F496348

General Info

Members Datasets Scaffolds Average Seq Length
2071 823 1778 372

Family's Representative Sequence

Representative Sequence 3300009036|Ga0105244_10000735|Ga0105244_1000073514
Length 421
Sequence MGTSAHVETARRARQVASAPGTGRAFNVFLAHCEVPTPFAESGFGKGSSKVRAVTYEIEIGRGKRGRRAYSLDDIAIVPNRRTRDPKDVSVSWQIDAYKFDIPVIAAPMDSAMSPETAIALGRLGGLGVLDLEGLWTRYEDPQSVLDEISALAGETASPAVTRRMQDLYKAPIQPELITSRLAEIRASGVTVAGSLTPQRTQEHYKTVLAAGVDIFVIRGTTVSAEHVSKNHEPLNLKQFIYELDVPVIVGGAAGYTPALHLMRTGAAGVLVGFGALGIHSPMASAISDVAAARRDYLDESGGRYVHVIADGGMGASGDIVKAVAMGADAVMLGSALARAEEAPGKGWHWGQEAHHLELPRGDRVNVGTVGPLEEVLFGPGHHTNGTSNLIGALRRSMATTGYSDLKEFQRVDVVVSPYLG

Samples

Sample ID Description Type Environment
1 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
2 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
3 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
4 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
5 2554235227 Arthrobacter sp. PAO19 Isolate Rhizosphere
6 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
7 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
8 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
9 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
10 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
11 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
12 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
13 2643221546 Microbacterium sp. Root53 Isolate Unclassified
14 2643221548 Streptomyces sp. Root55 Isolate Unclassified
15 2643221549 Agromyces sp. Root1464 Isolate Unclassified
16 2643221553 Microbacterium sp. Root553 Isolate Unclassified
17 2643221566 Microbacterium sp. Root166 Isolate Unclassified
18 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
19 2643221575 Microbacterium sp. Root61 Isolate Unclassified
20 2643221578 Streptomyces sp. Root63 Isolate Unclassified
21 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
22 2643221597 Microbacterium sp. Root180 Isolate Unclassified
23 2643221613 Oerskovia sp. Root22 Isolate Unclassified
24 2643221619 Agromyces sp. Root81 Isolate Unclassified
25 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
26 2643221630 Microbacterium sp. Root322 Isolate Unclassified
27 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
28 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
29 2643221635 Yonghaparkia sp. Root332 Isolate Unclassified
30 2643221647 Streptomyces sp. Root369 Isolate Unclassified
31 2643221649 Leifsonia sp. Root4 Isolate Unclassified
32 2643221670 Streptomyces sp. Root431 Isolate Unclassified
33 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
34 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
35 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
36 2643221679 Angustibacter sp. Root456 Isolate Unclassified
37 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
38 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
39 2643221692 Nocardia sp. Root136 Isolate Unclassified
40 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
41 2643221711 Terrabacter sp. Root85 Isolate Unclassified
42 2643221721 Oerskovia sp. Root918 Isolate Unclassified
43 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
44 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
45 2654587600 Glutamicibacter halophytocola KLBMP5180 Isolate Unclassified
46 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
47 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
48 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
49 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
50 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
51 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
52 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
53 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
54 2739367653 Kocuria sp. OV113 Isolate Unclassified
55 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
56 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
57 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
58 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
59 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
60 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
61 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
62 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
63 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
64 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
65 2773857759 Microbacterium sp. 1294 Isolate Unclassified
66 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
67 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
68 2784132109 Dermacoccus sp. DS28 SAI-028 Isolate Unclassified
69 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
70 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
71 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
72 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
73 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
74 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
75 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
76 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
77 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
78 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
79 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
80 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
81 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
82 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
83 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
84 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
85 2808606394 Promicromonospora sp. C35 Isolate Unclassified
86 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
87 2808606448 Streptomyces sp. 193411 Isolate Unclassified
88 2808606700 Arthrobacter agilis UMCV2 Isolate Rhizosphere
89 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
90 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
91 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
92 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
93 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
94 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
95 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
96 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
97 2816332305 Kocuria rhizophila FDAARGOS_302 Isolate Rhizosphere
98 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
99 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
100 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
101 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
102 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
103 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
104 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
105 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
106 2835188231 Isoptericola variabilis JZ7 Isolate Unclassified
107 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
108 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
109 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
110 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
111 2848551377 Brachybacterium saurashtrense DSM 23186 Isolate Unclassified
112 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
113 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
114 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
115 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
116 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
117 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
118 2857479173 Micrococcus sp. R-74225 Isolate Unclassified
119 2857632687 Micrococcus sp. R-73081 Isolate Unclassified
120 2857710386 Brevibacterium sp. R-73093 Isolate Unclassified
121 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
122 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
123 2857727296 Kocuria sp. R-72562 Isolate Unclassified
124 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
125 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
126 2857737099 Lysinimonas sp. R-73066 Isolate Unclassified
127 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
128 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
129 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
130 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
131 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
132 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
133 2862574272 Streptomyces sp. AcE210 Isolate Nodule
134 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
135 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
136 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
137 2867369537 Streptomyces sp. Z26 Isolate Unclassified
138 2867428634 Streptomyces sp. RP5T Isolate Unclassified
139 2867475112 Streptomyces sp. TM32 Isolate Unclassified
140 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
141 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
142 2870801768 Micrococcus endophyticus DSM 17945 Isolate Unclassified
143 2870804320 Micrococcus yunnanensis DSM 21948 Isolate Unclassified
144 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
145 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
146 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
147 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
148 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
149 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
150 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
151 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
152 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
153 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
154 2891562705 Microbispora tritici MT50 Isolate Unclassified
155 2893684298 Kocuria palustris DSM 11925 Isolate Rhizosphere
156 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
157 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
158 2904430863 Curtobacterium oceanosedimentum 1519 Isolate Rhizosphere
159 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
160 2904501621 Curtobacterium sp. 1909 Isolate Unclassified
161 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
162 2904776348 Paenarthrobacter sp. 1092 Isolate Rhizosphere
163 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
164 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
165 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
166 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
167 2909074476 Curtobacterium sp. 1310 Isolate Rhizosphere
168 2910809715 Paenarthrobacter sp. CM16 Isolate Unclassified
169 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
170 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
171 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
172 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
173 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
174 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
175 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
176 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
177 2919051321 Sinomonas atrocyanea 1003 Isolate Rhizosphere
178 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
179 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
180 2919069694 Microbacterium sp. 1154 Isolate Unclassified
181 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
182 2919395869 Microbacterium resistens 2980 Isolate Unclassified
183 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
184 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
185 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
186 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
187 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
188 2920879853 Kocuria salina CV6 Isolate Unclassified
189 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
190 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
191 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
192 2928153084 Leifsonia sp. 563 Isolate Unclassified
193 2928500415 Curtobacterium oceanosedimentum 1257 Isolate Rhizosphere
194 2932426870 Paenarthrobacter sp. 4246 Isolate Rhizosphere
195 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
196 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
197 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
198 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
199 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
200 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
201 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
202 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
203 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
204 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
205 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
206 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
207 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
208 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
209 2946024296 Arthrobacter woluwensis W4I2 Isolate Rhizosphere
210 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
211 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
212 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
213 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
214 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
215 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
216 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
217 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
218 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
219 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
220 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
221 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
222 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
223 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
224 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
225 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
226 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
227 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
228 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
229 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
230 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
231 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
232 2956939328 Lolliginicoccus suaedae LNNU 331112 Isolate Rhizosphere
233 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
234 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
235 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere
236 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
237 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
238 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
239 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
240 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
241 2977251589 Microbacterium sp. SORGH_AS 505 Isolate Unclassified
242 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
243 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
244 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
245 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
246 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
247 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
248 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
249 2995726249 Leucobacter zeae CC-MF41 Isolate Rhizosphere
250 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
251 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
252 3001119090 Lolliginicoccus lacisalsi G463 Isolate Rhizosphere
253 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified
254 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
255 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
256 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
257 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
258 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
259 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
260 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
261 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
262 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
263 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
264 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
265 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
266 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
267 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
268 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
269 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
270 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
271 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
272 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
273 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
274 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
275 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
276 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
277 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
278 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
279 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
280 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
281 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
282 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
283 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
284 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
285 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
286 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
287 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
288 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
289 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
290 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
291 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
292 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
293 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
294 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
295 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
296 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
297 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
298 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
299 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
300 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
301 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
302 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
303 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
304 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
305 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
306 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
307 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
308 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
309 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
310 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
311 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
312 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
313 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
314 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
315 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
316 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
317 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
318 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
319 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
320 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
321 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
322 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
323 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
324 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
325 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
326 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
327 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
328 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
329 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
330 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
331 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
332 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
333 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
334 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
335 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
336 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
337 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
338 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
339 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
340 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
341 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
342 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
343 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
344 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
345 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
346 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
347 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
348 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
349 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
350 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
351 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
352 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
353 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
354 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
355 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
356 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
357 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
358 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
359 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
360 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
361 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
362 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
363 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
364 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
365 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
366 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
367 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
368 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
369 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
370 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
371 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
372 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
373 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
374 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
375 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
376 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
377 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
378 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
379 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
380 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
381 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
382 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
383 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
384 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
385 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
386 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
387 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
388 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
389 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
390 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
391 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
392 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
393 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
394 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
395 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
396 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
397 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
398 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
399 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
400 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
401 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
402 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
403 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
404 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
405 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
406 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
407 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
408 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
409 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
410 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
411 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
412 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
413 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
414 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
415 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
416 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
417 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
418 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
419 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
420 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
421 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
422 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
423 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
424 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
425 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
426 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
427 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
428 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
429 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
430 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
431 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
432 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
433 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
434 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
435 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
436 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
437 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
438 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
439 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
440 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
441 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
442 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
443 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
444 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
445 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
446 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
447 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
448 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
449 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
450 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
451 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
452 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
453 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
454 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
455 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
456 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
457 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
458 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
459 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
460 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
461 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
462 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
463 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
464 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
465 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
466 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
467 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
468 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
469 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
470 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
471 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
472 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
473 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
474 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
475 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
476 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
477 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
478 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
479 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
480 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
481 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
482 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
483 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
484 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
485 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
486 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
487 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
488 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
489 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
490 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
491 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
492 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
493 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
494 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
495 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
496 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
497 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
498 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
499 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
500 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
501 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
502 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
503 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
504 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
505 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
506 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
507 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
508 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
509 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
510 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
511 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
512 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
513 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
514 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
515 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
516 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
517 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
518 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
519 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
520 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
521 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
522 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
523 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
524 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
525 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
526 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
527 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
528 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
529 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
530 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
531 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
532 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
533 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
534 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
535 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
536 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
537 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
538 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
539 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
540 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
541 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
542 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
543 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
544 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
545 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
546 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
547 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
548 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
549 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
550 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
551 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
552 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
553 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
554 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
555 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
556 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
557 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
558 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
559 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
560 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
561 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
562 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
563 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
564 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
565 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
566 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
567 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
568 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
569 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
570 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
571 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
572 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
573 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
574 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
575 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
576 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
577 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
578 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
579 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
580 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
581 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
582 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
583 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
584 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
585 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
586 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
587 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
588 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
589 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
590 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
591 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
592 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
593 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
594 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
595 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
596 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
597 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
598 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
599 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
600 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
601 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
602 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
603 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
604 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
605 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
606 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
607 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
608 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
609 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
610 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
611 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
612 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
613 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
614 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
615 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
616 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
617 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
618 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
619 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
620 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
621 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
622 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
623 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
624 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
625 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
626 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
627 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
628 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
629 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
630 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
631 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
632 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
633 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
634 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
635 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
636 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
637 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
638 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
639 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
640 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
641 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
642 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
643 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
644 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
645 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
646 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
647 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
648 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
649 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
650 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
651 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
652 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
653 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
654 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
655 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
656 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
657 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
658 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
659 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
660 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
661 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
662 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
663 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
664 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
665 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
666 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
667 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
668 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
669 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
670 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
671 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
672 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
673 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
674 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
675 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
676 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
677 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
678 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
679 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
680 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
681 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
682 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
683 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
684 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
685 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
686 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
687 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
688 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
689 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
690 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
691 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
692 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
693 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
694 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
695 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
696 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
697 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
698 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
699 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
700 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
701 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
702 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
703 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
704 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
705 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
706 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
707 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
708 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
709 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
710 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
711 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
712 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
713 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
714 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
715 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
716 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
717 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
718 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
719 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
720 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
721 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
722 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
723 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
724 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
725 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
726 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
727 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
728 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
729 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
730 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
731 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
732 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
733 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
734 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
735 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
736 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
737 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
738 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
739 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
740 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
741 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
742 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
743 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
744 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
745 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
746 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
747 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
748 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
749 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
750 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
751 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
752 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
753 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
754 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
755 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
756 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
757 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
758 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
759 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
760 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
761 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
762 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
763 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
764 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
765 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
766 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
767 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
768 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
769 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
770 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
771 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
772 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
773 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
774 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
775 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
776 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
777 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
778 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
779 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
780 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
781 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
782 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
783 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
784 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
785 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
786 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
787 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
788 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
789 8002811521 Leucobacter chinensis NC76-1 Isolate Rhizosphere
790 8004021418 Arthrobacter sp. SDTb3-6 Isolate Rhizosphere
791 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
792 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
793 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
794 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
795 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
796 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
797 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
798 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
799 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
800 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
801 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
802 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
803 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
804 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified
805 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
806 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
807 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
808 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
809 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
810 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere
811 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
812 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
813 8055034563 Leucobacter allii H21R-40 Isolate Rhizosphere
814 8055037949 Leucobacter rhizosphaerae H25R-14 Isolate Rhizosphere
815 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
816 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
817 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere
818 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified
819 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
820 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere
821 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
822 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere
823 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.36
Metatranscriptomes 1.5
Isolates 14.15

Biome Distribution

Category Percentage (%)
Aerial Root 0.14
Bulb 0
Endosphere 3.62
Nodule 0.14
Rhizoplane 6.08
Rhizosphere 75.76
Stem 0
Stem Tuber 0
Unclassified 14.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1000257 3300000549 Bacteria 9695
2 LJQas_1000741 3300000549 Bacteria 5168
3 JGI25154J39366_1003355 3300002738 Bacteria 3417
4 JGI25152J39213_1000399 3300002773 Bacteria 26470
5 JGI25406J46586_10001751 3300003203 Bacteria 10207
6 JGI25160J50197_1014988 3300003354 Bacteria 2564
7 Ga0006562J51391_1013439 3300003578 Bacteria 7730
8 Ga0006562J51391_1013440 3300003578 Bacteria 4940
9 Ga0006562J51391_1025688 3300003578 Bacteria 6307
10 Ga0006562J51391_1025689 3300003578 Bacteria 4797
11 Ga0006562J51391_1098594 3300003578 Bacteria 5598
12 Ga0006562J51391_1098595 3300003578 Bacteria 5160
13 Ga0055539_1000005 3300003752 Bacteria 609598
14 Ga0055533_1000001 3300003756 Bacteria 1863437
15 Ga0055527_1000017 3300003760 Bacteria 242362
16 Ga0055542_1000044 3300003762 Bacteria 206982
17 Ga0055529_1000279 3300003763 Bacteria 60946
18 Ga0055541_1008325 3300003841 Bacteria 1656
19 Ga0065714_10104412 3300005288 Bacteria 1585
20 Ga0070658_10000266 3300005327 Bacteria 46035
21 Ga0070658_10013342 3300005327 Bacteria 6594
22 Ga0070658_10031946 3300005327 Bacteria 4231
23 Ga0070658_10035794 3300005327 Bacteria 3999
24 Ga0070658_10043257 3300005327 Bacteria 3639
25 Ga0070658_10219665 3300005327 Bacteria 1607
26 Ga0070676_10045831 3300005328 Bacteria 2547
27 Ga0070683_100019688 3300005329 Bacteria 5997
28 Ga0070683_100048077 3300005329 Bacteria 3944
29 Ga0070683_100058043 3300005329 Bacteria 3596
30 Ga0070683_100225127 3300005329 Bacteria 1782
31 Ga0070683_100257981 3300005329 Bacteria 1658
32 Ga0070683_100323958 3300005329 Bacteria 1467
33 Ga0070690_100059023 3300005330 Bacteria 2465
34 Ga0068869_100099715 3300005334 Bacteria 2195
35 Ga0070680_100000604 3300005336 Bacteria 24854
36 Ga0070680_100040663 3300005336 Bacteria 3766
37 Ga0070682_100100331 3300005337 Bacteria 1910
38 Ga0070682_100142635 3300005337 Bacteria 1635
39 Ga0070682_100195328 3300005337 Bacteria 1424
40 Ga0068868_100022267 3300005338 Bacteria 4780
41 Ga0070660_100081123 3300005339 Bacteria 2546
42 Ga0070689_100095806 3300005340 Bacteria 2344
43 Ga0070691_10120944 3300005341 Bacteria 1318
44 Ga0070687_100056394 3300005343 Bacteria 2055
45 Ga0070692_10019702 3300005345 Bacteria 3260
46 Ga0070692_10052038 3300005345 Bacteria 2132
47 Ga0070692_10076527 3300005345 Bacteria 1794
48 Ga0070668_100088728 3300005347 Bacteria 2435
49 Ga0070668_100215082 3300005347 Bacteria 1583
50 Ga0070669_100022755 3300005353 Bacteria 4482
51 Ga0070675_100005971 3300005354 Bacteria 9330
52 Ga0070675_100032384 3300005354 Bacteria 4231
53 Ga0070674_100019987 3300005356 Bacteria 4267
54 Ga0070674_100078162 3300005356 Bacteria 2357
55 Ga0070673_100038887 3300005364 Bacteria 3637
56 Ga0070673_100058206 3300005364 Bacteria 3054
57 Ga0070673_100171762 3300005364 Bacteria 1851
58 Ga0070659_100053135 3300005366 Bacteria 3188
59 Ga0070667_100021591 3300005367 Bacteria 5344
60 Ga0070709_10000118 3300005434 Bacteria 53312
61 Ga0070709_10003048 3300005434 Bacteria 8990
62 Ga0070709_10004402 3300005434 Bacteria 7595
63 Ga0070709_10036494 3300005434 Bacteria 2995
64 Ga0070714_100001466 3300005435 Bacteria 17185
65 Ga0070714_100005802 3300005435 Bacteria 9468
66 Ga0070714_100030612 3300005435 Bacteria 4482
67 Ga0070714_100066156 3300005435 Bacteria 3115
68 Ga0070714_100073929 3300005435 Bacteria 2954
69 Ga0070714_100085074 3300005435 Bacteria 2761
70 Ga0070713_100001299 3300005436 Bacteria 15987
71 Ga0070713_100015416 3300005436 Bacteria 5713
72 Ga0070713_100018101 3300005436 Bacteria 5351
73 Ga0070713_100026407 3300005436 Bacteria 4558
74 Ga0070710_10000216 3300005437 Bacteria 26980
75 Ga0070710_10000381 3300005437 Bacteria 20743
76 Ga0070710_10001064 3300005437 Bacteria 13005
77 Ga0070710_10024900 3300005437 Bacteria 3162
78 Ga0070710_10054249 3300005437 Bacteria 2261
79 Ga0070710_10075637 3300005437 Bacteria 1952
80 Ga0070710_10113558 3300005437 Bacteria 1630
81 Ga0070711_100000774 3300005439 Bacteria 16660
82 Ga0070711_100001507 3300005439 Bacteria 12813
83 Ga0070711_100011359 3300005439 Bacteria 5527
84 Ga0070711_100052982 3300005439 Bacteria 2794
85 Ga0070705_100027550 3300005440 Bacteria 3104
86 Ga0070705_100143311 3300005440 Bacteria 1575
87 Ga0070700_100018526 3300005441 Bacteria 4003
88 Ga0070708_100042482 3300005445 Bacteria 3991
89 Ga0070708_100114211 3300005445 Bacteria 2484
90 Ga0070708_100282487 3300005445 Bacteria 1562
91 Ga0070663_100165035 3300005455 Bacteria 1708
92 Ga0070678_100059360 3300005456 Bacteria 2811
93 Ga0070678_100082055 3300005456 Bacteria 2446
94 Ga0070678_100216134 3300005456 Bacteria 1591
95 Ga0070681_10037371 3300005458 Bacteria 4873
96 Ga0070681_10076072 3300005458 Bacteria 3316
97 Ga0070681_10113295 3300005458 Bacteria 2651
98 Ga0070681_10314051 3300005458 Bacteria 1476
99 Ga0068867_100277951 3300005459 Bacteria 1372
100 Ga0070685_10017980 3300005466 Bacteria 3795
101 Ga0070706_100002453 3300005467 Bacteria 18702
102 Ga0070706_100007246 3300005467 Bacteria 10420
103 Ga0070706_100013652 3300005467 Bacteria 7510
104 Ga0070706_100019132 3300005467 Bacteria 6318
105 Ga0070706_100029833 3300005467 Bacteria 5024
106 Ga0070706_100030981 3300005467 Bacteria 4932
107 Ga0070706_100048810 3300005467 Bacteria 3906
108 Ga0070706_100238770 3300005467 Bacteria 1697
109 Ga0070707_100000878 3300005468 Bacteria 29814
110 Ga0070707_100016295 3300005468 Bacteria 6976
111 Ga0070707_100017111 3300005468 Bacteria 6809
112 Ga0070707_100027135 3300005468 Bacteria 5445
113 Ga0070707_100043198 3300005468 Bacteria 4315
114 Ga0070707_100063769 3300005468 Bacteria 3537
115 Ga0070707_100120942 3300005468 Bacteria 2542
116 Ga0070698_100000621 3300005471 Bacteria 38176
117 Ga0070698_100001092 3300005471 Bacteria 29843
118 Ga0070698_100017339 3300005471 Bacteria 7587
119 Ga0070698_100017533 3300005471 Bacteria 7546
120 Ga0070698_100018948 3300005471 Bacteria 7239
121 Ga0070698_100029366 3300005471 Bacteria 5708
122 Ga0070698_100035507 3300005471 Bacteria 5155
123 Ga0070698_100132843 3300005471 Bacteria 2444
124 Ga0070699_100298178 3300005518 Bacteria 1446
125 Ga0070679_100054351 3300005530 Bacteria 3986
126 Ga0070679_100105416 3300005530 Bacteria 2805
127 Ga0070679_100127582 3300005530 Bacteria 2525
128 Ga0070679_100140904 3300005530 Bacteria 2391
129 Ga0070679_100184734 3300005530 Bacteria 2056
130 Ga0070684_100029632 3300005535 Bacteria 4641
131 Ga0070684_100122242 3300005535 Bacteria 2342
132 Ga0070684_100274891 3300005535 Bacteria 1543
133 Ga0070697_100025290 3300005536 Bacteria 4736
134 Ga0070697_100045569 3300005536 Bacteria 3554
135 Ga0068853_100074526 3300005539 Bacteria 2961
136 Ga0068853_100185674 3300005539 Bacteria 1887
137 Ga0068853_100258327 3300005539 Bacteria 1601
138 Ga0070672_100013432 3300005543 Bacteria 5785
139 Ga0070672_100015790 3300005543 Bacteria 5391
140 Ga0070672_100021208 3300005543 Bacteria 4750
141 Ga0070686_100164925 3300005544 Bacteria 1563
142 Ga0070695_100058153 3300005545 Bacteria 2499
143 Ga0070696_100048404 3300005546 Bacteria 2951
144 Ga0070693_100032957 3300005547 Bacteria 2855
145 Ga0070665_100006265 3300005548 Bacteria 12163
146 Ga0070665_100178198 3300005548 Bacteria 2126
147 Ga0070665_100215114 3300005548 Bacteria 1923
148 Ga0070704_100145513 3300005549 Bacteria 1856
149 Ga0068855_100022690 3300005563 Bacteria 7520
150 Ga0068855_100043681 3300005563 Bacteria 5307
151 Ga0068855_100119766 3300005563 Bacteria 3013
152 Ga0068855_100177890 3300005563 Bacteria 2406
153 Ga0070664_100076214 3300005564 Bacteria 2881
154 Ga0068857_100050157 3300005577 Bacteria 3703
155 Ga0068857_100204484 3300005577 Bacteria 1801
156 Ga0068854_100051107 3300005578 Bacteria 2960
157 Ga0068856_100091894 3300005614 Bacteria 3019
158 Ga0068856_100103109 3300005614 Bacteria 2847
159 Ga0068856_100115037 3300005614 Bacteria 2689
160 Ga0068856_100288139 3300005614 Bacteria 1659
161 Ga0068856_100329509 3300005614 Bacteria 1544
162 Ga0068856_100368358 3300005614 Bacteria 1455
163 Ga0070702_100000716 3300005615 Bacteria 12568
164 Ga0070702_100046300 3300005615 Bacteria 2465
165 Ga0070702_100077702 3300005615 Bacteria 1979
166 Ga0068852_100012452 3300005616 Bacteria 6461
167 Ga0068852_100063039 3300005616 Bacteria 3226
168 Ga0068852_100188837 3300005616 Bacteria 1943
169 Ga0068852_100201339 3300005616 Bacteria 1884
170 Ga0068859_100078111 3300005617 Bacteria 3350
171 Ga0068859_100106112 3300005617 Bacteria 2868
172 Ga0068864_100037398 3300005618 Bacteria 4142
173 Ga0068866_10129595 3300005718 Bacteria 1433
174 Ga0068861_100025788 3300005719 Bacteria 4267
175 Ga0068861_100173790 3300005719 Bacteria 1787
176 Ga0068851_10000022 3300005834 Bacteria 129607
177 Ga0068870_10043557 3300005840 Bacteria 2341
178 Ga0068870_10092007 3300005840 Bacteria 1698
179 Ga0068863_100000912 3300005841 Bacteria 29665
180 Ga0068863_100027376 3300005841 Bacteria 5437
181 Ga0068863_100121426 3300005841 Bacteria 2492
182 Ga0068863_100188176 3300005841 Bacteria 1983
183 Ga0068863_100413521 3300005841 Bacteria 1320
184 Ga0068858_100000016 3300005842 Bacteria 193130
185 Ga0068858_100090777 3300005842 Bacteria 2843
186 Ga0068858_100183277 3300005842 Bacteria 1977
187 Ga0068860_100022448 3300005843 Bacteria 6104
188 Ga0068860_100240062 3300005843 Bacteria 1762
189 Ga0081540_1001352 3300005983 Bacteria 21314
190 Ga0081540_1002515 3300005983 Bacteria 14885
191 Ga0081540_1002903 3300005983 Bacteria 13813
192 Ga0081539_10001393 3300005985 Bacteria 41656
193 Ga0081539_10019489 3300005985 Bacteria 4639
194 Ga0070717_10000504 3300006028 Bacteria 24742
195 Ga0070717_10055270 3300006028 Bacteria 3275
196 Ga0070717_10058992 3300006028 Bacteria 3174
197 Ga0070717_10112192 3300006028 Bacteria 2327
198 Ga0070717_10120794 3300006028 Bacteria 2244
199 Ga0070717_10140625 3300006028 Bacteria 2082
200 Ga0070717_10191812 3300006028 Bacteria 1786
201 Ga0070717_10210671 3300006028 Bacteria 1705
202 Ga0075365_10017542 3300006038 Bacteria 4381
203 Ga0075365_10022365 3300006038 Bacteria 3961
204 Ga0075365_10046434 3300006038 Bacteria 2852
205 Ga0075432_10000249 3300006058 Bacteria 14621
206 Ga0075432_10001177 3300006058 Bacteria 8378
207 Ga0075432_10023188 3300006058 Bacteria 2125
208 Ga0075432_10039010 3300006058 Bacteria 1655
209 Ga0070715_10003999 3300006163 Bacteria 4778
210 Ga0070715_10008469 3300006163 Bacteria 3586
211 Ga0070715_10086227 3300006163 Bacteria 1435
212 Ga0070716_100039444 3300006173 Bacteria 2621
213 Ga0070716_100068368 3300006173 Bacteria 2078
214 Ga0070712_100006228 3300006175 Bacteria 7386
215 Ga0070712_100009230 3300006175 Bacteria 6212
216 Ga0070712_100049554 3300006175 Bacteria 2917
217 Ga0070712_100060346 3300006175 Bacteria 2674
218 Ga0070712_100135383 3300006175 Bacteria 1873
219 Ga0075367_10025051 3300006178 Bacteria 3370
220 Ga0075428_100023989 3300006844 Bacteria 6750
221 Ga0075428_100106170 3300006844 Bacteria 3062
222 Ga0075430_100190988 3300006846 Bacteria 1702
223 Ga0075431_100005919 3300006847 Bacteria 12097
224 Ga0075433_10000652 3300006852 Bacteria 23385
225 Ga0075433_10001827 3300006852 Bacteria 15974
226 Ga0075433_10007398 3300006852 Bacteria 8716
227 Ga0075433_10028029 3300006852 Bacteria 4784
228 Ga0075434_100000181 3300006871 Bacteria 40986
229 Ga0075434_100018396 3300006871 Bacteria 6750
230 Ga0075434_100038538 3300006871 Bacteria 4733
231 Ga0075434_100060076 3300006871 Bacteria 3780
232 Ga0075429_100038385 3300006880 Bacteria 4169
233 Ga0075429_100038598 3300006880 Bacteria 4158
234 Ga0075436_100010867 3300006914 Bacteria 6247
235 Ga0075436_100047311 3300006914 Bacteria 2967
236 Ga0075436_100132048 3300006914 Bacteria 1751
237 Ga0097620_100078109 3300006931 Bacteria 3350
238 Ga0097620_100106127 3300006931 Bacteria 2868
239 Ga0075435_100068135 3300007076 Bacteria 2898
240 Ga0075435_100108572 3300007076 Bacteria 2306
241 Ga0105251_10004563 3300009011 Bacteria 9373
242 Ga0105251_10006598 3300009011 Bacteria 7357
243 Ga0105251_10011880 3300009011 Bacteria 4947
244 Ga0105244_10000735 3300009036 Bacteria 28063
245 Ga0105240_10155493 3300009093 Bacteria 2721
246 Ga0111539_10000095 3300009094 Bacteria 93635
247 Ga0111539_10010369 3300009094 Bacteria 11732
248 Ga0111539_10165704 3300009094 Bacteria 2584
249 Ga0105245_10013491 3300009098 Bacteria 7117
250 Ga0105245_10036186 3300009098 Bacteria 4384
251 Ga0105245_10039281 3300009098 Bacteria 4213
252 Ga0105245_10144385 3300009098 Bacteria 2244
253 Ga0105245_10202729 3300009098 Bacteria 1905
254 Ga0105245_10319187 3300009098 Bacteria 1530
255 Ga0105247_10070656 3300009101 Bacteria 2181
256 Ga0114129_10008769 3300009147 Bacteria 14422
257 Ga0114129_10014475 3300009147 Bacteria 11241
258 Ga0114129_10027431 3300009147 Bacteria 8062
259 Ga0114129_10053520 3300009147 Bacteria 5661
260 Ga0114129_10280963 3300009147 Bacteria 2224
261 Ga0105243_10149832 3300009148 Bacteria 2000
262 Ga0105243_10228885 3300009148 Bacteria 1648
263 Ga0105243_10332041 3300009148 Bacteria 1389
264 Ga0105243_10335691 3300009148 Bacteria 1382
265 Ga0105241_10004447 3300009174 Bacteria 10364
266 Ga0105242_10010462 3300009176 Bacteria 7119
267 Ga0105242_10020736 3300009176 Bacteria 5155
268 Ga0105242_10033389 3300009176 Bacteria 4119
269 Ga0105242_10113127 3300009176 Bacteria 2317
270 Ga0105242_10251589 3300009176 Bacteria 1592
271 Ga0105242_10274188 3300009176 Bacteria 1529
272 Ga0105248_10000880 3300009177 Bacteria 33648
273 Ga0105248_10091708 3300009177 Bacteria 3421
274 Ga0105248_10173957 3300009177 Bacteria 2427
275 Ga0105248_10246363 3300009177 Bacteria 2012
276 Ga0105237_10006728 3300009545 Bacteria 12695
277 Ga0105237_10064474 3300009545 Bacteria 3660
278 Ga0105237_10166341 3300009545 Bacteria 2204
279 Ga0105238_10002053 3300009551 Bacteria 20326
280 Ga0105249_10065057 3300009553 Bacteria 3353
281 Ga0105249_10109470 3300009553 Bacteria 2609
282 Ga0105249_10152986 3300009553 Bacteria 2222
283 Ga0105249_10175164 3300009553 Bacteria 2083
284 Ga0105032_100683 3300009979 Bacteria 3310
285 Ga0105033_101458 3300009986 Bacteria 1937
286 Ga0105239_10112904 3300010375 Bacteria 3013
287 Ga0105246_10000474 3300011119 Bacteria 21648
288 Ga0105246_10030002 3300011119 Bacteria 3587
289 Ga0157344_1000433 3300012476 Bacteria 1622
290 Ga0157373_10091086 3300013100 Bacteria 2147
291 Ga0157371_10071463 3300013102 Bacteria 2456
292 Ga0157370_10001462 3300013104 Bacteria 29206
293 Ga0157370_10161321 3300013104 Bacteria 2086
294 Ga0157370_10171889 3300013104 Bacteria 2014
295 Ga0157369_10028346 3300013105 Bacteria 6198
296 Ga0157369_10031501 3300013105 Bacteria 5838
297 Ga0157369_10050500 3300013105 Bacteria 4504
298 Ga0157369_10054453 3300013105 Bacteria 4320
299 Ga0157369_10064247 3300013105 Bacteria 3953
300 Ga0157369_10077143 3300013105 Bacteria 3571
301 Ga0157369_10088646 3300013105 Bacteria 3303
302 Ga0157369_10282236 3300013105 Bacteria 1729
303 Ga0171462_1001 3300013250 Bacteria 1135406
304 Ga0157374_10024151 3300013296 Bacteria 5447
305 Ga0157374_10042610 3300013296 Bacteria 4187
306 Ga0157374_10191923 3300013296 Bacteria 1998
307 Ga0163162_10017442 3300013306 Bacteria 7025
308 Ga0163162_10098066 3300013306 Bacteria 3020
309 Ga0157372_10115493 3300013307 Bacteria 3077
310 Ga0157372_10117818 3300013307 Bacteria 3046
311 Ga0157372_10389671 3300013307 Bacteria 1623
312 Ga0157372_10435920 3300013307 Bacteria 1527
313 Ga0157375_10104547 3300013308 Bacteria 2920
314 Ga0157375_10222721 3300013308 Bacteria 2045
315 Ga0157375_10483163 3300013308 Bacteria 1404
316 Ga0157375_10538782 3300013308 Bacteria 1330
317 Ga0157375_10583356 3300013308 Bacteria 1278
318 Ga0163163_10008035 3300014325 Bacteria 9344
319 Ga0163163_10177155 3300014325 Bacteria 2179
320 Ga0163163_10245003 3300014325 Bacteria 1842
321 Ga0163163_10393289 3300014325 Bacteria 1444
322 Ga0157380_10018506 3300014326 Bacteria 5172
323 Ga0157380_10177247 3300014326 Bacteria 1869
324 Ga0182008_10000155 3300014497 Bacteria 54054
325 Ga0157377_10011120 3300014745 Bacteria 4481
326 Ga0157379_10006602 3300014968 Bacteria 10012
327 Ga0157379_10007743 3300014968 Bacteria 9303
328 Ga0157376_10102957 3300014969 Bacteria 2499
329 Ga0157376_10177269 3300014969 Bacteria 1945
330 Ga0157376_10311140 3300014969 Bacteria 1494
331 Ga0182007_10006083 3300015262 Bacteria 5218
332 Ga0183367_1002 3300015688 Bacteria 1101531
333 Ga0163161_10022188 3300017792 Bacteria 4468
334 Ga0163161_10064109 3300017792 Bacteria 2680
335 Ga0197907_10254036 3300020069 Bacteria 2663
336 Ga0197907_10622146 3300020069 Bacteria 1626
337 Ga0206356_10718652 3300020070 Bacteria 3527
338 Ga0206352_10797669 3300020078 Bacteria 3257
339 Ga0206350_10773787 3300020080 Bacteria 2001
340 Ga0206350_11125152 3300020080 Bacteria 2951
341 Ga0206354_10351484 3300020081 Bacteria 1673
342 Ga0206354_10556289 3300020081 Bacteria 2445
343 Ga0206354_10679121 3300020081 Bacteria 4827
344 Ga0206354_10854419 3300020081 Bacteria 2337
345 Ga0206354_11188581 3300020081 Bacteria 8815
346 Ga0206354_11707980 3300020081 Bacteria 1771
347 Ga0206353_10410223 3300020082 Bacteria 6596
348 Ga0206353_10645933 3300020082 Bacteria 12151
349 Ga0206353_10842314 3300020082 Bacteria 3030
350 Ga0206353_10849751 3300020082 Bacteria 2411
351 Ga0206353_11875109 3300020082 Bacteria 2679
352 Ga0213875_10000250 3300021388 Bacteria 54123
353 Ga0213875_10000514 3300021388 Bacteria 32222
354 Ga0213875_10117901 3300021388 Bacteria 1240
355 Ga0224712_10002198 3300022467 Bacteria 4762
356 Ga0224712_10002255 3300022467 Bacteria 4717
357 Ga0224712_10021596 3300022467 Bacteria 2206
358 Ga0224712_10037054 3300022467 Bacteria 1812
359 Ga0224572_1000179 3300024225 Bacteria 5857
360 Ga0224572_1000254 3300024225 Bacteria 5437
361 Ga0209566_100053 3300025225 Bacteria 224436
362 Ga0209674_100001 3300025226 Bacteria 4013750
363 Ga0209672_100039 3300025228 Bacteria 283064
364 Ga0209147_101049 3300025229 Bacteria 11708
365 Ga0209563_100001 3300025230 Bacteria 4013775
366 Ga0209563_100766 3300025230 Bacteria 9765
367 Ga0209646_1000088 3300025246 Bacteria 192345
368 Ga0209677_100001 3300025253 Bacteria 4013787
369 Ga0209677_100448 3300025253 Bacteria 23936
370 Ga0209148_1000004 3300025254 Bacteria 1844481
371 Ga0209148_1004065 3300025254 Bacteria 3716
372 Ga0209148_1004139 3300025254 Bacteria 3659
373 Ga0209129_1000047 3300025258 Bacteria 270566
374 Ga0209455_1000117 3300025272 Bacteria 176940
375 Ga0209455_1003789 3300025272 Bacteria 5200
376 Ga0209025_1000920 3300025294 Bacteria 45267
377 Ga0209758_1002219 3300025297 Bacteria 20208
378 Ga0207426_1005431 3300025302 Bacteria 5816
379 Ga0209051_1003197 3300025303 Bacteria 10933
380 Ga0209051_1013778 3300025303 Bacteria 3820
381 Ga0207697_10001921 3300025315 Bacteria 11055
382 Ga0207656_10000005 3300025321 Bacteria 490514
383 Ga0207655_1006296 3300025728 Bacteria 7893
384 Ga0207655_1015554 3300025728 Bacteria 4220
385 Ga0207713_1051913 3300025735 Bacteria 1627
386 Ga0207653_10006417 3300025885 Bacteria 3667
387 Ga0207682_10001886 3300025893 Bacteria 9541
388 Ga0207692_10000225 3300025898 Bacteria 19145
389 Ga0207692_10009769 3300025898 Bacteria 4019
390 Ga0207692_10049387 3300025898 Bacteria 2123
391 Ga0207692_10051604 3300025898 Bacteria 2086
392 Ga0207692_10134957 3300025898 Bacteria 1398
393 Ga0207642_10011637 3300025899 Bacteria 3147
394 Ga0207710_10033869 3300025900 Bacteria 2242
395 Ga0207710_10052795 3300025900 Bacteria 1828
396 Ga0207647_10009551 3300025904 Bacteria 6885
397 Ga0207647_10091475 3300025904 Bacteria 1814
398 Ga0207647_10135588 3300025904 Bacteria 1445
399 Ga0207685_10000224 3300025905 Bacteria 8791
400 Ga0207685_10030315 3300025905 Bacteria 1924
401 Ga0207699_10000106 3300025906 Bacteria 58842
402 Ga0207699_10004744 3300025906 Bacteria 6495
403 Ga0207699_10005198 3300025906 Bacteria 6223
404 Ga0207699_10007365 3300025906 Bacteria 5381
405 Ga0207699_10008667 3300025906 Bacteria 5030
406 Ga0207645_10016279 3300025907 Bacteria 4924
407 Ga0207643_10015262 3300025908 Bacteria 4179
408 Ga0207643_10132631 3300025908 Bacteria 1483
409 Ga0207643_10135365 3300025908 Bacteria 1468
410 Ga0207705_10000001 3300025909 Bacteria 2061880
411 Ga0207705_10009574 3300025909 Bacteria 7048
412 Ga0207705_10014811 3300025909 Bacteria 5606
413 Ga0207705_10099321 3300025909 Bacteria 2140
414 Ga0207705_10139709 3300025909 Bacteria 1808
415 Ga0207705_10145603 3300025909 Bacteria 1772
416 Ga0207684_10002459 3300025910 Bacteria 18674
417 Ga0207684_10006157 3300025910 Bacteria 10973
418 Ga0207684_10013779 3300025910 Bacteria 6984
419 Ga0207684_10026141 3300025910 Bacteria 4975
420 Ga0207684_10031843 3300025910 Bacteria 4486
421 Ga0207684_10032282 3300025910 Bacteria 4454
422 Ga0207684_10032768 3300025910 Bacteria 4418
423 Ga0207654_10000001 3300025911 Bacteria 1816198
424 Ga0207707_10003758 3300025912 Bacteria 13458
425 Ga0207707_10303097 3300025912 Bacteria 1381
426 Ga0207695_10005496 3300025913 Bacteria 16776
427 Ga0207671_10000016 3300025914 Bacteria 435413
428 Ga0207671_10177663 3300025914 Bacteria 1655
429 Ga0207693_10002782 3300025915 Bacteria 15143
430 Ga0207693_10003038 3300025915 Bacteria 14506
431 Ga0207693_10007334 3300025915 Bacteria 9068
432 Ga0207693_10008350 3300025915 Bacteria 8474
433 Ga0207693_10045686 3300025915 Bacteria 3441
434 Ga0207693_10072583 3300025915 Bacteria 2694
435 Ga0207693_10087986 3300025915 Bacteria 2434
436 Ga0207663_10005403 3300025916 Bacteria 6432
437 Ga0207663_10021516 3300025916 Bacteria 3673
438 Ga0207663_10034482 3300025916 Bacteria 3027
439 Ga0207663_10091360 3300025916 Bacteria 2021
440 Ga0207663_10188167 3300025916 Bacteria 1480
441 Ga0207660_10000245 3300025917 Bacteria 35340
442 Ga0207660_10104135 3300025917 Bacteria 2124
443 Ga0207662_10002253 3300025918 Bacteria 9642
444 Ga0207657_10018246 3300025919 Bacteria 6709
445 Ga0207657_10045521 3300025919 Bacteria 3850
446 Ga0207657_10080562 3300025919 Bacteria 2736
447 Ga0207657_10086227 3300025919 Bacteria 2629
448 Ga0207649_10053258 3300025920 Bacteria 2514
449 Ga0207652_10000294 3300025921 Bacteria 51581
450 Ga0207652_10068778 3300025921 Bacteria 3073
451 Ga0207652_10118221 3300025921 Bacteria 2356
452 Ga0207652_10149647 3300025921 Bacteria 2090
453 Ga0207646_10001959 3300025922 Bacteria 24684
454 Ga0207646_10004445 3300025922 Bacteria 15203
455 Ga0207646_10020856 3300025922 Bacteria 6064
456 Ga0207646_10053018 3300025922 Bacteria 3629
457 Ga0207646_10111544 3300025922 Bacteria 2454
458 Ga0207646_10117071 3300025922 Bacteria 2393
459 Ga0207646_10312279 3300025922 Bacteria 1420
460 Ga0207646_10345862 3300025922 Bacteria 1344
461 Ga0207681_10042632 3300025923 Bacteria 3032
462 Ga0207694_10000057 3300025924 Bacteria 146441
463 Ga0207694_10100546 3300025924 Bacteria 2291
464 Ga0207687_10013434 3300025927 Bacteria 5345
465 Ga0207687_10043864 3300025927 Bacteria 3083
466 Ga0207687_10045183 3300025927 Bacteria 3043
467 Ga0207687_10144667 3300025927 Bacteria 1807
468 Ga0207687_10240039 3300025927 Bacteria 1436
469 Ga0207700_10000053 3300025928 Bacteria 75986
470 Ga0207700_10002291 3300025928 Bacteria 10983
471 Ga0207700_10008955 3300025928 Bacteria 6230
472 Ga0207700_10011392 3300025928 Bacteria 5666
473 Ga0207700_10014429 3300025928 Bacteria 5177
474 Ga0207700_10016711 3300025928 Bacteria 4883
475 Ga0207700_10018986 3300025928 Bacteria 4634
476 Ga0207700_10034772 3300025928 Bacteria 3621
477 Ga0207700_10062900 3300025928 Bacteria 2820
478 Ga0207700_10065079 3300025928 Bacteria 2780
479 Ga0207700_10114707 3300025928 Bacteria 2174
480 Ga0207700_10162334 3300025928 Bacteria 1857
481 Ga0207664_10000701 3300025929 Bacteria 22942
482 Ga0207664_10000834 3300025929 Bacteria 20936
483 Ga0207664_10002440 3300025929 Bacteria 12303
484 Ga0207664_10002847 3300025929 Bacteria 11488
485 Ga0207664_10002931 3300025929 Bacteria 11336
486 Ga0207664_10005087 3300025929 Bacteria 8961
487 Ga0207664_10005293 3300025929 Bacteria 8811
488 Ga0207664_10014166 3300025929 Bacteria 5751
489 Ga0207664_10035531 3300025929 Bacteria 3846
490 Ga0207664_10067649 3300025929 Bacteria 2867
491 Ga0207664_10076669 3300025929 Bacteria 2707
492 Ga0207664_10096423 3300025929 Bacteria 2434
493 Ga0207664_10111991 3300025929 Bacteria 2271
494 Ga0207664_10178465 3300025929 Bacteria 1822
495 Ga0207644_10011157 3300025931 Bacteria 5937
496 Ga0207644_10283993 3300025931 Bacteria 1329
497 Ga0207690_10040760 3300025932 Bacteria 3038
498 Ga0207706_10010621 3300025933 Bacteria 8411
499 Ga0207706_10022853 3300025933 Bacteria 5612
500 Ga0207706_10024565 3300025933 Bacteria 5402
501 Ga0207686_10157297 3300025934 Bacteria 1589
502 Ga0207709_10031526 3300025935 Bacteria 3097
503 Ga0207669_10131751 3300025937 Bacteria 1719
504 Ga0207665_10000166 3300025939 Bacteria 44650
505 Ga0207665_10002299 3300025939 Bacteria 12906
506 Ga0207665_10011425 3300025939 Bacteria 5833
507 Ga0207665_10012620 3300025939 Bacteria 5554
508 Ga0207665_10026642 3300025939 Bacteria 3817
509 Ga0207665_10041375 3300025939 Bacteria 3077
510 Ga0207691_10001200 3300025940 Bacteria 25797
511 Ga0207691_10067617 3300025940 Bacteria 3230
512 Ga0207691_10165816 3300025940 Bacteria 1936
513 Ga0207711_10005166 3300025941 Bacteria 11061
514 Ga0207711_10098454 3300025941 Bacteria 2584
515 Ga0207689_10007084 3300025942 Bacteria 9858
516 Ga0207661_10054298 3300025944 Bacteria 3209
517 Ga0207661_10252596 3300025944 Bacteria 1568
518 Ga0207661_10308762 3300025944 Bacteria 1419
519 Ga0207679_10100044 3300025945 Bacteria 2265
520 Ga0207679_10210222 3300025945 Bacteria 1631
521 Ga0207667_10002042 3300025949 Bacteria 25307
522 Ga0207667_10011034 3300025949 Bacteria 10527
523 Ga0207667_10027457 3300025949 Bacteria 6195
524 Ga0207667_10138396 3300025949 Bacteria 2507
525 Ga0207712_10233207 3300025961 Bacteria 1479
526 Ga0207668_10094646 3300025972 Bacteria 2203
527 Ga0207668_10111826 3300025972 Bacteria 2051
528 Ga0207658_10203354 3300025986 Bacteria 1655
529 Ga0207677_10193109 3300026023 Bacteria 1612
530 Ga0207703_10000345 3300026035 Bacteria 49953
531 Ga0207639_10079767 3300026041 Bacteria 2588
532 Ga0207639_10088644 3300026041 Bacteria 2470
533 Ga0207678_10003794 3300026067 Bacteria 13585
534 Ga0207678_10007006 3300026067 Bacteria 10007
535 Ga0207678_10250368 3300026067 Bacteria 1517
536 Ga0207708_10103770 3300026075 Bacteria 2202
537 Ga0207702_10077147 3300026078 Bacteria 2881
538 Ga0207702_10173137 3300026078 Bacteria 1981
539 Ga0207702_10173323 3300026078 Bacteria 1980
540 Ga0207641_10002332 3300026088 Bacteria 17607
541 Ga0207648_10047554 3300026089 Bacteria 3760
542 Ga0207648_10062162 3300026089 Bacteria 3256
543 Ga0207676_10043731 3300026095 Bacteria 3450
544 Ga0207676_10061345 3300026095 Bacteria 2977
545 Ga0207674_10012372 3300026116 Bacteria 9539
546 Ga0207674_10013065 3300026116 Bacteria 9245
547 Ga0207674_10019331 3300026116 Bacteria 7379
548 Ga0207674_10045712 3300026116 Bacteria 4501
549 Ga0207675_100005332 3300026118 Bacteria 12354
550 Ga0207675_100047486 3300026118 Bacteria 4008
551 Ga0207675_100110508 3300026118 Bacteria 2593
552 Ga0207683_10001303 3300026121 Bacteria 22540
553 Ga0207683_10050682 3300026121 Bacteria 3637
554 Ga0207683_10059997 3300026121 Bacteria 3342
555 Ga0207683_10078958 3300026121 Bacteria 2917
556 Ga0207683_10109649 3300026121 Bacteria 2471
557 Ga0207683_10143628 3300026121 Bacteria 2151
558 Ga0207698_10004794 3300026142 Bacteria 8280
559 Ga0207698_10120534 3300026142 Bacteria 2219
560 Ga0207698_10192526 3300026142 Bacteria 1818
561 Ga0207428_10000102 3300027907 Bacteria 118940
562 Ga0207428_10002614 3300027907 Bacteria 17980
563 Ga0207428_10085407 3300027907 Bacteria 2457
564 Ga0268265_10117329 3300028380 Bacteria 2186
565 Ga0268264_10007965 3300028381 Bacteria 8817
566 Ga0265337_1000031 3300028556 Bacteria 64194
567 Ga0265319_1002342 3300028563 Bacteria 10430
568 Ga0265334_10000091 3300028573 Bacteria 64750
569 Ga0265334_10003140 3300028573 Bacteria 7541
570 Ga0265323_10049795 3300028653 Bacteria 1490
571 Ga0265322_10003185 3300028654 Bacteria 4986
572 Ga0265336_10007606 3300028666 Bacteria 3848
573 Ga0307517_10002777 3300028786 Bacteria 27845
574 Ga0307517_10015795 3300028786 Bacteria 9994
575 Ga0307515_10010875 3300028794 Bacteria 17364
576 Ga0307515_10180353 3300028794 Bacteria 2064
577 Ga0265338_10000233 3300028800 Bacteria 103593
578 Ga0265338_10002443 3300028800 Bacteria 27876
579 Ga0265338_10025625 3300028800 Bacteria 5977
580 Ga0265338_10233416 3300028800 Bacteria 1367
581 Ga0265324_10004717 3300029957 Bacteria 6041
582 Ga0307511_10018996 3300030521 Bacteria 6550
583 Ga0307511_10048418 3300030521 Bacteria 3458
584 Ga0307511_10052434 3300030521 Bacteria 3250
585 Ga0307512_10013114 3300030522 Bacteria 7789
586 Ga0307512_10087803 3300030522 Bacteria 2187
587 Ga0307512_10121776 3300030522 Bacteria 1672
588 Ga0314311_1016886 3300030733 Bacteria 2903
589 Ga0265332_10006014 3300031238 Bacteria 5548
590 Ga0265320_10008863 3300031240 Bacteria 6116
591 Ga0265327_10000019 3300031251 Bacteria 427653
592 Ga0265316_10065002 3300031344 Bacteria 2825
593 Ga0307513_10000936 3300031456 Bacteria 42211
594 Ga0307513_10001197 3300031456 Bacteria 37689
595 Ga0307513_10034204 3300031456 Bacteria 5705
596 Ga0307513_10223828 3300031456 Bacteria 1700
597 Ga0307509_10010025 3300031507 Bacteria 11694
598 Ga0307509_10061631 3300031507 Bacteria 3958
599 Ga0307509_10126821 3300031507 Bacteria 2516
600 Ga0307408_100003074 3300031548 Bacteria 11504
601 Ga0307408_100060781 3300031548 Bacteria 2755
602 Ga0307408_100099817 3300031548 Bacteria 2209
603 Ga0307408_100156051 3300031548 Bacteria 1807
604 Ga0307408_100216733 3300031548 Bacteria 1559
605 Ga0265313_10002825 3300031595 Bacteria 14617
606 Ga0307508_10001583 3300031616 Bacteria 25403
607 Ga0307508_10029203 3300031616 Bacteria 4986
608 Ga0307508_10033651 3300031616 Bacteria 4625
609 Ga0307514_10008438 3300031649 Bacteria 8780
610 Ga0307514_10090774 3300031649 Bacteria 2227
611 Ga0307514_10096465 3300031649 Bacteria 2136
612 Ga0316575_10000668 3300031665 Bacteria 10159
613 Ga0316575_10003717 3300031665 Bacteria 5296
614 Ga0316575_10091932 3300031665 Bacteria 1229
615 Ga0316579_10002190 3300031691 Bacteria 7356
616 Ga0316579_10118321 3300031691 Bacteria 1272
617 Ga0265314_10006509 3300031711 Bacteria 10322
618 Ga0265342_10004101 3300031712 Bacteria 11614
619 Ga0316576_10001465 3300031727 Bacteria 12677
620 Ga0316576_10002319 3300031727 Bacteria 10792
621 Ga0316576_10021064 3300031727 Bacteria 4502
622 Ga0316576_10023914 3300031727 Bacteria 4262
623 Ga0316578_10002782 3300031728 Bacteria 7792
624 Ga0316578_10038070 3300031728 Bacteria 2772
625 Ga0307516_10019845 3300031730 Bacteria 6950
626 Ga0307516_10036778 3300031730 Bacteria 4898
627 Ga0307405_10014792 3300031731 Bacteria 4207
628 Ga0307405_10023043 3300031731 Bacteria 3532
629 Ga0307405_10071150 3300031731 Bacteria 2237
630 Ga0307405_10086782 3300031731 Bacteria 2060
631 Ga0307405_10088812 3300031731 Bacteria 2040
632 Ga0307413_10007992 3300031824 Bacteria 4959
633 Ga0307413_10009243 3300031824 Bacteria 4709
634 Ga0307413_10046827 3300031824 Bacteria 2575
635 Ga0307413_10108539 3300031824 Bacteria 1852
636 Ga0307518_10057070 3300031838 Bacteria 2836
637 Ga0307410_10012152 3300031852 Bacteria 4962
638 Ga0307410_10017054 3300031852 Bacteria 4349
639 Ga0307410_10025171 3300031852 Bacteria 3729
640 Ga0307410_10038935 3300031852 Bacteria 3118
641 Ga0307410_10148707 3300031852 Bacteria 1741
642 Ga0307410_10149908 3300031852 Bacteria 1735
643 Ga0307410_10165544 3300031852 Bacteria 1661
644 Ga0307410_10250384 3300031852 Bacteria 1377
645 Ga0307406_10000104 3300031901 Bacteria 49152
646 Ga0307406_10000932 3300031901 Bacteria 16339
647 Ga0307406_10001566 3300031901 Bacteria 12607
648 Ga0307406_10076440 3300031901 Bacteria 2212
649 Ga0307407_10007739 3300031903 Bacteria 4884
650 Ga0307407_10010003 3300031903 Bacteria 4450
651 Ga0307407_10048355 3300031903 Bacteria 2420
652 Ga0307407_10075390 3300031903 Bacteria 2022
653 Ga0307407_10081179 3300031903 Bacteria 1962
654 Ga0307407_10164226 3300031903 Bacteria 1456
655 Ga0307412_10017272 3300031911 Bacteria 4316
656 Ga0307412_10029651 3300031911 Bacteria 3436
657 Ga0307412_10098355 3300031911 Bacteria 2063
658 Ga0307412_10212449 3300031911 Bacteria 1477
659 Ga0307409_100009644 3300031995 Bacteria 5946
660 Ga0307409_100034809 3300031995 Bacteria 3684
661 Ga0307409_100063923 3300031995 Bacteria 2888
662 Ga0307409_100106542 3300031995 Bacteria 2340
663 Ga0307409_100109373 3300031995 Bacteria 2314
664 Ga0307409_100109684 3300031995 Bacteria 2311
665 Ga0307409_100140908 3300031995 Bacteria 2077
666 Ga0307409_100147804 3300031995 Bacteria 2035
667 Ga0307409_100228942 3300031995 Bacteria 1683
668 Ga0307409_100279486 3300031995 Bacteria 1542
669 Ga0307409_100390846 3300031995 Bacteria 1325
670 Ga0307416_100004847 3300032002 Bacteria 8187
671 Ga0307416_100008600 3300032002 Bacteria 6602
672 Ga0307416_100024975 3300032002 Bacteria 4372
673 Ga0307416_100055367 3300032002 Bacteria 3194
674 Ga0307416_100057924 3300032002 Bacteria 3138
675 Ga0307416_100172596 3300032002 Bacteria 2015
676 Ga0307416_100254176 3300032002 Bacteria 1713
677 Ga0307416_100455599 3300032002 Bacteria 1333
678 Ga0307414_10016958 3300032004 Bacteria 4445
679 Ga0307414_10020103 3300032004 Bacteria 4154
680 Ga0307414_10024236 3300032004 Bacteria 3866
681 Ga0307414_10065704 3300032004 Bacteria 2589
682 Ga0307414_10141928 3300032004 Bacteria 1882
683 Ga0307411_10028720 3300032005 Bacteria 3387
684 Ga0307411_10062908 3300032005 Bacteria 2478
685 Ga0307411_10121414 3300032005 Bacteria 1891
686 Ga0307411_10156076 3300032005 Bacteria 1703
687 Ga0307411_10167669 3300032005 Bacteria 1652
688 Ga0307415_100021173 3300032126 Bacteria 3990
689 Ga0307415_100213319 3300032126 Bacteria 1542
690 Ga0307415_100215722 3300032126 Bacteria 1534
691 Ga0307415_100220758 3300032126 Bacteria 1519
692 Ga0316583_10031886 3300032133 Bacteria 1875
693 Ga0316585_10008431 3300032137 Bacteria 2991
694 Ga0307507_10000024 3300033179 Bacteria 212340
695 Ga0307507_10039031 3300033179 Bacteria 4799
696 Ga0307510_10071034 3300033180 Bacteria 3471
697 Ga0307510_10093196 3300033180 Bacteria 2845
698 Ga0316212_1008686 3300033547 Bacteria 1459
699 Ga0373938_0002225 3300034957 Bacteria 3115
700 Ga0373926_0018060 3300035083 Bacteria 2424
701 Ga0373926_0054436 3300035083 Bacteria 1449
702 Ga0373934_0000060 3300035086 Bacteria 37064
703 Ga0373934_0005753 3300035086 Bacteria 4593
704 Ga0373934_0007765 3300035086 Bacteria 3985
705 Ga0373934_0021948 3300035086 Bacteria 2460
706 Ga0373940_0013993 3300035088 Bacteria 1951
707 Ga0373944_0001496 3300035089 Bacteria 5909
708 Ga0373944_0006615 3300035089 Bacteria 3078
709 Ga0373923_0001412 3300035111 Bacteria 6861
710 Ga0373923_0006524 3300035111 Bacteria 4041
711 Ga0373923_0022397 3300035111 Bacteria 2477
712 Ga0373923_0030949 3300035111 Bacteria 2154
713 Ga0373932_0015193 3300035112 Bacteria 1948
714 Ga0373936_0000847 3300035113 Bacteria 10892
715 Ga0373936_0007777 3300035113 Bacteria 4026
716 Ga0373936_0015652 3300035113 Bacteria 2907
717 Ga0373936_0057553 3300035113 Bacteria 1581
718 Ga0373945_0000182 3300035116 Bacteria 16849
719 Ga0373953_0000277 3300035117 Bacteria 14136
720 Ga0373953_0002414 3300035117 Bacteria 5643
721 Ga0373953_0003904 3300035117 Bacteria 4697
722 Ga0373953_0012377 3300035117 Bacteria 3020
723 Ga0373954_0002950 3300035118 Bacteria 7178
724 Ga0373954_0023130 3300035118 Bacteria 2823
725 Ga0373954_0024959 3300035118 Bacteria 2728
726 Ga0373954_0025004 3300035118 Bacteria 2726
727 Ga0373954_0026765 3300035118 Bacteria 2645
728 Ga0373956_0000422 3300035119 Bacteria 17238
729 Ga0373956_0005349 3300035119 Bacteria 5137
730 Ga0373956_0005512 3300035119 Bacteria 5066
731 Ga0373956_0014937 3300035119 Bacteria 3247
732 Ga0373956_0029433 3300035119 Bacteria 2395
733 Ga0373956_0054191 3300035119 Bacteria 1806
734 Ga0373957_0000077 3300035120 Bacteria 23677
735 Ga0373957_0002673 3300035120 Bacteria 5117
736 Ga0373957_0012834 3300035120 Bacteria 2828
737 Ga0373957_0022802 3300035120 Bacteria 2233
738 Ga0373957_0024157 3300035120 Bacteria 2180
739 Ga0373957_0062286 3300035120 Bacteria 1447
740 Ga0373946_0000651 3300035171 Bacteria 11638
741 Ga0373946_0007865 3300035171 Bacteria 3914
742 Ga0373946_0059149 3300035171 Bacteria 1626
743 Ga0373955_0000013 3300035172 Bacteria 73449
744 Ga0373955_0027994 3300035172 Bacteria 2918
745 Ga0373955_0094242 3300035172 Bacteria 1710
746 Ga0373961_0013919 3300035241 Bacteria 2035
747 Ga0316574_0015485 3300035398 Bacteria 4425
748 Ga0316574_0076927 3300035398 Bacteria 2114
749 Ga0373924_0000936 3300035410 Bacteria 9209
750 Ga0373924_0009894 3300035410 Bacteria 3507
751 Ga0373935_0007297 3300035692 Bacteria 6609
752 Ga0373935_0037830 3300035692 Bacteria 3020
753 Ga0373935_0131404 3300035692 Bacteria 1682
754 Ga0373927_0012605 3300035695 Bacteria 5624
755 Ga0373927_0015053 3300035695 Bacteria 5113
756 Ga0373927_0144016 3300035695 Bacteria 1559
757 Ga0373933_0000139 3300035724 Bacteria 46756
758 Ga0373933_0001396 3300035724 Bacteria 14183
759 Ga0373933_0013994 3300035724 Bacteria 4451
760 Ga0373933_0044507 3300035724 Bacteria 2629
761 Ga0373947_0007347 3300035725 Bacteria 6378
762 Ga0373947_0123178 3300035725 Bacteria 1649
763 Ga0373947_0131535 3300035725 Bacteria 1598
764 Ga0373937_0000112 3300036401 Bacteria 77473
765 Ga0373937_0008701 3300036401 Bacteria 8819
766 Ga0373937_0010609 3300036401 Bacteria 8049
767 Ga0373937_0037477 3300036401 Bacteria 4418
768 Ga0373937_0193865 3300036401 Bacteria 1909
769 Ga0373937_0208875 3300036401 Bacteria 1836
770 Ga0372808_001746 3300036459 Bacteria 2349
771 Ga0316582_0004467 3300036647 Bacteria 7080
772 Ga0316582_0039405 3300036647 Bacteria 2942
773 Ga0316584_0003649 3300036712 Bacteria 10076
774 Ga0316584_0005041 3300036712 Bacteria 8802
775 Ga0316584_0012623 3300036712 Bacteria 5960
776 Ga0316584_0016410 3300036712 Bacteria 5309
777 Ga0316584_0030549 3300036712 Bacteria 3978
778 Ga0373925_0000008 3300037068 Bacteria 249158
779 Ga0373925_0002037 3300037068 Bacteria 16694
780 Ga0373925_0003433 3300037068 Bacteria 12260
781 Ga0373925_0007151 3300037068 Bacteria 8159
782 Ga0373925_0147876 3300037068 Bacteria 1842
783 Ga0395899_0005583 3300037312 Bacteria 9756
784 Ga0395899_0017225 3300037312 Bacteria 5505
785 Ga0395899_0032197 3300037312 Bacteria 3939
786 Ga0395899_0038763 3300037312 Bacteria 3567
787 Ga0395899_0040320 3300037312 Bacteria 3493
788 Ga0395899_0076971 3300037312 Bacteria 2434
789 Ga0395899_0110727 3300037312 Bacteria 1975
790 Ga0395899_0184253 3300037312 Bacteria 1464
791 Ga0395900_0011102 3300037418 Bacteria 9206
792 Ga0395900_0093930 3300037418 Bacteria 3081
793 Ga0395900_0102603 3300037418 Bacteria 2938
794 Ga0395900_0209796 3300037418 Bacteria 1967
795 Ga0395900_0407188 3300037418 Bacteria 1323
796 Ga0395898_0000381 3300037466 Bacteria 97274
797 Ga0395898_0001626 3300037466 Bacteria 30485
798 Ga0395898_0006252 3300037466 Bacteria 12744
799 Ga0395898_0016357 3300037466 Bacteria 7592
800 Ga0395898_0020646 3300037466 Bacteria 6689
801 Ga0395898_0027833 3300037466 Bacteria 5668
802 Ga0395898_0031520 3300037466 Bacteria 5296
803 Ga0395898_0057057 3300037466 Bacteria 3805
804 Ga0395898_0070700 3300037466 Bacteria 3373
805 Ga0395898_0089016 3300037466 Bacteria 2971
806 Ga0395898_0346841 3300037466 Bacteria 1416
807 Ga0395898_0367269 3300037466 Bacteria 1372
808 Ga0436364_0160104 3300037853 Bacteria 3213
809 Ga0436364_0287407 3300037853 Bacteria 132611
810 Ga0436364_0464514 3300037853 Bacteria 2581
811 Ga0436364_0964211 3300037853 Bacteria 1702
812 Ga0436364_1096374 3300037853 Bacteria 1783
813 Ga0436364_1261806 3300037853 Bacteria 5053
814 Ga0436364_1274663 3300037853 Bacteria 8091
815 Ga0436364_1379988 3300037853 Bacteria 24630
816 Ga0436364_1399659 3300037853 Bacteria 2774
817 Ga0395901_0036787 3300038443 Bacteria 5061
818 Ga0395901_0071477 3300038443 Bacteria 3616
819 Ga0395901_0079374 3300038443 Bacteria 3427
820 Ga0395901_0111329 3300038443 Bacteria 2875
821 Ga0395901_0131820 3300038443 Bacteria 2626
822 Ga0395901_0135263 3300038443 Bacteria 2591
823 Ga0395901_0145256 3300038443 Bacteria 2493
824 Ga0395901_0240809 3300038443 Bacteria 1887
825 Ga0395901_0272956 3300038443 Bacteria 1758
826 Ga0395901_0486909 3300038443 Bacteria 1257
827 Ga0400485_14348 3300038735 Bacteria 15612
828 Ga0400488_19742 3300038741 Bacteria 1306
829 Ga0400486_32183 3300038742 Bacteria 37185
830 Ga0436365_1516734 3300039437 Bacteria 2369
831 Ga0436360_1265940 3300039438 Bacteria 1838
832 Ga0439436_0001906 3300041404 Bacteria 6173
833 Ga0439436_0004852 3300041404 Bacteria 4127
834 Ga0439436_0012938 3300041404 Bacteria 2528
835 Ga0439436_0020025 3300041404 Bacteria 1993
836 Ga0439436_0037014 3300041404 Bacteria 1406
837 Ga0439438_052622 3300041405 Bacteria 1032
838 Ga0439439_0001108 3300041406 Bacteria 5147
839 Ga0439439_0002397 3300041406 Bacteria 3975
840 Ga0439447_016639 3300041407 Bacteria 2015
841 Ga0439466_0004226 3300041411 Bacteria 5546
842 Ga0439466_0004258 3300041411 Bacteria 5522
843 Ga0451791_0795391 3300041451 Bacteria 1382
844 Ga0451791_1067624 3300041451 Bacteria 5132
845 Ga0451793_0283208 3300041452 Bacteria 5544
846 Ga0451797_0921282 3300041453 Bacteria 2572
847 Ga0451802_0199680 3300041460 Bacteria 2116
848 Ga0451807_0181894 3300041486 Bacteria 2199
849 Ga0451833_1396629 3300041491 Bacteria 1597
850 Ga0451837_1299351 3300041494 Bacteria 1455
851 Ga0451839_1074799 3300041496 Bacteria 3420
852 Ga0451853_0509641 3300041512 Bacteria 3460
853 Ga0451853_2323682 3300041512 Bacteria 3405
854 Ga0439433_0000156 3300041999 Bacteria 10531
855 Ga0439433_0000220 3300041999 Bacteria 9358
856 Ga0439442_000012 3300042002 Bacteria 49187
857 Ga0439442_000083 3300042002 Bacteria 22714
858 Ga0439442_000162 3300042002 Bacteria 16792
859 Ga0439442_004696 3300042002 Bacteria 2716
860 Ga0439442_009119 3300042002 Bacteria 2005
861 Ga0439449_0000984 3300042007 Bacteria 11198
862 Ga0439449_0029595 3300042007 Bacteria 2041
863 Ga0439452_007207 3300042010 Bacteria 3421
864 Ga0439457_000027 3300042014 Bacteria 29657
865 Ga0439457_003698 3300042014 Bacteria 4122
866 Ga0439457_004957 3300042014 Bacteria 3405
867 Ga0439462_0041974 3300042015 Bacteria 1222
868 Ga0439462_0057144 3300042015 Bacteria 1053
869 Ga0450894_000043 3300042131 Bacteria 18761
870 Ga0450907_000265 3300042146 Bacteria 17745
871 Ga0450907_005873 3300042146 Bacteria 2060
872 Ga0439458_0001450 3300042157 Bacteria 5973
873 Ga0450909_000182 3300042185 Bacteria 7060
874 Ga0439434_0000031 3300042435 Bacteria 33054
875 Ga0439434_0003626 3300042435 Bacteria 4515
876 Ga0439434_0013610 3300042435 Bacteria 2416
877 Ga0450918_000950 3300042531 Bacteria 6051
878 Ga0450918_003686 3300042531 Bacteria 2836
879 Ga0466969_0019697 3300044656 Bacteria 3503
880 Ga0466969_0030935 3300044656 Bacteria 2725
881 Ga0466969_0037022 3300044656 Bacteria 2462
882 Ga0466972_0004584 3300044658 Bacteria 6926
883 Ga0466972_0035044 3300044658 Bacteria 2457
884 Ga0466972_0047412 3300044658 Bacteria 2078
885 Ga0466972_0059802 3300044658 Bacteria 1828
886 Ga0466965_0000038 3300044683 Bacteria 47424
887 Ga0466965_0013448 3300044683 Bacteria 3861
888 Ga0466965_0034551 3300044683 Bacteria 2473
889 Ga0466965_0046392 3300044683 Bacteria 2151
890 Ga0466966_0032573 3300044684 Bacteria 3377
891 Ga0466966_0058359 3300044684 Bacteria 2439
892 Ga0466966_0189110 3300044684 Bacteria 1248
893 Ga0466961_0000630 3300044693 Bacteria 22090
894 Ga0466961_0004359 3300044693 Bacteria 8866
895 Ga0466961_0004420 3300044693 Bacteria 8800
896 Ga0466961_0031022 3300044693 Bacteria 3435
897 Ga0466961_0048035 3300044693 Bacteria 2728
898 Ga0466961_0072229 3300044693 Bacteria 2189
899 Ga0466963_0000611 3300044694 Bacteria 17115
900 Ga0466963_0002295 3300044694 Bacteria 10636
901 Ga0466963_0074190 3300044694 Bacteria 2294
902 Ga0466963_0191155 3300044694 Bacteria 1430
903 Ga0466963_0255975 3300044694 Bacteria 1229
904 Ga0466971_0000512 3300044719 Bacteria 15294
905 Ga0466971_0001195 3300044719 Bacteria 10780
906 Ga0466971_0001379 3300044719 Bacteria 10183
907 Ga0466971_0084173 3300044719 Bacteria 1452
908 Ga0466968_0010980 3300044735 Bacteria 3521
909 Ga0466970_0000322 3300044765 Bacteria 23272
910 Ga0466970_0002564 3300044765 Bacteria 8766
911 Ga0466970_0004093 3300044765 Bacteria 7170
912 Ga0466970_0013270 3300044765 Bacteria 4223
913 Ga0466970_0020549 3300044765 Bacteria 3432
914 Ga0466970_0027254 3300044765 Bacteria 2997
915 Ga0466970_0044803 3300044765 Bacteria 2355
916 Ga0466970_0057628 3300044765 Bacteria 2077
917 Ga0466957_0000143 3300044842 Bacteria 30758
918 Ga0466957_0108661 3300044842 Bacteria 1757
919 Ga0466960_0009565 3300044901 Bacteria 4000
920 Ga0466960_0012316 3300044901 Bacteria 3605
921 Ga0466960_0029449 3300044901 Bacteria 2520
922 Ga0466960_0029531 3300044901 Bacteria 2516
923 Ga0466960_0118455 3300044901 Bacteria 1384
924 Ga0466959_0005248 3300045049 Bacteria 8845
925 Ga0466959_0051206 3300045049 Bacteria 3030
926 Ga0466959_0059799 3300045049 Bacteria 2773
927 Ga0466959_0196100 3300045049 Bacteria 1407
928 Ga0466958_0003353 3300045836 Bacteria 8302
929 Ga0466958_0017403 3300045836 Bacteria 4154
930 Ga0466958_0047464 3300045836 Bacteria 2593
931 Ga0466958_0071467 3300045836 Bacteria 2125
932 Ga0466958_0111387 3300045836 Bacteria 1709
933 Ga0466958_0172368 3300045836 Bacteria 1370
934 Ga0466967_0009414 3300045976 Bacteria 7245
935 Ga0466967_0027218 3300045976 Bacteria 4753
936 Ga0466967_0053667 3300045976 Bacteria 3544
937 Ga0466967_0080891 3300045976 Bacteria 2933
938 Ga0466967_0546302 3300045976 Bacteria 1140
939 Ga0495627_001457 3300046453 Bacteria 13875
940 Ga0495627_033005 3300046453 Bacteria 1625
941 Ga0495592_0000094 3300046454 Bacteria 78801
942 Ga0495592_0000481 3300046454 Bacteria 29134
943 Ga0495592_0008825 3300046454 Bacteria 7571
944 Ga0495592_0032917 3300046454 Bacteria 3910
945 Ga0495592_0086011 3300046454 Bacteria 2265
946 Ga0495592_0103099 3300046454 Bacteria 2030
947 Ga0495592_0110410 3300046454 Bacteria 1946
948 Ga0495592_0121173 3300046454 Bacteria 1840
949 Ga0495603_0001779 3300046455 Bacteria 12705
950 Ga0495603_0006149 3300046455 Bacteria 7176
951 Ga0495603_0012191 3300046455 Bacteria 5205
952 Ga0495603_0167868 3300046455 Bacteria 1271
953 Ga0495590_0000094 3300046457 Bacteria 54669
954 Ga0495590_0010180 3300046457 Bacteria 3543
955 Ga0495629_0002238 3300046459 Bacteria 14917
956 Ga0495629_0004014 3300046459 Bacteria 11058
957 Ga0495629_0005922 3300046459 Bacteria 9112
958 Ga0495629_0017611 3300046459 Bacteria 5121
959 Ga0495629_0079132 3300046459 Bacteria 2295
960 Ga0495638_0024022 3300046460 Bacteria 3979
961 Ga0495638_0183544 3300046460 Bacteria 1192
962 Ga0495641_0007164 3300046461 Bacteria 7040
963 Ga0495641_0014070 3300046461 Bacteria 4349
964 Ga0495641_0016263 3300046461 Bacteria 3926
965 Ga0495641_0040202 3300046461 Bacteria 2176
966 Ga0495651_0000041 3300046462 Bacteria 94160
967 Ga0495651_0002291 3300046462 Bacteria 14763
968 Ga0495651_0009757 3300046462 Bacteria 7383
969 Ga0495651_0013168 3300046462 Bacteria 6392
970 Ga0495651_0042337 3300046462 Bacteria 3536
971 Ga0495651_0042569 3300046462 Bacteria 3525
972 Ga0495651_0068071 3300046462 Bacteria 2714
973 Ga0495651_0073357 3300046462 Bacteria 2598
974 Ga0495651_0077794 3300046462 Bacteria 2510
975 Ga0495651_0081622 3300046462 Bacteria 2440
976 Ga0495651_0084716 3300046462 Bacteria 2388
977 Ga0495653_0002267 3300046463 Bacteria 15220
978 Ga0495653_0006276 3300046463 Bacteria 9755
979 Ga0495653_0007658 3300046463 Bacteria 8837
980 Ga0495653_0026502 3300046463 Bacteria 4646
981 Ga0495653_0039274 3300046463 Bacteria 3708
982 Ga0495653_0045800 3300046463 Bacteria 3389
983 Ga0495653_0137825 3300046463 Bacteria 1719
984 Ga0495650_0016212 3300046471 Bacteria 3783
985 Ga0495650_0060587 3300046471 Bacteria 1519
986 Ga0495580_0016321 3300046472 Bacteria 5577
987 Ga0495580_0023584 3300046472 Bacteria 4515
988 Ga0495580_0044397 3300046472 Bacteria 3161
989 Ga0495580_0078078 3300046472 Bacteria 2309
990 Ga0495582_0001614 3300046473 Bacteria 12697
991 Ga0495582_0015676 3300046473 Bacteria 4159
992 Ga0495582_0070053 3300046473 Bacteria 1939
993 Ga0495582_0120796 3300046473 Bacteria 1476
994 Ga0495605_0021869 3300046474 Bacteria 3382
995 Ga0495639_0001608 3300046475 Bacteria 10058
996 Ga0495639_0006034 3300046475 Bacteria 5205
997 Ga0495662_0000490 3300046476 Bacteria 18037
998 Ga0495662_0001269 3300046476 Bacteria 12479
999 Ga0495662_0006654 3300046476 Bacteria 5764
1000 Ga0495662_0015157 3300046476 Bacteria 3745
1001 Ga0495662_0017624 3300046476 Bacteria 3457
1002 Ga0495662_0022376 3300046476 Bacteria 3052
1003 Ga0495662_0098602 3300046476 Bacteria 1429
1004 Ga0495664_0000351 3300046477 Bacteria 22346
1005 Ga0495664_0002132 3300046477 Bacteria 10569
1006 Ga0495664_0012658 3300046477 Bacteria 4778
1007 Ga0495664_0013992 3300046477 Bacteria 4545
1008 Ga0495664_0014416 3300046477 Bacteria 4481
1009 Ga0495664_0023780 3300046477 Bacteria 3557
1010 Ga0495664_0045484 3300046477 Bacteria 2603
1011 Ga0495664_0095689 3300046477 Bacteria 1787
1012 Ga0495664_0121248 3300046477 Bacteria 1581
1013 Ga0495584_0011675 3300046491 Bacteria 4496
1014 Ga0495585_0002304 3300046492 Bacteria 13754
1015 Ga0495594_0008762 3300046499 Bacteria 5215
1016 Ga0495594_0025952 3300046499 Bacteria 3151
1017 Ga0495594_0044164 3300046499 Bacteria 2444
1018 Ga0495594_0117357 3300046499 Bacteria 1503
1019 Ga0495596_0024389 3300046500 Bacteria 2448
1020 Ga0495607_0129690 3300046501 Bacteria 1313
1021 Ga0495608_0000081 3300046511 Bacteria 69898
1022 Ga0495608_0005238 3300046511 Bacteria 9265
1023 Ga0495608_0005899 3300046511 Bacteria 8712
1024 Ga0495608_0009160 3300046511 Bacteria 6919
1025 Ga0495608_0012635 3300046511 Bacteria 5859
1026 Ga0495608_0015039 3300046511 Bacteria 5368
1027 Ga0495608_0022768 3300046511 Bacteria 4298
1028 Ga0495608_0038030 3300046511 Bacteria 3234
1029 Ga0495616_0008848 3300046513 Bacteria 5924
1030 Ga0495618_0007735 3300046514 Bacteria 6501
1031 Ga0495618_0016327 3300046514 Bacteria 4540
1032 Ga0495618_0087836 3300046514 Bacteria 1988
1033 Ga0495618_0108606 3300046514 Bacteria 1776
1034 Ga0495618_0126501 3300046514 Bacteria 1636
1035 Ga0495620_0020344 3300046515 Bacteria 3242
1036 Ga0495628_0000164 3300046516 Bacteria 57810
1037 Ga0495628_0017977 3300046516 Bacteria 5865
1038 Ga0495628_0027448 3300046516 Bacteria 4632
1039 Ga0495628_0038786 3300046516 Bacteria 3811
1040 Ga0495628_0067706 3300046516 Bacteria 2787
1041 Ga0495628_0069623 3300046516 Bacteria 2744
1042 Ga0495628_0112235 3300046516 Bacteria 2095
1043 Ga0495628_0112763 3300046516 Bacteria 2090
1044 Ga0495628_0134712 3300046516 Bacteria 1888
1045 Ga0495628_0138633 3300046516 Bacteria 1857
1046 Ga0495630_0026724 3300046517 Bacteria 4275
1047 Ga0495630_0049619 3300046517 Bacteria 3141
1048 Ga0495630_0118189 3300046517 Bacteria 2010
1049 Ga0495630_0172843 3300046517 Bacteria 1646
1050 Ga0495631_0004932 3300046518 Bacteria 7033
1051 Ga0495631_0025816 3300046518 Bacteria 2702
1052 Ga0495632_0085526 3300046519 Bacteria 1500
1053 Ga0495637_0051577 3300046520 Bacteria 1721
1054 Ga0495643_0001347 3300046522 Bacteria 23107
1055 Ga0495643_0056504 3300046522 Bacteria 2095
1056 Ga0495663_0025093 3300046525 Bacteria 1737
1057 Ga0495652_0000289 3300046529 Bacteria 59692
1058 Ga0495652_0020655 3300046529 Bacteria 5854
1059 Ga0495652_0026494 3300046529 Bacteria 5122
1060 Ga0495652_0069294 3300046529 Bacteria 2953
1061 Ga0495652_0080266 3300046529 Bacteria 2695
1062 Ga0495652_0102644 3300046529 Bacteria 2316
1063 Ga0495652_0122654 3300046529 Bacteria 2069
1064 Ga0495652_0162901 3300046529 Bacteria 1729
1065 Ga0495654_0023227 3300046530 Bacteria 3213
1066 Ga0495665_0001175 3300046531 Bacteria 13940
1067 Ga0495665_0002775 3300046531 Bacteria 9454
1068 Ga0495665_0003528 3300046531 Bacteria 8493
1069 Ga0495665_0026611 3300046531 Bacteria 3106
1070 Ga0495665_0101074 3300046531 Bacteria 1513
1071 Ga0495640_0013085 3300046533 Bacteria 6318
1072 Ga0495640_0022205 3300046533 Bacteria 4643
1073 Ga0495640_0026527 3300046533 Bacteria 4185
1074 Ga0495640_0040085 3300046533 Bacteria 3281
1075 Ga0495640_0045928 3300046533 Bacteria 3029
1076 Ga0495640_0050900 3300046533 Bacteria 2850
1077 Ga0495640_0125465 3300046533 Bacteria 1665
1078 Ga0495586_0005989 3300046535 Bacteria 6503
1079 Ga0495586_0017800 3300046535 Bacteria 3781
1080 Ga0495586_0035870 3300046535 Bacteria 2663
1081 Ga0495586_0040418 3300046535 Bacteria 2509
1082 Ga0495586_0070150 3300046535 Bacteria 1913
1083 Ga0495586_0081510 3300046535 Bacteria 1778
1084 Ga0495586_0114722 3300046535 Bacteria 1501
1085 Ga0495587_0000038 3300046536 Bacteria 116118
1086 Ga0495587_0002540 3300046536 Bacteria 12202
1087 Ga0495587_0003607 3300046536 Bacteria 10300
1088 Ga0495587_0004772 3300046536 Bacteria 8900
1089 Ga0495587_0006829 3300046536 Bacteria 7428
1090 Ga0495587_0011078 3300046536 Bacteria 5719
1091 Ga0495587_0042335 3300046536 Bacteria 2716
1092 Ga0495587_0259725 3300046536 Bacteria 976
1093 Ga0495609_0027336 3300046538 Bacteria 2608
1094 Ga0495609_0043122 3300046538 Bacteria 2025
1095 Ga0495597_0011805 3300046542 Bacteria 4229
1096 Ga0495645_0002826 3300046543 Bacteria 11777
1097 Ga0495645_0004680 3300046543 Bacteria 9340
1098 Ga0495645_0017922 3300046543 Bacteria 5081
1099 Ga0495645_0031690 3300046543 Bacteria 3852
1100 Ga0495645_0032889 3300046543 Bacteria 3783
1101 Ga0495645_0056280 3300046543 Bacteria 2855
1102 Ga0495645_0078459 3300046543 Bacteria 2373
1103 Ga0495645_0107550 3300046543 Bacteria 1977
1104 Ga0495645_0124372 3300046543 Bacteria 1813
1105 Ga0495645_0150757 3300046543 Bacteria 1615
1106 Ga0495645_0180555 3300046543 Bacteria 1446
1107 Ga0495622_0006569 3300046557 Bacteria 5392
1108 Ga0495667_0000070 3300046559 Bacteria 78776
1109 Ga0495667_0003737 3300046559 Bacteria 10240
1110 Ga0495667_0038072 3300046559 Bacteria 3203
1111 Ga0495667_0052664 3300046559 Bacteria 2680
1112 Ga0495667_0067051 3300046559 Bacteria 2345
1113 Ga0495667_0087278 3300046559 Bacteria 2023
1114 Ga0495667_0119304 3300046559 Bacteria 1703
1115 Ga0495667_0173174 3300046559 Bacteria 1386
1116 Ga0495634_0002454 3300046642 Bacteria 15402
1117 Ga0495634_0028577 3300046642 Bacteria 3869
1118 Ga0495634_0041285 3300046642 Bacteria 3134
1119 Ga0495634_0098856 3300046642 Bacteria 1887
1120 Ga0495611_0026253 3300046648 Bacteria 2540
1121 Ga0495625_0010712 3300046660 Bacteria 7549
1122 Ga0495635_0002501 3300046663 Bacteria 12559
1123 Ga0495635_0007697 3300046663 Bacteria 7515
1124 Ga0495635_0016282 3300046663 Bacteria 5191
1125 Ga0495635_0032208 3300046663 Bacteria 3637
1126 Ga0495635_0032458 3300046663 Bacteria 3622
1127 Ga0495635_0045447 3300046663 Bacteria 3030
1128 Ga0495635_0078795 3300046663 Bacteria 2255
1129 Ga0495659_0006157 3300046664 Bacteria 3792
1130 Ga0495588_0054453 3300046674 Bacteria 2064
1131 Ga0495588_0074525 3300046674 Bacteria 1767
1132 Ga0495657_0000192 3300046675 Bacteria 55017
1133 Ga0495657_0001801 3300046675 Bacteria 18344
1134 Ga0495657_0007863 3300046675 Bacteria 8184
1135 Ga0495657_0017701 3300046675 Bacteria 5169
1136 Ga0495657_0019259 3300046675 Bacteria 4926
1137 Ga0495657_0034064 3300046675 Bacteria 3540
1138 Ga0495657_0034170 3300046675 Bacteria 3533
1139 Ga0495657_0062590 3300046675 Bacteria 2457
1140 Ga0495657_0114737 3300046675 Bacteria 1702
1141 Ga0495657_0116754 3300046675 Bacteria 1684
1142 Ga0495599_0000100 3300046678 Bacteria 60814
1143 Ga0495599_0007362 3300046678 Bacteria 6671
1144 Ga0495599_0018592 3300046678 Bacteria 4329
1145 Ga0495599_0028460 3300046678 Bacteria 3503
1146 Ga0495599_0050021 3300046678 Bacteria 2619
1147 Ga0495623_0000409 3300046679 Bacteria 28354
1148 Ga0495623_0002698 3300046679 Bacteria 11725
1149 Ga0495623_0016055 3300046679 Bacteria 4839
1150 Ga0495623_0040737 3300046679 Bacteria 2965
1151 Ga0495623_0047715 3300046679 Bacteria 2718
1152 Ga0495623_0060152 3300046679 Bacteria 2384
1153 Ga0495623_0094606 3300046679 Bacteria 1827
1154 Ga0495646_0005300 3300046680 Bacteria 8141
1155 Ga0495646_0046110 3300046680 Bacteria 2659
1156 Ga0495646_0051293 3300046680 Bacteria 2497
1157 Ga0495647_0003185 3300046681 Bacteria 5254
1158 Ga0495647_0011635 3300046681 Bacteria 3017
1159 Ga0495658_0002514 3300046683 Bacteria 9224
1160 Ga0495658_0038925 3300046683 Bacteria 2635
1161 Ga0495658_0087508 3300046683 Bacteria 1840
1162 Ga0495613_0004118 3300046689 Bacteria 10875
1163 Ga0495613_0005121 3300046689 Bacteria 9835
1164 Ga0495613_0007805 3300046689 Bacteria 7963
1165 Ga0495613_0017497 3300046689 Bacteria 5336
1166 Ga0495613_0043432 3300046689 Bacteria 3325
1167 Ga0495613_0222982 3300046689 Bacteria 1323
1168 Ga0495624_0006182 3300046690 Bacteria 8513
1169 Ga0495624_0022253 3300046690 Bacteria 4194
1170 Ga0495624_0046417 3300046690 Bacteria 2761
1171 Ga0495624_0049837 3300046690 Bacteria 2654
1172 Ga0495624_0092011 3300046690 Bacteria 1870
1173 Ga0495670_0023417 3300046691 Bacteria 3048
1174 Ga0495670_0071207 3300046691 Bacteria 1760
1175 Ga0495671_0005333 3300046692 Bacteria 7543
1176 Ga0495589_0022703 3300046794 Bacteria 3200
1177 Ga0495600_0001188 3300046809 Bacteria 14237
1178 Ga0495600_0004237 3300046809 Bacteria 8567
1179 Ga0495600_0005804 3300046809 Bacteria 7460
1180 Ga0495600_0009346 3300046809 Bacteria 6054
1181 Ga0495600_0013174 3300046809 Bacteria 5188
1182 Ga0495600_0035019 3300046809 Bacteria 3260
1183 Ga0495600_0041537 3300046809 Bacteria 2997
1184 Ga0495600_0051307 3300046809 Bacteria 2693
1185 Ga0495600_0140257 3300046809 Bacteria 1568
1186 Ga0495600_0172600 3300046809 Bacteria 1395
1187 Ga0495660_0006238 3300046810 Bacteria 7074
1188 Ga0495581_0003354 3300047315 Bacteria 9191
1189 Ga0495581_0044659 3300047315 Bacteria 2562
1190 Ga0495581_0059541 3300047315 Bacteria 2207
1191 Ga0495581_0076501 3300047315 Bacteria 1936
1192 Ga0495581_0110107 3300047315 Bacteria 1601
1193 Ga0495581_0112287 3300047315 Bacteria 1585
1194 Ga0495604_0000061 3300047317 Bacteria 94158
1195 Ga0495604_0002802 3300047317 Bacteria 13991
1196 Ga0495604_0026075 3300047317 Bacteria 4654
1197 Ga0495604_0033094 3300047317 Bacteria 4093
1198 Ga0495604_0033445 3300047317 Bacteria 4070
1199 Ga0495604_0050839 3300047317 Bacteria 3216
1200 Ga0495604_0141761 3300047317 Bacteria 1716
1201 Ga0495604_0223403 3300047317 Bacteria 1295
1202 Ga0495636_0002194 3300047318 Bacteria 7493
1203 Ga0495636_0032486 3300047318 Bacteria 2141
1204 Ga0495674_0019179 3300047319 Bacteria 6353
1205 Ga0495674_0027638 3300047319 Bacteria 5182
1206 Ga0495674_0037963 3300047319 Bacteria 4327
1207 Ga0495674_0048001 3300047319 Bacteria 3781
1208 Ga0495674_0070377 3300047319 Bacteria 3023
1209 Ga0495674_0083559 3300047319 Bacteria 2736
1210 Ga0495674_0148901 3300047319 Bacteria 1963
1211 Ga0495674_0278225 3300047319 Bacteria 1372
1212 Ga0495672_0015842 3300047320 Bacteria 5103
1213 Ga0495676_0024813 3300047321 Bacteria 5181
1214 Ga0495676_0028997 3300047321 Bacteria 4718
1215 Ga0495676_0035758 3300047321 Bacteria 4152
1216 Ga0495676_0071092 3300047321 Bacteria 2676
1217 Ga0495676_0116781 3300047321 Bacteria 1947
1218 Ga0495680_0000099 3300047322 Bacteria 78801
1219 Ga0495680_0005688 3300047322 Bacteria 11668
1220 Ga0495680_0005926 3300047322 Bacteria 11419
1221 Ga0495680_0011978 3300047322 Bacteria 7654
1222 Ga0495680_0011998 3300047322 Bacteria 7646
1223 Ga0495680_0017923 3300047322 Bacteria 6025
1224 Ga0495680_0023854 3300047322 Bacteria 5083
1225 Ga0495680_0029389 3300047322 Bacteria 4500
1226 Ga0495680_0030570 3300047322 Bacteria 4396
1227 Ga0495680_0069758 3300047322 Bacteria 2680
1228 Ga0495680_0170421 3300047322 Bacteria 1576
1229 Ga0495680_0173768 3300047322 Bacteria 1559
1230 Ga0495687_002575 3300047443 Bacteria 14296
1231 Ga0495687_026770 3300047443 Bacteria 2709
1232 Ga0495675_0005606 3300047444 Bacteria 7664
1233 Ga0495675_0014263 3300047444 Bacteria 5023
1234 Ga0495675_0017765 3300047444 Bacteria 4510
1235 Ga0495675_0018969 3300047444 Bacteria 4368
1236 Ga0495675_0019565 3300047444 Bacteria 4301
1237 Ga0495675_0020983 3300047444 Bacteria 4159
1238 Ga0495675_0052338 3300047444 Bacteria 2592
1239 Ga0495675_0101922 3300047444 Bacteria 1796
1240 Ga0495685_000277 3300047447 Bacteria 17201
1241 Ga0495673_0084402 3300047469 Bacteria 1309
1242 Ga0495681_0000289 3300047470 Bacteria 40161
1243 Ga0495681_0077508 3300047470 Bacteria 1491
1244 Ga0495684_0002552 3300047471 Bacteria 14487
1245 Ga0495684_0002952 3300047471 Bacteria 13389
1246 Ga0495684_0013883 3300047471 Bacteria 6195
1247 Ga0495684_0016318 3300047471 Bacteria 5718
1248 Ga0495684_0027440 3300047471 Bacteria 4371
1249 Ga0495684_0039709 3300047471 Bacteria 3608
1250 Ga0495684_0089962 3300047471 Bacteria 2325
1251 Ga0495684_0128301 3300047471 Bacteria 1906
1252 Ga0495684_0154148 3300047471 Bacteria 1716
1253 Ga0495684_0193289 3300047471 Bacteria 1503
1254 Ga0495684_0221305 3300047471 Bacteria 1388
1255 Ga0495593_0001682 3300047673 Bacteria 13119
1256 Ga0495593_0007995 3300047673 Bacteria 6157
1257 Ga0495593_0016042 3300047673 Bacteria 4228
1258 Ga0495593_0031017 3300047673 Bacteria 2922
1259 Ga0495602_0000649 3300048088 Bacteria 32571
1260 Ga0495602_0021967 3300048088 Bacteria 6258
1261 Ga0495602_0022801 3300048088 Bacteria 6120
1262 Ga0495602_0046525 3300048088 Bacteria 3918
1263 Ga0495602_0077403 3300048088 Bacteria 2814
1264 Ga0495602_0108079 3300048088 Bacteria 2265
1265 Ga0495602_0177044 3300048088 Bacteria 1649
1266 Ga0495602_0207241 3300048088 Bacteria 1491
1267 Ga0495614_0000245 3300048089 Bacteria 21228
1268 Ga0495626_0004415 3300048091 Bacteria 8647
1269 Ga0496100_0007737 3300048903 Bacteria 5951
1270 Ga0496100_0016444 3300048903 Bacteria 4345
1271 Ga0496100_0029003 3300048903 Bacteria 3418
1272 Ga0496100_0037110 3300048903 Bacteria 3078
1273 Ga0496100_0097033 3300048903 Bacteria 2023
1274 Ga0496101_0007337 3300048904 Bacteria 7137
1275 Ga0496101_0028405 3300048904 Bacteria 3904
1276 Ga0496101_0050988 3300048904 Bacteria 2980
1277 Ga0496101_0103857 3300048904 Bacteria 2130
1278 Ga0496101_0158675 3300048904 Bacteria 1734
1279 Ga0496101_0174961 3300048904 Bacteria 1650
1280 Ga0496101_0278620 3300048904 Bacteria 1307
1281 Ga0496101_0286128 3300048904 Bacteria 1289
1282 Ga0496102_0000236 3300048905 Bacteria 72601
1283 Ga0496102_0006337 3300048905 Bacteria 10088
1284 Ga0496102_0012264 3300048905 Bacteria 7412
1285 Ga0496102_0013702 3300048905 Bacteria 7029
1286 Ga0496102_0046015 3300048905 Bacteria 3962
1287 Ga0496102_0058240 3300048905 Bacteria 3530
1288 Ga0496102_0128630 3300048905 Bacteria 2369
1289 Ga0496102_0357919 3300048905 Bacteria 1374
1290 Ga0496102_0375764 3300048905 Bacteria 1337
1291 Ga0496103_0000185 3300048906 Bacteria 62838
1292 Ga0496103_0008811 3300048906 Bacteria 5984
1293 Ga0496103_0018888 3300048906 Bacteria 4139
1294 Ga0496103_0033020 3300048906 Bacteria 3161
1295 Ga0496103_0042282 3300048906 Bacteria 2803
1296 Ga0496103_0070949 3300048906 Bacteria 2179
1297 Ga0496103_0118362 3300048906 Bacteria 1686
1298 Ga0496104_0000836 3300048907 Bacteria 26568
1299 Ga0496104_0004654 3300048907 Bacteria 11937
1300 Ga0496104_0006197 3300048907 Bacteria 10503
1301 Ga0496104_0006329 3300048907 Bacteria 10415
1302 Ga0496104_0021598 3300048907 Bacteria 5911
1303 Ga0496104_0095950 3300048907 Bacteria 2837
1304 Ga0496104_0315250 3300048907 Bacteria 1477
1305 Ga0496104_0349905 3300048907 Bacteria 1390
1306 Ga0496105_0001152 3300048908 Bacteria 18424
1307 Ga0496105_0006003 3300048908 Bacteria 9277
1308 Ga0496105_0009146 3300048908 Bacteria 7731
1309 Ga0496105_0025178 3300048908 Bacteria 4840
1310 Ga0496105_0039651 3300048908 Bacteria 3883
1311 Ga0496105_0041449 3300048908 Bacteria 3795
1312 Ga0496105_0061154 3300048908 Bacteria 3107
1313 Ga0496105_0094807 3300048908 Bacteria 2465
1314 Ga0496105_0142604 3300048908 Bacteria 1971
1315 Ga0496105_0147804 3300048908 Bacteria 1932
1316 Ga0496105_0163629 3300048908 Bacteria 1826
1317 Ga0496105_0203627 3300048908 Bacteria 1615
1318 Ga0496105_0262892 3300048908 Bacteria 1395
1319 Ga0496106_0004056 3300048909 Bacteria 10928
1320 Ga0496106_0050284 3300048909 Bacteria 3141
1321 Ga0496106_0213560 3300048909 Bacteria 1537
1322 Ga0496107_0010945 3300048910 Bacteria 6311
1323 Ga0496107_0039784 3300048910 Bacteria 3373
1324 Ga0496107_0076637 3300048910 Bacteria 2435
1325 Ga0496107_0142423 3300048910 Bacteria 1772
1326 Ga0496108_0002269 3300048911 Bacteria 15405
1327 Ga0496108_0006606 3300048911 Bacteria 9405
1328 Ga0496108_0020362 3300048911 Bacteria 5452
1329 Ga0496108_0071227 3300048911 Bacteria 2933
1330 Ga0496108_0086847 3300048911 Bacteria 2656
1331 Ga0496108_0099231 3300048911 Bacteria 2482
1332 Ga0496108_0141913 3300048911 Bacteria 2070
1333 Ga0496108_0311417 3300048911 Bacteria 1372
1334 Ga0496108_0332564 3300048911 Bacteria 1325
1335 Ga0496109_0001771 3300048912 Bacteria 17933
1336 Ga0496109_0043541 3300048912 Bacteria 4069
1337 Ga0496109_0093261 3300048912 Bacteria 2786
1338 Ga0496109_0109774 3300048912 Bacteria 2564
1339 Ga0496109_0189008 3300048912 Bacteria 1935
1340 Ga0496109_0278913 3300048912 Bacteria 1575
1341 Ga0496110_0000402 3300048913 Bacteria 29301
1342 Ga0496110_0040056 3300048913 Bacteria 4082
1343 Ga0496110_0064159 3300048913 Bacteria 3245
1344 Ga0496110_0067588 3300048913 Bacteria 3162
1345 Ga0496110_0110730 3300048913 Bacteria 2467
1346 Ga0496110_0139127 3300048913 Bacteria 2195
1347 Ga0496110_0171369 3300048913 Bacteria 1969
1348 Ga0496110_0180304 3300048913 Bacteria 1918
1349 Ga0496110_0237305 3300048913 Bacteria 1659
1350 Ga0496110_0263563 3300048913 Bacteria 1568
1351 Ga0496111_0008549 3300048914 Bacteria 6782
1352 Ga0496111_0192563 3300048914 Bacteria 1516
1353 Ga0496111_0209079 3300048914 Bacteria 1449
1354 Ga0496112_0003674 3300048915 Bacteria 12790
1355 Ga0496112_0004882 3300048915 Bacteria 11467
1356 Ga0496112_0057931 3300048915 Bacteria 3814
1357 Ga0496112_0100835 3300048915 Bacteria 2857
1358 Ga0496112_0166035 3300048915 Bacteria 2173
1359 Ga0496112_0256377 3300048915 Bacteria 1699
1360 Ga0496112_0412491 3300048915 Bacteria 1290
1361 Ga0496113_0015524 3300048916 Bacteria 5238
1362 Ga0496113_0017024 3300048916 Bacteria 5036
1363 Ga0496113_0029029 3300048916 Bacteria 3988
1364 Ga0496113_0048554 3300048916 Bacteria 3158
1365 Ga0496113_0071819 3300048916 Bacteria 2633
1366 Ga0496113_0074984 3300048916 Bacteria 2580
1367 Ga0496113_0469384 3300048916 Bacteria 1011
1368 Ga0496114_0003907 3300048917 Bacteria 11495
1369 Ga0496114_0010520 3300048917 Bacteria 7362
1370 Ga0496114_0021323 3300048917 Bacteria 5270
1371 Ga0496114_0028070 3300048917 Bacteria 4615
1372 Ga0496114_0028689 3300048917 Bacteria 4568
1373 Ga0496114_0081784 3300048917 Bacteria 2729
1374 Ga0496114_0106929 3300048917 Bacteria 2394
1375 Ga0496114_0129495 3300048917 Bacteria 2178
1376 Ga0496114_0130696 3300048917 Bacteria 2168
1377 Ga0496114_0167237 3300048917 Bacteria 1915
1378 Ga0496114_0176625 3300048917 Bacteria 1863
1379 Ga0496114_0242881 3300048917 Bacteria 1584
1380 Ga0496115_0004890 3300048918 Bacteria 9727
1381 Ga0496115_0006411 3300048918 Bacteria 8621
1382 Ga0496115_0006671 3300048918 Bacteria 8470
1383 Ga0496115_0012610 3300048918 Bacteria 6366
1384 Ga0496115_0030355 3300048918 Bacteria 4251
1385 Ga0496115_0049791 3300048918 Bacteria 3354
1386 Ga0496115_0081938 3300048918 Bacteria 2628
1387 Ga0496115_0133557 3300048918 Bacteria 2046
1388 Ga0496116_0000340 3300048919 Bacteria 74829
1389 Ga0496117_0000387 3300048920 Bacteria 75589
1390 Ga0496117_0000738 3300048920 Bacteria 51389
1391 Ga0496117_0000791 3300048920 Bacteria 49611
1392 Ga0496117_0000986 3300048920 Bacteria 43574
1393 Ga0496117_0001718 3300048920 Bacteria 30310
1394 Ga0496117_0012087 3300048920 Bacteria 7661
1395 Ga0496117_0012943 3300048920 Bacteria 7310
1396 Ga0496117_0023293 3300048920 Bacteria 4941
1397 Ga0496117_0041758 3300048920 Bacteria 3355
1398 Ga0496118_0000096 3300048921 Bacteria 163988
1399 Ga0496118_0000610 3300048921 Bacteria 58893
1400 Ga0496118_0002673 3300048921 Bacteria 23562
1401 Ga0496118_0006467 3300048921 Bacteria 12869
1402 Ga0496118_0009795 3300048921 Bacteria 9604
1403 Ga0496118_0016454 3300048921 Bacteria 6784
1404 Ga0496118_0033164 3300048921 Bacteria 4242
1405 Ga0496118_0042203 3300048921 Bacteria 3601
1406 Ga0496118_0091107 3300048921 Bacteria 2098
1407 Ga0496118_0115595 3300048921 Bacteria 1765
1408 Ga0496119_0000340 3300048922 Bacteria 65290
1409 Ga0496119_0000437 3300048922 Bacteria 57106
1410 Ga0496119_0001355 3300048922 Bacteria 29948
1411 Ga0496119_0002632 3300048922 Bacteria 19477
1412 Ga0496119_0004459 3300048922 Bacteria 13932
1413 Ga0496119_0005146 3300048922 Bacteria 12660
1414 Ga0496119_0009558 3300048922 Bacteria 8295
1415 Ga0496119_0018646 3300048922 Bacteria 5152
1416 Ga0496119_0041849 3300048922 Bacteria 2912
1417 Ga0496119_0061246 3300048922 Bacteria 2249
1418 Ga0496119_0063300 3300048922 Bacteria 2201
1419 Ga0496119_0065003 3300048922 Bacteria 2163
1420 Ga0496119_0123262 3300048922 Bacteria 1421
1421 Ga0496120_0001932 3300048923 Bacteria 22779
1422 Ga0496120_0005677 3300048923 Bacteria 9856
1423 Ga0496120_0006725 3300048923 Bacteria 8743
1424 Ga0496120_0006917 3300048923 Bacteria 8556
1425 Ga0496120_0022515 3300048923 Bacteria 3962
1426 Ga0496120_0023496 3300048923 Bacteria 3859
1427 Ga0496120_0031483 3300048923 Bacteria 3211
1428 Ga0496120_0039950 3300048923 Bacteria 2762
1429 Ga0496121_0000015 3300048924 Bacteria 571958
1430 Ga0496121_0080853 3300048924 Bacteria 2574
1431 Ga0496121_0169373 3300048924 Bacteria 1588
1432 Ga0496121_0219052 3300048924 Bacteria 1342
1433 Ga0496122_0000020 3300048925 Bacteria 401675
1434 Ga0496122_0001218 3300048925 Bacteria 43657
1435 Ga0496122_0005902 3300048925 Bacteria 14341
1436 Ga0496122_0005965 3300048925 Bacteria 14259
1437 Ga0496122_0009445 3300048925 Bacteria 10275
1438 Ga0496122_0011256 3300048925 Bacteria 9090
1439 Ga0496122_0062094 3300048925 Bacteria 2737
1440 Ga0496122_0070148 3300048925 Bacteria 2506
1441 Ga0496122_0086360 3300048925 Bacteria 2160
1442 Ga0496123_0000003 3300048926 Bacteria 866556
1443 Ga0496123_0000009 3300048926 Bacteria 509486
1444 Ga0496123_0000922 3300048926 Bacteria 46092
1445 Ga0496123_0003978 3300048926 Bacteria 16006
1446 Ga0496123_0028382 3300048926 Bacteria 4144
1447 Ga0496123_0039255 3300048926 Bacteria 3314
1448 Ga0496123_0078797 3300048926 Bacteria 2016
1449 Ga0496124_0000135 3300048927 Bacteria 152458
1450 Ga0496124_0002352 3300048927 Bacteria 24959
1451 Ga0496124_0002908 3300048927 Bacteria 21592
1452 Ga0496124_0005711 3300048927 Bacteria 13865
1453 Ga0496124_0039133 3300048927 Bacteria 4113
1454 Ga0496124_0078730 3300048927 Bacteria 2716
1455 Ga0496124_0105592 3300048927 Bacteria 2275
1456 Ga0496125_0000086 3300048928 Bacteria 216489
1457 Ga0496125_0000209 3300048928 Bacteria 122267
1458 Ga0496125_0001608 3300048928 Bacteria 31895
1459 Ga0496125_0005451 3300048928 Bacteria 14135
1460 Ga0496125_0006238 3300048928 Bacteria 12963
1461 Ga0496125_0012012 3300048928 Bacteria 8623
1462 Ga0496125_0036438 3300048928 Bacteria 4295
1463 Ga0496125_0040583 3300048928 Bacteria 3990
1464 Ga0496125_0080753 3300048928 Bacteria 2487
1465 Ga0496126_0000547 3300048929 Bacteria 72557
1466 Ga0496126_0002060 3300048929 Bacteria 28225
1467 Ga0496126_0007345 3300048929 Bacteria 12101
1468 Ga0496126_0030861 3300048929 Bacteria 5073
1469 Ga0496126_0038893 3300048929 Bacteria 4421
1470 Ga0496126_0053780 3300048929 Bacteria 3651
1471 Ga0496126_0069828 3300048929 Bacteria 3132
1472 Ga0496126_0083544 3300048929 Bacteria 2818
1473 Ga0496126_0118501 3300048929 Bacteria 2298
1474 Ga0496126_0281447 3300048929 Bacteria 1378
1475 Ga0501318_003946 3300049534 Bacteria 1395
1476 Ga0501321_002166 3300049537 Bacteria 1668
1477 Ga0501031_0002231 3300049568 Bacteria 12253
1478 Ga0501031_0005538 3300049568 Bacteria 8221
1479 Ga0501031_0006771 3300049568 Bacteria 7477
1480 Ga0501031_0008520 3300049568 Bacteria 6673
1481 Ga0501031_0028733 3300049568 Bacteria 3625
1482 Ga0501032_0001733 3300049569 Bacteria 17251
1483 Ga0501032_0006740 3300049569 Bacteria 8430
1484 Ga0501032_0007901 3300049569 Bacteria 7744
1485 Ga0501032_0010914 3300049569 Bacteria 6530
1486 Ga0501032_0012689 3300049569 Bacteria 6007
1487 Ga0501032_0015179 3300049569 Bacteria 5439
1488 Ga0501032_0017903 3300049569 Bacteria 4971
1489 Ga0501032_0020302 3300049569 Bacteria 4629
1490 Ga0501032_0038963 3300049569 Bacteria 3234
1491 Ga0501032_0043425 3300049569 Bacteria 3045
1492 Ga0501032_0057119 3300049569 Bacteria 2622
1493 Ga0501032_0123968 3300049569 Bacteria 1707
1494 Ga0501032_0143916 3300049569 Bacteria 1569
1495 Ga0501033_0001533 3300049570 Bacteria 20408
1496 Ga0501033_0006784 3300049570 Bacteria 8937
1497 Ga0501033_0016453 3300049570 Bacteria 5602
1498 Ga0501033_0037448 3300049570 Bacteria 3630
1499 Ga0501033_0047280 3300049570 Bacteria 3199
1500 Ga0501033_0075075 3300049570 Bacteria 2481
1501 Ga0501033_0099379 3300049570 Bacteria 2125
1502 Ga0501033_0163489 3300049570 Bacteria 1601
1503 Ga0501034_0000079 3300049571 Bacteria 171105
1504 Ga0501034_0000910 3300049571 Bacteria 43164
1505 Ga0501034_0004451 3300049571 Bacteria 15576
1506 Ga0501034_0004610 3300049571 Bacteria 15275
1507 Ga0501034_0005584 3300049571 Bacteria 13698
1508 Ga0501034_0007328 3300049571 Bacteria 11752
1509 Ga0501034_0016939 3300049571 Bacteria 7472
1510 Ga0501034_0022103 3300049571 Bacteria 6479
1511 Ga0501034_0024475 3300049571 Bacteria 6142
1512 Ga0501034_0032998 3300049571 Bacteria 5257
1513 Ga0501034_0060038 3300049571 Bacteria 3820
1514 Ga0501034_0062895 3300049571 Bacteria 3726
1515 Ga0501034_0069979 3300049571 Bacteria 3520
1516 Ga0501034_0095490 3300049571 Bacteria 2969
1517 Ga0501034_0130331 3300049571 Bacteria 2498
1518 Ga0501034_0172223 3300049571 Bacteria 2131
1519 Ga0501034_0174071 3300049571 Bacteria 2119
1520 Ga0501034_0278830 3300049571 Bacteria 1611
1521 Ga0501036_0002124 3300049572 Bacteria 15470
1522 Ga0501036_0003126 3300049572 Bacteria 13212
1523 Ga0501036_0010468 3300049572 Bacteria 7662
1524 Ga0501036_0026255 3300049572 Bacteria 4914
1525 Ga0501036_0061367 3300049572 Bacteria 3184
1526 Ga0501036_0065461 3300049572 Bacteria 3076
1527 Ga0501036_0070904 3300049572 Bacteria 2947
1528 Ga0501036_0082954 3300049572 Bacteria 2709
1529 Ga0501036_0084430 3300049572 Bacteria 2684
1530 Ga0501036_0304735 3300049572 Bacteria 1332
1531 Ga0501037_0003940 3300049573 Bacteria 10766
1532 Ga0501037_0005417 3300049573 Bacteria 9292
1533 Ga0501037_0005558 3300049573 Bacteria 9194
1534 Ga0501037_0012804 3300049573 Bacteria 6181
1535 Ga0501037_0013780 3300049573 Bacteria 5958
1536 Ga0501037_0018305 3300049573 Bacteria 5161
1537 Ga0501037_0019639 3300049573 Bacteria 4985
1538 Ga0501037_0056598 3300049573 Bacteria 2863
1539 Ga0501037_0073269 3300049573 Bacteria 2490
1540 Ga0501037_0088732 3300049573 Bacteria 2238
1541 Ga0501037_0119303 3300049573 Bacteria 1897
1542 Ga0501037_0170277 3300049573 Bacteria 1548
1543 Ga0501038_0002793 3300049574 Bacteria 16244
1544 Ga0501038_0009522 3300049574 Bacteria 8913
1545 Ga0501038_0014812 3300049574 Bacteria 7101
1546 Ga0501038_0019259 3300049574 Bacteria 6156
1547 Ga0501038_0019392 3300049574 Bacteria 6132
1548 Ga0501038_0035681 3300049574 Bacteria 4365
1549 Ga0501038_0036093 3300049574 Bacteria 4338
1550 Ga0501038_0038913 3300049574 Bacteria 4162
1551 Ga0501038_0061045 3300049574 Bacteria 3224
1552 Ga0501038_0073378 3300049574 Bacteria 2898
1553 Ga0501038_0075649 3300049574 Bacteria 2846
1554 Ga0501038_0079053 3300049574 Bacteria 2774
1555 Ga0501038_0125533 3300049574 Bacteria 2112
1556 Ga0501039_0001345 3300049575 Bacteria 17992
1557 Ga0501039_0012049 3300049575 Bacteria 6590
1558 Ga0501039_0014554 3300049575 Bacteria 6024
1559 Ga0501039_0134070 3300049575 Bacteria 1944
1560 Ga0501040_0006755 3300049576 Bacteria 7445
1561 Ga0501040_0019206 3300049576 Bacteria 4545
1562 Ga0501041_0000510 3300049577 Bacteria 19990
1563 Ga0501042_0002946 3300049578 Bacteria 10571
1564 Ga0501042_0005797 3300049578 Bacteria 7975
1565 Ga0501042_0006620 3300049578 Bacteria 7540
1566 Ga0501042_0044551 3300049578 Bacteria 3161
1567 Ga0501042_0144041 3300049578 Bacteria 1718
1568 Ga0501043_0002325 3300049579 Bacteria 16099
1569 Ga0501043_0003130 3300049579 Bacteria 13723
1570 Ga0501043_0008228 3300049579 Bacteria 8219
1571 Ga0501043_0008953 3300049579 Bacteria 7878
1572 Ga0501043_0010184 3300049579 Bacteria 7370
1573 Ga0501043_0010272 3300049579 Bacteria 7336
1574 Ga0501043_0015132 3300049579 Bacteria 6036
1575 Ga0501043_0043814 3300049579 Bacteria 3517
1576 Ga0501043_0091786 3300049579 Bacteria 2388
1577 Ga0501043_0119796 3300049579 Bacteria 2064
1578 Ga0501043_0157809 3300049579 Bacteria 1774
1579 Ga0501043_0160239 3300049579 Bacteria 1758
1580 Ga0501046_0004180 3300049580 Bacteria 13143
1581 Ga0501046_0007136 3300049580 Bacteria 9828
1582 Ga0501046_0009635 3300049580 Bacteria 8328
1583 Ga0501046_0016221 3300049580 Bacteria 6244
1584 Ga0501046_0121181 3300049580 Bacteria 1990
1585 Ga0501047_0000005 3300049581 Bacteria 456524
1586 Ga0501047_0003756 3300049581 Bacteria 14301
1587 Ga0501047_0010901 3300049581 Bacteria 8596
1588 Ga0501047_0018642 3300049581 Bacteria 6655
1589 Ga0501047_0021174 3300049581 Bacteria 6244
1590 Ga0501047_0023128 3300049581 Bacteria 5966
1591 Ga0501047_0032440 3300049581 Bacteria 5041
1592 Ga0501047_0050684 3300049581 Bacteria 4009
1593 Ga0501047_0051285 3300049581 Bacteria 3986
1594 Ga0501047_0082245 3300049581 Bacteria 3095
1595 Ga0501047_0239018 3300049581 Bacteria 1667
1596 Ga0501047_0371310 3300049581 Bacteria 1265
1597 Ga0501048_0001322 3300049582 Bacteria 18775
1598 Ga0501048_0004371 3300049582 Bacteria 10759
1599 Ga0501048_0008906 3300049582 Bacteria 7555
1600 Ga0501048_0010033 3300049582 Bacteria 7086
1601 Ga0501048_0101153 3300049582 Bacteria 2033
1602 Ga0501048_0188471 3300049582 Bacteria 1462
1603 Ga0501048_0236991 3300049582 Bacteria 1295
1604 Ga0501067_0001107 3300049583 Bacteria 14551
1605 Ga0501067_0020188 3300049583 Bacteria 3686
1606 Ga0501067_0083786 3300049583 Bacteria 1769
1607 Ga0501068_0004355 3300049584 Bacteria 7696
1608 Ga0501068_0030431 3300049584 Bacteria 3202
1609 Ga0501068_0165979 3300049584 Bacteria 1393
1610 Ga0501069_0042811 3300049585 Bacteria 2506
1611 Ga0501070_0002352 3300049586 Bacteria 16602
1612 Ga0501070_0003420 3300049586 Bacteria 13767
1613 Ga0501070_0009355 3300049586 Bacteria 8287
1614 Ga0501070_0010098 3300049586 Bacteria 7990
1615 Ga0501070_0015896 3300049586 Bacteria 6326
1616 Ga0501070_0018990 3300049586 Bacteria 5765
1617 Ga0501070_0033611 3300049586 Bacteria 4292
1618 Ga0501070_0038905 3300049586 Bacteria 3969
1619 Ga0501070_0039125 3300049586 Bacteria 3956
1620 Ga0501070_0095003 3300049586 Bacteria 2467
1621 Ga0501070_0204631 3300049586 Bacteria 1621
1622 Ga0501070_0236002 3300049586 Bacteria 1498
1623 Ga0501071_0001275 3300049587 Bacteria 14303
1624 Ga0501071_0002509 3300049587 Bacteria 11169
1625 Ga0501071_0061566 3300049587 Bacteria 2718
1626 Ga0501072_0033937 3300049588 Bacteria 3998
1627 Ga0501072_0104825 3300049588 Bacteria 2248
1628 Ga0501073_0000030 3300049589 Bacteria 115949
1629 Ga0501073_0113310 3300049589 Bacteria 1881
1630 Ga0501074_0004495 3300049590 Bacteria 9984
1631 Ga0501074_0008723 3300049590 Bacteria 7349
1632 Ga0501074_0089288 3300049590 Bacteria 2207
1633 Ga0501075_0008628 3300049591 Bacteria 7105
1634 Ga0501076_0049185 3300049592 Bacteria 3333
1635 Ga0501076_0175451 3300049592 Bacteria 1747
1636 Ga0501077_0021191 3300049593 Bacteria 4113
1637 Ga0501077_0036848 3300049593 Bacteria 3116
1638 Ga0501079_0001632 3300049741 Bacteria 15976
1639 Ga0501079_0025872 3300049741 Bacteria 4501
1640 Ga0501080_0000023 3300049742 Bacteria 90345
1641 Ga0501080_0042141 3300049742 Bacteria 4252
1642 Ga0501080_0056997 3300049742 Bacteria 3638
1643 Ga0501080_0064971 3300049742 Bacteria 3394
1644 Ga0501080_0071502 3300049742 Bacteria 3227
1645 Ga0501080_0093219 3300049742 Bacteria 2797
1646 Ga0501080_0273742 3300049742 Bacteria 1536
1647 Ga0501081_0012816 3300049743 Bacteria 5513
1648 Ga0501083_0000059 3300049744 Bacteria 78374
1649 Ga0501083_0004256 3300049744 Bacteria 10074
1650 Ga0501083_0004565 3300049744 Bacteria 9779
1651 Ga0501083_0031451 3300049744 Bacteria 3643
1652 Ga0501083_0315342 3300049744 Bacteria 1017
1653 Ga0501279_006874 3300049775 Bacteria 1506
1654 Ga0501035_0002846 3300049822 Bacteria 16722
1655 Ga0501035_0006735 3300049822 Bacteria 10739
1656 Ga0501035_0007884 3300049822 Bacteria 9947
1657 Ga0501035_0008420 3300049822 Bacteria 9603
1658 Ga0501035_0013293 3300049822 Bacteria 7595
1659 Ga0501035_0015593 3300049822 Bacteria 7011
1660 Ga0501035_0017656 3300049822 Bacteria 6581
1661 Ga0501035_0017981 3300049822 Bacteria 6519
1662 Ga0501035_0024286 3300049822 Bacteria 5559
1663 Ga0501035_0029166 3300049822 Bacteria 5032
1664 Ga0501035_0031513 3300049822 Bacteria 4827
1665 Ga0501035_0050317 3300049822 Bacteria 3734
1666 Ga0501044_0003414 3300049823 Bacteria 17900
1667 Ga0501044_0010052 3300049823 Bacteria 10282
1668 Ga0501044_0012278 3300049823 Bacteria 9273
1669 Ga0501044_0013325 3300049823 Bacteria 8898
1670 Ga0501044_0015296 3300049823 Bacteria 8263
1671 Ga0501044_0015324 3300049823 Bacteria 8256
1672 Ga0501044_0033710 3300049823 Bacteria 5377
1673 Ga0501044_0088361 3300049823 Bacteria 3128
1674 Ga0501044_0104368 3300049823 Bacteria 2848
1675 Ga0501044_0167162 3300049823 Bacteria 2173
1676 Ga0501044_0175285 3300049823 Bacteria 2113
1677 Ga0501044_0230097 3300049823 Bacteria 1801
1678 Ga0501045_0047819 3300049824 Bacteria 3116
1679 Ga0501045_0100124 3300049824 Bacteria 2145
1680 nmdc:mga00v17_10676_c1 3300050491 Bacteria 5025
1681 nmdc:mga0yw44_109474_c1 3300050492 Bacteria 1769
1682 nmdc:mga0yw44_16446_c1 3300050492 Bacteria 3996
1683 nmdc:mga0yw44_7068_c1 3300050492 Bacteria 5494
1684 nmdc:mga06z11_29345_c1 3300050494 Bacteria 2649
1685 nmdc:mga05p37_408632_c1 3300050507 Bacteria 1583
1686 nmdc:mga05p37_9690_c1 3300050507 Bacteria 11418
1687 nmdc:mga05p37_9984_c1 3300050507 Bacteria 11274
1688 nmdc:mga09592_110175_c1 3300050508 Bacteria 2362
1689 nmdc:mga09592_97806_c1 3300050508 Bacteria 2512
1690 nmdc:mga0qj67_176290_c1 3300050509 Bacteria 1736
1691 nmdc:mga06r32_202_c5 3300050510 Bacteria 10484
1692 nmdc:mga08y16_116201_c1 3300050511 Bacteria 2785
1693 nmdc:mga08y16_14541_c1 3300050511 Bacteria 8278
1694 nmdc:mga08y16_24871_c1 3300050511 Bacteria 6317
1695 nmdc:mga08y16_47659_c1 3300050511 Bacteria 4485
1696 nmdc:mga0n895_12260_c1 3300050512 Bacteria 7684
1697 nmdc:mga0n895_27126_c1 3300050512 Bacteria 5438
1698 nmdc:mga0n895_313887_c1 3300050512 Bacteria 1589
1699 nmdc:mga0n895_64173_c1 3300050512 Bacteria 3633
1700 nmdc:mga0rr50_128236_c1 3300050513 Bacteria 2028
1701 nmdc:mga0rr50_3162_c1 3300050513 Bacteria 9412
1702 nmdc:mga0rr50_4142_c2 3300050513 Bacteria 4312
1703 nmdc:mga0rr50_95002_c1 3300050513 Bacteria 2329
1704 nmdc:mga08x19_33654_c1 3300050514 Bacteria 3235
1705 nmdc:mga08x19_34607_c1 3300050514 Bacteria 3194
1706 nmdc:mga0a205_3224_c1 3300050515 Bacteria 14510
1707 nmdc:mga0sz30_11075_c1 3300050516 Bacteria 3470
1708 Ga0495601_0013029 3300053077 Bacteria 4996
1709 Ga0495601_0015770 3300053077 Bacteria 4572
1710 Ga0495601_0030603 3300053077 Bacteria 3342
1711 Ga0495601_0032437 3300053077 Bacteria 3252
1712 Ga0495612_0001130 3300053078 Bacteria 10953
1713 Ga0495612_0010468 3300053078 Bacteria 3750
1714 Ga0495612_0010525 3300053078 Bacteria 3739
1715 Ga0495612_0024452 3300053078 Bacteria 2425
1716 Ga0495612_0045980 3300053078 Bacteria 1787
1717 Ga0495612_0060823 3300053078 Bacteria 1564
1718 Ga0500635_0000664 3300053080 Bacteria 8729
1719 Ga0495595_0001495 3300053084 Bacteria 9132
1720 Ga0495595_0020681 3300053084 Bacteria 2866
1721 Ga0495595_0036502 3300053084 Bacteria 2230
1722 Ga0495619_0010408 3300053085 Bacteria 5853
1723 Ga0495619_0021908 3300053085 Bacteria 4084
1724 Ga0495619_0083432 3300053085 Bacteria 2155
1725 Ga0495619_0132743 3300053085 Bacteria 1712
1726 Ga0500578_0014632 3300053086 Bacteria 5044
1727 Ga0500643_000191 3300053087 Bacteria 58540
1728 Ga0500583_0103117 3300053092 Bacteria 1399
1729 Ga0500651_0003063 3300053093 Bacteria 9045
1730 Ga0500640_001744 3300053095 Bacteria 6801
1731 Ga0500641_0056548 3300053096 Bacteria 1626
1732 Ga0500556_0000115 3300053104 Bacteria 69837
1733 Ga0500556_0000426 3300053104 Bacteria 30343
1734 Ga0500560_009842 3300053107 Bacteria 2367
1735 Ga0500560_012532 3300053107 Bacteria 2201
1736 Ga0500562_000183 3300053108 Bacteria 16987
1737 Ga0500593_001772 3300053117 Bacteria 7763
1738 Ga0500658_0004371 3300053134 Bacteria 5294
1739 Ga0500559_0000050 3300053136 Bacteria 93262
1740 Ga0500559_0000800 3300053136 Bacteria 20562
1741 Ga0500559_0042277 3300053136 Bacteria 1988
1742 Ga0500568_0000038 3300053139 Bacteria 134267
1743 Ga0500568_0000117 3300053139 Bacteria 71510
1744 Ga0500568_0001933 3300053139 Bacteria 12699
1745 Ga0500568_0007501 3300053139 Bacteria 5345
1746 Ga0500568_0013939 3300053139 Bacteria 3648
1747 Ga0500573_0000014 3300053140 Bacteria 193353
1748 Ga0500573_0006418 3300053140 Bacteria 6366
1749 Ga0500573_0013932 3300053140 Bacteria 4542
1750 Ga0500573_0014968 3300053140 Bacteria 4392
1751 Ga0500577_0004479 3300053142 Bacteria 3697
1752 Ga0500577_0016903 3300053142 Bacteria 2311
1753 Ga0500577_0020950 3300053142 Bacteria 2148
1754 Ga0500590_013523 3300053148 Bacteria 4191
1755 Ga0500616_0000027 3300053153 Bacteria 441053
1756 Ga0500616_0000117 3300053153 Bacteria 145655
1757 Ga0500616_0000620 3300053153 Bacteria 43119
1758 Ga0500616_0011539 3300053153 Bacteria 5210
1759 Ga0500616_0061798 3300053153 Bacteria 1937
1760 Ga0500620_000082 3300053155 Bacteria 18227
1761 Ga0500624_002275 3300053157 Bacteria 2632
1762 Ga0500634_0003371 3300053161 Bacteria 7073
1763 Ga0501084_0011942 3300054114 Bacteria 7191
1764 Ga0501084_0042709 3300054114 Bacteria 3792
1765 Ga0590075_003544 3300059424 Bacteria 3706
1766 Ga0587072_000110 3300059643 Bacteria 6592
1767 Ga0501082_0011737 3300060353 Bacteria 7531
1768 Ga0501082_0021746 3300060353 Bacteria 5530
1769 Ga0501082_0024215 3300060353 Bacteria 5235
1770 Ga0501082_0053825 3300060353 Bacteria 3469
1771 Ga0466962_0001145 3300061719 Bacteria 12247
1772 Ga0466962_0001217 3300061719 Bacteria 11836
1773 Ga0466962_0005385 3300061719 Bacteria 6156
1774 Ga0466962_0012085 3300061719 Bacteria 4152
1775 Ga0466962_0057982 3300061719 Bacteria 1849
1776 Ga0530510_0002078 3300061734 Bacteria 13753
1777 Ga0530510_0113870 3300061734 Bacteria 1982
1778 Ga0530510_0142274 3300061734 Bacteria 1768

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046536 Ga0495587_0259725 Ga0495587_0259725_20_961 297
2 3300044765 Ga0466970_0027254 Ga0466970_0027254_2044_2970 299
3 3300048911 Ga0496108_0332564 Ga0496108_0332564_16_942 299
4 3300046516 Ga0495628_0112235 Ga0495628_0112235_1143_2078 300
5 3300045976 Ga0466967_0546302 Ga0466967_0546302_40_1005 307
6 3300042015 Ga0439462_0057144 Ga0439462_0057144_27_989 310
7 3300045836 Ga0466958_0172368 Ga0466958_0172368_12_971 310
8 3300046462 Ga0495651_0081622 Ga0495651_0081622_15_977 310
9 3300046476 Ga0495662_0017624 Ga0495662_0017624_141_1106 310
10 3300046531 Ga0495665_0101074 Ga0495665_0101074_13_975 310
11 3300046536 Ga0495587_0042335 Ga0495587_0042335_1734_2705 310
12 3300048903 Ga0496100_0037110 Ga0496100_0037110_2097_3062 310
13 3300048916 Ga0496113_0469384 Ga0496113_0469384_38_997 310
14 3300049744 Ga0501083_0315342 Ga0501083_0315342_23_982 310
15 3300026067 Ga0207678_10250368 Ga0207678_102503682 318
16 3300041405 Ga0439438_052622 Ga0439438_052622_25_1017 321
17 3300005615 Ga0070702_100077702 Ga0070702_1000777022 325
18 3300009148 Ga0105243_10332041 Ga0105243_103320412 328
19 3300037418 Ga0395900_0407188 Ga0395900_0407188_182_1198 329
20 3300037466 Ga0395898_0057057 Ga0395898_0057057_2757_3773 329
21 3300038443 Ga0395901_0486909 Ga0395901_0486909_181_1197 329
22 3300045976 Ga0466967_0009414 Ga0466967_0009414_507_1697 329
23 3300048922 Ga0496119_0018646 Ga0496119_0018646_4083_5102 330
24 3300005343 Ga0070687_100056394 Ga0070687_1000563942 333
25 3300005616 Ga0068852_100063039 Ga0068852_1000630392 333
26 3300005617 Ga0068859_100106112 Ga0068859_1001061122 333
27 3300005718 Ga0068866_10129595 Ga0068866_101295952 333
28 3300005842 Ga0068858_100183277 Ga0068858_1001832772 333
29 3300006931 Ga0097620_100106127 Ga0097620_1001061271 333
30 3300025919 Ga0207657_10045521 Ga0207657_100455212 333
31 3300025937 Ga0207669_10131751 Ga0207669_101317512 333
32 3300006175 Ga0070712_100135383 Ga0070712_1001353832 334
33 3300049584 Ga0501068_0165979 Ga0501068_0165979_31_1164 334
34 3300061734 Ga0530510_0142274 Ga0530510_0142274_202_1344 335
35 3300044683 Ga0466965_0034551 Ga0466965_0034551_511_1662 336
36 3300009545 Ga0105237_10006728 Ga0105237_100067286 337
37 3300044683 Ga0466965_0000038 Ga0466965_0000038_39455_40576 342
38 3300049578 Ga0501042_0002946 Ga0501042_0002946_5582_6703 342
39 3300005327 Ga0070658_10043257 Ga0070658_100432573 343
40 3300005616 Ga0068852_100012452 Ga0068852_1000124526 343
41 3300005834 Ga0068851_10000022 Ga0068851_1000002283 343
42 3300009147 Ga0114129_10053520 Ga0114129_100535204 343
43 3300009177 Ga0105248_10173957 Ga0105248_101739572 343
44 3300009551 Ga0105238_10002053 Ga0105238_100020536 343
45 3300025321 Ga0207656_10000005 Ga0207656_10000005345 343
46 3300025914 Ga0207671_10000016 Ga0207671_10000016115 343
47 3300025924 Ga0207694_10000057 Ga0207694_1000005755 343
48 3300026067 Ga0207678_10007006 Ga0207678_100070062 343
49 3300026142 Ga0207698_10004794 Ga0207698_100047943 343
50 3300050507 nmdc:mga05p37_408632_c1 nmdc:mga05p37_408632_c1_403_1461 343
51 3300005577 Ga0068857_100050157 Ga0068857_1000501572 344
52 3300009098 Ga0105245_10013491 Ga0105245_100134915 344
53 3300010375 Ga0105239_10112904 Ga0105239_101129043 344
54 3300025927 Ga0207687_10013434 Ga0207687_100134342 344
55 3300026116 Ga0207674_10019331 Ga0207674_100193313 344
56 3300048921 Ga0496118_0042203 Ga0496118_0042203_1059_2183 344
57 3300048922 Ga0496119_0000437 Ga0496119_0000437_31700_32821 344
58 3300048923 Ga0496120_0023496 Ga0496120_0023496_183_1313 344
59 3300048923 Ga0496120_0039950 Ga0496120_0039950_337_1458 344
60 3300048929 Ga0496126_0069828 Ga0496126_0069828_130_1251 344
61 3300049571 Ga0501034_0174071 Ga0501034_0174071_471_1595 344
62 3300049581 Ga0501047_0051285 Ga0501047_0051285_1325_2449 344
63 3300049744 Ga0501083_0000059 Ga0501083_0000059_1178_2299 344
64 3300049823 Ga0501044_0015324 Ga0501044_0015324_1969_3093 344
65 3300005614 Ga0068856_100329509 Ga0068856_1003295092 345
66 3300009093 Ga0105240_10155493 Ga0105240_101554933 345
67 3300009174 Ga0105241_10004447 Ga0105241_100044478 345
68 3300013104 Ga0157370_10171889 Ga0157370_101718893 345
69 3300025254 Ga0209148_1004139 Ga0209148_10041393 345
70 3300025911 Ga0207654_10000001 Ga0207654_10000001898 345
71 3300031456 Ga0307513_10223828 Ga0307513_102238282 345
72 3300049586 Ga0501070_0009355 Ga0501070_0009355_4113_5222 345
73 3300049742 Ga0501080_0093219 Ga0501080_0093219_1104_2213 345
74 3300053139 Ga0500568_0000117 Ga0500568_0000117_28128_29249 345
75 3300014969 Ga0157376_10311140 Ga0157376_103111402 346
76 3300048904 Ga0496101_0278620 Ga0496101_0278620_55_1179 346
77 3300049585 Ga0501069_0042811 Ga0501069_0042811_999_2120 347
78 3300048929 Ga0496126_0053780 Ga0496126_0053780_119_1243 348
79 3300049570 Ga0501033_0099379 Ga0501033_0099379_684_1805 348
80 3300049581 Ga0501047_0003756 Ga0501047_0003756_12251_13372 348
81 3300049822 Ga0501035_0007884 Ga0501035_0007884_4766_5887 348
82 3300032137 Ga0316585_10008431 Ga0316585_100084312 349
83 3300036647 Ga0316582_0039405 Ga0316582_0039405_1305_2426 349
84 3300036712 Ga0316584_0030549 Ga0316584_0030549_1102_2223 349
85 3300041404 Ga0439436_0037014 Ga0439436_0037014_231_1355 349
86 3300044693 Ga0466961_0004359 Ga0466961_0004359_7687_8796 349
87 3300048921 Ga0496118_0033164 Ga0496118_0033164_928_2049 349
88 3300005328 Ga0070676_10045831 Ga0070676_100458311 350
89 3300005329 Ga0070683_100225127 Ga0070683_1002251272 350
90 3300005334 Ga0068869_100099715 Ga0068869_1000997152 350
91 3300005338 Ga0068868_100022267 Ga0068868_1000222674 350
92 3300005345 Ga0070692_10076527 Ga0070692_100765273 350
93 3300005441 Ga0070700_100018526 Ga0070700_1000185262 350
94 3300005548 Ga0070665_100178198 Ga0070665_1001781981 350
95 3300005577 Ga0068857_100204484 Ga0068857_1002044842 350
96 3300005614 Ga0068856_100115037 Ga0068856_1001150371 350
97 3300005615 Ga0070702_100046300 Ga0070702_1000463002 350
98 3300005618 Ga0068864_100037398 Ga0068864_1000373983 350
99 3300005719 Ga0068861_100173790 Ga0068861_1001737903 350
100 3300005840 Ga0068870_10092007 Ga0068870_100920072 350
101 3300005841 Ga0068863_100121426 Ga0068863_1001214262 350
102 3300005842 Ga0068858_100090777 Ga0068858_1000907771 350
103 3300009098 Ga0105245_10039281 Ga0105245_100392813 350
104 3300009176 Ga0105242_10251589 Ga0105242_102515891 350
105 3300024225 Ga0224572_1000254 Ga0224572_10002542 350
106 3300025908 Ga0207643_10132631 Ga0207643_101326312 350
107 3300025909 Ga0207705_10014811 Ga0207705_100148115 350
108 3300025924 Ga0207694_10100546 Ga0207694_101005463 350
109 3300025927 Ga0207687_10240039 Ga0207687_102400392 350
110 3300025928 Ga0207700_10162334 Ga0207700_101623342 350
111 3300025933 Ga0207706_10022853 Ga0207706_100228535 350
112 3300025941 Ga0207711_10098454 Ga0207711_100984542 350
113 3300026075 Ga0207708_10103770 Ga0207708_101037702 350
114 3300026089 Ga0207648_10062162 Ga0207648_100621621 350
115 3300026116 Ga0207674_10045712 Ga0207674_100457125 350
116 3300026118 Ga0207675_100110508 Ga0207675_1001105083 350
117 3300026121 Ga0207683_10143628 Ga0207683_101436282 350
118 3300037853 Ga0436364_0287407 Ga0436364_0287407_70087_71262 350
119 3300037853 Ga0436364_0964211 Ga0436364_0964211_30_1169 350
120 3300042015 Ga0439462_0041974 Ga0439462_0041974_87_1211 350
121 3300044765 Ga0466970_0044803 Ga0466970_0044803_933_2048 350
122 3300045836 Ga0466958_0111387 Ga0466958_0111387_319_1434 350
123 3300048908 Ga0496105_0163629 Ga0496105_0163629_632_1729 350
124 3300048912 Ga0496109_0109774 Ga0496109_0109774_724_1821 350
125 3300048914 Ga0496111_0192563 Ga0496111_0192563_40_1137 350
126 3300048921 Ga0496118_0009795 Ga0496118_0009795_8513_9592 350
127 3300050511 nmdc:mga08y16_116201_c1 nmdc:mga08y16_116201_c1_228_1325 350
128 3300005548 Ga0070665_100006265 Ga0070665_1000062655 351
129 3300005843 Ga0068860_100022448 Ga0068860_1000224483 351
130 3300025929 Ga0207664_10178465 Ga0207664_101784652 351
131 3300025931 Ga0207644_10011157 Ga0207644_100111574 351
132 3300028381 Ga0268264_10007965 Ga0268264_100079658 351
133 3300031852 Ga0307410_10149908 Ga0307410_101499082 351
134 3300048905 Ga0496102_0006337 Ga0496102_0006337_4288_5409 351
135 3300048906 Ga0496103_0042282 Ga0496103_0042282_1553_2674 351
136 3300048907 Ga0496104_0004654 Ga0496104_0004654_10011_11132 351
137 3300048908 Ga0496105_0025178 Ga0496105_0025178_3432_4553 351
138 3300048910 Ga0496107_0142423 Ga0496107_0142423_59_1180 351
139 3300048911 Ga0496108_0141913 Ga0496108_0141913_522_1628 351
140 3300048912 Ga0496109_0189008 Ga0496109_0189008_703_1824 351
141 3300048913 Ga0496110_0263563 Ga0496110_0263563_40_1161 351
142 3300048917 Ga0496114_0003907 Ga0496114_0003907_752_1873 351
143 3300048917 Ga0496114_0242881 Ga0496114_0242881_140_1246 351
144 3300031456 Ga0307513_10001197 Ga0307513_100011974 352
145 3300041451 Ga0451791_1067624 Ga0451791_1067624_1826_2932 352
146 3300041452 Ga0451793_0283208 Ga0451793_0283208_3694_4800 352
147 3300041453 Ga0451797_0921282 Ga0451797_0921282_1121_2227 352
148 3300041460 Ga0451802_0199680 Ga0451802_0199680_909_2015 352
149 3300041486 Ga0451807_0181894 Ga0451807_0181894_778_1884 352
150 3300041491 Ga0451833_1396629 Ga0451833_1396629_370_1476 352
151 3300041496 Ga0451839_1074799 Ga0451839_1074799_1372_2478 352
152 3300041512 Ga0451853_0509641 Ga0451853_0509641_133_1239 352
153 3300048911 Ga0496108_0071227 Ga0496108_0071227_1628_2749 352
154 3300048913 Ga0496110_0040056 Ga0496110_0040056_2672_3793 352
155 3300048915 Ga0496112_0412491 Ga0496112_0412491_109_1230 352
156 3300048917 Ga0496114_0021323 Ga0496114_0021323_1501_2622 352
157 3300053085 Ga0495619_0083432 Ga0495619_0083432_271_1383 352
158 3300021388 Ga0213875_10000250 Ga0213875_1000025017 353
159 3300035398 Ga0316574_0076927 Ga0316574_0076927_949_2070 353
160 3300037466 Ga0395898_0346841 Ga0395898_0346841_38_1159 353
161 3300048921 Ga0496118_0115595 Ga0496118_0115595_416_1534 353
162 3300005467 Ga0070706_100030981 Ga0070706_1000309812 354
163 3300025910 Ga0207684_10026141 Ga0207684_100261412 354
164 3300031665 Ga0316575_10003717 Ga0316575_100037172 354
165 3300031691 Ga0316579_10002190 Ga0316579_100021902 354
166 3300031727 Ga0316576_10002319 Ga0316576_100023194 354
167 3300031728 Ga0316578_10002782 Ga0316578_100027822 354
168 3300031852 Ga0307410_10250384 Ga0307410_102503841 354
169 3300032133 Ga0316583_10031886 Ga0316583_100318861 354
170 3300035398 Ga0316574_0015485 Ga0316574_0015485_2209_3330 354
171 3300036647 Ga0316582_0004467 Ga0316582_0004467_280_1401 354
172 3300036712 Ga0316584_0005041 Ga0316584_0005041_5583_6704 354
173 3300049569 Ga0501032_0012689 Ga0501032_0012689_1770_2894 354
174 3300049571 Ga0501034_0016939 Ga0501034_0016939_2625_3749 354
175 3300049574 Ga0501038_0009522 Ga0501038_0009522_4361_5485 354
176 3300049581 Ga0501047_0023128 Ga0501047_0023128_717_1841 354
177 3300049744 Ga0501083_0004565 Ga0501083_0004565_5267_6391 354
178 3300049822 Ga0501035_0006735 Ga0501035_0006735_6825_7949 354
179 3300060353 Ga0501082_0021746 Ga0501082_0021746_961_2085 354
180 3300009979 Ga0105032_100683 Ga0105032_1006833 355
181 3300009986 Ga0105033_101458 Ga0105033_1014582 355
182 3300031903 Ga0307407_10081179 Ga0307407_100811792 355
183 3300049583 Ga0501067_0083786 Ga0501067_0083786_455_1573 355
184 iso_pu_bacteria 2816332139 2816505500 355
185 iso_pu_bacteria 2915358134 2915359603 355
186 iso_pu_bacteria 8054472261 8054475838 355
187 3300013105 Ga0157369_10088646 Ga0157369_100886462 356
188 3300044693 Ga0466961_0004420 Ga0466961_0004420_647_1744 356
189 3300044719 Ga0466971_0001195 Ga0466971_0001195_8666_9763 356
190 3300045836 Ga0466958_0071467 Ga0466958_0071467_985_2082 356
191 3300049589 Ga0501073_0000030 Ga0501073_0000030_57918_59039 356
192 3300049742 Ga0501080_0071502 Ga0501080_0071502_196_1317 356
193 3300053104 Ga0500556_0000426 Ga0500556_0000426_13724_14845 356
194 3300053117 Ga0500593_001772 Ga0500593_001772_4927_6048 356
195 3300061719 Ga0466962_0005385 Ga0466962_0005385_3750_4847 356
196 iso_pu_bacteria 2767802112 2768643577 356
197 iso_pu_bacteria 2848551377 2848551703 356
198 iso_pu_bacteria 8056060235 8056063837 356
199 3300006058 Ga0075432_10000249 Ga0075432_100002493 357
200 3300006058 Ga0075432_10001177 Ga0075432_100011776 357
201 3300006847 Ga0075431_100005919 Ga0075431_1000059193 357
202 3300006852 Ga0075433_10000652 Ga0075433_1000065220 357
203 3300006852 Ga0075433_10001827 Ga0075433_1000182713 357
204 3300006871 Ga0075434_100000181 Ga0075434_1000001814 357
205 3300009094 Ga0111539_10000095 Ga0111539_1000009582 357
206 3300009176 Ga0105242_10010462 Ga0105242_100104623 357
207 3300025933 Ga0207706_10024565 Ga0207706_100245652 357
208 3300026118 Ga0207675_100047486 Ga0207675_1000474863 357
209 3300027907 Ga0207428_10000102 Ga0207428_1000010284 357
210 3300027907 Ga0207428_10002614 Ga0207428_100026143 357
211 3300048928 Ga0496125_0000086 Ga0496125_0000086_53730_54854 357
212 3300050511 nmdc:mga08y16_24871_c1 nmdc:mga08y16_24871_c1_2953_4056 357
213 3300050512 nmdc:mga0n895_313887_c1 nmdc:mga0n895_313887_c1_100_1203 357
214 3300050513 nmdc:mga0rr50_3162_c1 nmdc:mga0rr50_3162_c1_5228_6331 357
215 iso_pu_bacteria 2818991472 2819742314 357
216 iso_pu_bacteria 2867369537 2867373302 357
217 3300035119 Ga0373956_0005512 Ga0373956_0005512_347_1471 358
218 3300046454 Ga0495592_0121173 Ga0495592_0121173_132_1256 358
219 3300046462 Ga0495651_0009757 Ga0495651_0009757_922_2046 358
220 3300046675 Ga0495657_0034170 Ga0495657_0034170_586_1710 358
221 3300047322 Ga0495680_0005926 Ga0495680_0005926_7037_8161 358
222 3300048088 Ga0495602_0207241 Ga0495602_0207241_283_1407 358
223 iso_pu_bacteria 2551306166 2552105984 358
224 iso_pu_bacteria 2585428157 2588106927 358
225 iso_pu_bacteria 2643221542 2643734866 358
226 iso_pu_bacteria 2643221553 2643783527 358
227 iso_pu_bacteria 2643221630 2644173026 358
228 iso_pu_bacteria 2643221724 2644679225 358
229 iso_pu_bacteria 2728369380 2730228728 358
230 iso_pu_bacteria 2747842429 2747953169 358
231 iso_pu_bacteria 2757320536 2758224676 358
232 iso_pu_bacteria 2773857758 2774378827 358
233 iso_pu_bacteria 2808606447 2809226524 358
234 iso_pu_bacteria 2856741275 2856746564 358
235 iso_pu_bacteria 2862705112 2862709676 358
236 iso_pu_bacteria 2867346516 2867349841 358
237 iso_pu_bacteria 2867475112 2867478680 358
238 iso_pu_bacteria 2891326441 2891331433 358
239 iso_pu_bacteria 2891562705 2891566160 358
240 iso_pu_bacteria 2956939328 2956941033 358
241 iso_pu_bacteria 2990044586 2990044890 358
242 iso_pu_bacteria 2990088156 2990093261 358
243 iso_pu_bacteria 2995726249 2995728402 358
244 iso_pu_bacteria 2997451912 2997458291 358
245 iso_pu_bacteria 3001119090 3001120725 358
246 iso_pu_bacteria 8002811521 8002811619 358
247 iso_pu_bacteria 8008485437 8008490555 358
248 iso_pu_bacteria 8025524527 8025529857 358
249 iso_pu_bacteria 8033684223 8033687274 358
250 iso_pu_bacteria 8054160619 8054164200 358
251 iso_pu_bacteria 8055034563 8055035349 358
252 iso_pu_bacteria 8055037949 8055038962 358
253 iso_pu_bacteria 8055066027 8055073949 358
254 3300005327 Ga0070658_10035794 Ga0070658_100357944 359
255 3300005337 Ga0070682_100100331 Ga0070682_1001003312 359
256 3300005337 Ga0070682_100195328 Ga0070682_1001953282 359
257 3300005347 Ga0070668_100088728 Ga0070668_1000887283 359
258 3300005435 Ga0070714_100066156 Ga0070714_1000661562 359
259 3300005841 Ga0068863_100000912 Ga0068863_10000091218 359
260 3300014968 Ga0157379_10007743 Ga0157379_100077435 359
261 3300014969 Ga0157376_10177269 Ga0157376_101772691 359
262 3300020081 Ga0206354_10351484 Ga0206354_103514842 359
263 3300022467 Ga0224712_10002198 Ga0224712_100021981 359
264 3300025928 Ga0207700_10114707 Ga0207700_101147071 359
265 3300025929 Ga0207664_10096423 Ga0207664_100964232 359
266 3300025972 Ga0207668_10094646 Ga0207668_100946462 359
267 3300026088 Ga0207641_10002332 Ga0207641_100023329 359
268 3300030521 Ga0307511_10052434 Ga0307511_100524342 359
269 3300031507 Ga0307509_10010025 Ga0307509_1001002511 359
270 3300033179 Ga0307507_10000024 Ga0307507_10000024153 359
271 3300044656 Ga0466969_0030935 Ga0466969_0030935_973_2079 359
272 3300044683 Ga0466965_0013448 Ga0466965_0013448_2242_3366 359
273 3300044683 Ga0466965_0046392 Ga0466965_0046392_251_1360 359
274 3300044694 Ga0466963_0191155 Ga0466963_0191155_40_1170 359
275 3300044719 Ga0466971_0084173 Ga0466971_0084173_181_1287 359
276 3300044765 Ga0466970_0020549 Ga0466970_0020549_694_1818 359
277 3300044842 Ga0466957_0108661 Ga0466957_0108661_43_1149 359
278 3300044901 Ga0466960_0012316 Ga0466960_0012316_732_1856 359
279 3300045049 Ga0466959_0059799 Ga0466959_0059799_44_1150 359
280 3300045836 Ga0466958_0017403 Ga0466958_0017403_682_1788 359
281 3300046462 Ga0495651_0002291 Ga0495651_0002291_2120_3226 359
282 3300046471 Ga0495650_0060587 Ga0495650_0060587_123_1247 359
283 3300046473 Ga0495582_0120796 Ga0495582_0120796_304_1431 359
284 3300046477 Ga0495664_0023780 Ga0495664_0023780_1994_3121 359
285 3300046516 Ga0495628_0027448 Ga0495628_0027448_3434_4540 359
286 3300046529 Ga0495652_0122654 Ga0495652_0122654_535_1641 359
287 3300046543 Ga0495645_0180555 Ga0495645_0180555_40_1146 359
288 3300046663 Ga0495635_0032208 Ga0495635_0032208_776_1882 359
289 3300046809 Ga0495600_0004237 Ga0495600_0004237_3686_4792 359
290 3300047315 Ga0495581_0059541 Ga0495581_0059541_892_2034 359
291 3300047319 Ga0495674_0278225 Ga0495674_0278225_112_1239 359
292 3300047322 Ga0495680_0170421 Ga0495680_0170421_139_1245 359
293 3300048903 Ga0496100_0016444 Ga0496100_0016444_2170_3294 359
294 3300048904 Ga0496101_0007337 Ga0496101_0007337_5220_6344 359
295 3300048905 Ga0496102_0000236 Ga0496102_0000236_42499_43623 359
296 3300048905 Ga0496102_0128630 Ga0496102_0128630_902_2029 359
297 3300048906 Ga0496103_0000185 Ga0496103_0000185_31108_32232 359
298 3300048907 Ga0496104_0006197 Ga0496104_0006197_5824_6948 359
299 3300048907 Ga0496104_0021598 Ga0496104_0021598_3532_4659 359
300 3300048908 Ga0496105_0001152 Ga0496105_0001152_1842_2969 359
301 3300048908 Ga0496105_0009146 Ga0496105_0009146_2510_3634 359
302 3300048911 Ga0496108_0020362 Ga0496108_0020362_913_2040 359
303 3300048911 Ga0496108_0099231 Ga0496108_0099231_1324_2451 359
304 3300048912 Ga0496109_0001771 Ga0496109_0001771_13130_14257 359
305 3300048913 Ga0496110_0000402 Ga0496110_0000402_5435_6562 359
306 3300048914 Ga0496111_0008549 Ga0496111_0008549_3505_4632 359
307 3300048916 Ga0496113_0029029 Ga0496113_0029029_2056_3183 359
308 3300048917 Ga0496114_0010520 Ga0496114_0010520_2302_3429 359
309 3300048917 Ga0496114_0028689 Ga0496114_0028689_1286_2413 359
310 3300048917 Ga0496114_0106929 Ga0496114_0106929_703_1830 359
311 3300048917 Ga0496114_0167237 Ga0496114_0167237_516_1643 359
312 3300048919 Ga0496116_0000340 Ga0496116_0000340_31143_32267 359
313 3300048920 Ga0496117_0000986 Ga0496117_0000986_13391_14515 359
314 3300048921 Ga0496118_0000096 Ga0496118_0000096_30640_31764 359
315 3300048922 Ga0496119_0000340 Ga0496119_0000340_38748_39872 359
316 3300048923 Ga0496120_0005677 Ga0496120_0005677_1455_2579 359
317 3300048924 Ga0496121_0169373 Ga0496121_0169373_237_1361 359
318 3300048927 Ga0496124_0005711 Ga0496124_0005711_9713_10837 359
319 3300048928 Ga0496125_0036438 Ga0496125_0036438_2901_4025 359
320 3300048929 Ga0496126_0000547 Ga0496126_0000547_42494_43618 359
321 3300053077 Ga0495601_0030603 Ga0495601_0030603_1930_3036 359
322 3300053078 Ga0495612_0001130 Ga0495612_0001130_8455_9561 359
323 3300061719 Ga0466962_0012085 Ga0466962_0012085_772_1878 359
324 iso_pu_bacteria 2643221566 2643847848 359
325 iso_pu_bacteria 2643221575 2643888218 359
326 iso_pu_bacteria 2643221597 2643994890 359
327 iso_pu_bacteria 2643221631 2644175828 359
328 iso_pu_bacteria 2643221632 2644182446 359
329 iso_pu_bacteria 2643221649 2644277737 359
330 iso_pu_bacteria 2643221692 2644515240 359
331 iso_pu_bacteria 2773857759 2774383431 359
332 iso_pu_bacteria 2773857763 2774400613 359
333 iso_pu_bacteria 2808606368 2808884818 359
334 iso_pu_bacteria 2811994872 2812322197 359
335 iso_pu_bacteria 2844852863 2844854372 359
336 iso_pu_bacteria 2873314349 2873322080 359
337 iso_pu_bacteria 2891395885 2891401853 359
338 iso_pu_bacteria 2891554331 2891560593 359
339 iso_pu_bacteria 2906799679 2906801637 359
340 iso_pu_bacteria 2964326757 2964328524 359
341 iso_pu_bacteria 3006321560 3006326633 359
342 iso_pu_bacteria 8055172936 8055179018 359
343 iso_pu_bacteria 8056037122 8056039332 359
344 iso_pu_bacteria 8057345674 8057347458 359
345 3300005327 Ga0070658_10031946 Ga0070658_100319464 360
346 3300005329 Ga0070683_100257981 Ga0070683_1002579812 360
347 3300005336 Ga0070680_100000604 Ga0070680_10000060413 360
348 3300005345 Ga0070692_10052038 Ga0070692_100520382 360
349 3300005458 Ga0070681_10037371 Ga0070681_100373714 360
350 3300006844 Ga0075428_100023989 Ga0075428_1000239894 360
351 3300006844 Ga0075428_100106170 Ga0075428_1001061702 360
352 3300006846 Ga0075430_100190988 Ga0075430_1001909882 360
353 3300006871 Ga0075434_100018396 Ga0075434_1000183964 360
354 3300006880 Ga0075429_100038385 Ga0075429_1000383853 360
355 3300006880 Ga0075429_100038598 Ga0075429_1000385983 360
356 3300007076 Ga0075435_100108572 Ga0075435_1001085722 360
357 3300009094 Ga0111539_10010369 Ga0111539_100103693 360
358 3300009098 Ga0105245_10144385 Ga0105245_101443852 360
359 3300009147 Ga0114129_10014475 Ga0114129_100144757 360
360 3300009147 Ga0114129_10027431 Ga0114129_100274313 360
361 3300009176 Ga0105242_10113127 Ga0105242_101131273 360
362 3300009553 Ga0105249_10109470 Ga0105249_101094702 360
363 3300013105 Ga0157369_10054453 Ga0157369_100544532 360
364 3300013306 Ga0163162_10098066 Ga0163162_100980663 360
365 3300013307 Ga0157372_10435920 Ga0157372_104359202 360
366 3300014325 Ga0163163_10393289 Ga0163163_103932891 360
367 3300020070 Ga0206356_10718652 Ga0206356_107186522 360
368 3300020078 Ga0206352_10797669 Ga0206352_107976692 360
369 3300020080 Ga0206350_11125152 Ga0206350_111251522 360
370 3300020081 Ga0206354_11188581 Ga0206354_111885814 360
371 3300020082 Ga0206353_10645933 Ga0206353_1064593310 360
372 3300020082 Ga0206353_10842314 Ga0206353_108423142 360
373 3300022467 Ga0224712_10002255 Ga0224712_100022552 360
374 3300022467 Ga0224712_10037054 Ga0224712_100370542 360
375 3300025909 Ga0207705_10009574 Ga0207705_100095744 360
376 3300025912 Ga0207707_10003758 Ga0207707_100037583 360
377 3300025917 Ga0207660_10000245 Ga0207660_1000024523 360
378 3300025921 Ga0207652_10000294 Ga0207652_1000029447 360
379 3300025961 Ga0207712_10233207 Ga0207712_102332072 360
380 3300026023 Ga0207677_10193109 Ga0207677_101931092 360
381 3300031665 Ga0316575_10091932 Ga0316575_100919321 360
382 3300031727 Ga0316576_10021064 Ga0316576_100210641 360
383 3300031728 Ga0316578_10038070 Ga0316578_100380702 360
384 3300031995 Ga0307409_100109684 Ga0307409_1001096842 360
385 3300032004 Ga0307414_10141928 Ga0307414_101419282 360
386 3300036712 Ga0316584_0003649 Ga0316584_0003649_8838_9947 360
387 3300044656 Ga0466969_0037022 Ga0466969_0037022_20_1129 360
388 3300044693 Ga0466961_0048035 Ga0466961_0048035_1155_2264 360
389 3300048903 Ga0496100_0097033 Ga0496100_0097033_571_1680 360
390 3300048904 Ga0496101_0103857 Ga0496101_0103857_550_1659 360
391 3300048905 Ga0496102_0058240 Ga0496102_0058240_1515_2624 360
392 3300048907 Ga0496104_0095950 Ga0496104_0095950_203_1312 360
393 3300048908 Ga0496105_0203627 Ga0496105_0203627_452_1561 360
394 3300048908 Ga0496105_0262892 Ga0496105_0262892_121_1251 360
395 3300048910 Ga0496107_0010945 Ga0496107_0010945_2124_3233 360
396 3300048913 Ga0496110_0237305 Ga0496110_0237305_212_1321 360
397 3300048915 Ga0496112_0057931 Ga0496112_0057931_2583_3692 360
398 3300048915 Ga0496112_0256377 Ga0496112_0256377_497_1606 360
399 3300048916 Ga0496113_0015524 Ga0496113_0015524_190_1299 360
400 3300048917 Ga0496114_0028070 Ga0496114_0028070_3445_4554 360
401 3300048917 Ga0496114_0176625 Ga0496114_0176625_214_1323 360
402 3300048918 Ga0496115_0081938 Ga0496115_0081938_202_1332 360
403 3300048922 Ga0496119_0065003 Ga0496119_0065003_257_1366 360
404 3300049586 Ga0501070_0095003 Ga0501070_0095003_934_2043 360
405 3300050507 nmdc:mga05p37_9984_c1 nmdc:mga05p37_9984_c1_7978_9111 360
406 3300050508 nmdc:mga09592_110175_c1 nmdc:mga09592_110175_c1_404_1513 360
407 3300050508 nmdc:mga09592_97806_c1 nmdc:mga09592_97806_c1_14_1147 360
408 3300050509 nmdc:mga0qj67_176290_c1 nmdc:mga0qj67_176290_c1_480_1613 360
409 3300050511 nmdc:mga08y16_14541_c1 nmdc:mga08y16_14541_c1_5394_6527 360
410 3300050512 nmdc:mga0n895_27126_c1 nmdc:mga0n895_27126_c1_1830_2963 360
411 3300050513 nmdc:mga0rr50_4142_c2 nmdc:mga0rr50_4142_c2_704_1837 360
412 3300050515 nmdc:mga0a205_3224_c1 nmdc:mga0a205_3224_c1_8045_9178 360
413 3300053077 Ga0495601_0032437 Ga0495601_0032437_1074_2216 360
414 iso_pu_bacteria 2554235005 2554256717 360
415 iso_pu_bacteria 2582581312 2585295996 360
416 iso_pu_bacteria 2582581313 2585306288 360
417 iso_pu_bacteria 2582581314 2585320272 360
418 iso_pu_bacteria 2616644814 2616696701 360
419 iso_pu_bacteria 2616644941 2616903179 360
420 iso_pu_bacteria 2643221548 2643764695 360
421 iso_pu_bacteria 2643221567 2643852653 360
422 iso_pu_bacteria 2643221578 2643903027 360
423 iso_pu_bacteria 2643221587 2643941919 360
424 iso_pu_bacteria 2643221624 2644135161 360
425 iso_pu_bacteria 2643221635 2644197898 360
426 iso_pu_bacteria 2643221647 2644261510 360
427 iso_pu_bacteria 2643221670 2644389541 360
428 iso_pu_bacteria 2643221673 2644404463 360
429 iso_pu_bacteria 2643221677 2644429002 360
430 iso_pu_bacteria 2643221678 2644439410 360
431 iso_pu_bacteria 2643221679 2644445480 360
432 iso_pu_bacteria 2643221682 2644462080 360
433 iso_pu_bacteria 2643221711 2644610808 360
434 iso_pu_bacteria 2675903060 2676494524 360
435 iso_pu_bacteria 2728369276 2729906622 360
436 iso_pu_bacteria 2731639228 2731908986 360
437 iso_pu_bacteria 2739367653 2739602919 360
438 iso_pu_bacteria 2751185788 2753303633 360
439 iso_pu_bacteria 2784132109 2784472905 360
440 iso_pu_bacteria 2784132148 2784589814 360
441 iso_pu_bacteria 2784746763 2785341790 360
442 iso_pu_bacteria 2784746768 2785370856 360
443 iso_pu_bacteria 2786546132 2786672035 360
444 iso_pu_bacteria 2791355406 2793981347 360
445 iso_pu_bacteria 2802429296 2804845461 360
446 iso_pu_bacteria 2808606359 2808843413 360
447 iso_pu_bacteria 2808606365 2808875457 360
448 iso_pu_bacteria 2808606375 2808912998 360
449 iso_pu_bacteria 2808606448 2809233483 360
450 iso_pu_bacteria 2808606982 2811845029 360
451 iso_pu_bacteria 2811994879 2812356628 360
452 iso_pu_bacteria 2811994882 2812375766 360
453 iso_pu_bacteria 2811994917 2812479336 360
454 iso_pu_bacteria 2816332305 2817508571 360
455 iso_pu_bacteria 2818991318 2819424663 360
456 iso_pu_bacteria 2818991458 2819667002 360
457 iso_pu_bacteria 2818991462 2819690356 360
458 iso_pu_bacteria 2818991463 2819695159 360
459 iso_pu_bacteria 2818991469 2819728382 360
460 iso_pu_bacteria 2852632344 2852632770 360
461 iso_pu_bacteria 2852635781 2852642776 360
462 iso_pu_bacteria 2852643534 2852644397 360
463 iso_pu_bacteria 2852646457 2852646538 360
464 iso_pu_bacteria 2852663356 2852665830 360
465 iso_pu_bacteria 2857723135 2857724667 360
466 iso_pu_bacteria 2857727296 2857729262 360
467 iso_pu_bacteria 2857733635 2857734492 360
468 iso_pu_bacteria 2857737099 2857739751 360
469 iso_pu_bacteria 2862178590 2862185244 360
470 iso_pu_bacteria 2862281513 2862287082 360
471 iso_pu_bacteria 2862290372 2862292054 360
472 iso_pu_bacteria 2862382967 2862385302 360
473 iso_pu_bacteria 2862507626 2862511968 360
474 iso_pu_bacteria 2862574272 2862578110 360
475 iso_pu_bacteria 2863404153 2863411483 360
476 iso_pu_bacteria 2867428634 2867434122 360
477 iso_pu_bacteria 2870622029 2870622239 360
478 iso_pu_bacteria 2873151551 2873154636 360
479 iso_pu_bacteria 2875391855 2875396116 360
480 iso_pu_bacteria 2877676314 2877679721 360
481 iso_pu_bacteria 2884693830 2884694879 360
482 iso_pu_bacteria 2895427314 2895432642 360
483 iso_pu_bacteria 2895442618 2895446426 360
484 iso_pu_bacteria 2904430863 2904432440 360
485 iso_pu_bacteria 2904501621 2904501765 360
486 iso_pu_bacteria 2904509784 2904510287 360
487 iso_pu_bacteria 2908674828 2908676181 360
488 iso_pu_bacteria 2908678064 2908678498 360
489 iso_pu_bacteria 2909074476 2909077060 360
490 iso_pu_bacteria 2912715099 2912718358 360
491 iso_pu_bacteria 2912723979 2912730710 360
492 iso_pu_bacteria 2912757875 2912762198 360
493 iso_pu_bacteria 2918501144 2918505904 360
494 iso_pu_bacteria 2919039151 2919041800 360
495 iso_pu_bacteria 2919042368 2919043240 360
496 iso_pu_bacteria 2919069694 2919070819 360
497 iso_pu_bacteria 2919395869 2919397768 360
498 iso_pu_bacteria 2919446982 2919447880 360
499 iso_pu_bacteria 2919468124 2919470311 360
500 iso_pu_bacteria 2920879853 2920882720 360
501 iso_pu_bacteria 2928104781 2928105537 360
502 iso_pu_bacteria 2928500415 2928500943 360
503 iso_pu_bacteria 2935390628 2935395278 360
504 iso_pu_bacteria 2945968032 2945970886 360
505 iso_pu_bacteria 2946041624 2946043203 360
506 iso_pu_bacteria 2946045630 2946048504 360
507 iso_pu_bacteria 2946064051 2946069240 360
508 iso_pu_bacteria 2946072368 2946077189 360
509 iso_pu_bacteria 2946080515 2946081800 360
510 iso_pu_bacteria 2947224130 2947227685 360
511 iso_pu_bacteria 2954002825 2954004828 360
512 iso_pu_bacteria 2954380949 2954384633 360
513 iso_pu_bacteria 2954673503 2954678307 360
514 iso_pu_bacteria 2954682443 2954685850 360
515 iso_pu_bacteria 2954691527 2954695489 360
516 iso_pu_bacteria 2954701450 2954710682 360
517 iso_pu_bacteria 2954711539 2954714920 360
518 iso_pu_bacteria 2954721474 2954724863 360
519 iso_pu_bacteria 2954731030 2954736955 360
520 iso_pu_bacteria 2954740390 2954743789 360
521 iso_pu_bacteria 2954749733 2954755805 360
522 iso_pu_bacteria 2954759201 2954762741 360
523 iso_pu_bacteria 2966598605 2966601376 360
524 iso_pu_bacteria 2966924647 2966926590 360
525 iso_pu_bacteria 2974294766 2974298324 360
526 iso_pu_bacteria 2974324384 2974325447 360
527 iso_pu_bacteria 2977228692 2977230392 360
528 iso_pu_bacteria 2977236895 2977239195 360
529 iso_pu_bacteria 2977264416 2977265623 360
530 iso_pu_bacteria 2984542743 2984543021 360
531 iso_pu_bacteria 2984551494 2984551932 360
532 iso_pu_bacteria 2990059506 2990060988 360
533 iso_pu_bacteria 2997600082 2997601414 360
534 iso_pu_bacteria 3001889506 3001892153 360
535 iso_pu_bacteria 3006393351 3006397840 360
536 iso_pu_bacteria 3006425503 3006429828 360
537 iso_pu_bacteria 3006486233 3006493413 360
538 iso_pu_bacteria 3006493962 3006498897 360
539 iso_pu_bacteria 8004182704 8004183588 360
540 iso_pu_bacteria 8008558824 8008566634 360
541 iso_pu_bacteria 8008574985 8008577735 360
542 iso_pu_bacteria 8016254467 8016254998 360
543 iso_pu_bacteria 8023623736 8023627007 360
544 iso_pu_bacteria 8025413630 8025417166 360
545 iso_pu_bacteria 8025530807 8025532243 360
546 iso_pu_bacteria 8047893842 8047896896 360
547 iso_pu_bacteria 8048356638 8048362054 360
548 iso_pu_bacteria 8048369669 8048373881 360
549 iso_pu_bacteria 8048379754 8048384347 360
550 iso_pu_bacteria 8048406513 8048413751 360
551 iso_pu_bacteria 8056447290 8056448512 360
552 iso_pu_bacteria 8056667051 8056672849 360
553 iso_pu_bacteria 8056829672 8056837541 360
554 3300005329 Ga0070683_100058043 Ga0070683_1000580432 361
555 3300005329 Ga0070683_100323958 Ga0070683_1003239582 361
556 3300005336 Ga0070680_100040663 Ga0070680_1000406632 361
557 3300005435 Ga0070714_100085074 Ga0070714_1000850741 361
558 3300005439 Ga0070711_100052982 Ga0070711_1000529823 361
559 3300005458 Ga0070681_10076072 Ga0070681_100760721 361
560 3300005467 Ga0070706_100238770 Ga0070706_1002387702 361
561 3300005468 Ga0070707_100027135 Ga0070707_1000271353 361
562 3300005471 Ga0070698_100029366 Ga0070698_1000293662 361
563 3300005530 Ga0070679_100054351 Ga0070679_1000543512 361
564 3300005530 Ga0070679_100184734 Ga0070679_1001847342 361
565 3300006028 Ga0070717_10191812 Ga0070717_101918122 361
566 3300013104 Ga0157370_10161321 Ga0157370_101613212 361
567 3300020081 Ga0206354_10556289 Ga0206354_105562892 361
568 3300020082 Ga0206353_10849751 Ga0206353_108497512 361
569 3300021388 Ga0213875_10000514 Ga0213875_1000051420 361
570 3300025910 Ga0207684_10013779 Ga0207684_100137794 361
571 3300025910 Ga0207684_10031843 Ga0207684_100318432 361
572 3300025915 Ga0207693_10072583 Ga0207693_100725833 361
573 3300025917 Ga0207660_10104135 Ga0207660_101041352 361
574 3300025919 Ga0207657_10086227 Ga0207657_100862272 361
575 3300025920 Ga0207649_10053258 Ga0207649_100532582 361
576 3300025921 Ga0207652_10149647 Ga0207652_101496472 361
577 3300025922 Ga0207646_10111544 Ga0207646_101115442 361
578 3300025928 Ga0207700_10008955 Ga0207700_100089552 361
579 3300025928 Ga0207700_10062900 Ga0207700_100629003 361
580 3300025929 Ga0207664_10005293 Ga0207664_100052932 361
581 3300025929 Ga0207664_10067649 Ga0207664_100676492 361
582 3300025929 Ga0207664_10076669 Ga0207664_100766692 361
583 3300025939 Ga0207665_10041375 Ga0207665_100413752 361
584 3300025944 Ga0207661_10054298 Ga0207661_100542982 361
585 3300025944 Ga0207661_10308762 Ga0207661_103087621 361
586 3300025945 Ga0207679_10210222 Ga0207679_102102222 361
587 3300028556 Ga0265337_1000031 Ga0265337_100003122 361
588 3300028563 Ga0265319_1002342 Ga0265319_10023425 361
589 3300028573 Ga0265334_10000091 Ga0265334_1000009122 361
590 3300028653 Ga0265323_10049795 Ga0265323_100497951 361
591 3300028654 Ga0265322_10003185 Ga0265322_100031852 361
592 3300028666 Ga0265336_10007606 Ga0265336_100076062 361
593 3300028800 Ga0265338_10000233 Ga0265338_1000023349 361
594 3300028800 Ga0265338_10002443 Ga0265338_100024439 361
595 3300028800 Ga0265338_10233416 Ga0265338_102334162 361
596 3300029957 Ga0265324_10004717 Ga0265324_100047172 361
597 3300031238 Ga0265332_10006014 Ga0265332_100060144 361
598 3300031240 Ga0265320_10008863 Ga0265320_100088631 361
599 3300031344 Ga0265316_10065002 Ga0265316_100650022 361
600 3300031595 Ga0265313_10002825 Ga0265313_100028257 361
601 3300031711 Ga0265314_10006509 Ga0265314_100065095 361
602 3300031712 Ga0265342_10004101 Ga0265342_100041012 361
603 3300033547 Ga0316212_1008686 Ga0316212_10086861 361
604 3300035086 Ga0373934_0007765 Ga0373934_0007765_2038_3165 361
605 3300035111 Ga0373923_0001412 Ga0373923_0001412_4021_5148 361
606 3300035118 Ga0373954_0026765 Ga0373954_0026765_553_1680 361
607 3300035119 Ga0373956_0014937 Ga0373956_0014937_881_2008 361
608 3300035120 Ga0373957_0022802 Ga0373957_0022802_430_1557 361
609 3300035724 Ga0373933_0044507 Ga0373933_0044507_861_1988 361
610 3300035725 Ga0373947_0131535 Ga0373947_0131535_443_1570 361
611 3300036401 Ga0373937_0208875 Ga0373937_0208875_35_1162 361
612 3300036459 Ga0372808_001746 Ga0372808_001746_502_1629 361
613 3300037068 Ga0373925_0000008 Ga0373925_0000008_93075_94202 361
614 3300037466 Ga0395898_0089016 Ga0395898_0089016_659_1786 361
615 3300037853 Ga0436364_1379988 Ga0436364_1379988_23008_24135 361
616 3300038443 Ga0395901_0071477 Ga0395901_0071477_1199_2311 361
617 3300039438 Ga0436360_1265940 Ga0436360_1265940_413_1540 361
618 3300044719 Ga0466971_0001379 Ga0466971_0001379_4396_5511 361
619 3300045049 Ga0466959_0196100 Ga0466959_0196100_139_1251 361
620 3300046454 Ga0495592_0032917 Ga0495592_0032917_1668_2795 361
621 3300046462 Ga0495651_0042569 Ga0495651_0042569_1432_2559 361
622 3300046463 Ga0495653_0039274 Ga0495653_0039274_903_2030 361
623 3300046476 Ga0495662_0098602 Ga0495662_0098602_253_1380 361
624 3300046477 Ga0495664_0045484 Ga0495664_0045484_71_1198 361
625 3300046511 Ga0495608_0012635 Ga0495608_0012635_2719_3846 361
626 3300046514 Ga0495618_0087836 Ga0495618_0087836_46_1173 361
627 3300046516 Ga0495628_0069623 Ga0495628_0069623_1596_2723 361
628 3300046517 Ga0495630_0172843 Ga0495630_0172843_40_1167 361
629 3300046533 Ga0495640_0022205 Ga0495640_0022205_2366_3493 361
630 3300046535 Ga0495586_0040418 Ga0495586_0040418_678_1805 361
631 3300046536 Ga0495587_0011078 Ga0495587_0011078_4292_5419 361
632 3300046543 Ga0495645_0150757 Ga0495645_0150757_111_1238 361
633 3300046642 Ga0495634_0041285 Ga0495634_0041285_930_2057 361
634 3300046663 Ga0495635_0078795 Ga0495635_0078795_725_1852 361
635 3300046675 Ga0495657_0019259 Ga0495657_0019259_1283_2410 361
636 3300046809 Ga0495600_0041537 Ga0495600_0041537_308_1435 361
637 3300047317 Ga0495604_0050839 Ga0495604_0050839_1448_2575 361
638 3300047319 Ga0495674_0070377 Ga0495674_0070377_379_1506 361
639 3300047322 Ga0495680_0029389 Ga0495680_0029389_1388_2515 361
640 3300047444 Ga0495675_0101922 Ga0495675_0101922_421_1548 361
641 3300047471 Ga0495684_0013883 Ga0495684_0013883_1770_2897 361
642 3300048088 Ga0495602_0077403 Ga0495602_0077403_1661_2788 361
643 3300048915 Ga0496112_0100835 Ga0496112_0100835_1305_2432 361
644 3300048918 Ga0496115_0012610 Ga0496115_0012610_4228_5355 361
645 3300048929 Ga0496126_0038893 Ga0496126_0038893_2024_3151 361
646 3300048929 Ga0496126_0083544 Ga0496126_0083544_958_2085 361
647 3300048929 Ga0496126_0281447 Ga0496126_0281447_213_1340 361
648 3300053077 Ga0495601_0015770 Ga0495601_0015770_3089_4216 361
649 3300061719 Ga0466962_0001145 Ga0466962_0001145_4705_5820 361
650 iso_pu_bacteria 2643221546 2643753782 361
651 iso_pu_bacteria 2643221690 2644502903 361
652 iso_pu_bacteria 2643221694 2644525268 361
653 iso_pu_bacteria 2643221722 2644669353 361
654 iso_pu_bacteria 2738541272 2738693731 361
655 iso_pu_bacteria 2738543027 2739328110 361
656 iso_pu_bacteria 2739367654 2739607439 361
657 iso_pu_bacteria 2758568522 2760304659 361
658 iso_pu_bacteria 2758568621 2760621530 361
659 iso_pu_bacteria 2808606306 2808628693 361
660 iso_pu_bacteria 2808606394 2809026317 361
661 iso_pu_bacteria 2811994880 2812364422 361
662 iso_pu_bacteria 2821268502 2821269128 361
663 iso_pu_bacteria 2833709550 2833710011 361
664 iso_pu_bacteria 2835188231 2835189079 361
665 iso_pu_bacteria 2839986021 2839989113 361
666 iso_pu_bacteria 2844841374 2844843321 361
667 iso_pu_bacteria 2857479173 2857480484 361
668 iso_pu_bacteria 2857632687 2857633705 361
669 iso_pu_bacteria 2857710386 2857712593 361
670 iso_pu_bacteria 2857720070 2857722181 361
671 iso_pu_bacteria 2857729791 2857730614 361
672 iso_pu_bacteria 2870628048 2870629522 361
673 iso_pu_bacteria 2870801768 2870801986 361
674 iso_pu_bacteria 2870804320 2870806376 361
675 iso_pu_bacteria 2884994152 2884996381 361
676 iso_pu_bacteria 2887443736 2887447131 361
677 iso_pu_bacteria 2919055335 2919058802 361
678 iso_pu_bacteria 2919443155 2919445606 361
679 iso_pu_bacteria 2919523602 2919525379 361
680 iso_pu_bacteria 2928090899 2928090944 361
681 iso_pu_bacteria 2928121344 2928121418 361
682 iso_pu_bacteria 2928153084 2928153459 361
683 iso_pu_bacteria 2932431166 2932432256 361
684 iso_pu_bacteria 2946033335 2946034682 361
685 iso_pu_bacteria 2977251589 2977252073 361
686 iso_pu_bacteria 2984580707 2984582301 361
687 iso_pu_bacteria 8004021418 8004021608 361
688 iso_pu_bacteria 8004025490 8004027974 361
689 iso_pu_bacteria 8004212874 8004213407 361
690 iso_pu_bacteria 8045830549 8045832305 361
691 iso_pu_bacteria 8056579771 8056583246 361
692 3300002738 JGI25154J39366_1003355 JGI25154J39366_10033551 362
693 3300003354 JGI25160J50197_1014988 JGI25160J50197_10149882 362
694 3300005435 Ga0070714_100005802 Ga0070714_1000058022 362
695 3300006028 Ga0070717_10140625 Ga0070717_101406252 362
696 3300006038 Ga0075365_10046434 Ga0075365_100464344 362
697 3300021388 Ga0213875_10117901 Ga0213875_101179011 362
698 3300025246 Ga0209646_1000088 Ga0209646_1000088126 362
699 3300025929 Ga0207664_10000834 Ga0207664_1000083413 362
700 3300031727 Ga0316576_10001465 Ga0316576_100014657 362
701 3300031727 Ga0316576_10023914 Ga0316576_100239142 362
702 3300031901 Ga0307406_10000932 Ga0307406_1000093215 362
703 3300031901 Ga0307406_10001566 Ga0307406_1000156610 362
704 3300031901 Ga0307406_10076440 Ga0307406_100764402 362
705 3300036712 Ga0316584_0012623 Ga0316584_0012623_1548_2663 362
706 3300036712 Ga0316584_0016410 Ga0316584_0016410_2091_3206 362
707 3300037853 Ga0436364_1096374 Ga0436364_1096374_614_1741 362
708 3300037853 Ga0436364_1261806 Ga0436364_1261806_2604_3731 362
709 3300039437 Ga0436365_1516734 Ga0436365_1516734_326_1456 362
710 3300044765 Ga0466970_0013270 Ga0466970_0013270_1532_2647 362
711 3300044901 Ga0466960_0009565 Ga0466960_0009565_1419_2534 362
712 3300044901 Ga0466960_0118455 Ga0466960_0118455_244_1359 362
713 3300046453 Ga0495627_001457 Ga0495627_001457_5660_6775 362
714 3300048905 Ga0496102_0357919 Ga0496102_0357919_12_1127 362
715 3300048920 Ga0496117_0000791 Ga0496117_0000791_19154_20269 362
716 3300048920 Ga0496117_0001718 Ga0496117_0001718_10209_11324 362
717 3300048920 Ga0496117_0012943 Ga0496117_0012943_768_1883 362
718 3300048920 Ga0496117_0023293 Ga0496117_0023293_657_1772 362
719 3300048921 Ga0496118_0006467 Ga0496118_0006467_3248_4363 362
720 3300048921 Ga0496118_0016454 Ga0496118_0016454_1218_2333 362
721 3300048922 Ga0496119_0004459 Ga0496119_0004459_8074_9189 362
722 3300048922 Ga0496119_0005146 Ga0496119_0005146_6207_7322 362
723 3300048922 Ga0496119_0009558 Ga0496119_0009558_4256_5371 362
724 3300048922 Ga0496119_0063300 Ga0496119_0063300_748_1863 362
725 3300048923 Ga0496120_0001932 Ga0496120_0001932_1827_2942 362
726 3300048923 Ga0496120_0006725 Ga0496120_0006725_1459_2574 362
727 3300048923 Ga0496120_0006917 Ga0496120_0006917_6009_7124 362
728 3300048925 Ga0496122_0000020 Ga0496122_0000020_151303_152418 362
729 3300048925 Ga0496122_0011256 Ga0496122_0011256_4542_5657 362
730 3300048925 Ga0496122_0062094 Ga0496122_0062094_26_1141 362
731 3300048925 Ga0496122_0070148 Ga0496122_0070148_1053_2168 362
732 3300048926 Ga0496123_0000003 Ga0496123_0000003_366427_367542 362
733 3300048926 Ga0496123_0028382 Ga0496123_0028382_1076_2191 362
734 3300048926 Ga0496123_0039255 Ga0496123_0039255_491_1606 362
735 3300048927 Ga0496124_0002352 Ga0496124_0002352_11298_12413 362
736 3300048927 Ga0496124_0002908 Ga0496124_0002908_9790_10905 362
737 3300048927 Ga0496124_0078730 Ga0496124_0078730_667_1782 362
738 3300048928 Ga0496125_0001608 Ga0496125_0001608_1477_2592 362
739 3300048928 Ga0496125_0005451 Ga0496125_0005451_328_1443 362
740 3300048928 Ga0496125_0006238 Ga0496125_0006238_5718_6833 362
741 3300048928 Ga0496125_0012012 Ga0496125_0012012_3817_4932 362
742 3300048928 Ga0496125_0040583 Ga0496125_0040583_2024_3139 362
743 3300048929 Ga0496126_0002060 Ga0496126_0002060_7851_8966 362
744 3300049578 Ga0501042_0144041 Ga0501042_0144041_308_1468 362
745 3300049582 Ga0501048_0188471 Ga0501048_0188471_176_1336 362
746 3300049588 Ga0501072_0104825 Ga0501072_0104825_86_1246 362
747 3300049592 Ga0501076_0175451 Ga0501076_0175451_67_1227 362
748 3300049824 Ga0501045_0100124 Ga0501045_0100124_654_1814 362
749 3300050510 nmdc:mga06r32_202_c5 nmdc:mga06r32_202_c5_67_1203 362
750 3300060353 Ga0501082_0053825 Ga0501082_0053825_188_1348 362
751 3300061719 Ga0466962_0057982 Ga0466962_0057982_221_1339 362
752 3300061734 Ga0530510_0113870 Ga0530510_0113870_333_1493 362
753 iso_pu_bacteria 2643221549 2643768564 362
754 iso_pu_bacteria 2643221619 2644111941 362
755 iso_pu_bacteria 2721755702 2723643100 362
756 iso_pu_bacteria 2893684298 2893685140 362
757 iso_pu_bacteria 2935409751 2935412172 362
758 3300003578 Ga0006562J51391_1013439 Ga0006562J51391_10134393 363
759 3300003578 Ga0006562J51391_1013440 Ga0006562J51391_10134402 363
760 3300003578 Ga0006562J51391_1025688 Ga0006562J51391_10256882 363
761 3300003578 Ga0006562J51391_1025689 Ga0006562J51391_10256894 363
762 3300003752 Ga0055539_1000005 Ga0055539_1000005565 363
763 3300003756 Ga0055533_1000001 Ga0055533_10000011634 363
764 3300003760 Ga0055527_1000017 Ga0055527_100001795 363
765 3300003762 Ga0055542_1000044 Ga0055542_100004495 363
766 3300003763 Ga0055529_1000279 Ga0055529_100027950 363
767 3300003841 Ga0055541_1008325 Ga0055541_10083252 363
768 3300005288 Ga0065714_10104412 Ga0065714_101044122 363
769 3300005327 Ga0070658_10000266 Ga0070658_1000026642 363
770 3300005337 Ga0070682_100142635 Ga0070682_1001426352 363
771 3300005434 Ga0070709_10004402 Ga0070709_100044024 363
772 3300005434 Ga0070709_10036494 Ga0070709_100364942 363
773 3300005435 Ga0070714_100030612 Ga0070714_1000306123 363
774 3300005436 Ga0070713_100015416 Ga0070713_1000154163 363
775 3300005437 Ga0070710_10000381 Ga0070710_100003818 363
776 3300005445 Ga0070708_100042482 Ga0070708_1000424821 363
777 3300005455 Ga0070663_100165035 Ga0070663_1001650352 363
778 3300005458 Ga0070681_10314051 Ga0070681_103140511 363
779 3300005467 Ga0070706_100002453 Ga0070706_10000245314 363
780 3300005467 Ga0070706_100013652 Ga0070706_1000136524 363
781 3300005467 Ga0070706_100048810 Ga0070706_1000488101 363
782 3300005468 Ga0070707_100000878 Ga0070707_1000008783 363
783 3300005468 Ga0070707_100016295 Ga0070707_1000162954 363
784 3300005468 Ga0070707_100043198 Ga0070707_1000431983 363
785 3300005471 Ga0070698_100001092 Ga0070698_1000010923 363
786 3300005471 Ga0070698_100017339 Ga0070698_1000173392 363
787 3300005471 Ga0070698_100017533 Ga0070698_1000175333 363
788 3300005471 Ga0070698_100018948 Ga0070698_1000189484 363
789 3300005471 Ga0070698_100132843 Ga0070698_1001328432 363
790 3300005518 Ga0070699_100298178 Ga0070699_1002981782 363
791 3300005535 Ga0070684_100274891 Ga0070684_1002748912 363
792 3300005536 Ga0070697_100025290 Ga0070697_1000252902 363
793 3300005536 Ga0070697_100045569 Ga0070697_1000455694 363
794 3300005544 Ga0070686_100164925 Ga0070686_1001649252 363
795 3300005563 Ga0068855_100119766 Ga0068855_1001197662 363
796 3300005614 Ga0068856_100091894 Ga0068856_1000918942 363
797 3300005841 Ga0068863_100188176 Ga0068863_1001881762 363
798 3300005983 Ga0081540_1001352 Ga0081540_100135219 363
799 3300006028 Ga0070717_10112192 Ga0070717_101121921 363
800 3300006163 Ga0070715_10008469 Ga0070715_100084692 363
801 3300006173 Ga0070716_100039444 Ga0070716_1000394442 363
802 3300006175 Ga0070712_100009230 Ga0070712_1000092304 363
803 3300006178 Ga0075367_10025051 Ga0075367_100250513 363
804 3300006852 Ga0075433_10007398 Ga0075433_100073981 363
805 3300006852 Ga0075433_10028029 Ga0075433_100280294 363
806 3300006871 Ga0075434_100038538 Ga0075434_1000385381 363
807 3300006914 Ga0075436_100010867 Ga0075436_1000108672 363
808 3300006914 Ga0075436_100047311 Ga0075436_1000473113 363
809 3300006914 Ga0075436_100132048 Ga0075436_1001320482 363
810 3300007076 Ga0075435_100068135 Ga0075435_1000681352 363
811 3300009094 Ga0111539_10165704 Ga0111539_101657042 363
812 3300009147 Ga0114129_10008769 Ga0114129_100087695 363
813 3300009147 Ga0114129_10280963 Ga0114129_102809632 363
814 3300009545 Ga0105237_10064474 Ga0105237_100644742 363
815 3300013105 Ga0157369_10031501 Ga0157369_100315013 363
816 3300013105 Ga0157369_10064247 Ga0157369_100642472 363
817 3300013105 Ga0157369_10282236 Ga0157369_102822362 363
818 3300013250 Ga0171462_1001 Ga0171462_1001712 363
819 3300013296 Ga0157374_10042610 Ga0157374_100426102 363
820 3300013307 Ga0157372_10115493 Ga0157372_101154932 363
821 3300013307 Ga0157372_10117818 Ga0157372_101178182 363
822 3300013307 Ga0157372_10389671 Ga0157372_103896712 363
823 3300013308 Ga0157375_10104547 Ga0157375_101045472 363
824 3300013308 Ga0157375_10483163 Ga0157375_104831631 363
825 3300013308 Ga0157375_10538782 Ga0157375_105387822 363
826 3300014325 Ga0163163_10177155 Ga0163163_101771552 363
827 3300014968 Ga0157379_10006602 Ga0157379_100066026 363
828 3300014969 Ga0157376_10102957 Ga0157376_101029572 363
829 3300020069 Ga0197907_10254036 Ga0197907_102540362 363
830 3300020080 Ga0206350_10773787 Ga0206350_107737872 363
831 3300020081 Ga0206354_10679121 Ga0206354_106791212 363
832 3300020082 Ga0206353_10410223 Ga0206353_104102233 363
833 3300020082 Ga0206353_11875109 Ga0206353_118751092 363
834 3300025225 Ga0209566_100053 Ga0209566_100053221 363
835 3300025226 Ga0209674_100001 Ga0209674_1000011635 363
836 3300025228 Ga0209672_100039 Ga0209672_10003996 363
837 3300025229 Ga0209147_101049 Ga0209147_1010498 363
838 3300025230 Ga0209563_100001 Ga0209563_1000011635 363
839 3300025230 Ga0209563_100766 Ga0209563_1007662 363
840 3300025253 Ga0209677_100001 Ga0209677_1000011635 363
841 3300025253 Ga0209677_100448 Ga0209677_10044817 363
842 3300025254 Ga0209148_1000004 Ga0209148_100000496 363
843 3300025272 Ga0209455_1000117 Ga0209455_1000117137 363
844 3300025272 Ga0209455_1003789 Ga0209455_10037893 363
845 3300025302 Ga0207426_1005431 Ga0207426_10054315 363
846 3300025728 Ga0207655_1006296 Ga0207655_10062962 363
847 3300025898 Ga0207692_10049387 Ga0207692_100493872 363
848 3300025898 Ga0207692_10134957 Ga0207692_101349572 363
849 3300025904 Ga0207647_10091475 Ga0207647_100914752 363
850 3300025904 Ga0207647_10135588 Ga0207647_101355881 363
851 3300025905 Ga0207685_10000224 Ga0207685_100002245 363
852 3300025906 Ga0207699_10004744 Ga0207699_100047442 363
853 3300025906 Ga0207699_10005198 Ga0207699_100051982 363
854 3300025909 Ga0207705_10000001 Ga0207705_10000001643 363
855 3300025909 Ga0207705_10139709 Ga0207705_101397092 363
856 3300025910 Ga0207684_10002459 Ga0207684_1000245912 363
857 3300025910 Ga0207684_10006157 Ga0207684_100061574 363
858 3300025915 Ga0207693_10002782 Ga0207693_100027828 363
859 3300025915 Ga0207693_10008350 Ga0207693_100083505 363
860 3300025915 Ga0207693_10045686 Ga0207693_100456862 363
861 3300025916 Ga0207663_10021516 Ga0207663_100215162 363
862 3300025916 Ga0207663_10034482 Ga0207663_100344822 363
863 3300025916 Ga0207663_10188167 Ga0207663_101881672 363
864 3300025922 Ga0207646_10001959 Ga0207646_1000195910 363
865 3300025922 Ga0207646_10004445 Ga0207646_100044457 363
866 3300025922 Ga0207646_10053018 Ga0207646_100530182 363
867 3300025922 Ga0207646_10117071 Ga0207646_101170712 363
868 3300025927 Ga0207687_10144667 Ga0207687_101446672 363
869 3300025928 Ga0207700_10002291 Ga0207700_100022915 363
870 3300025928 Ga0207700_10014429 Ga0207700_100144293 363
871 3300025928 Ga0207700_10018986 Ga0207700_100189862 363
872 3300025929 Ga0207664_10002440 Ga0207664_100024404 363
873 3300025929 Ga0207664_10002847 Ga0207664_100028477 363
874 3300025929 Ga0207664_10014166 Ga0207664_100141662 363
875 3300025935 Ga0207709_10031526 Ga0207709_100315261 363
876 3300025939 Ga0207665_10002299 Ga0207665_100022994 363
877 3300025939 Ga0207665_10011425 Ga0207665_100114252 363
878 3300025939 Ga0207665_10012620 Ga0207665_100126202 363
879 3300026078 Ga0207702_10173137 Ga0207702_101731371 363
880 3300026095 Ga0207676_10061345 Ga0207676_100613452 363
881 3300026116 Ga0207674_10013065 Ga0207674_100130654 363
882 3300026121 Ga0207683_10059997 Ga0207683_100599974 363
883 3300027907 Ga0207428_10085407 Ga0207428_100854072 363
884 3300028786 Ga0307517_10002777 Ga0307517_100027777 363
885 3300031251 Ga0265327_10000019 Ga0265327_10000019181 363
886 3300031616 Ga0307508_10001583 Ga0307508_1000158326 363
887 3300031649 Ga0307514_10096465 Ga0307514_100964652 363
888 3300031730 Ga0307516_10036778 Ga0307516_100367783 363
889 3300031901 Ga0307406_10000104 Ga0307406_1000010435 363
890 3300034957 Ga0373938_0002225 Ga0373938_0002225_172_1296 363
891 3300035083 Ga0373926_0054436 Ga0373926_0054436_199_1323 363
892 3300035086 Ga0373934_0000060 Ga0373934_0000060_11477_12601 363
893 3300035086 Ga0373934_0021948 Ga0373934_0021948_409_1533 363
894 3300035088 Ga0373940_0013993 Ga0373940_0013993_443_1567 363
895 3300035089 Ga0373944_0006615 Ga0373944_0006615_865_1989 363
896 3300035111 Ga0373923_0006524 Ga0373923_0006524_1774_2898 363
897 3300035111 Ga0373923_0022397 Ga0373923_0022397_123_1247 363
898 3300035111 Ga0373923_0030949 Ga0373923_0030949_18_1142 363
899 3300035113 Ga0373936_0015652 Ga0373936_0015652_1577_2701 363
900 3300035113 Ga0373936_0057553 Ga0373936_0057553_406_1530 363
901 3300035117 Ga0373953_0000277 Ga0373953_0000277_2409_3533 363
902 3300035117 Ga0373953_0002414 Ga0373953_0002414_4429_5553 363
903 3300035117 Ga0373953_0003904 Ga0373953_0003904_211_1335 363
904 3300035117 Ga0373953_0012377 Ga0373953_0012377_897_2021 363
905 3300035118 Ga0373954_0002950 Ga0373954_0002950_850_1974 363
906 3300035118 Ga0373954_0023130 Ga0373954_0023130_66_1190 363
907 3300035118 Ga0373954_0025004 Ga0373954_0025004_675_1799 363
908 3300035119 Ga0373956_0000422 Ga0373956_0000422_14154_15278 363
909 3300035119 Ga0373956_0005349 Ga0373956_0005349_382_1506 363
910 3300035119 Ga0373956_0029433 Ga0373956_0029433_1092_2216 363
911 3300035120 Ga0373957_0000077 Ga0373957_0000077_9016_10140 363
912 3300035120 Ga0373957_0002673 Ga0373957_0002673_881_2005 363
913 3300035120 Ga0373957_0024157 Ga0373957_0024157_675_1799 363
914 3300035171 Ga0373946_0007865 Ga0373946_0007865_1785_2909 363
915 3300035171 Ga0373946_0059149 Ga0373946_0059149_384_1508 363
916 3300035172 Ga0373955_0000013 Ga0373955_0000013_46762_47886 363
917 3300035172 Ga0373955_0094242 Ga0373955_0094242_249_1373 363
918 3300035410 Ga0373924_0009894 Ga0373924_0009894_2002_3126 363
919 3300035692 Ga0373935_0037830 Ga0373935_0037830_1122_2246 363
920 3300035695 Ga0373927_0144016 Ga0373927_0144016_401_1525 363
921 3300035724 Ga0373933_0000139 Ga0373933_0000139_22521_23645 363
922 3300035724 Ga0373933_0001396 Ga0373933_0001396_4831_5955 363
923 3300035725 Ga0373947_0123178 Ga0373947_0123178_329_1453 363
924 3300036401 Ga0373937_0000112 Ga0373937_0000112_68470_69594 363
925 3300036401 Ga0373937_0010609 Ga0373937_0010609_4362_5486 363
926 3300036401 Ga0373937_0037477 Ga0373937_0037477_1495_2619 363
927 3300037068 Ga0373925_0007151 Ga0373925_0007151_860_1984 363
928 3300037312 Ga0395899_0184253 Ga0395899_0184253_232_1350 363
929 3300037466 Ga0395898_0000381 Ga0395898_0000381_62121_63239 363
930 3300037466 Ga0395898_0367269 Ga0395898_0367269_163_1284 363
931 3300037853 Ga0436364_0464514 Ga0436364_0464514_1394_2518 363
932 3300038443 Ga0395901_0079374 Ga0395901_0079374_52_1170 363
933 3300038443 Ga0395901_0135263 Ga0395901_0135263_856_1974 363
934 3300044658 Ga0466972_0035044 Ga0466972_0035044_1142_2263 363
935 3300044684 Ga0466966_0032573 Ga0466966_0032573_2097_3215 363
936 3300044693 Ga0466961_0031022 Ga0466961_0031022_1906_3024 363
937 3300044693 Ga0466961_0072229 Ga0466961_0072229_507_1625 363
938 3300044735 Ga0466968_0010980 Ga0466968_0010980_1154_2272 363
939 3300044765 Ga0466970_0000322 Ga0466970_0000322_5879_7000 363
940 3300044765 Ga0466970_0004093 Ga0466970_0004093_5069_6187 363
941 3300044765 Ga0466970_0057628 Ga0466970_0057628_231_1349 363
942 3300044901 Ga0466960_0029531 Ga0466960_0029531_1370_2488 363
943 3300045049 Ga0466959_0005248 Ga0466959_0005248_977_2095 363
944 3300045049 Ga0466959_0051206 Ga0466959_0051206_1832_2956 363
945 3300045976 Ga0466967_0053667 Ga0466967_0053667_675_1793 363
946 3300046454 Ga0495592_0000094 Ga0495592_0000094_25564_26688 363
947 3300046454 Ga0495592_0086011 Ga0495592_0086011_931_2055 363
948 3300046454 Ga0495592_0103099 Ga0495592_0103099_548_1669 363
949 3300046454 Ga0495592_0110410 Ga0495592_0110410_418_1542 363
950 3300046455 Ga0495603_0167868 Ga0495603_0167868_77_1198 363
951 3300046459 Ga0495629_0079132 Ga0495629_0079132_208_1329 363
952 3300046460 Ga0495638_0183544 Ga0495638_0183544_48_1169 363
953 3300046461 Ga0495641_0016263 Ga0495641_0016263_1270_2394 363
954 3300046462 Ga0495651_0000041 Ga0495651_0000041_40923_42047 363
955 3300046462 Ga0495651_0013168 Ga0495651_0013168_314_1438 363
956 3300046462 Ga0495651_0068071 Ga0495651_0068071_427_1551 363
957 3300046462 Ga0495651_0073357 Ga0495651_0073357_800_1924 363
958 3300046462 Ga0495651_0084716 Ga0495651_0084716_1173_2294 363
959 3300046463 Ga0495653_0002267 Ga0495653_0002267_4081_5205 363
960 3300046463 Ga0495653_0026502 Ga0495653_0026502_3124_4248 363
961 3300046463 Ga0495653_0045800 Ga0495653_0045800_1123_2247 363
962 3300046472 Ga0495580_0078078 Ga0495580_0078078_114_1238 363
963 3300046473 Ga0495582_0001614 Ga0495582_0001614_8208_9332 363
964 3300046473 Ga0495582_0070053 Ga0495582_0070053_529_1653 363
965 3300046476 Ga0495662_0006654 Ga0495662_0006654_4298_5422 363
966 3300046476 Ga0495662_0022376 Ga0495662_0022376_132_1256 363
967 3300046477 Ga0495664_0013992 Ga0495664_0013992_1346_2470 363
968 3300046477 Ga0495664_0014416 Ga0495664_0014416_1058_2182 363
969 3300046492 Ga0495585_0002304 Ga0495585_0002304_5286_6407 363
970 3300046511 Ga0495608_0000081 Ga0495608_0000081_25564_26688 363
971 3300046511 Ga0495608_0009160 Ga0495608_0009160_211_1335 363
972 3300046511 Ga0495608_0015039 Ga0495608_0015039_704_1828 363
973 3300046514 Ga0495618_0108606 Ga0495618_0108606_77_1201 363
974 3300046514 Ga0495618_0126501 Ga0495618_0126501_75_1199 363
975 3300046516 Ga0495628_0000164 Ga0495628_0000164_52098_53222 363
976 3300046516 Ga0495628_0112763 Ga0495628_0112763_515_1639 363
977 3300046516 Ga0495628_0134712 Ga0495628_0134712_450_1574 363
978 3300046516 Ga0495628_0138633 Ga0495628_0138633_693_1814 363
979 3300046517 Ga0495630_0118189 Ga0495630_0118189_349_1473 363
980 3300046522 Ga0495643_0001347 Ga0495643_0001347_3862_5019 363
981 3300046529 Ga0495652_0000289 Ga0495652_0000289_6473_7597 363
982 3300046529 Ga0495652_0080266 Ga0495652_0080266_1489_2610 363
983 3300046531 Ga0495665_0003528 Ga0495665_0003528_1632_2756 363
984 3300046531 Ga0495665_0026611 Ga0495665_0026611_1928_3052 363
985 3300046533 Ga0495640_0013085 Ga0495640_0013085_3849_4973 363
986 3300046533 Ga0495640_0026527 Ga0495640_0026527_1951_3072 363
987 3300046533 Ga0495640_0040085 Ga0495640_0040085_1734_2858 363
988 3300046533 Ga0495640_0045928 Ga0495640_0045928_136_1257 363
989 3300046535 Ga0495586_0035870 Ga0495586_0035870_933_2057 363
990 3300046535 Ga0495586_0070150 Ga0495586_0070150_648_1772 363
991 3300046535 Ga0495586_0081510 Ga0495586_0081510_518_1642 363
992 3300046536 Ga0495587_0000038 Ga0495587_0000038_46525_47649 363
993 3300046536 Ga0495587_0002540 Ga0495587_0002540_5603_6727 363
994 3300046536 Ga0495587_0003607 Ga0495587_0003607_1824_2948 363
995 3300046538 Ga0495609_0027336 Ga0495609_0027336_1266_2384 363
996 3300046543 Ga0495645_0017922 Ga0495645_0017922_3528_4652 363
997 3300046543 Ga0495645_0031690 Ga0495645_0031690_2191_3315 363
998 3300046543 Ga0495645_0032889 Ga0495645_0032889_868_1992 363
999 3300046543 Ga0495645_0078459 Ga0495645_0078459_814_1932 363
1000 3300046557 Ga0495622_0006569 Ga0495622_0006569_864_2021 363
1001 3300046559 Ga0495667_0000070 Ga0495667_0000070_52107_53231 363
1002 3300046559 Ga0495667_0052664 Ga0495667_0052664_1346_2470 363
1003 3300046559 Ga0495667_0067051 Ga0495667_0067051_248_1372 363
1004 3300046559 Ga0495667_0119304 Ga0495667_0119304_162_1286 363
1005 3300046642 Ga0495634_0028577 Ga0495634_0028577_991_2115 363
1006 3300046663 Ga0495635_0016282 Ga0495635_0016282_790_1914 363
1007 3300046663 Ga0495635_0032458 Ga0495635_0032458_382_1506 363
1008 3300046674 Ga0495588_0054453 Ga0495588_0054453_828_1952 363
1009 3300046675 Ga0495657_0000192 Ga0495657_0000192_48200_49324 363
1010 3300046675 Ga0495657_0062590 Ga0495657_0062590_1123_2247 363
1011 3300046675 Ga0495657_0114737 Ga0495657_0114737_77_1201 363
1012 3300046678 Ga0495599_0000100 Ga0495599_0000100_40870_41994 363
1013 3300046678 Ga0495599_0007362 Ga0495599_0007362_1270_2394 363
1014 3300046678 Ga0495599_0050021 Ga0495599_0050021_1334_2458 363
1015 3300046679 Ga0495623_0000409 Ga0495623_0000409_16923_18047 363
1016 3300046679 Ga0495623_0002698 Ga0495623_0002698_4077_5201 363
1017 3300046680 Ga0495646_0051293 Ga0495646_0051293_211_1335 363
1018 3300046681 Ga0495647_0011635 Ga0495647_0011635_1461_2585 363
1019 3300046683 Ga0495658_0038925 Ga0495658_0038925_1501_2622 363
1020 3300046683 Ga0495658_0087508 Ga0495658_0087508_437_1561 363
1021 3300046689 Ga0495613_0007805 Ga0495613_0007805_29_1150 363
1022 3300046689 Ga0495613_0043432 Ga0495613_0043432_214_1338 363
1023 3300046689 Ga0495613_0222982 Ga0495613_0222982_22_1143 363
1024 3300046690 Ga0495624_0022253 Ga0495624_0022253_2075_3199 363
1025 3300046690 Ga0495624_0046417 Ga0495624_0046417_170_1294 363
1026 3300046691 Ga0495670_0023417 Ga0495670_0023417_1456_2574 363
1027 3300046809 Ga0495600_0001188 Ga0495600_0001188_12903_14027 363
1028 3300046809 Ga0495600_0140257 Ga0495600_0140257_144_1268 363
1029 3300046810 Ga0495660_0006238 Ga0495660_0006238_4404_5561 363
1030 3300047315 Ga0495581_0110107 Ga0495581_0110107_139_1263 363
1031 3300047317 Ga0495604_0000061 Ga0495604_0000061_52114_53238 363
1032 3300047317 Ga0495604_0026075 Ga0495604_0026075_2842_3963 363
1033 3300047317 Ga0495604_0141761 Ga0495604_0141761_382_1506 363
1034 3300047317 Ga0495604_0223403 Ga0495604_0223403_11_1135 363
1035 3300047319 Ga0495674_0027638 Ga0495674_0027638_808_1932 363
1036 3300047319 Ga0495674_0083559 Ga0495674_0083559_315_1439 363
1037 3300047319 Ga0495674_0148901 Ga0495674_0148901_125_1249 363
1038 3300047321 Ga0495676_0071092 Ga0495676_0071092_1476_2597 363
1039 3300047322 Ga0495680_0000099 Ga0495680_0000099_52114_53238 363
1040 3300047322 Ga0495680_0069758 Ga0495680_0069758_211_1335 363
1041 3300047443 Ga0495687_026770 Ga0495687_026770_1277_2434 363
1042 3300047444 Ga0495675_0005606 Ga0495675_0005606_3290_4414 363
1043 3300047444 Ga0495675_0017765 Ga0495675_0017765_3075_4199 363
1044 3300047444 Ga0495675_0019565 Ga0495675_0019565_439_1563 363
1045 3300047444 Ga0495675_0052338 Ga0495675_0052338_538_1662 363
1046 3300047447 Ga0495685_000277 Ga0495685_000277_15980_17137 363
1047 3300047471 Ga0495684_0002552 Ga0495684_0002552_11928_13052 363
1048 3300047471 Ga0495684_0089962 Ga0495684_0089962_399_1523 363
1049 3300047471 Ga0495684_0154148 Ga0495684_0154148_211_1335 363
1050 3300047673 Ga0495593_0007995 Ga0495593_0007995_3212_4336 363
1051 3300048088 Ga0495602_0000649 Ga0495602_0000649_25564_26688 363
1052 3300048088 Ga0495602_0046525 Ga0495602_0046525_1169_2293 363
1053 3300048088 Ga0495602_0108079 Ga0495602_0108079_211_1335 363
1054 3300048904 Ga0496101_0028405 Ga0496101_0028405_1164_2282 363
1055 3300048904 Ga0496101_0158675 Ga0496101_0158675_468_1586 363
1056 3300048907 Ga0496104_0006329 Ga0496104_0006329_6233_7357 363
1057 3300048907 Ga0496104_0315250 Ga0496104_0315250_268_1386 363
1058 3300048907 Ga0496104_0349905 Ga0496104_0349905_213_1331 363
1059 3300048908 Ga0496105_0041449 Ga0496105_0041449_1545_2663 363
1060 3300048908 Ga0496105_0094807 Ga0496105_0094807_138_1256 363
1061 3300048908 Ga0496105_0142604 Ga0496105_0142604_432_1556 363
1062 3300048908 Ga0496105_0147804 Ga0496105_0147804_277_1401 363
1063 3300048909 Ga0496106_0050284 Ga0496106_0050284_1366_2490 363
1064 3300048910 Ga0496107_0076637 Ga0496107_0076637_528_1652 363
1065 3300048911 Ga0496108_0006606 Ga0496108_0006606_6024_7148 363
1066 3300048911 Ga0496108_0086847 Ga0496108_0086847_514_1632 363
1067 3300048911 Ga0496108_0311417 Ga0496108_0311417_187_1305 363
1068 3300048912 Ga0496109_0043541 Ga0496109_0043541_891_2015 363
1069 3300048912 Ga0496109_0093261 Ga0496109_0093261_1243_2361 363
1070 3300048913 Ga0496110_0110730 Ga0496110_0110730_692_1810 363
1071 3300048913 Ga0496110_0180304 Ga0496110_0180304_753_1871 363
1072 3300048915 Ga0496112_0004882 Ga0496112_0004882_10179_11303 363
1073 3300048916 Ga0496113_0017024 Ga0496113_0017024_593_1717 363
1074 3300048917 Ga0496114_0130696 Ga0496114_0130696_632_1750 363
1075 3300048918 Ga0496115_0004890 Ga0496115_0004890_877_2001 363
1076 3300048918 Ga0496115_0006671 Ga0496115_0006671_4154_5272 363
1077 3300048918 Ga0496115_0030355 Ga0496115_0030355_2610_3728 363
1078 3300048918 Ga0496115_0133557 Ga0496115_0133557_806_1924 363
1079 3300048920 Ga0496117_0000387 Ga0496117_0000387_17175_18293 363
1080 3300048920 Ga0496117_0000738 Ga0496117_0000738_9135_10253 363
1081 3300048920 Ga0496117_0012087 Ga0496117_0012087_5350_6468 363
1082 3300048920 Ga0496117_0041758 Ga0496117_0041758_802_1920 363
1083 3300048921 Ga0496118_0002673 Ga0496118_0002673_1265_2383 363
1084 3300048921 Ga0496118_0091107 Ga0496118_0091107_10_1128 363
1085 3300048922 Ga0496119_0001355 Ga0496119_0001355_26449_27567 363
1086 3300048922 Ga0496119_0002632 Ga0496119_0002632_4517_5635 363
1087 3300048922 Ga0496119_0041849 Ga0496119_0041849_1211_2329 363
1088 3300048924 Ga0496121_0219052 Ga0496121_0219052_205_1323 363
1089 3300048925 Ga0496122_0001218 Ga0496122_0001218_9160_10278 363
1090 3300048925 Ga0496122_0005902 Ga0496122_0005902_6158_7276 363
1091 3300048925 Ga0496122_0086360 Ga0496122_0086360_455_1573 363
1092 3300048926 Ga0496123_0000009 Ga0496123_0000009_444679_445797 363
1093 3300048926 Ga0496123_0078797 Ga0496123_0078797_435_1553 363
1094 3300048927 Ga0496124_0039133 Ga0496124_0039133_1310_2428 363
1095 3300048928 Ga0496125_0000209 Ga0496125_0000209_90162_91280 363
1096 3300048929 Ga0496126_0007345 Ga0496126_0007345_8167_9285 363
1097 3300048929 Ga0496126_0118501 Ga0496126_0118501_766_1884 363
1098 3300049568 Ga0501031_0005538 Ga0501031_0005538_1083_2201 363
1099 3300049568 Ga0501031_0006771 Ga0501031_0006771_4769_5887 363
1100 3300049568 Ga0501031_0028733 Ga0501031_0028733_1809_2930 363
1101 3300049569 Ga0501032_0007901 Ga0501032_0007901_1213_2331 363
1102 3300049569 Ga0501032_0010914 Ga0501032_0010914_1880_2998 363
1103 3300049569 Ga0501032_0043425 Ga0501032_0043425_102_1262 363
1104 3300049569 Ga0501032_0057119 Ga0501032_0057119_85_1203 363
1105 3300049569 Ga0501032_0143916 Ga0501032_0143916_32_1159 363
1106 3300049570 Ga0501033_0006784 Ga0501033_0006784_2965_4083 363
1107 3300049570 Ga0501033_0037448 Ga0501033_0037448_680_1807 363
1108 3300049570 Ga0501033_0047280 Ga0501033_0047280_832_1950 363
1109 3300049571 Ga0501034_0000910 Ga0501034_0000910_4829_5953 363
1110 3300049571 Ga0501034_0004610 Ga0501034_0004610_1995_3113 363
1111 3300049571 Ga0501034_0007328 Ga0501034_0007328_6575_7735 363
1112 3300049571 Ga0501034_0024475 Ga0501034_0024475_4120_5238 363
1113 3300049571 Ga0501034_0032998 Ga0501034_0032998_841_1959 363
1114 3300049571 Ga0501034_0062895 Ga0501034_0062895_1999_3126 363
1115 3300049571 Ga0501034_0069979 Ga0501034_0069979_2019_3137 363
1116 3300049571 Ga0501034_0095490 Ga0501034_0095490_597_1715 363
1117 3300049571 Ga0501034_0172223 Ga0501034_0172223_152_1270 363
1118 3300049572 Ga0501036_0003126 Ga0501036_0003126_1305_2423 363
1119 3300049572 Ga0501036_0061367 Ga0501036_0061367_1589_2749 363
1120 3300049572 Ga0501036_0070904 Ga0501036_0070904_25_1152 363
1121 3300049572 Ga0501036_0082954 Ga0501036_0082954_1109_2227 363
1122 3300049573 Ga0501037_0005417 Ga0501037_0005417_1256_2374 363
1123 3300049573 Ga0501037_0019639 Ga0501037_0019639_1790_2908 363
1124 3300049574 Ga0501038_0002793 Ga0501038_0002793_4617_5735 363
1125 3300049574 Ga0501038_0019392 Ga0501038_0019392_4332_5492 363
1126 3300049574 Ga0501038_0075649 Ga0501038_0075649_128_1246 363
1127 3300049574 Ga0501038_0125533 Ga0501038_0125533_424_1542 363
1128 3300049575 Ga0501039_0001345 Ga0501039_0001345_3141_4259 363
1129 3300049575 Ga0501039_0014554 Ga0501039_0014554_4582_5700 363
1130 3300049579 Ga0501043_0008953 Ga0501043_0008953_5322_6440 363
1131 3300049579 Ga0501043_0010184 Ga0501043_0010184_6049_7209 363
1132 3300049579 Ga0501043_0043814 Ga0501043_0043814_410_1528 363
1133 3300049579 Ga0501043_0091786 Ga0501043_0091786_159_1277 363
1134 3300049579 Ga0501043_0119796 Ga0501043_0119796_137_1255 363
1135 3300049580 Ga0501046_0007136 Ga0501046_0007136_5761_6879 363
1136 3300049581 Ga0501047_0000005 Ga0501047_0000005_39112_40233 363
1137 3300049581 Ga0501047_0010901 Ga0501047_0010901_2947_4065 363
1138 3300049581 Ga0501047_0018642 Ga0501047_0018642_1358_2476 363
1139 3300049581 Ga0501047_0050684 Ga0501047_0050684_960_2087 363
1140 3300049581 Ga0501047_0082245 Ga0501047_0082245_963_2081 363
1141 3300049581 Ga0501047_0239018 Ga0501047_0239018_99_1259 363
1142 3300049581 Ga0501047_0371310 Ga0501047_0371310_74_1195 363
1143 3300049582 Ga0501048_0008906 Ga0501048_0008906_5572_6690 363
1144 3300049582 Ga0501048_0101153 Ga0501048_0101153_560_1678 363
1145 3300049586 Ga0501070_0002352 Ga0501070_0002352_6996_8114 363
1146 3300049586 Ga0501070_0010098 Ga0501070_0010098_5840_6958 363
1147 3300049586 Ga0501070_0015896 Ga0501070_0015896_5139_6257 363
1148 3300049586 Ga0501070_0039125 Ga0501070_0039125_617_1735 363
1149 3300049586 Ga0501070_0236002 Ga0501070_0236002_16_1134 363
1150 3300049587 Ga0501071_0061566 Ga0501071_0061566_270_1388 363
1151 3300049590 Ga0501074_0089288 Ga0501074_0089288_520_1638 363
1152 3300049742 Ga0501080_0064971 Ga0501080_0064971_954_2072 363
1153 3300049822 Ga0501035_0013293 Ga0501035_0013293_5173_6291 363
1154 3300049822 Ga0501035_0015593 Ga0501035_0015593_1192_2310 363
1155 3300049822 Ga0501035_0017656 Ga0501035_0017656_1968_3086 363
1156 3300049822 Ga0501035_0024286 Ga0501035_0024286_786_1946 363
1157 3300049822 Ga0501035_0029166 Ga0501035_0029166_3620_4738 363
1158 3300049822 Ga0501035_0031513 Ga0501035_0031513_1117_2244 363
1159 3300049823 Ga0501044_0010052 Ga0501044_0010052_6998_8125 363
1160 3300049823 Ga0501044_0012278 Ga0501044_0012278_7359_8477 363
1161 3300049823 Ga0501044_0015296 Ga0501044_0015296_2614_3732 363
1162 3300049823 Ga0501044_0088361 Ga0501044_0088361_566_1726 363
1163 3300049823 Ga0501044_0104368 Ga0501044_0104368_866_1984 363
1164 3300049823 Ga0501044_0230097 Ga0501044_0230097_274_1392 363
1165 3300050492 nmdc:mga0yw44_109474_c1 nmdc:mga0yw44_109474_c1_347_1465 363
1166 3300050507 nmdc:mga05p37_9690_c1 nmdc:mga05p37_9690_c1_5506_6630 363
1167 3300050511 nmdc:mga08y16_47659_c1 nmdc:mga08y16_47659_c1_981_2105 363
1168 3300050512 nmdc:mga0n895_12260_c1 nmdc:mga0n895_12260_c1_3455_4579 363
1169 3300050512 nmdc:mga0n895_64173_c1 nmdc:mga0n895_64173_c1_1573_2697 363
1170 3300050513 nmdc:mga0rr50_95002_c1 nmdc:mga0rr50_95002_c1_1145_2269 363
1171 3300050514 nmdc:mga08x19_33654_c1 nmdc:mga08x19_33654_c1_1217_2341 363
1172 3300053078 Ga0495612_0010525 Ga0495612_0010525_1142_2266 363
1173 3300053078 Ga0495612_0024452 Ga0495612_0024452_537_1661 363
1174 3300053078 Ga0495612_0045980 Ga0495612_0045980_271_1395 363
1175 3300053080 Ga0500635_0000664 Ga0500635_0000664_1887_3005 363
1176 3300053084 Ga0495595_0001495 Ga0495595_0001495_7721_8845 363
1177 3300053084 Ga0495595_0020681 Ga0495595_0020681_162_1286 363
1178 3300053084 Ga0495595_0036502 Ga0495595_0036502_677_1801 363
1179 3300053085 Ga0495619_0021908 Ga0495619_0021908_1254_2378 363
1180 3300053086 Ga0500578_0014632 Ga0500578_0014632_68_1225 363
1181 3300053107 Ga0500560_009842 Ga0500560_009842_49_1170 363
1182 3300053134 Ga0500658_0004371 Ga0500658_0004371_4089_5246 363
1183 3300053136 Ga0500559_0000800 Ga0500559_0000800_392_1510 363
1184 3300053140 Ga0500573_0006418 Ga0500573_0006418_4596_5717 363
1185 3300053153 Ga0500616_0000027 Ga0500616_0000027_163332_164450 363
1186 3300053161 Ga0500634_0003371 Ga0500634_0003371_5831_6988 363
1187 3300059424 Ga0590075_003544 Ga0590075_003544_2418_3545 363
1188 iso_pu_bacteria 2523231044 2523384565 363
1189 iso_pu_bacteria 2751185725 2753037991 363
1190 iso_pu_bacteria 2751185792 2753325859 363
1191 iso_pu_bacteria 2919051321 2919054468 363
1192 iso_pu_bacteria 2946024296 2946026599 363
1193 3300003203 JGI25406J46586_10001751 JGI25406J46586_100017515 364
1194 3300003578 Ga0006562J51391_1098594 Ga0006562J51391_10985943 364
1195 3300003578 Ga0006562J51391_1098595 Ga0006562J51391_10985952 364
1196 3300005327 Ga0070658_10013342 Ga0070658_100133422 364
1197 3300005327 Ga0070658_10219665 Ga0070658_102196652 364
1198 3300005329 Ga0070683_100019688 Ga0070683_1000196884 364
1199 3300005329 Ga0070683_100048077 Ga0070683_1000480772 364
1200 3300005330 Ga0070690_100059023 Ga0070690_1000590232 364
1201 3300005339 Ga0070660_100081123 Ga0070660_1000811232 364
1202 3300005340 Ga0070689_100095806 Ga0070689_1000958061 364
1203 3300005341 Ga0070691_10120944 Ga0070691_101209441 364
1204 3300005345 Ga0070692_10019702 Ga0070692_100197022 364
1205 3300005354 Ga0070675_100032384 Ga0070675_1000323843 364
1206 3300005356 Ga0070674_100078162 Ga0070674_1000781622 364
1207 3300005364 Ga0070673_100038887 Ga0070673_1000388871 364
1208 3300005364 Ga0070673_100058206 Ga0070673_1000582062 364
1209 3300005366 Ga0070659_100053135 Ga0070659_1000531352 364
1210 3300005367 Ga0070667_100021591 Ga0070667_1000215916 364
1211 3300005434 Ga0070709_10000118 Ga0070709_1000011810 364
1212 3300005434 Ga0070709_10003048 Ga0070709_100030482 364
1213 3300005435 Ga0070714_100001466 Ga0070714_1000014664 364
1214 3300005435 Ga0070714_100073929 Ga0070714_1000739292 364
1215 3300005436 Ga0070713_100001299 Ga0070713_10000129910 364
1216 3300005436 Ga0070713_100018101 Ga0070713_1000181012 364
1217 3300005436 Ga0070713_100026407 Ga0070713_1000264072 364
1218 3300005437 Ga0070710_10000216 Ga0070710_1000021610 364
1219 3300005437 Ga0070710_10001064 Ga0070710_100010646 364
1220 3300005437 Ga0070710_10024900 Ga0070710_100249002 364
1221 3300005437 Ga0070710_10054249 Ga0070710_100542492 364
1222 3300005437 Ga0070710_10075637 Ga0070710_100756372 364
1223 3300005437 Ga0070710_10113558 Ga0070710_101135581 364
1224 3300005439 Ga0070711_100000774 Ga0070711_10000077410 364
1225 3300005439 Ga0070711_100001507 Ga0070711_1000015072 364
1226 3300005439 Ga0070711_100011359 Ga0070711_1000113593 364
1227 3300005440 Ga0070705_100027550 Ga0070705_1000275502 364
1228 3300005440 Ga0070705_100143311 Ga0070705_1001433112 364
1229 3300005445 Ga0070708_100114211 Ga0070708_1001142111 364
1230 3300005445 Ga0070708_100282487 Ga0070708_1002824872 364
1231 3300005456 Ga0070678_100059360 Ga0070678_1000593602 364
1232 3300005456 Ga0070678_100216134 Ga0070678_1002161342 364
1233 3300005458 Ga0070681_10113295 Ga0070681_101132952 364
1234 3300005459 Ga0068867_100277951 Ga0068867_1002779511 364
1235 3300005466 Ga0070685_10017980 Ga0070685_100179802 364
1236 3300005467 Ga0070706_100007246 Ga0070706_1000072464 364
1237 3300005467 Ga0070706_100019132 Ga0070706_1000191323 364
1238 3300005467 Ga0070706_100029833 Ga0070706_1000298333 364
1239 3300005468 Ga0070707_100017111 Ga0070707_1000171112 364
1240 3300005468 Ga0070707_100063769 Ga0070707_1000637692 364
1241 3300005468 Ga0070707_100120942 Ga0070707_1001209422 364
1242 3300005471 Ga0070698_100000621 Ga0070698_10000062112 364
1243 3300005471 Ga0070698_100035507 Ga0070698_1000355073 364
1244 3300005530 Ga0070679_100105416 Ga0070679_1001054162 364
1245 3300005530 Ga0070679_100127582 Ga0070679_1001275822 364
1246 3300005530 Ga0070679_100140904 Ga0070679_1001409041 364
1247 3300005535 Ga0070684_100029632 Ga0070684_1000296322 364
1248 3300005535 Ga0070684_100122242 Ga0070684_1001222421 364
1249 3300005539 Ga0068853_100074526 Ga0068853_1000745261 364
1250 3300005539 Ga0068853_100185674 Ga0068853_1001856742 364
1251 3300005539 Ga0068853_100258327 Ga0068853_1002583272 364
1252 3300005543 Ga0070672_100013432 Ga0070672_1000134324 364
1253 3300005543 Ga0070672_100021208 Ga0070672_1000212083 364
1254 3300005545 Ga0070695_100058153 Ga0070695_1000581532 364
1255 3300005546 Ga0070696_100048404 Ga0070696_1000484042 364
1256 3300005547 Ga0070693_100032957 Ga0070693_1000329572 364
1257 3300005548 Ga0070665_100215114 Ga0070665_1002151142 364
1258 3300005549 Ga0070704_100145513 Ga0070704_1001455132 364
1259 3300005563 Ga0068855_100022690 Ga0068855_1000226906 364
1260 3300005563 Ga0068855_100043681 Ga0068855_1000436814 364
1261 3300005563 Ga0068855_100177890 Ga0068855_1001778903 364
1262 3300005564 Ga0070664_100076214 Ga0070664_1000762142 364
1263 3300005578 Ga0068854_100051107 Ga0068854_1000511072 364
1264 3300005614 Ga0068856_100103109 Ga0068856_1001031092 364
1265 3300005614 Ga0068856_100288139 Ga0068856_1002881392 364
1266 3300005614 Ga0068856_100368358 Ga0068856_1003683582 364
1267 3300005615 Ga0070702_100000716 Ga0070702_10000071610 364
1268 3300005616 Ga0068852_100188837 Ga0068852_1001888371 364
1269 3300005616 Ga0068852_100201339 Ga0068852_1002013392 364
1270 3300005617 Ga0068859_100078111 Ga0068859_1000781113 364
1271 3300005719 Ga0068861_100025788 Ga0068861_1000257883 364
1272 3300005840 Ga0068870_10043557 Ga0068870_100435571 364
1273 3300005841 Ga0068863_100027376 Ga0068863_1000273762 364
1274 3300005841 Ga0068863_100413521 Ga0068863_1004135211 364
1275 3300005842 Ga0068858_100000016 Ga0068858_1000000167 364
1276 3300005843 Ga0068860_100240062 Ga0068860_1002400622 364
1277 3300005983 Ga0081540_1002515 Ga0081540_10025157 364
1278 3300005983 Ga0081540_1002903 Ga0081540_10029033 364
1279 3300005985 Ga0081539_10001393 Ga0081539_1000139319 364
1280 3300005985 Ga0081539_10019489 Ga0081539_100194894 364
1281 3300006028 Ga0070717_10000504 Ga0070717_100005047 364
1282 3300006028 Ga0070717_10055270 Ga0070717_100552702 364
1283 3300006028 Ga0070717_10058992 Ga0070717_100589923 364
1284 3300006028 Ga0070717_10120794 Ga0070717_101207942 364
1285 3300006028 Ga0070717_10210671 Ga0070717_102106712 364
1286 3300006038 Ga0075365_10017542 Ga0075365_100175422 364
1287 3300006038 Ga0075365_10022365 Ga0075365_100223653 364
1288 3300006163 Ga0070715_10003999 Ga0070715_100039992 364
1289 3300006163 Ga0070715_10086227 Ga0070715_100862272 364
1290 3300006173 Ga0070716_100068368 Ga0070716_1000683682 364
1291 3300006175 Ga0070712_100006228 Ga0070712_1000062285 364
1292 3300006175 Ga0070712_100049554 Ga0070712_1000495542 364
1293 3300006175 Ga0070712_100060346 Ga0070712_1000603462 364
1294 3300006871 Ga0075434_100060076 Ga0075434_1000600762 364
1295 3300006931 Ga0097620_100078109 Ga0097620_1000781092 364
1296 3300009011 Ga0105251_10006598 Ga0105251_100065984 364
1297 3300009011 Ga0105251_10011880 Ga0105251_100118804 364
1298 3300009098 Ga0105245_10036186 Ga0105245_100361863 364
1299 3300009098 Ga0105245_10319187 Ga0105245_103191872 364
1300 3300009101 Ga0105247_10070656 Ga0105247_100706563 364
1301 3300009148 Ga0105243_10149832 Ga0105243_101498321 364
1302 3300009148 Ga0105243_10228885 Ga0105243_102288852 364
1303 3300009176 Ga0105242_10020736 Ga0105242_100207362 364
1304 3300009176 Ga0105242_10033389 Ga0105242_100333892 364
1305 3300009176 Ga0105242_10274188 Ga0105242_102741882 364
1306 3300009177 Ga0105248_10000880 Ga0105248_1000088018 364
1307 3300009177 Ga0105248_10091708 Ga0105248_100917082 364
1308 3300009177 Ga0105248_10246363 Ga0105248_102463631 364
1309 3300009545 Ga0105237_10166341 Ga0105237_101663412 364
1310 3300009553 Ga0105249_10065057 Ga0105249_100650573 364
1311 3300009553 Ga0105249_10152986 Ga0105249_101529862 364
1312 3300009553 Ga0105249_10175164 Ga0105249_101751642 364
1313 3300012476 Ga0157344_1000433 Ga0157344_10004332 364
1314 3300013100 Ga0157373_10091086 Ga0157373_100910862 364
1315 3300013105 Ga0157369_10050500 Ga0157369_100505003 364
1316 3300013105 Ga0157369_10077143 Ga0157369_100771432 364
1317 3300013296 Ga0157374_10024151 Ga0157374_100241515 364
1318 3300013296 Ga0157374_10191923 Ga0157374_101919232 364
1319 3300013306 Ga0163162_10017442 Ga0163162_100174426 364
1320 3300013308 Ga0157375_10222721 Ga0157375_102227212 364
1321 3300013308 Ga0157375_10583356 Ga0157375_105833561 364
1322 3300014325 Ga0163163_10008035 Ga0163163_100080355 364
1323 3300014325 Ga0163163_10245003 Ga0163163_102450032 364
1324 3300014326 Ga0157380_10018506 Ga0157380_100185065 364
1325 3300014326 Ga0157380_10177247 Ga0157380_101772472 364
1326 3300014497 Ga0182008_10000155 Ga0182008_100001551 364
1327 3300014745 Ga0157377_10011120 Ga0157377_100111203 364
1328 3300015262 Ga0182007_10006083 Ga0182007_100060831 364
1329 3300015688 Ga0183367_1002 Ga0183367_1002691 364
1330 3300017792 Ga0163161_10064109 Ga0163161_100641092 364
1331 3300020069 Ga0197907_10622146 Ga0197907_106221462 364
1332 3300020081 Ga0206354_10854419 Ga0206354_108544192 364
1333 3300020081 Ga0206354_11707980 Ga0206354_117079802 364
1334 3300022467 Ga0224712_10021596 Ga0224712_100215962 364
1335 3300024225 Ga0224572_1000179 Ga0224572_10001794 364
1336 3300025297 Ga0209758_1002219 Ga0209758_10022194 364
1337 3300025885 Ga0207653_10006417 Ga0207653_100064172 364
1338 3300025898 Ga0207692_10000225 Ga0207692_1000022510 364
1339 3300025898 Ga0207692_10009769 Ga0207692_100097692 364
1340 3300025898 Ga0207692_10051604 Ga0207692_100516042 364
1341 3300025899 Ga0207642_10011637 Ga0207642_100116372 364
1342 3300025900 Ga0207710_10033869 Ga0207710_100338692 364
1343 3300025900 Ga0207710_10052795 Ga0207710_100527952 364
1344 3300025904 Ga0207647_10009551 Ga0207647_100095517 364
1345 3300025905 Ga0207685_10030315 Ga0207685_100303152 364
1346 3300025906 Ga0207699_10000106 Ga0207699_1000010621 364
1347 3300025906 Ga0207699_10007365 Ga0207699_100073654 364
1348 3300025906 Ga0207699_10008667 Ga0207699_100086673 364
1349 3300025908 Ga0207643_10015262 Ga0207643_100152622 364
1350 3300025908 Ga0207643_10135365 Ga0207643_101353652 364
1351 3300025909 Ga0207705_10099321 Ga0207705_100993212 364
1352 3300025909 Ga0207705_10145603 Ga0207705_101456032 364
1353 3300025910 Ga0207684_10032282 Ga0207684_100322823 364
1354 3300025910 Ga0207684_10032768 Ga0207684_100327682 364
1355 3300025912 Ga0207707_10303097 Ga0207707_103030972 364
1356 3300025913 Ga0207695_10005496 Ga0207695_100054968 364
1357 3300025914 Ga0207671_10177663 Ga0207671_101776631 364
1358 3300025915 Ga0207693_10003038 Ga0207693_100030386 364
1359 3300025915 Ga0207693_10007334 Ga0207693_100073342 364
1360 3300025915 Ga0207693_10087986 Ga0207693_100879862 364
1361 3300025916 Ga0207663_10005403 Ga0207663_100054034 364
1362 3300025916 Ga0207663_10091360 Ga0207663_100913602 364
1363 3300025918 Ga0207662_10002253 Ga0207662_100022537 364
1364 3300025919 Ga0207657_10018246 Ga0207657_100182463 364
1365 3300025919 Ga0207657_10080562 Ga0207657_100805622 364
1366 3300025921 Ga0207652_10068778 Ga0207652_100687783 364
1367 3300025921 Ga0207652_10118221 Ga0207652_101182212 364
1368 3300025922 Ga0207646_10020856 Ga0207646_100208564 364
1369 3300025922 Ga0207646_10312279 Ga0207646_103122791 364
1370 3300025922 Ga0207646_10345862 Ga0207646_103458622 364
1371 3300025927 Ga0207687_10043864 Ga0207687_100438642 364
1372 3300025928 Ga0207700_10000053 Ga0207700_1000005361 364
1373 3300025928 Ga0207700_10011392 Ga0207700_100113922 364
1374 3300025928 Ga0207700_10016711 Ga0207700_100167112 364
1375 3300025928 Ga0207700_10034772 Ga0207700_100347722 364
1376 3300025928 Ga0207700_10065079 Ga0207700_100650792 364
1377 3300025929 Ga0207664_10000701 Ga0207664_1000070110 364
1378 3300025929 Ga0207664_10002931 Ga0207664_100029317 364
1379 3300025929 Ga0207664_10005087 Ga0207664_100050875 364
1380 3300025929 Ga0207664_10035531 Ga0207664_100355313 364
1381 3300025929 Ga0207664_10111991 Ga0207664_101119912 364
1382 3300025931 Ga0207644_10283993 Ga0207644_102839931 364
1383 3300025932 Ga0207690_10040760 Ga0207690_100407602 364
1384 3300025933 Ga0207706_10010621 Ga0207706_100106212 364
1385 3300025934 Ga0207686_10157297 Ga0207686_101572972 364
1386 3300025939 Ga0207665_10000166 Ga0207665_1000016641 364
1387 3300025939 Ga0207665_10026642 Ga0207665_100266422 364
1388 3300025940 Ga0207691_10067617 Ga0207691_100676173 364
1389 3300025940 Ga0207691_10165816 Ga0207691_101658162 364
1390 3300025941 Ga0207711_10005166 Ga0207711_100051663 364
1391 3300025942 Ga0207689_10007084 Ga0207689_100070847 364
1392 3300025944 Ga0207661_10252596 Ga0207661_102525961 364
1393 3300025945 Ga0207679_10100044 Ga0207679_101000442 364
1394 3300025949 Ga0207667_10002042 Ga0207667_100020425 364
1395 3300025949 Ga0207667_10011034 Ga0207667_100110342 364
1396 3300025949 Ga0207667_10027457 Ga0207667_100274574 364
1397 3300025949 Ga0207667_10138396 Ga0207667_101383962 364
1398 3300025972 Ga0207668_10111826 Ga0207668_101118262 364
1399 3300025986 Ga0207658_10203354 Ga0207658_102033542 364
1400 3300026035 Ga0207703_10000345 Ga0207703_1000034536 364
1401 3300026041 Ga0207639_10079767 Ga0207639_100797672 364
1402 3300026041 Ga0207639_10088644 Ga0207639_100886443 364
1403 3300026067 Ga0207678_10003794 Ga0207678_100037947 364
1404 3300026078 Ga0207702_10077147 Ga0207702_100771473 364
1405 3300026078 Ga0207702_10173323 Ga0207702_101733232 364
1406 3300026089 Ga0207648_10047554 Ga0207648_100475542 364
1407 3300026095 Ga0207676_10043731 Ga0207676_100437314 364
1408 3300026116 Ga0207674_10012372 Ga0207674_100123723 364
1409 3300026118 Ga0207675_100005332 Ga0207675_1000053325 364
1410 3300026121 Ga0207683_10050682 Ga0207683_100506822 364
1411 3300026121 Ga0207683_10078958 Ga0207683_100789582 364
1412 3300026121 Ga0207683_10109649 Ga0207683_101096492 364
1413 3300026142 Ga0207698_10120534 Ga0207698_101205342 364
1414 3300026142 Ga0207698_10192526 Ga0207698_101925262 364
1415 3300028380 Ga0268265_10117329 Ga0268265_101173292 364
1416 3300028573 Ga0265334_10003140 Ga0265334_100031406 364
1417 3300028786 Ga0307517_10015795 Ga0307517_100157951 364
1418 3300028794 Ga0307515_10010875 Ga0307515_100108756 364
1419 3300028794 Ga0307515_10180353 Ga0307515_101803531 364
1420 3300030521 Ga0307511_10018996 Ga0307511_100189964 364
1421 3300030521 Ga0307511_10048418 Ga0307511_100484183 364
1422 3300030522 Ga0307512_10013114 Ga0307512_100131142 364
1423 3300030522 Ga0307512_10087803 Ga0307512_100878032 364
1424 3300030522 Ga0307512_10121776 Ga0307512_101217761 364
1425 3300030733 Ga0314311_1016886 Ga0314311_10168861 364
1426 3300031456 Ga0307513_10000936 Ga0307513_1000093613 364
1427 3300031456 Ga0307513_10034204 Ga0307513_100342045 364
1428 3300031507 Ga0307509_10061631 Ga0307509_100616313 364
1429 3300031507 Ga0307509_10126821 Ga0307509_101268213 364
1430 3300031616 Ga0307508_10029203 Ga0307508_100292033 364
1431 3300031616 Ga0307508_10033651 Ga0307508_100336513 364
1432 3300031649 Ga0307514_10008438 Ga0307514_100084388 364
1433 3300031649 Ga0307514_10090774 Ga0307514_100907742 364
1434 3300031665 Ga0316575_10000668 Ga0316575_100006684 364
1435 3300031691 Ga0316579_10118321 Ga0316579_101183211 364
1436 3300031730 Ga0307516_10019845 Ga0307516_100198452 364
1437 3300031838 Ga0307518_10057070 Ga0307518_100570701 364
1438 3300031852 Ga0307410_10165544 Ga0307410_101655441 364
1439 3300031903 Ga0307407_10075390 Ga0307407_100753902 364
1440 3300031995 Ga0307409_100063923 Ga0307409_1000639233 364
1441 3300031995 Ga0307409_100106542 Ga0307409_1001065422 364
1442 3300031995 Ga0307409_100140908 Ga0307409_1001409082 364
1443 3300031995 Ga0307409_100147804 Ga0307409_1001478042 364
1444 3300032002 Ga0307416_100055367 Ga0307416_1000553673 364
1445 3300032002 Ga0307416_100172596 Ga0307416_1001725962 364
1446 3300032002 Ga0307416_100254176 Ga0307416_1002541762 364
1447 3300032002 Ga0307416_100455599 Ga0307416_1004555991 364
1448 3300032004 Ga0307414_10020103 Ga0307414_100201032 364
1449 3300032005 Ga0307411_10028720 Ga0307411_100287203 364
1450 3300032005 Ga0307411_10156076 Ga0307411_101560763 364
1451 3300032126 Ga0307415_100021173 Ga0307415_1000211732 364
1452 3300033179 Ga0307507_10039031 Ga0307507_100390311 364
1453 3300033180 Ga0307510_10071034 Ga0307510_100710342 364
1454 3300033180 Ga0307510_10093196 Ga0307510_100931961 364
1455 3300035083 Ga0373926_0018060 Ga0373926_0018060_449_1582 364
1456 3300035086 Ga0373934_0005753 Ga0373934_0005753_903_2039 364
1457 3300035089 Ga0373944_0001496 Ga0373944_0001496_1718_2851 364
1458 3300035112 Ga0373932_0015193 Ga0373932_0015193_389_1522 364
1459 3300035113 Ga0373936_0000847 Ga0373936_0000847_2751_3884 364
1460 3300035113 Ga0373936_0007777 Ga0373936_0007777_2219_3355 364
1461 3300035116 Ga0373945_0000182 Ga0373945_0000182_3080_4213 364
1462 3300035118 Ga0373954_0024959 Ga0373954_0024959_834_1967 364
1463 3300035119 Ga0373956_0054191 Ga0373956_0054191_269_1402 364
1464 3300035120 Ga0373957_0012834 Ga0373957_0012834_698_1831 364
1465 3300035120 Ga0373957_0062286 Ga0373957_0062286_114_1241 364
1466 3300035171 Ga0373946_0000651 Ga0373946_0000651_8670_9803 364
1467 3300035172 Ga0373955_0027994 Ga0373955_0027994_1210_2343 364
1468 3300035241 Ga0373961_0013919 Ga0373961_0013919_380_1513 364
1469 3300035410 Ga0373924_0000936 Ga0373924_0000936_873_2006 364
1470 3300035692 Ga0373935_0007297 Ga0373935_0007297_3263_4396 364
1471 3300035692 Ga0373935_0131404 Ga0373935_0131404_80_1213 364
1472 3300035695 Ga0373927_0012605 Ga0373927_0012605_2548_3681 364
1473 3300035695 Ga0373927_0015053 Ga0373927_0015053_334_1467 364
1474 3300035724 Ga0373933_0013994 Ga0373933_0013994_1823_2959 364
1475 3300035725 Ga0373947_0007347 Ga0373947_0007347_4385_5518 364
1476 3300036401 Ga0373937_0008701 Ga0373937_0008701_2921_4057 364
1477 3300036401 Ga0373937_0193865 Ga0373937_0193865_355_1488 364
1478 3300037068 Ga0373925_0002037 Ga0373925_0002037_12601_13728 364
1479 3300037068 Ga0373925_0003433 Ga0373925_0003433_6305_7438 364
1480 3300037068 Ga0373925_0147876 Ga0373925_0147876_639_1766 364
1481 3300037312 Ga0395899_0040320 Ga0395899_0040320_336_1517 364
1482 3300037466 Ga0395898_0001626 Ga0395898_0001626_29274_30458 364
1483 3300037853 Ga0436364_0160104 Ga0436364_0160104_1792_2946 364
1484 3300037853 Ga0436364_1274663 Ga0436364_1274663_3317_4450 364
1485 3300037853 Ga0436364_1399659 Ga0436364_1399659_410_1543 364
1486 3300038443 Ga0395901_0036787 Ga0395901_0036787_3636_4757 364
1487 3300038443 Ga0395901_0131820 Ga0395901_0131820_1324_2445 364
1488 3300038443 Ga0395901_0145256 Ga0395901_0145256_289_1410 364
1489 3300038443 Ga0395901_0240809 Ga0395901_0240809_491_1615 364
1490 3300038735 Ga0400485_14348 Ga0400485_14348_3307_4428 364
1491 3300038741 Ga0400488_19742 Ga0400488_19742_57_1178 364
1492 3300038742 Ga0400486_32183 Ga0400486_32183_3347_4468 364
1493 3300041404 Ga0439436_0001906 Ga0439436_0001906_1064_2188 364
1494 3300041404 Ga0439436_0012938 Ga0439436_0012938_360_1484 364
1495 3300041406 Ga0439439_0002397 Ga0439439_0002397_2762_3886 364
1496 3300041451 Ga0451791_0795391 Ga0451791_0795391_101_1222 364
1497 3300041494 Ga0451837_1299351 Ga0451837_1299351_169_1353 364
1498 3300041512 Ga0451853_2323682 Ga0451853_2323682_566_1690 364
1499 3300041999 Ga0439433_0000156 Ga0439433_0000156_5823_6947 364
1500 3300042002 Ga0439442_009119 Ga0439442_009119_142_1266 364
1501 3300042007 Ga0439449_0029595 Ga0439449_0029595_840_1964 364
1502 3300042014 Ga0439457_000027 Ga0439457_000027_22408_23532 364
1503 3300042131 Ga0450894_000043 Ga0450894_000043_11385_12509 364
1504 3300042157 Ga0439458_0001450 Ga0439458_0001450_2413_3597 364
1505 3300044656 Ga0466969_0019697 Ga0466969_0019697_994_2169 364
1506 3300044658 Ga0466972_0004584 Ga0466972_0004584_1675_2799 364
1507 3300044658 Ga0466972_0059802 Ga0466972_0059802_40_1164 364
1508 3300044684 Ga0466966_0058359 Ga0466966_0058359_868_1989 364
1509 3300044693 Ga0466961_0000630 Ga0466961_0000630_11349_12524 364
1510 3300044694 Ga0466963_0000611 Ga0466963_0000611_3145_4320 364
1511 3300044694 Ga0466963_0002295 Ga0466963_0002295_9487_10611 364
1512 3300044694 Ga0466963_0074190 Ga0466963_0074190_260_1393 364
1513 3300044694 Ga0466963_0255975 Ga0466963_0255975_10_1131 364
1514 3300044719 Ga0466971_0000512 Ga0466971_0000512_6890_8065 364
1515 3300044765 Ga0466970_0002564 Ga0466970_0002564_5042_6166 364
1516 3300044842 Ga0466957_0000143 Ga0466957_0000143_24004_25179 364
1517 3300044901 Ga0466960_0029449 Ga0466960_0029449_497_1621 364
1518 3300045836 Ga0466958_0003353 Ga0466958_0003353_6162_7337 364
1519 3300045836 Ga0466958_0047464 Ga0466958_0047464_93_1214 364
1520 3300045976 Ga0466967_0027218 Ga0466967_0027218_2491_3624 364
1521 3300045976 Ga0466967_0080891 Ga0466967_0080891_819_1940 364
1522 3300046453 Ga0495627_033005 Ga0495627_033005_206_1330 364
1523 3300046454 Ga0495592_0000481 Ga0495592_0000481_19089_20213 364
1524 3300046454 Ga0495592_0008825 Ga0495592_0008825_544_1668 364
1525 3300046455 Ga0495603_0001779 Ga0495603_0001779_6295_7419 364
1526 3300046455 Ga0495603_0006149 Ga0495603_0006149_1031_2155 364
1527 3300046455 Ga0495603_0012191 Ga0495603_0012191_3958_5142 364
1528 3300046457 Ga0495590_0000094 Ga0495590_0000094_38890_40011 364
1529 3300046457 Ga0495590_0010180 Ga0495590_0010180_1640_2764 364
1530 3300046459 Ga0495629_0002238 Ga0495629_0002238_12688_13812 364
1531 3300046459 Ga0495629_0004014 Ga0495629_0004014_1426_2550 364
1532 3300046459 Ga0495629_0005922 Ga0495629_0005922_2787_3920 364
1533 3300046459 Ga0495629_0017611 Ga0495629_0017611_439_1563 364
1534 3300046460 Ga0495638_0024022 Ga0495638_0024022_1343_2467 364
1535 3300046461 Ga0495641_0007164 Ga0495641_0007164_3861_4994 364
1536 3300046461 Ga0495641_0014070 Ga0495641_0014070_1844_2977 364
1537 3300046461 Ga0495641_0040202 Ga0495641_0040202_534_1655 364
1538 3300046462 Ga0495651_0042337 Ga0495651_0042337_992_2128 364
1539 3300046462 Ga0495651_0077794 Ga0495651_0077794_168_1295 364
1540 3300046463 Ga0495653_0007658 Ga0495653_0007658_7227_8360 364
1541 3300046463 Ga0495653_0137825 Ga0495653_0137825_143_1276 364
1542 3300046471 Ga0495650_0016212 Ga0495650_0016212_2522_3649 364
1543 3300046472 Ga0495580_0023584 Ga0495580_0023584_706_1839 364
1544 3300046472 Ga0495580_0044397 Ga0495580_0044397_1392_2516 364
1545 3300046473 Ga0495582_0015676 Ga0495582_0015676_350_1483 364
1546 3300046474 Ga0495605_0021869 Ga0495605_0021869_1368_2492 364
1547 3300046475 Ga0495639_0001608 Ga0495639_0001608_5759_6892 364
1548 3300046476 Ga0495662_0000490 Ga0495662_0000490_13991_15124 364
1549 3300046476 Ga0495662_0001269 Ga0495662_0001269_7265_8389 364
1550 3300046476 Ga0495662_0015157 Ga0495662_0015157_559_1692 364
1551 3300046477 Ga0495664_0000351 Ga0495664_0000351_6628_7752 364
1552 3300046477 Ga0495664_0002132 Ga0495664_0002132_6203_7336 364
1553 3300046477 Ga0495664_0095689 Ga0495664_0095689_637_1761 364
1554 3300046477 Ga0495664_0121248 Ga0495664_0121248_397_1530 364
1555 3300046491 Ga0495584_0011675 Ga0495584_0011675_1707_2831 364
1556 3300046499 Ga0495594_0008762 Ga0495594_0008762_4004_5137 364
1557 3300046499 Ga0495594_0117357 Ga0495594_0117357_11_1135 364
1558 3300046500 Ga0495596_0024389 Ga0495596_0024389_460_1584 364
1559 3300046501 Ga0495607_0129690 Ga0495607_0129690_167_1291 364
1560 3300046511 Ga0495608_0005238 Ga0495608_0005238_4385_5512 364
1561 3300046511 Ga0495608_0005899 Ga0495608_0005899_5886_7010 364
1562 3300046511 Ga0495608_0022768 Ga0495608_0022768_2383_3504 364
1563 3300046511 Ga0495608_0038030 Ga0495608_0038030_374_1507 364
1564 3300046513 Ga0495616_0008848 Ga0495616_0008848_4520_5644 364
1565 3300046514 Ga0495618_0007735 Ga0495618_0007735_176_1309 364
1566 3300046514 Ga0495618_0016327 Ga0495618_0016327_56_1189 364
1567 3300046515 Ga0495620_0020344 Ga0495620_0020344_2020_3144 364
1568 3300046516 Ga0495628_0017977 Ga0495628_0017977_444_1571 364
1569 3300046516 Ga0495628_0038786 Ga0495628_0038786_245_1369 364
1570 3300046516 Ga0495628_0067706 Ga0495628_0067706_1046_2179 364
1571 3300046517 Ga0495630_0026724 Ga0495630_0026724_80_1213 364
1572 3300046518 Ga0495631_0004932 Ga0495631_0004932_59_1183 364
1573 3300046519 Ga0495632_0085526 Ga0495632_0085526_66_1190 364
1574 3300046520 Ga0495637_0051577 Ga0495637_0051577_89_1213 364
1575 3300046529 Ga0495652_0020655 Ga0495652_0020655_35_1159 364
1576 3300046529 Ga0495652_0026494 Ga0495652_0026494_1591_2718 364
1577 3300046529 Ga0495652_0069294 Ga0495652_0069294_276_1403 364
1578 3300046529 Ga0495652_0102644 Ga0495652_0102644_1099_2232 364
1579 3300046529 Ga0495652_0162901 Ga0495652_0162901_346_1482 364
1580 3300046530 Ga0495654_0023227 Ga0495654_0023227_640_1764 364
1581 3300046531 Ga0495665_0001175 Ga0495665_0001175_4646_5779 364
1582 3300046533 Ga0495640_0050900 Ga0495640_0050900_950_2074 364
1583 3300046533 Ga0495640_0125465 Ga0495640_0125465_419_1546 364
1584 3300046535 Ga0495586_0114722 Ga0495586_0114722_270_1394 364
1585 3300046536 Ga0495587_0004772 Ga0495587_0004772_4155_5279 364
1586 3300046538 Ga0495609_0043122 Ga0495609_0043122_209_1333 364
1587 3300046542 Ga0495597_0011805 Ga0495597_0011805_2275_3399 364
1588 3300046543 Ga0495645_0002826 Ga0495645_0002826_6818_7942 364
1589 3300046543 Ga0495645_0056280 Ga0495645_0056280_1114_2247 364
1590 3300046543 Ga0495645_0124372 Ga0495645_0124372_611_1744 364
1591 3300046559 Ga0495667_0003737 Ga0495667_0003737_2816_3949 364
1592 3300046559 Ga0495667_0038072 Ga0495667_0038072_416_1543 364
1593 3300046559 Ga0495667_0087278 Ga0495667_0087278_362_1486 364
1594 3300046559 Ga0495667_0173174 Ga0495667_0173174_139_1272 364
1595 3300046642 Ga0495634_0002454 Ga0495634_0002454_14177_15301 364
1596 3300046642 Ga0495634_0098856 Ga0495634_0098856_539_1663 364
1597 3300046648 Ga0495611_0026253 Ga0495611_0026253_255_1379 364
1598 3300046660 Ga0495625_0010712 Ga0495625_0010712_795_1979 364
1599 3300046663 Ga0495635_0002501 Ga0495635_0002501_4188_5312 364
1600 3300046663 Ga0495635_0007697 Ga0495635_0007697_448_1581 364
1601 3300046663 Ga0495635_0045447 Ga0495635_0045447_978_2102 364
1602 3300046674 Ga0495588_0074525 Ga0495588_0074525_395_1528 364
1603 3300046675 Ga0495657_0001801 Ga0495657_0001801_10390_11514 364
1604 3300046675 Ga0495657_0007863 Ga0495657_0007863_3884_5011 364
1605 3300046675 Ga0495657_0034064 Ga0495657_0034064_143_1279 364
1606 3300046675 Ga0495657_0116754 Ga0495657_0116754_527_1660 364
1607 3300046678 Ga0495599_0018592 Ga0495599_0018592_2460_3593 364
1608 3300046678 Ga0495599_0028460 Ga0495599_0028460_2357_3481 364
1609 3300046679 Ga0495623_0016055 Ga0495623_0016055_1170_2294 364
1610 3300046679 Ga0495623_0040737 Ga0495623_0040737_406_1530 364
1611 3300046679 Ga0495623_0047715 Ga0495623_0047715_749_1882 364
1612 3300046679 Ga0495623_0094606 Ga0495623_0094606_325_1452 364
1613 3300046680 Ga0495646_0005300 Ga0495646_0005300_3733_4857 364
1614 3300046680 Ga0495646_0046110 Ga0495646_0046110_1278_2405 364
1615 3300046681 Ga0495647_0003185 Ga0495647_0003185_2228_3361 364
1616 3300046683 Ga0495658_0002514 Ga0495658_0002514_6114_7247 364
1617 3300046689 Ga0495613_0004118 Ga0495613_0004118_8057_9190 364
1618 3300046689 Ga0495613_0005121 Ga0495613_0005121_7009_8133 364
1619 3300046689 Ga0495613_0017497 Ga0495613_0017497_48_1172 364
1620 3300046690 Ga0495624_0006182 Ga0495624_0006182_5996_7129 364
1621 3300046690 Ga0495624_0049837 Ga0495624_0049837_1046_2170 364
1622 3300046690 Ga0495624_0092011 Ga0495624_0092011_80_1213 364
1623 3300046691 Ga0495670_0071207 Ga0495670_0071207_588_1712 364
1624 3300046692 Ga0495671_0005333 Ga0495671_0005333_1285_2469 364
1625 3300046794 Ga0495589_0022703 Ga0495589_0022703_840_1964 364
1626 3300046809 Ga0495600_0005804 Ga0495600_0005804_3805_4929 364
1627 3300046809 Ga0495600_0009346 Ga0495600_0009346_2051_3178 364
1628 3300046809 Ga0495600_0013174 Ga0495600_0013174_1752_2888 364
1629 3300046809 Ga0495600_0035019 Ga0495600_0035019_1806_2930 364
1630 3300046809 Ga0495600_0172600 Ga0495600_0172600_75_1208 364
1631 3300047315 Ga0495581_0003354 Ga0495581_0003354_1149_2273 364
1632 3300047315 Ga0495581_0076501 Ga0495581_0076501_223_1356 364
1633 3300047315 Ga0495581_0112287 Ga0495581_0112287_316_1440 364
1634 3300047317 Ga0495604_0002802 Ga0495604_0002802_4047_5171 364
1635 3300047317 Ga0495604_0033094 Ga0495604_0033094_1799_2932 364
1636 3300047317 Ga0495604_0033445 Ga0495604_0033445_472_1599 364
1637 3300047318 Ga0495636_0002194 Ga0495636_0002194_1150_2274 364
1638 3300047318 Ga0495636_0032486 Ga0495636_0032486_34_1158 364
1639 3300047319 Ga0495674_0019179 Ga0495674_0019179_1725_2858 364
1640 3300047319 Ga0495674_0037963 Ga0495674_0037963_1797_2924 364
1641 3300047319 Ga0495674_0048001 Ga0495674_0048001_531_1655 364
1642 3300047320 Ga0495672_0015842 Ga0495672_0015842_3706_4836 364
1643 3300047321 Ga0495676_0024813 Ga0495676_0024813_3958_5142 364
1644 3300047321 Ga0495676_0028997 Ga0495676_0028997_3435_4568 364
1645 3300047321 Ga0495676_0035758 Ga0495676_0035758_514_1638 364
1646 3300047321 Ga0495676_0116781 Ga0495676_0116781_785_1909 364
1647 3300047322 Ga0495680_0005688 Ga0495680_0005688_8345_9472 364
1648 3300047322 Ga0495680_0011998 Ga0495680_0011998_2046_3170 364
1649 3300047322 Ga0495680_0017923 Ga0495680_0017923_615_1748 364
1650 3300047322 Ga0495680_0023854 Ga0495680_0023854_1860_2993 364
1651 3300047322 Ga0495680_0030570 Ga0495680_0030570_1441_2577 364
1652 3300047322 Ga0495680_0173768 Ga0495680_0173768_294_1427 364
1653 3300047443 Ga0495687_002575 Ga0495687_002575_8261_9385 364
1654 3300047444 Ga0495675_0014263 Ga0495675_0014263_2797_3930 364
1655 3300047444 Ga0495675_0018969 Ga0495675_0018969_3099_4226 364
1656 3300047444 Ga0495675_0020983 Ga0495675_0020983_251_1375 364
1657 3300047469 Ga0495673_0084402 Ga0495673_0084402_56_1180 364
1658 3300047470 Ga0495681_0000289 Ga0495681_0000289_13202_14386 364
1659 3300047471 Ga0495684_0002952 Ga0495684_0002952_2676_3809 364
1660 3300047471 Ga0495684_0016318 Ga0495684_0016318_2521_3657 364
1661 3300047471 Ga0495684_0027440 Ga0495684_0027440_3159_4292 364
1662 3300047471 Ga0495684_0128301 Ga0495684_0128301_598_1731 364
1663 3300047471 Ga0495684_0193289 Ga0495684_0193289_349_1473 364
1664 3300047471 Ga0495684_0221305 Ga0495684_0221305_212_1336 364
1665 3300047673 Ga0495593_0001682 Ga0495593_0001682_7968_9092 364
1666 3300047673 Ga0495593_0016042 Ga0495593_0016042_176_1309 364
1667 3300048088 Ga0495602_0021967 Ga0495602_0021967_2706_3830 364
1668 3300048088 Ga0495602_0022801 Ga0495602_0022801_4044_5171 364
1669 3300048088 Ga0495602_0177044 Ga0495602_0177044_218_1339 364
1670 3300048089 Ga0495614_0000245 Ga0495614_0000245_20079_21203 364
1671 3300048091 Ga0495626_0004415 Ga0495626_0004415_2355_3479 364
1672 3300048903 Ga0496100_0029003 Ga0496100_0029003_498_1619 364
1673 3300048904 Ga0496101_0050988 Ga0496101_0050988_75_1208 364
1674 3300048904 Ga0496101_0286128 Ga0496101_0286128_30_1151 364
1675 3300048905 Ga0496102_0012264 Ga0496102_0012264_2520_3647 364
1676 3300048905 Ga0496102_0013702 Ga0496102_0013702_1199_2320 364
1677 3300048906 Ga0496103_0008811 Ga0496103_0008811_4852_5973 364
1678 3300048906 Ga0496103_0070949 Ga0496103_0070949_58_1191 364
1679 3300048907 Ga0496104_0000836 Ga0496104_0000836_16889_18055 364
1680 3300048908 Ga0496105_0006003 Ga0496105_0006003_3994_5121 364
1681 3300048908 Ga0496105_0039651 Ga0496105_0039651_1876_2997 364
1682 3300048908 Ga0496105_0061154 Ga0496105_0061154_367_1500 364
1683 3300048910 Ga0496107_0039784 Ga0496107_0039784_1662_2795 364
1684 3300048911 Ga0496108_0002269 Ga0496108_0002269_4850_6016 364
1685 3300048912 Ga0496109_0278913 Ga0496109_0278913_393_1517 364
1686 3300048913 Ga0496110_0064159 Ga0496110_0064159_1452_2585 364
1687 3300048913 Ga0496110_0139127 Ga0496110_0139127_352_1476 364
1688 3300048913 Ga0496110_0171369 Ga0496110_0171369_790_1911 364
1689 3300048915 Ga0496112_0003674 Ga0496112_0003674_3937_5064 364
1690 3300048915 Ga0496112_0166035 Ga0496112_0166035_29_1162 364
1691 3300048916 Ga0496113_0048554 Ga0496113_0048554_126_1292 364
1692 3300048916 Ga0496113_0071819 Ga0496113_0071819_1303_2424 364
1693 3300048917 Ga0496114_0081784 Ga0496114_0081784_676_1797 364
1694 3300048917 Ga0496114_0129495 Ga0496114_0129495_593_1750 364
1695 3300048918 Ga0496115_0006411 Ga0496115_0006411_1474_2601 364
1696 3300048918 Ga0496115_0049791 Ga0496115_0049791_1035_2168 364
1697 3300048921 Ga0496118_0000610 Ga0496118_0000610_29349_30470 364
1698 3300048922 Ga0496119_0123262 Ga0496119_0123262_131_1252 364
1699 3300048923 Ga0496120_0022515 Ga0496120_0022515_2056_3177 364
1700 3300048923 Ga0496120_0031483 Ga0496120_0031483_535_1656 364
1701 3300048924 Ga0496121_0000015 Ga0496121_0000015_188973_190094 364
1702 3300048924 Ga0496121_0080853 Ga0496121_0080853_1225_2346 364
1703 3300048925 Ga0496122_0005965 Ga0496122_0005965_5381_6505 364
1704 3300048925 Ga0496122_0009445 Ga0496122_0009445_3206_4327 364
1705 3300048926 Ga0496123_0000922 Ga0496123_0000922_7912_9036 364
1706 3300048926 Ga0496123_0003978 Ga0496123_0003978_2309_3430 364
1707 3300048927 Ga0496124_0000135 Ga0496124_0000135_51194_52315 364
1708 3300048929 Ga0496126_0030861 Ga0496126_0030861_3636_4757 364
1709 3300049534 Ga0501318_003946 Ga0501318_003946_252_1373 364
1710 3300049568 Ga0501031_0002231 Ga0501031_0002231_6177_7298 364
1711 3300049568 Ga0501031_0008520 Ga0501031_0008520_2649_3812 364
1712 3300049569 Ga0501032_0006740 Ga0501032_0006740_4406_5569 364
1713 3300049569 Ga0501032_0015179 Ga0501032_0015179_4162_5286 364
1714 3300049569 Ga0501032_0017903 Ga0501032_0017903_604_1725 364
1715 3300049569 Ga0501032_0020302 Ga0501032_0020302_1587_2708 364
1716 3300049569 Ga0501032_0038963 Ga0501032_0038963_1393_2517 364
1717 3300049569 Ga0501032_0123968 Ga0501032_0123968_95_1216 364
1718 3300049570 Ga0501033_0001533 Ga0501033_0001533_4789_5988 364
1719 3300049570 Ga0501033_0016453 Ga0501033_0016453_1840_2961 364
1720 3300049570 Ga0501033_0075075 Ga0501033_0075075_1234_2358 364
1721 3300049570 Ga0501033_0163489 Ga0501033_0163489_307_1428 364
1722 3300049571 Ga0501034_0004451 Ga0501034_0004451_4193_5356 364
1723 3300049571 Ga0501034_0005584 Ga0501034_0005584_7321_8520 364
1724 3300049571 Ga0501034_0022103 Ga0501034_0022103_3727_4848 364
1725 3300049571 Ga0501034_0060038 Ga0501034_0060038_2578_3702 364
1726 3300049571 Ga0501034_0130331 Ga0501034_0130331_1077_2201 364
1727 3300049571 Ga0501034_0278830 Ga0501034_0278830_416_1540 364
1728 3300049572 Ga0501036_0002124 Ga0501036_0002124_11008_12192 364
1729 3300049572 Ga0501036_0010468 Ga0501036_0010468_2492_3613 364
1730 3300049572 Ga0501036_0026255 Ga0501036_0026255_1820_2983 364
1731 3300049572 Ga0501036_0065461 Ga0501036_0065461_1585_2706 364
1732 3300049572 Ga0501036_0084430 Ga0501036_0084430_1447_2571 364
1733 3300049573 Ga0501037_0003940 Ga0501037_0003940_5411_6574 364
1734 3300049573 Ga0501037_0005558 Ga0501037_0005558_5217_6341 364
1735 3300049573 Ga0501037_0012804 Ga0501037_0012804_2558_3679 364
1736 3300049573 Ga0501037_0018305 Ga0501037_0018305_1430_2551 364
1737 3300049573 Ga0501037_0056598 Ga0501037_0056598_1402_2523 364
1738 3300049573 Ga0501037_0073269 Ga0501037_0073269_21_1142 364
1739 3300049573 Ga0501037_0119303 Ga0501037_0119303_655_1779 364
1740 3300049574 Ga0501038_0014812 Ga0501038_0014812_3041_4204 364
1741 3300049574 Ga0501038_0019259 Ga0501038_0019259_949_2070 364
1742 3300049574 Ga0501038_0035681 Ga0501038_0035681_2900_4021 364
1743 3300049574 Ga0501038_0036093 Ga0501038_0036093_247_1371 364
1744 3300049574 Ga0501038_0038913 Ga0501038_0038913_446_1567 364
1745 3300049574 Ga0501038_0079053 Ga0501038_0079053_1587_2708 364
1746 3300049575 Ga0501039_0012049 Ga0501039_0012049_3321_4442 364
1747 3300049575 Ga0501039_0134070 Ga0501039_0134070_384_1508 364
1748 3300049576 Ga0501040_0006755 Ga0501040_0006755_2062_3183 364
1749 3300049576 Ga0501040_0019206 Ga0501040_0019206_1056_2219 364
1750 3300049577 Ga0501041_0000510 Ga0501041_0000510_12903_14024 364
1751 3300049578 Ga0501042_0005797 Ga0501042_0005797_4207_5328 364
1752 3300049578 Ga0501042_0006620 Ga0501042_0006620_3307_4431 364
1753 3300049578 Ga0501042_0044551 Ga0501042_0044551_1863_3026 364
1754 3300049579 Ga0501043_0002325 Ga0501043_0002325_7635_8834 364
1755 3300049579 Ga0501043_0003130 Ga0501043_0003130_12145_13269 364
1756 3300049579 Ga0501043_0008228 Ga0501043_0008228_6987_8108 364
1757 3300049579 Ga0501043_0010272 Ga0501043_0010272_5696_6820 364
1758 3300049579 Ga0501043_0015132 Ga0501043_0015132_2898_4061 364
1759 3300049579 Ga0501043_0157809 Ga0501043_0157809_463_1584 364
1760 3300049579 Ga0501043_0160239 Ga0501043_0160239_34_1155 364
1761 3300049580 Ga0501046_0004180 Ga0501046_0004180_8625_9746 364
1762 3300049580 Ga0501046_0009635 Ga0501046_0009635_3968_5092 364
1763 3300049580 Ga0501046_0016221 Ga0501046_0016221_927_2090 364
1764 3300049580 Ga0501046_0121181 Ga0501046_0121181_803_1927 364
1765 3300049581 Ga0501047_0021174 Ga0501047_0021174_578_1702 364
1766 3300049581 Ga0501047_0032440 Ga0501047_0032440_22_1185 364
1767 3300049582 Ga0501048_0001322 Ga0501048_0001322_7684_8808 364
1768 3300049582 Ga0501048_0004371 Ga0501048_0004371_5042_6205 364
1769 3300049582 Ga0501048_0010033 Ga0501048_0010033_280_1401 364
1770 3300049582 Ga0501048_0236991 Ga0501048_0236991_117_1238 364
1771 3300049583 Ga0501067_0001107 Ga0501067_0001107_5551_6714 364
1772 3300049583 Ga0501067_0020188 Ga0501067_0020188_694_1815 364
1773 3300049584 Ga0501068_0004355 Ga0501068_0004355_4273_5436 364
1774 3300049584 Ga0501068_0030431 Ga0501068_0030431_1645_2766 364
1775 3300049586 Ga0501070_0003420 Ga0501070_0003420_8061_9260 364
1776 3300049586 Ga0501070_0018990 Ga0501070_0018990_1705_2868 364
1777 3300049586 Ga0501070_0033611 Ga0501070_0033611_334_1458 364
1778 3300049586 Ga0501070_0204631 Ga0501070_0204631_111_1232 364
1779 3300049587 Ga0501071_0001275 Ga0501071_0001275_10218_11381 364
1780 3300049587 Ga0501071_0002509 Ga0501071_0002509_3358_4479 364
1781 3300049588 Ga0501072_0033937 Ga0501072_0033937_34_1197 364
1782 3300049589 Ga0501073_0113310 Ga0501073_0113310_635_1756 364
1783 3300049590 Ga0501074_0004495 Ga0501074_0004495_3728_4927 364
1784 3300049590 Ga0501074_0008723 Ga0501074_0008723_3572_4693 364
1785 3300049591 Ga0501075_0008628 Ga0501075_0008628_2015_3136 364
1786 3300049592 Ga0501076_0049185 Ga0501076_0049185_1816_2937 364
1787 3300049593 Ga0501077_0021191 Ga0501077_0021191_1578_2699 364
1788 3300049593 Ga0501077_0036848 Ga0501077_0036848_1942_3105 364
1789 3300049741 Ga0501079_0001632 Ga0501079_0001632_10407_11570 364
1790 3300049741 Ga0501079_0025872 Ga0501079_0025872_1804_2925 364
1791 3300049742 Ga0501080_0000023 Ga0501080_0000023_79137_80258 364
1792 3300049742 Ga0501080_0042141 Ga0501080_0042141_192_1355 364
1793 3300049742 Ga0501080_0056997 Ga0501080_0056997_292_1476 364
1794 3300049742 Ga0501080_0273742 Ga0501080_0273742_163_1284 364
1795 3300049743 Ga0501081_0012816 Ga0501081_0012816_3719_4840 364
1796 3300049744 Ga0501083_0004256 Ga0501083_0004256_3740_4903 364
1797 3300049744 Ga0501083_0031451 Ga0501083_0031451_875_1996 364
1798 3300049822 Ga0501035_0002846 Ga0501035_0002846_5174_6337 364
1799 3300049822 Ga0501035_0008420 Ga0501035_0008420_4789_5988 364
1800 3300049822 Ga0501035_0017981 Ga0501035_0017981_4486_5607 364
1801 3300049822 Ga0501035_0050317 Ga0501035_0050317_1564_2688 364
1802 3300049823 Ga0501044_0003414 Ga0501044_0003414_8387_9511 364
1803 3300049823 Ga0501044_0013325 Ga0501044_0013325_4224_5348 364
1804 3300049823 Ga0501044_0033710 Ga0501044_0033710_22_1185 364
1805 3300049823 Ga0501044_0175285 Ga0501044_0175285_526_1650 364
1806 3300049824 Ga0501045_0047819 Ga0501045_0047819_22_1185 364
1807 3300050491 nmdc:mga00v17_10676_c1 nmdc:mga00v17_10676_c1_1107_2228 364
1808 3300050492 nmdc:mga0yw44_16446_c1 nmdc:mga0yw44_16446_c1_372_1493 364
1809 3300050492 nmdc:mga0yw44_7068_c1 nmdc:mga0yw44_7068_c1_3346_4467 364
1810 3300050494 nmdc:mga06z11_29345_c1 nmdc:mga06z11_29345_c1_61_1245 364
1811 3300050513 nmdc:mga0rr50_128236_c1 nmdc:mga0rr50_128236_c1_188_1321 364
1812 3300050514 nmdc:mga08x19_34607_c1 nmdc:mga08x19_34607_c1_847_1980 364
1813 3300050516 nmdc:mga0sz30_11075_c1 nmdc:mga0sz30_11075_c1_217_1338 364
1814 3300053077 Ga0495601_0013029 Ga0495601_0013029_2136_3269 364
1815 3300053078 Ga0495612_0010468 Ga0495612_0010468_1018_2151 364
1816 3300053078 Ga0495612_0060823 Ga0495612_0060823_72_1199 364
1817 3300053085 Ga0495619_0010408 Ga0495619_0010408_837_1970 364
1818 3300053085 Ga0495619_0132743 Ga0495619_0132743_71_1192 364
1819 3300053087 Ga0500643_000191 Ga0500643_000191_21721_22842 364
1820 3300053092 Ga0500583_0103117 Ga0500583_0103117_18_1142 364
1821 3300053093 Ga0500651_0003063 Ga0500651_0003063_3462_4637 364
1822 3300053095 Ga0500640_001744 Ga0500640_001744_3987_5111 364
1823 3300053096 Ga0500641_0056548 Ga0500641_0056548_51_1175 364
1824 3300053104 Ga0500556_0000115 Ga0500556_0000115_7028_8149 364
1825 3300053107 Ga0500560_012532 Ga0500560_012532_196_1380 364
1826 3300053108 Ga0500562_000183 Ga0500562_000183_9731_10852 364
1827 3300053136 Ga0500559_0000050 Ga0500559_0000050_16211_17332 364
1828 3300053136 Ga0500559_0042277 Ga0500559_0042277_655_1785 364
1829 3300053139 Ga0500568_0000038 Ga0500568_0000038_71487_72608 364
1830 3300053139 Ga0500568_0001933 Ga0500568_0001933_6962_8083 364
1831 3300053139 Ga0500568_0007501 Ga0500568_0007501_1720_2847 364
1832 3300053139 Ga0500568_0013939 Ga0500568_0013939_1655_2782 364
1833 3300053140 Ga0500573_0000014 Ga0500573_0000014_41373_42494 364
1834 3300053140 Ga0500573_0013932 Ga0500573_0013932_3361_4482 364
1835 3300053140 Ga0500573_0014968 Ga0500573_0014968_1042_2163 364
1836 3300053142 Ga0500577_0004479 Ga0500577_0004479_674_1795 364
1837 3300053142 Ga0500577_0016903 Ga0500577_0016903_1101_2222 364
1838 3300053142 Ga0500577_0020950 Ga0500577_0020950_478_1608 364
1839 3300053148 Ga0500590_013523 Ga0500590_013523_726_1847 364
1840 3300053153 Ga0500616_0000117 Ga0500616_0000117_47321_48448 364
1841 3300053153 Ga0500616_0000620 Ga0500616_0000620_15240_16361 364
1842 3300053153 Ga0500616_0011539 Ga0500616_0011539_3952_5073 364
1843 3300053153 Ga0500616_0061798 Ga0500616_0061798_538_1659 364
1844 3300053155 Ga0500620_000082 Ga0500620_000082_1187_2308 364
1845 3300053157 Ga0500624_002275 Ga0500624_002275_196_1320 364
1846 3300054114 Ga0501084_0011942 Ga0501084_0011942_1639_2802 364
1847 3300054114 Ga0501084_0042709 Ga0501084_0042709_1958_3079 364
1848 3300060353 Ga0501082_0011737 Ga0501082_0011737_1974_3137 364
1849 3300060353 Ga0501082_0024215 Ga0501082_0024215_3727_4848 364
1850 3300061719 Ga0466962_0001217 Ga0466962_0001217_2129_3304 364
1851 3300061734 Ga0530510_0002078 Ga0530510_0002078_9567_10688 364
1852 iso_pu_bacteria 2643221613 2644082324 364
1853 iso_pu_bacteria 2643221721 2644667053 364
1854 iso_pu_bacteria 2844849076 2844849700 364
1855 iso_pu_bacteria 2904776348 2904776799 364
1856 iso_pu_bacteria 2935890801 2935893553 364
1857 iso_pu_bacteria 8025478263 8025479533 364
1858 3300013104 Ga0157370_10001462 Ga0157370_1000146224 365
1859 3300028800 Ga0265338_10025625 Ga0265338_100256254 365
1860 iso_pu_bacteria 2537561592 2537898248 365
1861 iso_pu_bacteria 2554235227 2555228741 365
1862 iso_pu_bacteria 2654587600 2655033208 365
1863 iso_pu_bacteria 2690315906 2691514725 365
1864 iso_pu_bacteria 2775506735 2775654939 365
1865 iso_pu_bacteria 2808606357 2808827838 365
1866 iso_pu_bacteria 2808606360 2808853190 365
1867 iso_pu_bacteria 2808606366 2808878308 365
1868 iso_pu_bacteria 2808606370 2808892081 365
1869 iso_pu_bacteria 2808606371 2808897186 365
1870 iso_pu_bacteria 2808606700 2810364339 365
1871 iso_pu_bacteria 2811994871 2812320401 365
1872 iso_pu_bacteria 2857740372 2857741167 365
1873 iso_pu_bacteria 2904497146 2904500400 365
1874 iso_pu_bacteria 2905926851 2905927870 365
1875 iso_pu_bacteria 2910809715 2910810674 365
1876 iso_pu_bacteria 2919034639 2919036344 365
1877 iso_pu_bacteria 2919059106 2919059646 365
1878 iso_pu_bacteria 2919391150 2919391597 365
1879 iso_pu_bacteria 2919538618 2919540794 365
1880 iso_pu_bacteria 2932426870 2932426928 365
1881 iso_pu_bacteria 2933418574 2933419565 365
1882 iso_pu_bacteria 2939598168 2939598807 365
1883 iso_pu_bacteria 2939647034 2939650045 365
1884 iso_pu_bacteria 2945916053 2945918156 365
1885 iso_pu_bacteria 2945920336 2945921554 365
1886 iso_pu_bacteria 2945941187 2945942223 365
1887 iso_pu_bacteria 2945956166 2945960001 365
1888 iso_pu_bacteria 2946003308 2946005488 365
1889 iso_pu_bacteria 2946037020 2946038203 365
1890 iso_pu_bacteria 2946059875 2946062002 365
1891 iso_pu_bacteria 2953998280 2953999481 365
1892 iso_pu_bacteria 2974302888 2974306186 365
1893 iso_pu_bacteria 8054107350 8054108427 365
1894 3300037312 Ga0395899_0017225 Ga0395899_0017225_898_2028 367
1895 3300037418 Ga0395900_0102603 Ga0395900_0102603_1344_2474 367
1896 3300002773 JGI25152J39213_1000399 JGI25152J39213_100039914 368
1897 3300009036 Ga0105244_10000735 Ga0105244_1000073514 368
1898 3300011119 Ga0105246_10000474 Ga0105246_100004749 368
1899 3300025258 Ga0209129_1000047 Ga0209129_100004771 368
1900 3300025294 Ga0209025_1000920 Ga0209025_100092031 368
1901 3300025303 Ga0209051_1003197 Ga0209051_10031976 368
1902 3300025303 Ga0209051_1013778 Ga0209051_10137782 368
1903 3300041404 Ga0439436_0020025 Ga0439436_0020025_716_1849 368
1904 3300041411 Ga0439466_0004258 Ga0439466_0004258_4244_5377 368
1905 3300042002 Ga0439442_004696 Ga0439442_004696_355_1488 368
1906 3300042010 Ga0439452_007207 Ga0439452_007207_1471_2604 368
1907 3300042014 Ga0439457_003698 Ga0439457_003698_1344_2477 368
1908 3300042146 Ga0450907_005873 Ga0450907_005873_841_1974 368
1909 3300042185 Ga0450909_000182 Ga0450909_000182_3679_4812 368
1910 3300042435 Ga0439434_0003626 Ga0439434_0003626_122_1255 368
1911 3300042531 Ga0450918_003686 Ga0450918_003686_356_1489 368
1912 3300000549 LJQas_1000257 LJQas_10002573 369
1913 3300000549 LJQas_1000741 LJQas_10007412 369
1914 3300005347 Ga0070668_100215082 Ga0070668_1002150822 369
1915 3300005353 Ga0070669_100022755 Ga0070669_1000227554 369
1916 3300005354 Ga0070675_100005971 Ga0070675_1000059712 369
1917 3300005356 Ga0070674_100019987 Ga0070674_1000199872 369
1918 3300005364 Ga0070673_100171762 Ga0070673_1001717622 369
1919 3300005456 Ga0070678_100082055 Ga0070678_1000820552 369
1920 3300005543 Ga0070672_100015790 Ga0070672_1000157902 369
1921 3300006058 Ga0075432_10023188 Ga0075432_100231881 369
1922 3300006058 Ga0075432_10039010 Ga0075432_100390101 369
1923 3300009011 Ga0105251_10004563 Ga0105251_100045636 369
1924 3300009098 Ga0105245_10202729 Ga0105245_102027292 369
1925 3300009148 Ga0105243_10335691 Ga0105243_103356912 369
1926 3300011119 Ga0105246_10030002 Ga0105246_100300023 369
1927 3300013102 Ga0157371_10071463 Ga0157371_100714632 369
1928 3300013105 Ga0157369_10028346 Ga0157369_100283463 369
1929 3300017792 Ga0163161_10022188 Ga0163161_100221882 369
1930 3300025254 Ga0209148_1004065 Ga0209148_10040652 369
1931 3300025315 Ga0207697_10001921 Ga0207697_100019214 369
1932 3300025728 Ga0207655_1015554 Ga0207655_10155542 369
1933 3300025735 Ga0207713_1051913 Ga0207713_10519132 369
1934 3300025893 Ga0207682_10001886 Ga0207682_100018866 369
1935 3300025907 Ga0207645_10016279 Ga0207645_100162793 369
1936 3300025923 Ga0207681_10042632 Ga0207681_100426323 369
1937 3300025927 Ga0207687_10045183 Ga0207687_100451832 369
1938 3300025940 Ga0207691_10001200 Ga0207691_100012009 369
1939 3300026121 Ga0207683_10001303 Ga0207683_100013038 369
1940 3300031548 Ga0307408_100003074 Ga0307408_1000030746 369
1941 3300031548 Ga0307408_100060781 Ga0307408_1000607812 369
1942 3300031548 Ga0307408_100099817 Ga0307408_1000998171 369
1943 3300031548 Ga0307408_100156051 Ga0307408_1001560512 369
1944 3300031548 Ga0307408_100216733 Ga0307408_1002167332 369
1945 3300031731 Ga0307405_10014792 Ga0307405_100147922 369
1946 3300031731 Ga0307405_10023043 Ga0307405_100230433 369
1947 3300031731 Ga0307405_10071150 Ga0307405_100711502 369
1948 3300031731 Ga0307405_10086782 Ga0307405_100867822 369
1949 3300031731 Ga0307405_10088812 Ga0307405_100888122 369
1950 3300031824 Ga0307413_10007992 Ga0307413_100079922 369
1951 3300031824 Ga0307413_10009243 Ga0307413_100092432 369
1952 3300031824 Ga0307413_10046827 Ga0307413_100468272 369
1953 3300031824 Ga0307413_10108539 Ga0307413_101085392 369
1954 3300031852 Ga0307410_10012152 Ga0307410_100121521 369
1955 3300031852 Ga0307410_10017054 Ga0307410_100170543 369
1956 3300031852 Ga0307410_10025171 Ga0307410_100251711 369
1957 3300031852 Ga0307410_10038935 Ga0307410_100389352 369
1958 3300031852 Ga0307410_10148707 Ga0307410_101487071 369
1959 3300031903 Ga0307407_10007739 Ga0307407_100077392 369
1960 3300031903 Ga0307407_10010003 Ga0307407_100100032 369
1961 3300031903 Ga0307407_10048355 Ga0307407_100483552 369
1962 3300031903 Ga0307407_10164226 Ga0307407_101642261 369
1963 3300031911 Ga0307412_10017272 Ga0307412_100172722 369
1964 3300031911 Ga0307412_10029651 Ga0307412_100296511 369
1965 3300031911 Ga0307412_10098355 Ga0307412_100983551 369
1966 3300031911 Ga0307412_10212449 Ga0307412_102124492 369
1967 3300031995 Ga0307409_100009644 Ga0307409_1000096445 369
1968 3300031995 Ga0307409_100034809 Ga0307409_1000348093 369
1969 3300031995 Ga0307409_100109373 Ga0307409_1001093732 369
1970 3300031995 Ga0307409_100228942 Ga0307409_1002289422 369
1971 3300031995 Ga0307409_100279486 Ga0307409_1002794862 369
1972 3300031995 Ga0307409_100390846 Ga0307409_1003908461 369
1973 3300032002 Ga0307416_100004847 Ga0307416_1000048471 369
1974 3300032002 Ga0307416_100008600 Ga0307416_1000086002 369
1975 3300032002 Ga0307416_100024975 Ga0307416_1000249751 369
1976 3300032002 Ga0307416_100057924 Ga0307416_1000579243 369
1977 3300032004 Ga0307414_10016958 Ga0307414_100169582 369
1978 3300032004 Ga0307414_10024236 Ga0307414_100242361 369
1979 3300032004 Ga0307414_10065704 Ga0307414_100657041 369
1980 3300032005 Ga0307411_10062908 Ga0307411_100629082 369
1981 3300032005 Ga0307411_10121414 Ga0307411_101214142 369
1982 3300032005 Ga0307411_10167669 Ga0307411_101676692 369
1983 3300032126 Ga0307415_100213319 Ga0307415_1002133191 369
1984 3300032126 Ga0307415_100215722 Ga0307415_1002157221 369
1985 3300032126 Ga0307415_100220758 Ga0307415_1002207582 369
1986 3300037312 Ga0395899_0005583 Ga0395899_0005583_7127_8263 369
1987 3300037312 Ga0395899_0032197 Ga0395899_0032197_221_1357 369
1988 3300037312 Ga0395899_0038763 Ga0395899_0038763_363_1499 369
1989 3300037312 Ga0395899_0076971 Ga0395899_0076971_637_1773 369
1990 3300037312 Ga0395899_0110727 Ga0395899_0110727_706_1842 369
1991 3300037418 Ga0395900_0011102 Ga0395900_0011102_918_2054 369
1992 3300037418 Ga0395900_0093930 Ga0395900_0093930_885_2021 369
1993 3300037418 Ga0395900_0209796 Ga0395900_0209796_395_1531 369
1994 3300037466 Ga0395898_0006252 Ga0395898_0006252_5442_6578 369
1995 3300037466 Ga0395898_0016357 Ga0395898_0016357_3083_4219 369
1996 3300037466 Ga0395898_0020646 Ga0395898_0020646_4338_5474 369
1997 3300037466 Ga0395898_0027833 Ga0395898_0027833_2926_4062 369
1998 3300037466 Ga0395898_0031520 Ga0395898_0031520_3468_4604 369
1999 3300037466 Ga0395898_0070700 Ga0395898_0070700_573_1709 369
2000 3300038443 Ga0395901_0111329 Ga0395901_0111329_1665_2801 369
2001 3300038443 Ga0395901_0272956 Ga0395901_0272956_53_1189 369
2002 3300041404 Ga0439436_0004852 Ga0439436_0004852_2939_4075 369
2003 3300041406 Ga0439439_0001108 Ga0439439_0001108_1034_2170 369
2004 3300041407 Ga0439447_016639 Ga0439447_016639_761_1897 369
2005 3300041411 Ga0439466_0004226 Ga0439466_0004226_1414_2550 369
2006 3300041999 Ga0439433_0000220 Ga0439433_0000220_2882_4018 369
2007 3300042002 Ga0439442_000012 Ga0439442_000012_21080_22216 369
2008 3300042002 Ga0439442_000083 Ga0439442_000083_12114_13250 369
2009 3300042002 Ga0439442_000162 Ga0439442_000162_4035_5171 369
2010 3300042007 Ga0439449_0000984 Ga0439449_0000984_3140_4276 369
2011 3300042014 Ga0439457_004957 Ga0439457_004957_2221_3357 369
2012 3300042146 Ga0450907_000265 Ga0450907_000265_5634_6770 369
2013 3300042435 Ga0439434_0000031 Ga0439434_0000031_27463_28599 369
2014 3300042435 Ga0439434_0013610 Ga0439434_0013610_826_1962 369
2015 3300042531 Ga0450918_000950 Ga0450918_000950_1930_3066 369
2016 3300044658 Ga0466972_0047412 Ga0466972_0047412_345_1481 369
2017 3300044684 Ga0466966_0189110 Ga0466966_0189110_42_1178 369
2018 3300046463 Ga0495653_0006276 Ga0495653_0006276_3601_4737 369
2019 3300046472 Ga0495580_0016321 Ga0495580_0016321_1793_2929 369
2020 3300046475 Ga0495639_0006034 Ga0495639_0006034_839_1975 369
2021 3300046477 Ga0495664_0012658 Ga0495664_0012658_1860_2996 369
2022 3300046499 Ga0495594_0025952 Ga0495594_0025952_300_1436 369
2023 3300046499 Ga0495594_0044164 Ga0495594_0044164_832_1968 369
2024 3300046517 Ga0495630_0049619 Ga0495630_0049619_679_1815 369
2025 3300046518 Ga0495631_0025816 Ga0495631_0025816_1308_2444 369
2026 3300046522 Ga0495643_0056504 Ga0495643_0056504_546_1682 369
2027 3300046525 Ga0495663_0025093 Ga0495663_0025093_324_1460 369
2028 3300046531 Ga0495665_0002775 Ga0495665_0002775_1795_2931 369
2029 3300046535 Ga0495586_0005989 Ga0495586_0005989_3723_4859 369
2030 3300046535 Ga0495586_0017800 Ga0495586_0017800_2620_3756 369
2031 3300046536 Ga0495587_0006829 Ga0495587_0006829_2180_3316 369
2032 3300046543 Ga0495645_0004680 Ga0495645_0004680_5078_6214 369
2033 3300046543 Ga0495645_0107550 Ga0495645_0107550_178_1314 369
2034 3300046664 Ga0495659_0006157 Ga0495659_0006157_1816_2952 369
2035 3300046675 Ga0495657_0017701 Ga0495657_0017701_1478_2614 369
2036 3300046679 Ga0495623_0060152 Ga0495623_0060152_1045_2181 369
2037 3300046809 Ga0495600_0051307 Ga0495600_0051307_1464_2600 369
2038 3300047315 Ga0495581_0044659 Ga0495581_0044659_24_1160 369
2039 3300047322 Ga0495680_0011978 Ga0495680_0011978_4354_5490 369
2040 3300047470 Ga0495681_0077508 Ga0495681_0077508_144_1280 369
2041 3300047471 Ga0495684_0039709 Ga0495684_0039709_350_1486 369
2042 3300047673 Ga0495593_0031017 Ga0495593_0031017_879_2015 369
2043 3300048903 Ga0496100_0007737 Ga0496100_0007737_3191_4327 369
2044 3300048904 Ga0496101_0174961 Ga0496101_0174961_467_1603 369
2045 3300048905 Ga0496102_0046015 Ga0496102_0046015_245_1381 369
2046 3300048905 Ga0496102_0375764 Ga0496102_0375764_143_1279 369
2047 3300048906 Ga0496103_0018888 Ga0496103_0018888_1731_2867 369
2048 3300048906 Ga0496103_0033020 Ga0496103_0033020_73_1209 369
2049 3300048906 Ga0496103_0118362 Ga0496103_0118362_84_1220 369
2050 3300048909 Ga0496106_0004056 Ga0496106_0004056_3711_4847 369
2051 3300048909 Ga0496106_0213560 Ga0496106_0213560_181_1317 369
2052 3300048913 Ga0496110_0067588 Ga0496110_0067588_655_1791 369
2053 3300048914 Ga0496111_0209079 Ga0496111_0209079_102_1238 369
2054 3300048916 Ga0496113_0074984 Ga0496113_0074984_467_1603 369
2055 3300048922 Ga0496119_0061246 Ga0496119_0061246_438_1574 369
2056 3300048927 Ga0496124_0105592 Ga0496124_0105592_621_1757 369
2057 3300048928 Ga0496125_0080753 Ga0496125_0080753_1083_2219 369
2058 3300049537 Ga0501321_002166 Ga0501321_002166_446_1585 369
2059 3300049569 Ga0501032_0001733 Ga0501032_0001733_11955_13091 369
2060 3300049571 Ga0501034_0000079 Ga0501034_0000079_69184_70320 369
2061 3300049572 Ga0501036_0304735 Ga0501036_0304735_160_1296 369
2062 3300049573 Ga0501037_0013780 Ga0501037_0013780_835_1971 369
2063 3300049573 Ga0501037_0088732 Ga0501037_0088732_611_1747 369
2064 3300049573 Ga0501037_0170277 Ga0501037_0170277_81_1217 369
2065 3300049574 Ga0501038_0061045 Ga0501038_0061045_308_1444 369
2066 3300049574 Ga0501038_0073378 Ga0501038_0073378_850_1986 369
2067 3300049586 Ga0501070_0038905 Ga0501070_0038905_342_1478 369
2068 3300049775 Ga0501279_006874 Ga0501279_006874_197_1333 369
2069 3300049823 Ga0501044_0167162 Ga0501044_0167162_672_1808 369
2070 3300059643 Ga0587072_000110 Ga0587072_000110_5407_6543 369
2071 iso_pu_bacteria 2939674588 2939677490 369

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01645

Glu_synthase

Conserved region in glutamate synthase

265

340

0.83

PF00478

IMPDH

IMP dehydrogenase / GMP reductase domain

69

356

0.82

PF01070

FMN_dh

FMN-dependent dehydrogenase

151

347

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qr6-assembly1.cif.gz_A crystal structure of imp dehydrogenase/gmp reductase-like protein (np_599840.1) from corynebacterium glutamicum atcc 13032 kitasato at 1.50 a resolution 0.9483 4 364
2qr6-assembly1.cif.gz_A crystal structure of imp dehydrogenase/gmp reductase-like protein (np_599840.1) from corynebacterium glutamicum atcc 13032 kitasato at 1.50 a resolution 0.9256 4 364
4qq3-assembly1.cif.gz_A inosine 5'-monophosphate dehydrogenase from vibrio cholerae, deletion mutant, in complex with xmp 0.8494 6 363
4qq3-assembly1.cif.gz_A inosine 5'-monophosphate dehydrogenase from vibrio cholerae, deletion mutant, in complex with xmp 0.8364 6 363
6mgu-assembly1.cif.gz_A crystal structure of the catalytic domain of the inosine monophosphate dehydrogenase from bacillus anthracis in the complex with inhibitor oxanosine monophosphate 0.8355 14 363
ID Description Score Start End Superfamily
2qr6A02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.944 17 364 3.20.20.70
2qr6A02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9386 17 364 3.20.20.70
4qq3A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.847 6 363 3.20.20.70
4qq3A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.834 6 363 3.20.20.70
af_B4F8B4_8_338_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7927 47 290 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A3P5WU28-F1-model_v4 Putative oxidoreductase/MSMEI_1564 (EC 1.-.-.-) 0.987 1 368 GO:0003938
GO:0006183
AF-H0QRD3-F1-model_v4 IMP dehydrogenase family protein 0.9869 1 369 GO:0003938
GO:0006183
AF-A0A1G5PLG8-F1-model_v4 IMP dehydrogenase 0.9869 1 369 GO:0003938
GO:0006183
AF-K2M477-F1-model_v4 deleted 0.9866 15 222
AF-A0A7G6WMW6-F1-model_v4 GuaB3 family IMP dehydrogenase-related protein 0.9863 1 369 GO:0003938
GO:0006183

Feature Viewer

pLDDT pTM Quality
91.87 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map