc:mga06z11_54108_c1_202_1008	266
1068	3300050495	nmdc:mga04h51_121695_c1	nmdc:mga04h51_121695_c1_45_851	266
1069	3300050496	nmdc:mga07m45_12853_c1	nmdc:mga07m45_12853_c1_434_1240	266
1070	3300050510	nmdc:mga06r32_5145_c1	nmdc:mga06r32_5145_c1_2222_3028	266
1071	3300053087	Ga0500643_000369	Ga0500643_000369_27625_28449	266
1072	3300061719	Ga0466962_0001502	Ga0466962_0001502_6153_7013	266
1073	iso_pu_bacteria	2582580736	2583149875	266
1074	iso_pu_bacteria	2643221961	2645719618	266
1075	iso_pu_bacteria	2643221962	2645726514	266
1076	iso_pu_bacteria	2775506925	2776377362	266
1077	iso_pu_bacteria	2808606365	2808874273	266
1078	iso_pu_bacteria	2811994880	2812365024	266
1079	iso_pu_bacteria	2863067949	2863068102	266
1080	iso_pu_bacteria	2891395885	2891400461	266
1081	iso_pu_bacteria	2891554331	2891562182	266
1082	iso_pu_bacteria	2891562705	2891569751	266
1083	iso_pu_bacteria	2984592036	2984594783	266
1084	iso_pu_bacteria	8056054917	8056059753	266
1085	3300005329	Ga0070683_100001768	Ga0070683_1000017682	267
1086	3300005329	Ga0070683_100050602	Ga0070683_1000506024	267
1087	3300005336	Ga0070680_100015626	Ga0070680_1000156265	267
1088	3300005336	Ga0070680_100213782	Ga0070680_1002137821	267
1089	3300005458	Ga0070681_10000165	Ga0070681_1000016541	267
1090	3300005530	Ga0070679_100000350	Ga0070679_1000003505	267
1091	3300005535	Ga0070684_100043060	Ga0070684_1000430603	267
1092	3300005548	Ga0070665_100027333	Ga0070665_1000273334	267
1093	3300005548	Ga0070665_100168930	Ga0070665_1001689302	267
1094	3300005564	Ga0070664_100063419	Ga0070664_1000634193	267
1095	3300005577	Ga0068857_100104913	Ga0068857_1001049133	267
1096	3300005618	Ga0068864_100201463	Ga0068864_1002014631	267
1097	3300005841	Ga0068863_100000326	Ga0068863_10000032611	267
1098	3300005841	Ga0068863_100043158	Ga0068863_1000431583	267
1099	3300005842	Ga0068858_100063462	Ga0068858_1000634622	267
1100	3300006847	Ga0075431_100407751	Ga0075431_1004077512	267
1101	3300006931	Ga0097620_100023061	Ga0097620_1000230613	267
1102	3300009093	Ga0105240_10260576	Ga0105240_102605762	267
1103	3300009093	Ga0105240_10325643	Ga0105240_103256431	267
1104	3300014325	Ga0163163_10106601	Ga0163163_101066013	267
1105	3300020080	Ga0206350_11630717	Ga0206350_116307171	267
1106	3300025900	Ga0207710_10000109	Ga0207710_1000010939	267
1107	3300025912	Ga0207707_10000324	Ga0207707_1000032442	267
1108	3300025917	Ga0207660_10016397	Ga0207660_100163975	267
1109	3300025921	Ga0207652_10000308	Ga0207652_100003085	267
1110	3300025941	Ga0207711_10000240	Ga0207711_1000024019	267
1111	3300025941	Ga0207711_10003513	Ga0207711_100035139	267
1112	3300025944	Ga0207661_10018582	Ga0207661_100185822	267
1113	3300025944	Ga0207661_10035086	Ga0207661_100350864	267
1114	3300025945	Ga0207679_10025033	Ga0207679_100250334	267
1115	3300026035	Ga0207703_10047822	Ga0207703_100478222	267
1116	3300026095	Ga0207676_10290988	Ga0207676_102909881	267
1117	3300026116	Ga0207674_10159506	Ga0207674_101595062	267
1118	3300028379	Ga0268266_10017119	Ga0268266_100171193	267
1119	3300028379	Ga0268266_10140630	Ga0268266_101406303	267
1120	3300031548	Ga0307408_100166454	Ga0307408_1001664543	267
1121	3300031731	Ga0307405_10007813	Ga0307405_100078134	267
1122	3300031824	Ga0307413_10067921	Ga0307413_100679212	267
1123	3300031824	Ga0307413_10284940	Ga0307413_102849402	267
1124	3300031852	Ga0307410_10007099	Ga0307410_100070995	267
1125	3300031852	Ga0307410_10066120	Ga0307410_100661203	267
1126	3300031901	Ga0307406_10004776	Ga0307406_100047767	267
1127	3300031903	Ga0307407_10010022	Ga0307407_100100224	267
1128	3300031903	Ga0307407_10014243	Ga0307407_100142433	267
1129	3300031911	Ga0307412_10009929	Ga0307412_100099293	267
1130	3300031911	Ga0307412_10092360	Ga0307412_100923603	267
1131	3300031995	Ga0307409_100000394	Ga0307409_10000039413	267
1132	3300032002	Ga0307416_100003533	Ga0307416_1000035337	267
1133	3300032002	Ga0307416_100023109	Ga0307416_1000231094	267
1134	3300032002	Ga0307416_100070841	Ga0307416_1000708413	267
1135	3300032126	Ga0307415_100000418	Ga0307415_10000041812	267
1136	3300032126	Ga0307415_100239874	Ga0307415_1002398742	267
1137	3300037853	Ga0436364_0271152	Ga0436364_0271152_29357_30325	267
1138	3300044658	Ga0466972_0074262	Ga0466972_0074262_132_953	267
1139	3300044694	Ga0466963_0180179	Ga0466963_0180179_185_1009	267
1140	3300044765	Ga0466970_0044154	Ga0466970_0044154_844_1665	267
1141	3300044842	Ga0466957_0052722	Ga0466957_0052722_878_1717	267
1142	3300044901	Ga0466960_0108016	Ga0466960_0108016_28_852	267
1143	3300045976	Ga0466967_0004670	Ga0466967_0004670_5537_6367	267
1144	3300045976	Ga0466967_0214569	Ga0466967_0214569_447_1277	267
1145	3300046459	Ga0495629_0295341	Ga0495629_0295341_128_967	267
1146	3300046462	Ga0495651_0004632	Ga0495651_0004632_3458_4327	267
1147	3300046499	Ga0495594_0039450	Ga0495594_0039450_722_1561	267
1148	3300048915	Ga0496112_0064962	Ga0496112_0064962_791_1630	267
1149	3300048929	Ga0496126_0000036	Ga0496126_0000036_317140_317964	267
1150	3300049572	Ga0501036_0537336	Ga0501036_0537336_28_852	267
1151	3300053085	Ga0495619_0256203	Ga0495619_0256203_108_977	267
1152	iso_pu_bacteria	2515154088	2515495824	267
1153	iso_pu_bacteria	2515154129	2515719421	267
1154	iso_pu_bacteria	2515154137	2515755639	267
1155	iso_pu_bacteria	2515154202	2516083760	267
1156	iso_pu_bacteria	2515154203	2516088084	267
1157	iso_pu_bacteria	2622736626	2623588714	267
1158	iso_pu_bacteria	2643221681	2644457032	267
1159	iso_pu_bacteria	2675903059	2676484252	267
1160	iso_pu_bacteria	2751185782	2753263681	267
1161	iso_pu_bacteria	649633069	649815570	267
1162	iso_pu_bacteria	8001781756	8001782559	267
1163	iso_pu_bacteria	8003856774	8003859561	267
1164	iso_pu_bacteria	8003870546	8003871264	267
1165	iso_pu_bacteria	8054727385	8054733036	267
1166	iso_pu_bacteria	8054734606	8054737775	267
1167	iso_pu_bacteria	8056579771	8056585087	267
1168	iso_pu_bacteria	8057568493	8057572373	267
1169	3300005347	Ga0070668_100010237	Ga0070668_1000102375	268
1170	3300005367	Ga0070667_100451382	Ga0070667_1004513821	268
1171	3300005436	Ga0070713_100277108	Ga0070713_1002771081	268
1172	3300005455	Ga0070663_100262056	Ga0070663_1002620562	268
1173	3300005456	Ga0070678_100237295	Ga0070678_1002372952	268
1174	3300005544	Ga0070686_100252855	Ga0070686_1002528551	268
1175	3300005548	Ga0070665_100041870	Ga0070665_1000418704	268
1176	3300005614	Ga0068856_100130124	Ga0068856_1001301242	268
1177	3300005617	Ga0068859_100248712	Ga0068859_1002487123	268
1178	3300005618	Ga0068864_100253463	Ga0068864_1002534632	268
1179	3300005841	Ga0068863_100274132	Ga0068863_1002741321	268
1180	3300005842	Ga0068858_100052104	Ga0068858_1000521042	268
1181	3300005844	Ga0068862_100123283	Ga0068862_1001232832	268
1182	3300005983	Ga0081540_1015910	Ga0081540_10159103	268
1183	3300005985	Ga0081539_10000895	Ga0081539_1000089542	268
1184	3300005985	Ga0081539_10001312	Ga0081539_1000131212	268
1185	3300005985	Ga0081539_10087459	Ga0081539_100874591	268
1186	3300006028	Ga0070717_10104265	Ga0070717_101042653	268
1187	3300006028	Ga0070717_10155318	Ga0070717_101553183	268
1188	3300006844	Ga0075428_100003697	Ga0075428_1000036972	268
1189	3300006844	Ga0075428_100009074	Ga0075428_1000090744	268
1190	3300006846	Ga0075430_100000563	Ga0075430_10000056329	268
1191	3300006846	Ga0075430_100002069	Ga0075430_1000020694	268
1192	3300006846	Ga0075430_100005254	Ga0075430_1000052542	268
1193	3300006847	Ga0075431_100000653	Ga0075431_10000065317	268
1194	3300006847	Ga0075431_100005257	Ga0075431_10000525713	268
1195	3300006847	Ga0075431_100181395	Ga0075431_1001813952	268
1196	3300006880	Ga0075429_100000905	Ga0075429_1000009052	268
1197	3300006880	Ga0075429_100002232	Ga0075429_1000022323	268
1198	3300006914	Ga0075436_100240066	Ga0075436_1002400662	268
1199	3300006931	Ga0097620_100248751	Ga0097620_1002487512	268
1200	3300009147	Ga0114129_10004600	Ga0114129_100046005	268
1201	3300009147	Ga0114129_10202578	Ga0114129_102025783	268
1202	3300009177	Ga0105248_10407856	Ga0105248_104078562	268
1203	3300014968	Ga0157379_10245219	Ga0157379_102452192	268
1204	3300020070	Ga0206356_11227796	Ga0206356_112277962	268
1205	3300020075	Ga0206349_1880295	Ga0206349_18802952	268
1206	3300020078	Ga0206352_10084809	Ga0206352_100848092	268
1207	3300020081	Ga0206354_11403644	Ga0206354_114036442	268
1208	3300022467	Ga0224712_10004543	Ga0224712_100045433	268
1209	3300025910	Ga0207684_10164797	Ga0207684_101647973	268
1210	3300025923	Ga0207681_10370374	Ga0207681_103703741	268
1211	3300025929	Ga0207664_10169828	Ga0207664_101698282	268
1212	3300025938	Ga0207704_10172618	Ga0207704_101726182	268
1213	3300025942	Ga0207689_10212967	Ga0207689_102129672	268
1214	3300025961	Ga0207712_10414315	Ga0207712_104143151	268
1215	3300025972	Ga0207668_10005290	Ga0207668_100052906	268
1216	3300026023	Ga0207677_10337950	Ga0207677_103379502	268
1217	3300026035	Ga0207703_10222534	Ga0207703_102225342	268
1218	3300026078	Ga0207702_10121776	Ga0207702_101217762	268
1219	3300026095	Ga0207676_10307815	Ga0207676_103078152	268
1220	3300026116	Ga0207674_10220224	Ga0207674_102202242	268
1221	3300026118	Ga0207675_100216507	Ga0207675_1002165072	268
1222	3300026121	Ga0207683_10508241	Ga0207683_105082412	268
1223	3300028380	Ga0268265_10103230	Ga0268265_101032302	268
1224	3300028794	Ga0307515_10000526	Ga0307515_1000052637	268
1225	3300028794	Ga0307515_10052077	Ga0307515_100520773	268
1226	3300030521	Ga0307511_10089554	Ga0307511_100895542	268
1227	3300030522	Ga0307512_10018636	Ga0307512_100186363	268
1228	3300030522	Ga0307512_10149662	Ga0307512_101496621	268
1229	3300030732	Ga0316176_1099645	Ga0316176_10996451	268
1230	3300030742	Ga0316183_1156084	Ga0316183_11560841	268
1231	3300030836	Ga0265767_101273	Ga0265767_1012732	268
1232	3300031239	Ga0265328_10019656	Ga0265328_100196563	268
1233	3300031456	Ga0307513_10000005	Ga0307513_10000005488	268
1234	3300031507	Ga0307509_10310406	Ga0307509_103104062	268
1235	3300031614	Ga0310103_105103	Ga0310103_1051032	268
1236	3300031616	Ga0307508_10004108	Ga0307508_100041086	268
1237	3300031616	Ga0307508_10023752	Ga0307508_100237525	268
1238	3300031665	Ga0316575_10023585	Ga0316575_100235853	268
1239	3300031691	Ga0316579_10007179	Ga0316579_100071793	268
1240	3300031727	Ga0316576_10018850	Ga0316576_100188505	268
1241	3300031727	Ga0316576_10102483	Ga0316576_101024832	268
1242	3300031728	Ga0316578_10087169	Ga0316578_100871692	268
1243	3300031730	Ga0307516_10000947	Ga0307516_1000094734	268
1244	3300031730	Ga0307516_10090276	Ga0307516_100902762	268
1245	3300031730	Ga0307516_10202777	Ga0307516_102027772	268
1246	3300031731	Ga0307405_10011554	Ga0307405_100115543	268
1247	3300031731	Ga0307405_10597067	Ga0307405_105970671	268
1248	3300031733	Ga0316577_10013102	Ga0316577_100131025	268
1249	3300031824	Ga0307413_10050477	Ga0307413_100504773	268
1250	3300031889	Ga0326468_10000304	Ga0326468_100003045	268
1251	3300031901	Ga0307406_10037392	Ga0307406_100373923	268
1252	3300031901	Ga0307406_10221090	Ga0307406_102210902	268
1253	3300031903	Ga0307407_10295168	Ga0307407_102951682	268
1254	3300032002	Ga0307416_100227497	Ga0307416_1002274972	268
1255	3300032126	Ga0307415_100209027	Ga0307415_1002090273	268
1256	3300032126	Ga0307415_100431773	Ga0307415_1004317731	268
1257	3300032139	Ga0316580_10000435	Ga0316580_100004352	268
1258	3300033179	Ga0307507_10104686	Ga0307507_101046861	268
1259	3300034957	Ga0373938_0003486	Ga0373938_0003486_899_1738	268
1260	3300035207	Ga0373942_0000111	Ga0373942_0000111_2557_3390	268
1261	3300035242	Ga0373962_0005136	Ga0373962_0005136_168_1010	268
1262	3300035398	Ga0316574_0001081	Ga0316574_0001081_3878_4705	268
1263	3300035692	Ga0373935_0004209	Ga0373935_0004209_6662_7501	268
1264	3300036647	Ga0316582_0004544	Ga0316582_0004544_1139_1966	268
1265	3300037466	Ga0395898_0174687	Ga0395898_0174687_965_1804	268
1266	3300037471	Ga0395905_0037423	Ga0395905_0037423_1408_2247	268
1267	3300037588	Ga0316581_0046488	Ga0316581_0046488_272_1099	268
1268	3300038443	Ga0395901_0029836	Ga0395901_0029836_4348_5187	268
1269	3300041460	Ga0451802_1056664	Ga0451802_1056664_294_1121	268
1270	3300044656	Ga0466969_0002812	Ga0466969_0002812_6282_7106	268
1271	3300044684	Ga0466966_0044462	Ga0466966_0044462_1606_2430	268
1272	3300044719	Ga0466971_0000573	Ga0466971_0000573_9256_10080	268
1273	3300045836	Ga0466958_0007788	Ga0466958_0007788_1397_2221	268
1274	3300045976	Ga0466967_0225951	Ga0466967_0225951_459_1307	268
1275	3300046460	Ga0495638_0042477	Ga0495638_0042477_1180_2064	268
1276	3300046642	Ga0495634_0265835	Ga0495634_0265835_36_860	268
1277	3300047317	Ga0495604_0382844	Ga0495604_0382844_36_875	268
1278	3300047319	Ga0495674_0224223	Ga0495674_0224223_171_1085	268
1279	3300048911	Ga0496108_0000161	Ga0496108_0000161_11370_12209	268
1280	3300049568	Ga0501031_0006610	Ga0501031_0006610_5796_6623	268
1281	3300049570	Ga0501033_0009944	Ga0501033_0009944_790_1617	268
1282	3300049572	Ga0501036_0017334	Ga0501036_0017334_899_1726	268
1283	3300049573	Ga0501037_0037762	Ga0501037_0037762_1969_2796	268
1284	3300049575	Ga0501039_0010009	Ga0501039_0010009_5625_6452	268
1285	3300049576	Ga0501040_0004698	Ga0501040_0004698_5573_6400	268
1286	3300049577	Ga0501041_0020711	Ga0501041_0020711_1415_2242	268
1287	3300049578	Ga0501042_0018743	Ga0501042_0018743_3184_4011	268
1288	3300049579	Ga0501043_0023753	Ga0501043_0023753_3669_4496	268
1289	3300049580	Ga0501046_0028693	Ga0501046_0028693_660_1487	268
1290	3300049582	Ga0501048_0116050	Ga0501048_0116050_943_1770	268
1291	3300049587	Ga0501071_0000661	Ga0501071_0000661_16285_17112	268
1292	3300049588	Ga0501072_0043340	Ga0501072_0043340_821_1648	268
1293	3300049590	Ga0501074_0004669	Ga0501074_0004669_1531_2358	268
1294	3300049591	Ga0501075_0003435	Ga0501075_0003435_2912_3739	268
1295	3300049592	Ga0501076_0004072	Ga0501076_0004072_4466_5293	268
1296	3300049593	Ga0501077_0016129	Ga0501077_0016129_2784_3611	268
1297	3300049741	Ga0501079_0019808	Ga0501079_0019808_1759_2586	268
1298	3300049742	Ga0501080_0065121	Ga0501080_0065121_1693_2520	268
1299	3300049744	Ga0501083_0093236	Ga0501083_0093236_500_1327	268
1300	3300049822	Ga0501035_0256304	Ga0501035_0256304_58_885	268
1301	3300049824	Ga0501045_0007508	Ga0501045_0007508_5971_6798	268
1302	3300050507	nmdc:mga05p37_346018_c1	nmdc:mga05p37_346018_c1_783_1622	268
1303	3300050507	nmdc:mga05p37_4687_c1	nmdc:mga05p37_4687_c1_1348_2187	268
1304	3300050508	nmdc:mga09592_3_c1	nmdc:mga09592_3_c1_801_1640	268
1305	3300050508	nmdc:mga09592_453572_c1	nmdc:mga09592_453572_c1_70_906	268
1306	3300050509	nmdc:mga0qj67_12966_c1	nmdc:mga0qj67_12966_c1_2388_3227	268
1307	3300050509	nmdc:mga0qj67_286_c1	nmdc:mga0qj67_286_c1_14433_15272	268
1308	3300050510	nmdc:mga06r32_10211_c1	nmdc:mga06r32_10211_c1_412_1251	268
1309	3300050510	nmdc:mga06r32_460_c1	nmdc:mga06r32_460_c1_14451_15290	268
1310	3300053090	Ga0500646_0000289	Ga0500646_0000289_5262_6101	268
1311	3300053092	Ga0500583_0057937	Ga0500583_0057937_796_1635	268
1312	3300053096	Ga0500641_0025016	Ga0500641_0025016_802_1641	268
1313	3300053146	Ga0500588_0006010	Ga0500588_0006010_72_911	268
1314	3300053153	Ga0500616_0009436	Ga0500616_0009436_2402_3286	268
1315	3300054114	Ga0501084_0015712	Ga0501084_0015712_4665_5492	268
1316	3300060353	Ga0501082_0081600	Ga0501082_0081600_895_1722	268
1317	3300061719	Ga0466962_0000797	Ga0466962_0000797_9276_10100	268
1318	3300061734	Ga0530510_0013690	Ga0530510_0013690_1694_2521	268
1319	iso_pu_bacteria	2643221587	2643946407	268
1320	iso_pu_bacteria	2643221601	2644019302	268
1321	iso_pu_bacteria	2643221631	2644174210	268
1322	iso_pu_bacteria	2643221670	2644389247	268
1323	iso_pu_bacteria	2643221677	2644434211	268
1324	iso_pu_bacteria	2818991472	2819743746	268
1325	iso_pu_bacteria	2837268691	2837273774	268
1326	iso_pu_bacteria	2918501144	2918502667	268
1327	3300003285	Ga0007423J48922_100319	Ga0007423J48922_1003192	269
1328	3300005347	Ga0070668_100077717	Ga0070668_1000777173	269
1329	3300005435	Ga0070714_100219792	Ga0070714_1002197922	269
1330	3300005546	Ga0070696_100156087	Ga0070696_1001560873	269
1331	3300005718	Ga0068866_10042279	Ga0068866_100422792	269
1332	3300005985	Ga0081539_10001535	Ga0081539_1000153525	269
1333	3300006028	Ga0070717_10346707	Ga0070717_103467071	269
1334	3300006237	Ga0097621_100562870	Ga0097621_1005628701	269
1335	3300006881	Ga0068865_100129774	Ga0068865_1001297743	269
1336	3300010375	Ga0105239_10700539	Ga0105239_107005391	269
1337	3300020069	Ga0197907_10180487	Ga0197907_101804873	269
1338	3300020070	Ga0206356_10259801	Ga0206356_102598012	269
1339	3300020075	Ga0206349_1503277	Ga0206349_15032773	269
1340	3300020080	Ga0206350_10550104	Ga0206350_105501042	269
1341	3300020081	Ga0206354_10973233	Ga0206354_109732333	269
1342	3300020082	Ga0206353_11164031	Ga0206353_111640313	269
1343	3300026089	Ga0207648_10101962	Ga0207648_101019623	269
1344	3300031824	Ga0307413_10427511	Ga0307413_104275112	269
1345	3300033179	Ga0307507_10000081	Ga0307507_1000008159	269
1346	3300037068	Ga0373925_0285509	Ga0373925_0285509_422_1258	269
1347	3300044684	Ga0466966_0080597	Ga0466966_0080597_463_1290	269
1348	3300044693	Ga0466961_0047585	Ga0466961_0047585_1021_1848	269
1349	3300044694	Ga0466963_0404264	Ga0466963_0404264_45_872	269
1350	3300044719	Ga0466971_0008614	Ga0466971_0008614_385_1212	269
1351	3300044719	Ga0466971_0070489	Ga0466971_0070489_357_1184	269
1352	3300045049	Ga0466959_0043431	Ga0466959_0043431_847_1674	269
1353	3300045836	Ga0466958_0029765	Ga0466958_0029765_2003_2830	269
1354	3300048929	Ga0496126_0020671	Ga0496126_0020671_3197_4045	269
1355	3300049574	Ga0501038_0089475	Ga0501038_0089475_722_1558	269
1356	3300061719	Ga0466962_0009029	Ga0466962_0009029_783_1610	269
1357	iso_pu_bacteria	2862705112	2862706360	269
1358	iso_pu_bacteria	2966598605	2966604242	269
1359	iso_pu_bacteria	2990044586	2990050147	269
1360	iso_pu_bacteria	2995463766	2995469196	269
1361	iso_pu_bacteria	3002998708	3003009412	269
1362	iso_pu_bacteria	637000116	637879952	269
1363	iso_pu_bacteria	8008485437	8008486441	269
1364	iso_pu_bacteria	8025524527	8025525510	269
1365	iso_pu_bacteria	8053945823	8053953962	269
1366	iso_pu_bacteria	8056447290	8056453092	269
1367	3300000549	LJQas_1006786	LJQas_10067862	270
1368	3300005366	Ga0070659_100532681	Ga0070659_1005326811	270
1369	3300005435	Ga0070714_100218458	Ga0070714_1002184582	270
1370	3300005618	Ga0068864_100171036	Ga0068864_1001710362	270
1371	3300005843	Ga0068860_100427199	Ga0068860_1004271992	270
1372	3300005937	Ga0081455_10000174	Ga0081455_1000017422	270
1373	3300006880	Ga0075429_100054527	Ga0075429_1000545273	270
1374	3300006881	Ga0068865_100131443	Ga0068865_1001314432	270
1375	3300009147	Ga0114129_10004238	Ga0114129_100042384	270
1376	3300009147	Ga0114129_10046862	Ga0114129_100468623	270
1377	3300009147	Ga0114129_10245819	Ga0114129_102458192	270
1378	3300009147	Ga0114129_10271244	Ga0114129_102712443	270
1379	3300009148	Ga0105243_10243718	Ga0105243_102437182	270
1380	3300009553	Ga0105249_10282426	Ga0105249_102824263	270
1381	3300011119	Ga0105246_10024523	Ga0105246_100245232	270
1382	3300014325	Ga0163163_10159988	Ga0163163_101599882	270
1383	3300025909	Ga0207705_10280835	Ga0207705_102808351	270
1384	3300025961	Ga0207712_10320436	Ga0207712_103204361	270
1385	3300026067	Ga0207678_10119406	Ga0207678_101194062	270
1386	3300026075	Ga0207708_10057739	Ga0207708_100577393	270
1387	3300026095	Ga0207676_10465662	Ga0207676_104656621	270
1388	3300028379	Ga0268266_10257943	Ga0268266_102579432	270
1389	3300030744	Ga0316181_1038614	Ga0316181_10386143	270
1390	3300031824	Ga0307413_10137039	Ga0307413_101370392	270
1391	3300031901	Ga0307406_10091695	Ga0307406_100916952	270
1392	3300031903	Ga0307407_10109211	Ga0307407_101092112	270
1393	3300031995	Ga0307409_100064476	Ga0307409_1000644763	270
1394	3300031995	Ga0307409_100447147	Ga0307409_1004471471	270
1395	3300035086	Ga0373934_0011863	Ga0373934_0011863_766_1632	270
1396	3300035111	Ga0373923_0000682	Ga0373923_0000682_7410_8276	270
1397	3300035117	Ga0373953_0013800	Ga0373953_0013800_443_1309	270
1398	3300035118	Ga0373954_0007499	Ga0373954_0007499_439_1305	270
1399	3300035119	Ga0373956_0079700	Ga0373956_0079700_566_1432	270
1400	3300035120	Ga0373957_0009772	Ga0373957_0009772_730_1596	270
1401	3300035172	Ga0373955_0034352	Ga0373955_0034352_355_1221	270
1402	3300035410	Ga0373924_0032740	Ga0373924_0032740_1089_1955	270
1403	3300035692	Ga0373935_0200858	Ga0373935_0200858_171_1037	270
1404	3300035695	Ga0373927_0300718	Ga0373927_0300718_100_966	270
1405	3300036401	Ga0373937_0086609	Ga0373937_0086609_890_1756	270
1406	3300036457	Ga0265778_004304	Ga0265778_004304_227_1093	270
1407	3300041413	Ga0439465_0049835	Ga0439465_0049835_520_1335	270
1408	3300041512	Ga0451853_0097575	Ga0451853_0097575_331_1146	270
1409	3300042004	Ga0439445_0010181	Ga0439445_0010181_683_1498	270
1410	3300042004	Ga0439445_0028381	Ga0439445_0028381_434_1249	270
1411	3300046454	Ga0495592_0112825	Ga0495592_0112825_742_1608	270
1412	3300046462	Ga0495651_0065701	Ga0495651_0065701_1228_2094	270
1413	3300046463	Ga0495653_0030696	Ga0495653_0030696_2947_3813	270
1414	3300046476	Ga0495662_0032552	Ga0495662_0032552_825_1691	270
1415	3300046511	Ga0495608_0025580	Ga0495608_0025580_782_1648	270
1416	3300046516	Ga0495628_0055615	Ga0495628_0055615_1675_2541	270
1417	3300046531	Ga0495665_0069046	Ga0495665_0069046_471_1337	270
1418	3300046533	Ga0495640_0111419	Ga0495640_0111419_43_909	270
1419	3300046536	Ga0495587_0019434	Ga0495587_0019434_2698_3564	270
1420	3300046543	Ga0495645_0008653	Ga0495645_0008653_47_913	270
1421	3300046559	Ga0495667_0017309	Ga0495667_0017309_1834_2700	270
1422	3300046642	Ga0495634_0041631	Ga0495634_0041631_986_1852	270
1423	3300046663	Ga0495635_0005541	Ga0495635_0005541_5296_6162	270
1424	3300046675	Ga0495657_0065371	Ga0495657_0065371_1373_2239	270
1425	3300046679	Ga0495623_0068063	Ga0495623_0068063_477_1343	270
1426	3300046689	Ga0495613_0170234	Ga0495613_0170234_631_1497	270
1427	3300047317	Ga0495604_0028587	Ga0495604_0028587_2948_3814	270
1428	3300047319	Ga0495674_0016544	Ga0495674_0016544_44_910	270
1429	3300047322	Ga0495680_0071914	Ga0495680_0071914_1143_2009	270
1430	3300047444	Ga0495675_0127529	Ga0495675_0127529_520_1386	270
1431	3300047471	Ga0495684_0032407	Ga0495684_0032407_638_1504	270
1432	3300048088	Ga0495602_0108164	Ga0495602_0108164_425_1291	270
1433	3300049581	Ga0501047_0083217	Ga0501047_0083217_1515_2423	270
1434	3300050508	nmdc:mga09592_48021_c1	nmdc:mga09592_48021_c1_1084_1938	270
1435	3300050510	nmdc:mga06r32_566330_c1	nmdc:mga06r32_566330_c1_48_902	270
1436	3300053077	Ga0495601_0040077	Ga0495601_0040077_264_1130	270
1437	3300053078	Ga0495612_0018413	Ga0495612_0018413_978_1844	270
1438	3300053085	Ga0495619_0053280	Ga0495619_0053280_986_1852	270
1439	3300059628	Ga0587122_006961	Ga0587122_006961_28_840	270
1440	iso_pu_bacteria	2554235005	2554259407	270
1441	iso_pu_bacteria	2643221578	2643904636	270
1442	iso_pu_bacteria	2643221673	2644406098	270
1443	iso_pu_bacteria	2767802112	2768645681	270
1444	iso_pu_bacteria	2802429296	2804843945	270
1445	iso_pu_bacteria	2808606982	2811847118	270
1446	iso_pu_bacteria	2811994917	2812482225	270
1447	iso_pu_bacteria	2867369537	2867369990	270
1448	iso_pu_bacteria	2867475112	2867477063	270
1449	iso_pu_bacteria	2875391855	2875392836	270
1450	iso_pu_bacteria	2946045630	2946051871	270
1451	iso_pu_bacteria	2990088156	2990090426	270
1452	iso_pu_bacteria	8025413630	8025419562	270
1453	iso_pu_bacteria	8025530807	8025530930	270
1454	iso_pu_bacteria	8033684223	8033689466	270
1455	iso_pu_bacteria	8047893842	8047900155	270
1456	iso_pu_bacteria	8048127548	8048134022	270
1457	iso_pu_bacteria	8048356638	8048358772	270
1458	iso_pu_bacteria	8048369669	8048377102	270
1459	iso_pu_bacteria	8048379754	8048386157	270
1460	iso_pu_bacteria	8054160619	8054167071	270
1461	iso_pu_bacteria	8056667051	8056670242	270
1462	3300006051	Ga0075364_10010913	Ga0075364_100109135	271
1463	3300028800	Ga0265338_10102739	Ga0265338_101027391	271
1464	3300031241	Ga0265325_10106819	Ga0265325_101068192	271
1465	3300031595	Ga0265313_10044614	Ga0265313_100446142	271
1466	3300041494	Ga0451837_1526648	Ga0451837_1526648_394_1215	271
1467	3300042136	Ga0450900_023100	Ga0450900_023100_13_852	271
1468	3300046463	Ga0495653_0021207	Ga0495653_0021207_880_1728	271
1469	3300048904	Ga0496101_0291104	Ga0496101_0291104_330_1172	271
1470	3300048907	Ga0496104_0162968	Ga0496104_0162968_413_1249	271
1471	3300048913	Ga0496110_0033047	Ga0496110_0033047_2541_3377	271
1472	3300048913	Ga0496110_0113261	Ga0496110_0113261_1599_2426	271
1473	3300048914	Ga0496111_0061349	Ga0496111_0061349_928_1764	271
1474	3300048915	Ga0496112_0246873	Ga0496112_0246873_247_1083	271
1475	3300048917	Ga0496114_0285883	Ga0496114_0285883_367_1203	271
1476	3300048925	Ga0496122_0039579	Ga0496122_0039579_2139_2960	271
1477	3300048927	Ga0496124_0096223	Ga0496124_0096223_1172_1993	271
1478	3300049586	Ga0501070_0059692	Ga0501070_0059692_703_1539	271
1479	3300049586	Ga0501070_0113434	Ga0501070_0113434_382_1218	271
1480	3300049741	Ga0501079_0091274	Ga0501079_0091274_909_1727	271
1481	3300050491	nmdc:mga00v17_1426_c2	nmdc:mga00v17_1426_c2_3898_4719	271
1482	iso_pu_bacteria	2643221613	2644084325	271
1483	iso_pu_bacteria	2643221721	2644664371	271
1484	iso_pu_bacteria	2799112218	2799186362	271
1485	iso_pu_bacteria	2884994152	2884995325	271
1486	3300005327	Ga0070658_10000677	Ga0070658_1000067729	272
1487	3300005434	Ga0070709_10064622	Ga0070709_100646223	272
1488	3300005437	Ga0070710_10069572	Ga0070710_100695723	272
1489	3300005468	Ga0070707_100168168	Ga0070707_1001681682	272
1490	3300005563	Ga0068855_100017586	Ga0068855_1000175866	272
1491	3300006173	Ga0070716_100024579	Ga0070716_1000245793	272
1492	3300020075	Ga0206349_1533574	Ga0206349_15335741	272
1493	3300025898	Ga0207692_10033113	Ga0207692_100331133	272
1494	3300025905	Ga0207685_10083550	Ga0207685_100835502	272
1495	3300025909	Ga0207705_10001683	Ga0207705_100016839	272
1496	3300025921	Ga0207652_10044362	Ga0207652_100443622	272
1497	3300025922	Ga0207646_10073926	Ga0207646_100739262	272
1498	3300025928	Ga0207700_10164859	Ga0207700_101648592	272
1499	3300025939	Ga0207665_10059811	Ga0207665_100598112	272
1500	3300025949	Ga0207667_10064105	Ga0207667_100641054	272
1501	3300025949	Ga0207667_10244272	Ga0207667_102442722	272
1502	3300030744	Ga0316181_1007646	Ga0316181_10076462	272
1503	3300031456	Ga0307513_10004909	Ga0307513_1000490915	272
1504	3300031903	Ga0307407_10009801	Ga0307407_100098013	272
1505	3300031911	Ga0307412_10098323	Ga0307412_100983232	272
1506	3300032002	Ga0307416_100017383	Ga0307416_1000173836	272
1507	3300032005	Ga0307411_10040060	Ga0307411_100400603	272
1508	3300041494	Ga0451837_0252531	Ga0451837_0252531_859_1680	272
1509	3300041496	Ga0451839_1129246	Ga0451839_1129246_1066_1887	272
1510	3300042002	Ga0439442_012818	Ga0439442_012818_741_1580	272
1511	3300044684	Ga0466966_0001765	Ga0466966_0001765_10716_11561	272
1512	3300044684	Ga0466966_0071840	Ga0466966_0071840_539_1390	272
1513	3300044693	Ga0466961_0016340	Ga0466961_0016340_2068_2913	272
1514	3300044765	Ga0466970_0170268	Ga0466970_0170268_345_1190	272
1515	3300044901	Ga0466960_0030189	Ga0466960_0030189_1513_2343	272
1516	3300045049	Ga0466959_0004961	Ga0466959_0004961_2430_3275	272
1517	3300046473	Ga0495582_0227480	Ga0495582_0227480_144_974	272
1518	3300048914	Ga0496111_0183049	Ga0496111_0183049_710_1546	272
1519	3300048925	Ga0496122_0000548	Ga0496122_0000548_1638_2486	272
1520	3300048928	Ga0496125_0000025	Ga0496125_0000025_424933_425781	272
1521	3300049568	Ga0501031_0002419	Ga0501031_0002419_6567_7439	272
1522	3300049568	Ga0501031_0153441	Ga0501031_0153441_41_886	272
1523	3300049569	Ga0501032_0000531	Ga0501032_0000531_13846_14718	272
1524	3300049569	Ga0501032_0090854	Ga0501032_0090854_89_934	272
1525	3300049570	Ga0501033_0002898	Ga0501033_0002898_1597_2469	272
1526	3300049570	Ga0501033_0014590	Ga0501033_0014590_834_1679	272
1527	3300049571	Ga0501034_0044053	Ga0501034_0044053_2755_3627	272
1528	3300049571	Ga0501034_0061036	Ga0501034_0061036_1807_2652	272
1529	3300049572	Ga0501036_0091102	Ga0501036_0091102_557_1402	272
1530	3300049573	Ga0501037_0001214	Ga0501037_0001214_6567_7439	272
1531	3300049574	Ga0501038_0000985	Ga0501038_0000985_12076_12948	272
1532	3300049575	Ga0501039_0007366	Ga0501039_0007366_1747_2619	272
1533	3300049576	Ga0501040_0080688	Ga0501040_0080688_894_1766	272
1534	3300049579	Ga0501043_0015670	Ga0501043_0015670_4627_5472	272
1535	3300049579	Ga0501043_0027031	Ga0501043_0027031_2627_3499	272
1536	3300049580	Ga0501046_0000052	Ga0501046_0000052_126251_127123	272
1537	3300049581	Ga0501047_0004931	Ga0501047_0004931_3634_4506	272
1538	3300049581	Ga0501047_0070274	Ga0501047_0070274_1912_2757	272
1539	3300049582	Ga0501048_0001468	Ga0501048_0001468_4645_5517	272
1540	3300049585	Ga0501069_0001134	Ga0501069_0001134_3461_4333	272
1541	3300049585	Ga0501069_0005471	Ga0501069_0005471_2019_2891	272
1542	3300049586	Ga0501070_0005367	Ga0501070_0005367_7472_8344	272
1543	3300049586	Ga0501070_0014651	Ga0501070_0014651_3849_4721	272
1544	3300049589	Ga0501073_0006766	Ga0501073_0006766_5581_6453	272
1545	3300049590	Ga0501074_0000774	Ga0501074_0000774_3572_4444	272
1546	3300049590	Ga0501074_0074569	Ga0501074_0074569_70_942	272
1547	3300049742	Ga0501080_0000195	Ga0501080_0000195_40566_41438	272
1548	3300049742	Ga0501080_0103447	Ga0501080_0103447_50_922	272
1549	3300049744	Ga0501083_0036282	Ga0501083_0036282_1965_2837	272
1550	3300049822	Ga0501035_0004238	Ga0501035_0004238_933_1805	272
1551	3300049822	Ga0501035_0087017	Ga0501035_0087017_268_1113	272
1552	3300049823	Ga0501044_0007521	Ga0501044_0007521_7935_8807	272
1553	3300049823	Ga0501044_0053455	Ga0501044_0053455_2746_3591	272
1554	3300054114	Ga0501084_0001800	Ga0501084_0001800_12742_13614	272
1555	iso_pu_bacteria	2855386786	2855387232	272
1556	3300004799	Ga0058863_11842216	Ga0058863_118422162	273
1557	3300005548	Ga0070665_100066770	Ga0070665_1000667703	273
1558	3300005563	Ga0068855_100013737	Ga0068855_1000137379	273
1559	3300005577	Ga0068857_100158133	Ga0068857_1001581333	273
1560	3300005578	Ga0068854_100001572	Ga0068854_10000157212	273
1561	3300005614	Ga0068856_100175749	Ga0068856_1001757493	273
1562	3300005616	Ga0068852_100003280	Ga0068852_10000328013	273
1563	3300009174	Ga0105241_10004353	Ga0105241_100043533	273
1564	3300011119	Ga0105246_10388413	Ga0105246_103884132	273
1565	3300013296	Ga0157374_10061665	Ga0157374_100616653	273
1566	3300020069	Ga0197907_10178223	Ga0197907_101782233	273
1567	3300020070	Ga0206356_11913027	Ga0206356_119130273	273
1568	3300020077	Ga0206351_10074211	Ga0206351_100742112	273
1569	3300020078	Ga0206352_11047585	Ga0206352_110475852	273
1570	3300020080	Ga0206350_10284203	Ga0206350_102842031	273
1571	3300020081	Ga0206354_10169974	Ga0206354_101699743	273
1572	3300021384	Ga0213876_10001518	Ga0213876_100015189	273
1573	3300022467	Ga0224712_10007467	Ga0224712_100074672	273
1574	3300025909	Ga0207705_10049873	Ga0207705_100498733	273
1575	3300025911	Ga0207654_10007091	Ga0207654_100070913	273
1576	3300025913	Ga0207695_10002775	Ga0207695_1000277522	273
1577	3300025914	Ga0207671_10000492	Ga0207671_1000049244	273
1578	3300025924	Ga0207694_10003311	Ga0207694_100033116	273
1579	3300025929	Ga0207664_10185397	Ga0207664_101853973	273
1580	3300025949	Ga0207667_10251437	Ga0207667_102514373	273
1581	3300025981	Ga0207640_10016160	Ga0207640_100161604	273
1582	3300026078	Ga0207702_10085179	Ga0207702_100851792	273
1583	3300026078	Ga0207702_10606629	Ga0207702_106066291	273
1584	3300026116	Ga0207674_10051121	Ga0207674_100511215	273
1585	3300026116	Ga0207674_10200147	Ga0207674_102001472	273
1586	3300028379	Ga0268266_10049402	Ga0268266_100494023	273
1587	3300028794	Ga0307515_10188910	Ga0307515_101889102	273
1588	3300030521	Ga0307511_10073703	Ga0307511_100737032	273
1589	3300030522	Ga0307512_10013870	Ga0307512_100138702	273
1590	3300031456	Ga0307513_10060423	Ga0307513_100604232	273
1591	3300031456	Ga0307513_10074276	Ga0307513_100742763	273
1592	3300031649	Ga0307514_10083498	Ga0307514_100834982	273
1593	3300031649	Ga0307514_10201336	Ga0307514_102013361	273
1594	3300031727	Ga0316576_10075482	Ga0316576_100754823	273
1595	3300032002	Ga0307416_100059261	Ga0307416_1000592613	273
1596	3300033180	Ga0307510_10143279	Ga0307510_101432792	273
1597	3300039437	Ga0436365_0205930	Ga0436365_0205930_12270_13124	273
1598	3300044693	Ga0466961_0097369	Ga0466961_0097369_156_1010	273
1599	3300044706	Ga0466964_0024434	Ga0466964_0024434_249_1103	273
1600	3300044719	Ga0466971_0019833	Ga0466971_0019833_697_1551	273
1601	3300044842	Ga0466957_0001250	Ga0466957_0001250_204_1058	273
1602	3300045836	Ga0466958_0005908	Ga0466958_0005908_4612_5466	273
1603	3300045976	Ga0466967_0041743	Ga0466967_0041743_382_1236	273
1604	3300046454	Ga0495592_0033577	Ga0495592_0033577_2714_3562	273
1605	3300046459	Ga0495629_0254608	Ga0495629_0254608_253_1101	273
1606	3300046461	Ga0495641_0110321	Ga0495641_0110321_175_1020	273
1607	3300046492	Ga0495585_0037769	Ga0495585_0037769_84_929	273
1608	3300046516	Ga0495628_0061754	Ga0495628_0061754_1400_2269	273
1609	3300046516	Ga0495628_0112387	Ga0495628_0112387_1147_1995	273
1610	3300046529	Ga0495652_0005113	Ga0495652_0005113_784_1632	273
1611	3300046533	Ga0495640_0006184	Ga0495640_0006184_980_1828	273
1612	3300046642	Ga0495634_0007726	Ga0495634_0007726_5271_6119	273
1613	3300046675	Ga0495657_0005293	Ga0495657_0005293_4785_5633	273
1614	3300046678	Ga0495599_0234632	Ga0495599_0234632_201_1049	273
1615	3300046679	Ga0495623_0091764	Ga0495623_0091764_340_1188	273
1616	3300046689	Ga0495613_0009893	Ga0495613_0009893_4766_5614	273
1617	3300046689	Ga0495613_0206525	Ga0495613_0206525_63_908	273
1618	3300046690	Ga0495624_0026820	Ga0495624_0026820_912_1760	273
1619	3300046809	Ga0495600_0098739	Ga0495600_0098739_128_976	273
1620	3300047317	Ga0495604_0080130	Ga0495604_0080130_145_990	273
1621	3300047321	Ga0495676_0006231	Ga0495676_0006231_2733_3581	273
1622	3300048912	Ga0496109_0525471	Ga0496109_0525471_191_1033	273
1623	3300049569	Ga0501032_0065459	Ga0501032_0065459_267_1121	273
1624	3300049571	Ga0501034_0431225	Ga0501034_0431225_22_876	273
1625	3300049573	Ga0501037_0091919	Ga0501037_0091919_542_1396	273
1626	3300049581	Ga0501047_0000110	Ga0501047_0000110_91544_92392	273
1627	3300049581	Ga0501047_0075739	Ga0501047_0075739_1514_2359	273
1628	3300049585	Ga0501069_0059936	Ga0501069_0059936_248_1102	273
1629	3300049586	Ga0501070_0022117	Ga0501070_0022117_128_982	273
1630	3300049586	Ga0501070_0055213	Ga0501070_0055213_388_1242	273
1631	3300049589	Ga0501073_0223703	Ga0501073_0223703_87_941	273
1632	3300049741	Ga0501079_0020827	Ga0501079_0020827_2653_3507	273
1633	3300049742	Ga0501080_0000233	Ga0501080_0000233_22369_23223	273
1634	3300049742	Ga0501080_0052365	Ga0501080_0052365_2929_3783	273
1635	3300049822	Ga0501035_0024538	Ga0501035_0024538_1084_1932	273
1636	3300049823	Ga0501044_0044118	Ga0501044_0044118_247_1101	273
1637	3300049823	Ga0501044_0114677	Ga0501044_0114677_35_889	273
1638	3300049823	Ga0501044_0290999	Ga0501044_0290999_622_1464	273
1639	3300049823	Ga0501044_0560852	Ga0501044_0560852_73_918	273
1640	3300053077	Ga0495601_0084351	Ga0495601_0084351_1003_1872	273
1641	3300053107	Ga0500560_016244	Ga0500560_016244_151_996	273
1642	3300053140	Ga0500573_0024851	Ga0500573_0024851_864_1709	273
1643	iso_pu_bacteria	2643221696	2644532153	273
1644	iso_pu_bacteria	2857481737	2857482552	273
1645	3300003373	JGI25407J50210_10020927	JGI25407J50210_100209272	274
1646	3300005327	Ga0070658_10001229	Ga0070658_1000122918	274
1647	3300005336	Ga0070680_100001286	Ga0070680_1000012862	274
1648	3300005458	Ga0070681_10026426	Ga0070681_100264262	274
1649	3300005530	Ga0070679_100003768	Ga0070679_1000037686	274
1650	3300005563	Ga0068855_100151727	Ga0068855_1001517273	274
1651	3300005981	Ga0081538_10000016	Ga0081538_1000001659	274
1652	3300006844	Ga0075428_100268480	Ga0075428_1002684801	274
1653	3300006852	Ga0075433_10151960	Ga0075433_101519601	274
1654	3300006871	Ga0075434_100547877	Ga0075434_1005478771	274
1655	3300006914	Ga0075436_100051016	Ga0075436_1000510164	274
1656	3300009093	Ga0105240_10027024	Ga0105240_100270242	274
1657	3300009147	Ga0114129_10051063	Ga0114129_100510634	274
1658	3300010375	Ga0105239_10030750	Ga0105239_100307505	274
1659	3300013104	Ga0157370_10000875	Ga0157370_1000087510	274
1660	3300013105	Ga0157369_10008751	Ga0157369_100087518	274
1661	3300013296	Ga0157374_10553011	Ga0157374_105530112	274
1662	3300020081	Ga0206354_10515985	Ga0206354_105159852	274
1663	3300020081	Ga0206354_11004666	Ga0206354_110046662	274
1664	3300020082	Ga0206353_10372181	Ga0206353_103721812	274
1665	3300020082	Ga0206353_10896784	Ga0206353_108967843	274
1666	3300022467	Ga0224712_10078301	Ga0224712_100783012	274
1667	3300025909	Ga0207705_10141486	Ga0207705_101414862	274
1668	3300025912	Ga0207707_10007997	Ga0207707_100079975	274
1669	3300025912	Ga0207707_10060544	Ga0207707_100605444	274
1670	3300025913	Ga0207695_10028354	Ga0207695_100283544	274
1671	3300025917	Ga0207660_10124163	Ga0207660_101241633	274
1672	3300025917	Ga0207660_10164200	Ga0207660_101642002	274
1673	3300025919	Ga0207657_10152718	Ga0207657_101527182	274
1674	3300025921	Ga0207652_10001488	Ga0207652_100014882	274
1675	3300025921	Ga0207652_10052928	Ga0207652_100529282	274
1676	3300025949	Ga0207667_10020621	Ga0207667_100206217	274
1677	3300025949	Ga0207667_10266449	Ga0207667_102664492	274
1678	3300037466	Ga0395898_0018877	Ga0395898_0018877_1704_2573	274
1679	3300044694	Ga0466963_0094973	Ga0466963_0094973_909_1757	274
1680	3300044719	Ga0466971_0036447	Ga0466971_0036447_549_1397	274
1681	3300045836	Ga0466958_0029242	Ga0466958_0029242_2223_3071	274
1682	3300048912	Ga0496109_0098691	Ga0496109_0098691_1128_1964	274
1683	3300048913	Ga0496110_0020585	Ga0496110_0020585_3588_4424	274
1684	3300048914	Ga0496111_0460276	Ga0496111_0460276_34_921	274
1685	3300048917	Ga0496114_0090113	Ga0496114_0090113_367_1224	274
1686	3300048917	Ga0496114_0281178	Ga0496114_0281178_379_1224	274
1687	3300048925	Ga0496122_0000271	Ga0496122_0000271_39524_40384	274
1688	3300048926	Ga0496123_0000279	Ga0496123_0000279_37183_38043	274
1689	3300048927	Ga0496124_0000243	Ga0496124_0000243_81400_82260	274
1690	3300048927	Ga0496124_0130919	Ga0496124_0130919_248_1102	274
1691	3300049571	Ga0501034_0555234	Ga0501034_0555234_77_922	274
1692	3300049573	Ga0501037_0106295	Ga0501037_0106295_353_1198	274
1693	3300049574	Ga0501038_0006642	Ga0501038_0006642_1988_2833	274
1694	3300049574	Ga0501038_0312870	Ga0501038_0312870_211_1056	274
1695	3300049579	Ga0501043_0007425	Ga0501043_0007425_884_1729	274
1696	3300049580	Ga0501046_0001931	Ga0501046_0001931_1964_2809	274
1697	3300049581	Ga0501047_0029859	Ga0501047_0029859_3653_4498	274
1698	3300049582	Ga0501048_0124804	Ga0501048_0124804_289_1134	274
1699	3300049583	Ga0501067_0045210	Ga0501067_0045210_314_1159	274
1700	3300049586	Ga0501070_0086112	Ga0501070_0086112_356_1201	274
1701	3300049590	Ga0501074_0062111	Ga0501074_0062111_788_1633	274
1702	3300049743	Ga0501081_0186382	Ga0501081_0186382_345_1193	274
1703	3300049744	Ga0501083_0012430	Ga0501083_0012430_3128_3973	274
1704	3300049822	Ga0501035_0037083	Ga0501035_0037083_1896_2741	274
1705	3300049823	Ga0501044_0011630	Ga0501044_0011630_6705_7550	274
1706	3300050507	nmdc:mga05p37_14467_c1	nmdc:mga05p37_14467_c1_3531_4412	274
1707	3300050512	nmdc:mga0n895_87729_c1	nmdc:mga0n895_87729_c1_126_1007	274
1708	3300050513	nmdc:mga0rr50_74572_c1	nmdc:mga0rr50_74572_c1_1330_2211	274
1709	3300054114	Ga0501084_0167230	Ga0501084_0167230_605_1450	274
1710	3300060353	Ga0501082_0009212	Ga0501082_0009212_2002_2847	274
1711	3300061719	Ga0466962_0019181	Ga0466962_0019181_957_1805	274
1712	iso_pu_bacteria	2515154155	2515851243	274
1713	iso_pu_bacteria	2731639228	2731909313	274
1714	iso_pu_bacteria	2839986021	2839989137	274
1715	iso_pu_bacteria	3002998708	3003009230	274
1716	iso_pu_bacteria	8053945823	8053953200	274
1717	3300005355	Ga0070671_100352126	Ga0070671_1003521261	275
1718	3300005530	Ga0070679_100118956	Ga0070679_1001189564	275
1719	3300005546	Ga0070696_100071229	Ga0070696_1000712292	275
1720	3300006051	Ga0075364_10114018	Ga0075364_101140182	275
1721	3300020069	Ga0197907_10365046	Ga0197907_103650462	275
1722	3300032004	Ga0307414_10289273	Ga0307414_102892732	275
1723	3300037312	Ga0395899_0008630	Ga0395899_0008630_3442_4287	275
1724	3300038443	Ga0395901_0192534	Ga0395901_0192534_1157_2032	275
1725	3300039453	Ga0436362_0336459	Ga0436362_0336459_11_952	275
1726	3300044658	Ga0466972_0084392	Ga0466972_0084392_519_1349	275
1727	3300044693	Ga0466961_0006181	Ga0466961_0006181_4105_4977	275
1728	3300046529	Ga0495652_0009875	Ga0495652_0009875_1158_2072	275
1729	3300046680	Ga0495646_0007273	Ga0495646_0007273_623_1537	275
1730	3300048928	Ga0496125_0005551	Ga0496125_0005551_13070_13933	275
1731	3300049569	Ga0501032_0249146	Ga0501032_0249146_137_985	275
1732	3300049571	Ga0501034_0035341	Ga0501034_0035341_3406_4254	275
1733	3300049572	Ga0501036_0010598	Ga0501036_0010598_958_1806	275
1734	3300049573	Ga0501037_0007251	Ga0501037_0007251_606_1454	275
1735	3300049575	Ga0501039_0097538	Ga0501039_0097538_86_934	275
1736	3300049578	Ga0501042_0071597	Ga0501042_0071597_824_1672	275
1737	3300049579	Ga0501043_0010036	Ga0501043_0010036_6131_6979	275
1738	3300049589	Ga0501073_0116307	Ga0501073_0116307_45_893	275
1739	3300049590	Ga0501074_0003072	Ga0501074_0003072_5892_6740	275
1740	3300049823	Ga0501044_0034584	Ga0501044_0034584_2107_2955	275
1741	3300049824	Ga0501045_0342312	Ga0501045_0342312_160_1008	275
1742	3300053078	Ga0495612_0003533	Ga0495612_0003533_4075_4989	275
1743	3300054114	Ga0501084_0337969	Ga0501084_0337969_312_1160	275
1744	3300061719	Ga0466962_0118615	Ga0466962_0118615_306_1136	275
1745	iso_pu_bacteria	2675903058	2676475748	275
1746	iso_pu_bacteria	2827628540	2827630308	275
1747	3300000549	LJQas_1006053	LJQas_10060532	276
1748	3300005327	Ga0070658_10015639	Ga0070658_100156393	276
1749	3300005329	Ga0070683_100028402	Ga0070683_1000284024	276
1750	3300005329	Ga0070683_100284937	Ga0070683_1002849372	276
1751	3300005336	Ga0070680_100132158	Ga0070680_1001321583	276
1752	3300005339	Ga0070660_100026658	Ga0070660_1000266584	276
1753	3300005339	Ga0070660_100030882	Ga0070660_1000308824	276
1754	3300005367	Ga0070667_100030035	Ga0070667_1000300352	276
1755	3300005435	Ga0070714_100009154	Ga0070714_1000091546	276
1756	3300005458	Ga0070681_10109038	Ga0070681_101090383	276
1757	3300005530	Ga0070679_100008566	Ga0070679_10000856611	276
1758	3300005530	Ga0070679_100112031	Ga0070679_1001120314	276
1759	3300005535	Ga0070684_100487894	Ga0070684_1004878942	276
1760	3300005548	Ga0070665_100000522	Ga0070665_10000052224	276
1761	3300005577	Ga0068857_100121028	Ga0068857_1001210282	276
1762	3300005615	Ga0070702_100055420	Ga0070702_1000554203	276
1763	3300005718	Ga0068866_10129639	Ga0068866_101296392	276
1764	3300005937	Ga0081455_10028079	Ga0081455_100280797	276
1765	3300005937	Ga0081455_10156199	Ga0081455_101561993	276
1766	3300005981	Ga0081538_10020067	Ga0081538_100200675	276
1767	3300006038	Ga0075365_10249054	Ga0075365_102490542	276
1768	3300006844	Ga0075428_100171371	Ga0075428_1001713713	276
1769	3300006844	Ga0075428_100457702	Ga0075428_1004577022	276
1770	3300006847	Ga0075431_100270941	Ga0075431_1002709411	276
1771	3300006880	Ga0075429_100002285	Ga0075429_1000022854	276
1772	3300006881	Ga0068865_100026105	Ga0068865_1000261053	276
1773	3300006881	Ga0068865_100541281	Ga0068865_1005412812	276
1774	3300009094	Ga0111539_10025105	Ga0111539_100251052	276
1775	3300009098	Ga0105245_10260479	Ga0105245_102604793	276
1776	3300009147	Ga0114129_10061917	Ga0114129_100619174	276
1777	3300009147	Ga0114129_10090488	Ga0114129_100904884	276
1778	3300009147	Ga0114129_10132506	Ga0114129_101325063	276
1779	3300009148	Ga0105243_10372972	Ga0105243_103729722	276
1780	3300013307	Ga0157372_10225311	Ga0157372_102253112	276
1781	3300014325	Ga0163163_10163814	Ga0163163_101638144	276
1782	3300014326	Ga0157380_10581319	Ga0157380_105813192	276
1783	3300020081	Ga0206354_10208976	Ga0206354_102089762	276
1784	3300020082	Ga0206353_10997031	Ga0206353_109970313	276
1785	3300022467	Ga0224712_10073693	Ga0224712_100736932	276
1786	3300025908	Ga0207643_10127017	Ga0207643_101270172	276
1787	3300025909	Ga0207705_10043144	Ga0207705_100431443	276
1788	3300025909	Ga0207705_10050550	Ga0207705_100505503	276
1789	3300025912	Ga0207707_10042682	Ga0207707_100426824	276
1790	3300025914	Ga0207671_10262182	Ga0207671_102621822	276
1791	3300025917	Ga0207660_10254752	Ga0207660_102547522	276
1792	3300025919	Ga0207657_10038868	Ga0207657_100388683	276
1793	3300025919	Ga0207657_10073107	Ga0207657_100731073	276
1794	3300025921	Ga0207652_10072712	Ga0207652_100727122	276
1795	3300025929	Ga0207664_10004553	Ga0207664_100045536	276
1796	3300025929	Ga0207664_10397339	Ga0207664_103973392	276
1797	3300025938	Ga0207704_10388448	Ga0207704_103884482	276
1798	3300025944	Ga0207661_10006613	Ga0207661_100066133	276
1799	3300025944	Ga0207661_10590899	Ga0207661_105908991	276
1800	3300025986	Ga0207658_10139232	Ga0207658_101392322	276
1801	3300026023	Ga0207677_10060891	Ga0207677_100608913	276
1802	3300026075	Ga0207708_10143291	Ga0207708_101432912	276
1803	3300026089	Ga0207648_10288791	Ga0207648_102887912	276
1804	3300026116	Ga0207674_10049442	Ga0207674_100494423	276
1805	3300026118	Ga0207675_100041354	Ga0207675_1000413544	276
1806	3300027907	Ga0207428_10005610	Ga0207428_1000561012	276
1807	3300028379	Ga0268266_10001311	Ga0268266_1000131120	276
1808	3300031824	Ga0307413_10141287	Ga0307413_101412872	276
1809	3300032002	Ga0307416_100818743	Ga0307416_1008187432	276
1810	3300032126	Ga0307415_100127888	Ga0307415_1001278882	276
1811	3300037312	Ga0395899_0300690	Ga0395899_0300690_118_990	276
1812	3300037466	Ga0395898_0105863	Ga0395898_0105863_116_958	276
1813	3300037466	Ga0395898_0328137	Ga0395898_0328137_351_1223	276
1814	3300037853	Ga0436364_1031667	Ga0436364_1031667_162_992	276
1815	3300038443	Ga0395901_0039390	Ga0395901_0039390_3531_4373	276
1816	3300041405	Ga0439438_026310	Ga0439438_026310_214_1059	276
1817	3300041410	Ga0439461_0002599	Ga0439461_0002599_1046_1891	276
1818	3300041997	Ga0439431_0001715	Ga0439431_0001715_2426_3271	276
1819	3300042002	Ga0439442_005726	Ga0439442_005726_1105_1950	276
1820	3300042014	Ga0439457_018679	Ga0439457_018679_576_1421	276
1821	3300044694	Ga0466963_0035727	Ga0466963_0035727_884_1714	276
1822	3300044694	Ga0466963_0187817	Ga0466963_0187817_269_1099	276
1823	3300045976	Ga0466967_0033310	Ga0466967_0033310_937_1767	276
1824	3300045976	Ga0466967_0051219	Ga0466967_0051219_1022_1852	276
1825	3300045976	Ga0466967_0058139	Ga0466967_0058139_742_1572	276
1826	3300045976	Ga0466967_0241587	Ga0466967_0241587_118_1002	276
1827	3300046455	Ga0495603_0050725	Ga0495603_0050725_795_1625	276
1828	3300046559	Ga0495667_0284373	Ga0495667_0284373_101_931	276
1829	3300046663	Ga0495635_0124795	Ga0495635_0124795_819_1652	276
1830	3300048905	Ga0496102_0105127	Ga0496102_0105127_922_1779	276
1831	3300048905	Ga0496102_0226059	Ga0496102_0226059_38_880	276
1832	3300048906	Ga0496103_0004411	Ga0496103_0004411_1191_2033	276
1833	3300048907	Ga0496104_0380315	Ga0496104_0380315_137_994	276
1834	3300048908	Ga0496105_0258863	Ga0496105_0258863_204_1046	276
1835	3300048911	Ga0496108_0034958	Ga0496108_0034958_1105_1947	276
1836	3300048911	Ga0496108_0280815	Ga0496108_0280815_509_1339	276
1837	3300048912	Ga0496109_0083232	Ga0496109_0083232_616_1458	276
1838	3300048912	Ga0496109_0361467	Ga0496109_0361467_151_1008	276
1839	3300048913	Ga0496110_0215807	Ga0496110_0215807_365_1207	276
1840	3300048914	Ga0496111_0147345	Ga0496111_0147345_540_1397	276
1841	3300048915	Ga0496112_0113280	Ga0496112_0113280_1750_2607	276
1842	3300048915	Ga0496112_0127272	Ga0496112_0127272_615_1457	276
1843	3300048916	Ga0496113_0061251	Ga0496113_0061251_1051_1893	276
1844	3300048916	Ga0496113_0259303	Ga0496113_0259303_375_1205	276
1845	3300049568	Ga0501031_0015282	Ga0501031_0015282_2101_2970	276
1846	3300049568	Ga0501031_0097666	Ga0501031_0097666_821_1663	276
1847	3300049571	Ga0501034_0063482	Ga0501034_0063482_641_1471	276
1848	3300049571	Ga0501034_0420769	Ga0501034_0420769_333_1202	276
1849	3300049572	Ga0501036_0005617	Ga0501036_0005617_4640_5509	276
1850	3300049574	Ga0501038_0048801	Ga0501038_0048801_1992_2861	276
1851	3300049574	Ga0501038_0354121	Ga0501038_0354121_106_948	276
1852	3300049575	Ga0501039_0034656	Ga0501039_0034656_2149_3018	276
1853	3300049578	Ga0501042_0032718	Ga0501042_0032718_1808_2677	276
1854	3300049578	Ga0501042_0233827	Ga0501042_0233827_433_1263	276
1855	3300049580	Ga0501046_0016785	Ga0501046_0016785_1581_2450	276
1856	3300049580	Ga0501046_0372037	Ga0501046_0372037_94_924	276
1857	3300049581	Ga0501047_0315693	Ga0501047_0315693_298_1128	276
1858	3300049583	Ga0501067_0002905	Ga0501067_0002905_3317_4159	276
1859	3300049583	Ga0501067_0005959	Ga0501067_0005959_653_1483	276
1860	3300049583	Ga0501067_0010213	Ga0501067_0010213_1009_1839	276
1861	3300049583	Ga0501067_0158844	Ga0501067_0158844_382_1224	276
1862	3300049584	Ga0501068_0006190	Ga0501068_0006190_957_1787	276
1863	3300049584	Ga0501068_0023008	Ga0501068_0023008_1031_1861	276
1864	3300049585	Ga0501069_0103414	Ga0501069_0103414_592_1434	276
1865	3300049586	Ga0501070_0004150	Ga0501070_0004150_10208_11038	276
1866	3300049586	Ga0501070_0006073	Ga0501070_0006073_1977_2807	276
1867	3300049586	Ga0501070_0009717	Ga0501070_0009717_1022_1852	276
1868	3300049587	Ga0501071_0010299	Ga0501071_0010299_333_1202	276
1869	3300049587	Ga0501071_0031605	Ga0501071_0031605_1960_2790	276
1870	3300049587	Ga0501071_0130859	Ga0501071_0130859_111_941	276
1871	3300049588	Ga0501072_0033696	Ga0501072_0033696_2709_3539	276
1872	3300049589	Ga0501073_0015310	Ga0501073_0015310_2487_3317	276
1873	3300049589	Ga0501073_0056195	Ga0501073_0056195_1036_1866	276
1874	3300049590	Ga0501074_0001119	Ga0501074_0001119_15086_15916	276
1875	3300049590	Ga0501074_0014093	Ga0501074_0014093_3832_4662	276
1876	3300049590	Ga0501074_0029590	Ga0501074_0029590_1326_2195	276
1877	3300049590	Ga0501074_0207951	Ga0501074_0207951_405_1235	276
1878	3300049591	Ga0501075_0146973	Ga0501075_0146973_244_1113	276
1879	3300049592	Ga0501076_0003294	Ga0501076_0003294_2108_2977	276
1880	3300049593	Ga0501077_0030382	Ga0501077_0030382_957_1826	276
1881	3300049741	Ga0501079_0070902	Ga0501079_0070902_814_1644	276
1882	3300049741	Ga0501079_0174061	Ga0501079_0174061_195_1025	276
1883	3300049742	Ga0501080_0004103	Ga0501080_0004103_2456_3286	276
1884	3300049742	Ga0501080_0027086	Ga0501080_0027086_1132_1962	276
1885	3300049743	Ga0501081_0003904	Ga0501081_0003904_2400_3269	276
1886	3300049744	Ga0501083_0023050	Ga0501083_0023050_955_1785	276
1887	3300049744	Ga0501083_0178401	Ga0501083_0178401_57_887	276
1888	3300049822	Ga0501035_0033898	Ga0501035_0033898_654_1523	276
1889	3300049824	Ga0501045_0005932	Ga0501045_0005932_1143_2012	276
1890	3300049824	Ga0501045_0048612	Ga0501045_0048612_403_1245	276
1891	3300050492	nmdc:mga0yw44_121649_c1	nmdc:mga0yw44_121649_c1_654_1484	276
1892	3300050492	nmdc:mga0yw44_80861_c1	nmdc:mga0yw44_80861_c1_344_1186	276
1893	3300050507	nmdc:mga05p37_279632_c1	nmdc:mga05p37_279632_c1_706_1665	276
1894	3300050507	nmdc:mga05p37_381_c1	nmdc:mga05p37_381_c1_26649_27500	276
1895	3300050508	nmdc:mga09592_862_c1	nmdc:mga09592_862_c1_4376_5227	276
1896	3300050510	nmdc:mga06r32_129_c1	nmdc:mga06r32_129_c1_13601_14452	276
1897	3300053084	Ga0495595_0049816	Ga0495595_0049816_556_1386	276
1898	3300053085	Ga0495619_0266460	Ga0495619_0266460_281_1111	276
1899	3300054114	Ga0501084_0020544	Ga0501084_0020544_3250_4119	276
1900	3300054114	Ga0501084_0163470	Ga0501084_0163470_41_871	276
1901	3300054114	Ga0501084_0287517	Ga0501084_0287517_541_1371	276
1902	3300054114	Ga0501084_0381549	Ga0501084_0381549_34_876	276
1903	3300060353	Ga0501082_0033765	Ga0501082_0033765_220_1050	276
1904	3300060353	Ga0501082_0055844	Ga0501082_0055844_1220_2050	276
1905	3300061734	Ga0530510_0003106	Ga0530510_0003106_1878_2747	276
1906	3300061734	Ga0530510_0396600	Ga0530510_0396600_125_967	276
1907	iso_pu_bacteria	2811994874	2812332821	276
1908	3300001977	JGI24746J21847_1008500	JGI24746J21847_10085003	277
1909	3300001991	JGI24743J22301_10007050	JGI24743J22301_100070502	277
1910	3300005329	Ga0070683_100608806	Ga0070683_1006088061	277
1911	3300005337	Ga0070682_100239559	Ga0070682_1002395591	277
1912	3300005341	Ga0070691_10058637	Ga0070691_100586372	277
1913	3300005343	Ga0070687_100192220	Ga0070687_1001922201	277
1914	3300005345	Ga0070692_10001617	Ga0070692_100016174	277
1915	3300005366	Ga0070659_100166391	Ga0070659_1001663911	277
1916	3300005459	Ga0068867_100007096	Ga0068867_1000070965	277
1917	3300005471	Ga0070698_100015209	Ga0070698_1000152095	277
1918	3300005518	Ga0070699_100332033	Ga0070699_1003320333	277
1919	3300005543	Ga0070672_100040153	Ga0070672_1000401534	277
1920	3300005616	Ga0068852_100252324	Ga0068852_1002523243	277
1921	3300005718	Ga0068866_10029352	Ga0068866_100293522	277
1922	3300005719	Ga0068861_100208031	Ga0068861_1002080312	277
1923	3300005840	Ga0068870_10047274	Ga0068870_100472742	277
1924	3300005844	Ga0068862_100120004	Ga0068862_1001200042	277
1925	3300006880	Ga0075429_100352353	Ga0075429_1003523532	277
1926	3300009177	Ga0105248_10042139	Ga0105248_100421394	277
1927	3300009553	Ga0105249_10042483	Ga0105249_100424834	277
1928	3300010375	Ga0105239_10099924	Ga0105239_100999242	277
1929	3300010375	Ga0105239_10143184	Ga0105239_101431843	277
1930	3300013100	Ga0157373_10379516	Ga0157373_103795161	277
1931	3300013307	Ga0157372_10191644	Ga0157372_101916443	277
1932	3300014325	Ga0163163_10075978	Ga0163163_100759784	277
1933	3300025899	Ga0207642_10011825	Ga0207642_100118253	277
1934	3300025918	Ga0207662_10160958	Ga0207662_101609582	277
1935	3300025927	Ga0207687_10070144	Ga0207687_100701443	277
1936	3300025931	Ga0207644_10511065	Ga0207644_105110651	277
1937	3300025932	Ga0207690_10048998	Ga0207690_100489982	277
1938	3300025935	Ga0207709_10010199	Ga0207709_100101992	277
1939	3300025940	Ga0207691_10014193	Ga0207691_100141936	277
1940	3300025941	Ga0207711_10346196	Ga0207711_103461962	277
1941	3300025945	Ga0207679_10610576	Ga0207679_106105761	277
1942	3300025961	Ga0207712_10047412	Ga0207712_100474123	277
1943	3300025972	Ga0207668_10328299	Ga0207668_103282992	277
1944	3300026023	Ga0207677_10345156	Ga0207677_103451562	277
1945	3300026041	Ga0207639_10050540	Ga0207639_100505402	277
1946	3300026075	Ga0207708_10001305	Ga0207708_100013056	277
1947	3300026089	Ga0207648_10033415	Ga0207648_100334152	277
1948	3300026095	Ga0207676_10325163	Ga0207676_103251631	277
1949	3300026118	Ga0207675_100063254	Ga0207675_1000632542	277
1950	3300026142	Ga0207698_10094654	Ga0207698_100946542	277
1951	3300027907	Ga0207428_10055861	Ga0207428_100558612	277
1952	3300027907	Ga0207428_10187158	Ga0207428_101871582	277
1953	3300028380	Ga0268265_10102727	Ga0268265_101027273	277
1954	3300044693	Ga0466961_0009975	Ga0466961_0009975_1319_2194	277
1955	3300045836	Ga0466958_0052690	Ga0466958_0052690_719_1594	277
1956	3300045976	Ga0466967_0407084	Ga0466967_0407084_139_978	277
1957	3300048911	Ga0496108_0263339	Ga0496108_0263339_443_1291	277
1958	3300048912	Ga0496109_0437534	Ga0496109_0437534_93_941	277
1959	3300048913	Ga0496110_0205642	Ga0496110_0205642_435_1289	277
1960	3300049586	Ga0501070_0012225	Ga0501070_0012225_5727_6572	277
1961	3300050511	nmdc:mga08y16_198615_c1	nmdc:mga08y16_198615_c1_260_1114	277
1962	iso_pu_bacteria	2643221615	2644089117	277
1963	iso_pu_bacteria	2643221657	2644318962	277
1964	3300003320	rootH2_10067782	rootH2_100677821	278
1965	3300005327	Ga0070658_10000233	Ga0070658_1000023335	278
1966	3300005366	Ga0070659_100019900	Ga0070659_1000199004	278
1967	3300005436	Ga0070713_100008012	Ga0070713_1000080124	278
1968	3300005530	Ga0070679_100175553	Ga0070679_1001755532	278
1969	3300005563	Ga0068855_100483907	Ga0068855_1004839071	278
1970	3300005564	Ga0070664_100081088	Ga0070664_1000810882	278
1971	3300005616	Ga0068852_100350377	Ga0068852_1003503771	278
1972	3300006028	Ga0070717_10171449	Ga0070717_101714492	278
1973	3300006175	Ga0070712_100014957	Ga0070712_1000149574	278
1974	3300009093	Ga0105240_10319992	Ga0105240_103199922	278
1975	3300009551	Ga0105238_10412009	Ga0105238_104120092	278
1976	3300013105	Ga0157369_10002851	Ga0157369_100028516	278
1977	3300020075	Ga0206349_1928857	Ga0206349_19288573	278
1978	3300025904	Ga0207647_10066511	Ga0207647_100665113	278
1979	3300025909	Ga0207705_10000566	Ga0207705_1000056616	278
1980	3300025913	Ga0207695_10376307	Ga0207695_103763072	278
1981	3300025919	Ga0207657_10011227	Ga0207657_100112279	278
1982	3300025929	Ga0207664_10020080	Ga0207664_100200803	278
1983	3300025932	Ga0207690_10025349	Ga0207690_100253494	278
1984	3300025949	Ga0207667_10494725	Ga0207667_104947252	278
1985	3300044658	Ga0466972_0033382	Ga0466972_0033382_179_1036	278
1986	3300044683	Ga0466965_0008652	Ga0466965_0008652_2851_3708	278
1987	3300044693	Ga0466961_0032643	Ga0466961_0032643_1597_2454	278
1988	3300044694	Ga0466963_0083603	Ga0466963_0083603_913_1770	278
1989	3300044706	Ga0466964_0166104	Ga0466964_0166104_65_922	278
1990	3300044765	Ga0466970_0025489	Ga0466970_0025489_1573_2430	278
1991	3300044842	Ga0466957_0004053	Ga0466957_0004053_180_1037	278
1992	3300044901	Ga0466960_0096084	Ga0466960_0096084_490_1344	278
1993	3300045836	Ga0466958_0011511	Ga0466958_0011511_949_1806	278
1994	3300061719	Ga0466962_0014471	Ga0466962_0014471_1876_2733	278
1995	3300005329	Ga0070683_100059163	Ga0070683_1000591634	279
1996	3300005366	Ga0070659_100364992	Ga0070659_1003649922	279
1997	3300006042	Ga0075368_10000710	Ga0075368_1000071010	279
1998	3300006048	Ga0075363_100004282	Ga0075363_1000042823	279
1999	3300006178	Ga0075367_10016586	Ga0075367_100165866	279
2000	3300025919	Ga0207657_10128940	Ga0207657_101289402	279
2001	3300025944	Ga0207661_10287728	Ga0207661_102877282	279
2002	3300027866	Ga0209813_10007060	Ga0209813_100070601	279
2003	3300039450	Ga0436363_1120548	Ga0436363_1120548_70_954	279
2004	3300049572	Ga0501036_0285008	Ga0501036_0285008_192_1034	279
2005	3300049575	Ga0501039_0215384	Ga0501039_0215384_465_1307	279
2006	3300049578	Ga0501042_0209320	Ga0501042_0209320_465_1307	279
2007	3300049587	Ga0501071_0254626	Ga0501071_0254626_276_1118	279
2008	3300049591	Ga0501075_0029730	Ga0501075_0029730_2991_3833	279
2009	3300049592	Ga0501076_0228464	Ga0501076_0228464_583_1425	279
2010	3300049824	Ga0501045_0273482	Ga0501045_0273482_342_1184	279
2011	3300005985	Ga0081539_10026036	Ga0081539_100260365	280
2012	3300006038	Ga0075365_10105700	Ga0075365_101057002	280
2013	3300037418	Ga0395900_0016656	Ga0395900_0016656_3410_4264	280
2014	3300037471	Ga0395905_0305478	Ga0395905_0305478_85_939	280
2015	3300044683	Ga0466965_0018739	Ga0466965_0018739_1643_2506	280
2016	3300044719	Ga0466971_0006292	Ga0466971_0006292_2401_3279	280
2017	3300044901	Ga0466960_0167736	Ga0466960_0167736_27_878	280
2018	3300044901	Ga0466960_0201973	Ga0466960_0201973_144_1022	280
2019	3300049583	Ga0501067_0151252	Ga0501067_0151252_11_853	280
2020	3300050492	nmdc:mga0yw44_4161_c1	nmdc:mga0yw44_4161_c1_3779_4636	280
2021	3300053140	Ga0500573_0036971	Ga0500573_0036971_788_1639	280
2022	iso_pu_bacteria	2990256926	2990258958	280
2023	3300006038	Ga0075365_10074979	Ga0075365_100749793	281
2024	3300044658	Ga0466972_0120854	Ga0466972_0120854_241_1089	281
2025	3300044683	Ga0466965_0223458	Ga0466965_0223458_80_928	281
2026	3300044684	Ga0466966_0072428	Ga0466966_0072428_540_1388	281
2027	3300044684	Ga0466966_0241548	Ga0466966_0241548_151_999	281
2028	3300044694	Ga0466963_0028001	Ga0466963_0028001_84_932	281
2029	3300044706	Ga0466964_0031907	Ga0466964_0031907_370_1218	281
2030	3300044765	Ga0466970_0077497	Ga0466970_0077497_240_1088	281
2031	3300044842	Ga0466957_0020957	Ga0466957_0020957_2943_3791	281
2032	3300044901	Ga0466960_0011192	Ga0466960_0011192_836_1693	281
2033	3300045976	Ga0466967_0098772	Ga0466967_0098772_468_1316	281
2034	3300048903	Ga0496100_0087950	Ga0496100_0087950_402_1247	281
2035	3300048905	Ga0496102_0226432	Ga0496102_0226432_648_1493	281
2036	3300048927	Ga0496124_0051714	Ga0496124_0051714_1532_2395	281
2037	3300049586	Ga0501070_0290148	Ga0501070_0290148_194_1054	281
2038	3300049741	Ga0501079_0442136	Ga0501079_0442136_83_934	281
2039	3300050496	nmdc:mga07m45_155084_c1	nmdc:mga07m45_155084_c1_256_1116	281
2040	3300053104	Ga0500556_0001187	Ga0500556_0001187_4738_5607	281
2041	3300053117	Ga0500593_000401	Ga0500593_000401_8173_9018	281
2042	3300006038	Ga0075365_10026381	Ga0075365_100263813	282
2043	3300006048	Ga0075363_100003958	Ga0075363_1000039584	282
2044	3300006051	Ga0075364_10026128	Ga0075364_100261284	282
2045	3300006178	Ga0075367_10026488	Ga0075367_100264884	282
2046	3300006353	Ga0075370_10013081	Ga0075370_100130814	282
2047	3300027866	Ga0209813_10001624	Ga0209813_100016243	282
2048	3300042146	Ga0450907_007309	Ga0450907_007309_289_1152	282
2049	3300050490	nmdc:mga03n38_55356_c1	nmdc:mga03n38_55356_c1_277_1143	282
2050	3300050491	nmdc:mga00v17_37231_c1	nmdc:mga00v17_37231_c1_1836_2702	282
2051	3300050491	nmdc:mga00v17_42883_c1	nmdc:mga00v17_42883_c1_681_1550	282
2052	3300050492	nmdc:mga0yw44_40880_c1	nmdc:mga0yw44_40880_c1_1595_2467	282
2053	3300050496	nmdc:mga07m45_1420_c1	nmdc:mga07m45_1420_c1_5171_6037	282
2054	3300053088	Ga0500644_0000389	Ga0500644_0000389_9563_10426	282
2055	3300053151	Ga0500604_0048022	Ga0500604_0048022_333_1199	282
2056	3300000549	LJQas_1001039	LJQas_10010392	283
2057	3300006051	Ga0075364_10079323	Ga0075364_100793233	283
2058	3300006178	Ga0075367_10066850	Ga0075367_100668503	283
2059	3300006353	Ga0075370_10036163	Ga0075370_100361632	283
2060	3300028381	Ga0268264_10000320	Ga0268264_1000032017	283
2061	3300031731	Ga0307405_10213212	Ga0307405_102132122	283
2062	3300031911	Ga0307412_10056301	Ga0307412_100563012	283
2063	3300031911	Ga0307412_10171441	Ga0307412_101714413	283
2064	3300031995	Ga0307409_100003253	Ga0307409_1000032538	283
2065	3300032002	Ga0307416_100013856	Ga0307416_1000138565	283
2066	3300032002	Ga0307416_100280323	Ga0307416_1002803232	283
2067	3300032005	Ga0307411_10264974	Ga0307411_102649742	283
2068	3300032126	Ga0307415_100002687	Ga0307415_1000026878	283
2069	3300048917	Ga0496114_0214131	Ga0496114_0214131_555_1427	283
2070	3300049585	Ga0501069_0163465	Ga0501069_0163465_16_894	283
2071	3300049588	Ga0501072_0388438	Ga0501072_0388438_154_1026	283
2072	3300049592	Ga0501076_0458871	Ga0501076_0458871_63_935	283
2073	3300050490	nmdc:mga03n38_81812_c1	nmdc:mga03n38_81812_c1_395_1270	283
2074	3300050491	nmdc:mga00v17_114072_c1	nmdc:mga00v17_114072_c1_753_1628	283
2075	3300050491	nmdc:mga00v17_247399_c1	nmdc:mga00v17_247399_c1_153_1025	283
2076	3300050491	nmdc:mga00v17_6924_c1	nmdc:mga00v17_6924_c1_4182_5054	283
2077	3300050494	nmdc:mga06z11_14464_c1	nmdc:mga06z11_14464_c1_1898_2785	283
2078	3300050496	nmdc:mga07m45_9228_c1	nmdc:mga07m45_9228_c1_2641_3516	283

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00227

Proteasome

Proteasome subunit

88

271

0.97 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
5lzp-assembly1.cif.gz_G	binding of the c-terminal gqyl motif of the bacterial proteasome activator bpa to the 20s proteasome	0.9813	52	266
1q5q-assembly1.cif.gz_H	the rhodococcus 20s proteasome	0.9812	51	269
7pxd-assembly1.cif.gz_Y	substrate-engaged mycobacterial proteasome-associated atpase in complex with open-gate 20s cp - composite map (state b)	0.9787	51	267
2h6j-assembly1.cif.gz_H	crystal structure of the beta f145a rhodococcus proteasome	0.9637	18	261
3mka-assembly1.cif.gz_V	crystal structure of mycobacterium tuberculosis proteasome with propetide and an t1a mutation at beta-subunit	0.958	16	267

ID	Description	Score	Start	End	Superfamily
3h6fR00	Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain	0.9433	53	268	3.60.20.10
1pma100	Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain	0.9396	51	261	3.60.20.10
5fmgW00	Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain	0.9394	51	250	3.60.20.10
5fmgZ00	Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain	0.9354	51	250	3.60.20.10
af_Q8T915_50_270_3.60.20.10	Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain	0.9219	51	250	3.60.20.10

ID	Description	Score	Start	End	GO Terms
AF-A0A6I5G346-F1-model_v4	deleted	0.9947	86	277
AF-A0A2W4MM98-F1-model_v4	Proteasome subunit beta (EC 3.4.25.1)	0.9884	47	264	GO:0004298 GO:0005737 GO:0005839 GO:0010498
AF-A0A7V8W5K8-F1-model_v4	Proteasome subunit beta (EC 3.4.25.1)	0.9878	102	268	GO:0004298 GO:0005839 GO:0010498
AF-A0A839G5K7-F1-model_v4	deleted	0.9861	44	270
AF-A0A5D0UFY8-F1-model_v4	Proteasome subunit beta (EC 3.4.25.1) (20S proteasome beta subunit) (Proteasome core protein PrcB)	0.9847	8	277	GO:0004298 GO:0005737 GO:0010498 GO:0019774 GO:0019941

Feature Viewer

pLDDT	pTM	Quality
90.92	0.88	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F496363

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00227

Proteasome

Proteasome subunit

88

271

0.97

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map