F496211
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1991 | 1252 | 923 | 328 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2751185821|2753463398 |
| Length | 381 |
| Sequence | ERGAWRGRKRPLPPLIDLLSADASRPQRLCAMSVNIIAHHPVWNRNSRETKMTVRFGLLGAGRIGKVHAKAVSGNPDAVLVAVADAFSAAAEAIAKAYGCEVRTIEAIEAASDIDAVVICTPTDTHADLIERFARAGKAIFCEKPIDLDVDRVKACLKVVSETRAKLMVGFNRRFDPHFMAVRKAIDDGRIGDVEMVTITSRDPGAPPVDYIKRSGGIFRDMTIHDFDMARFLLGEEPVSVTATAAVLVDKAIGEAGDFDSVSVILQTASGKQAVISNSRRATYGYDQRIEVHGSKGAVAAENQRPVSIEIATGEGYTRPPLHDFFMTRYTEAYANEIESFIAAIEKGAEITPSGKDGLAALALADAAVRSVAEKRQISVA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501050 | Microvirga lupini Lut6 | Isolate | Nodule |
| 4 | 2508501114 | Microvirga lotononidis WSM3557 | Isolate | Nodule |
| 5 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 6 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 7 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 8 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 9 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 10 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 11 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 12 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 13 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 14 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 15 | 2510461069 | Rhizobium sp. PDO1-076 | Isolate | Rhizosphere |
| 16 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 17 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 18 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 19 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 20 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 21 | 2511231027 | Phyllobacterium sp. YR531 | Isolate | Rhizosphere |
| 22 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 23 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 24 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 25 | 2512875024 | Mesorhizobium loti R88b | Isolate | Nodule |
| 26 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 27 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 28 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 29 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 30 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 31 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 32 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 33 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 34 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 35 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 36 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 37 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 38 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 39 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 40 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 41 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 42 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 43 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 44 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 45 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 46 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 47 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 48 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 49 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 50 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 51 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 52 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 53 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 54 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 55 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 56 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 57 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 58 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 59 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 60 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 61 | 2523231067 | Pleomorphomonas oryzae DSM 16300 | Isolate | Unclassified |
| 62 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 63 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 64 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 65 | 2534681786 | Brucella suis 92/29 | Isolate | Unclassified |
| 66 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 67 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 68 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 69 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 70 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 71 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 72 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 73 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 74 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 75 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 76 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 77 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 78 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 79 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 80 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 81 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 82 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 83 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 84 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 85 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 86 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 87 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 88 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 89 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 90 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 91 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 92 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 93 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 94 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 95 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 96 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 97 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 98 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 99 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 100 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 101 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 102 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 103 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 104 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 105 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 106 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 107 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 108 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 109 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 110 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 111 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 112 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 113 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 114 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 115 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 116 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 117 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 118 | 2643221550 | Mesorhizobium sp. Root552 | Isolate | Unclassified |
| 119 | 2643221551 | Mesorhizobium sp. Root1471 | Isolate | Unclassified |
| 120 | 2643221555 | Mesorhizobium sp. Root554 | Isolate | Unclassified |
| 121 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 122 | 2643221558 | Rhizobium sp. Root149 | Isolate | Unclassified |
| 123 | 2643221564 | Mesorhizobium sp. Root157 | Isolate | Unclassified |
| 124 | 2643221568 | Rhizobium sp. Root564 | Isolate | Unclassified |
| 125 | 2643221580 | Devosia sp. Root635 | Isolate | Unclassified |
| 126 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 127 | 2643221591 | Devosia sp. Root685 | Isolate | Unclassified |
| 128 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 129 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 130 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 131 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 132 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 133 | 2643221623 | Aminobacter sp. DSM 101952 Root100 | Isolate | Unclassified |
| 134 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 135 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 136 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 137 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 138 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 139 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 140 | 2643221653 | Rhizobium sp. Root1240 | Isolate | Unclassified |
| 141 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 142 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 143 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 144 | 2643221674 | Devosia sp. Root436 | Isolate | Unclassified |
| 145 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 146 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 147 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 148 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 149 | 2643221689 | Rhizobium sp. Root483D2 | Isolate | Unclassified |
| 150 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 151 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 152 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 153 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 154 | 2643221719 | Rhizobium sp. Root274 | Isolate | Unclassified |
| 155 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 156 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 157 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 158 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 159 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 160 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 161 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 162 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 163 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 164 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 165 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 166 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 167 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 168 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 169 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 170 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 171 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 172 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 173 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 174 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 175 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 176 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 177 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 178 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 179 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 180 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 181 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 182 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 183 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 184 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 185 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 186 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 187 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 188 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 189 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 190 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 191 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 192 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 193 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 194 | 2738543031 | Pleomorphomonas sp. CF100 | Isolate | Unclassified |
| 195 | 2751185800 | Brucella pituitosa AA2 | Isolate | Unclassified |
| 196 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 197 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 198 | 2758568016 | [Ochrobactrum] quorumnocens A44 | Isolate | Rhizosphere |
| 199 | 2765235802 | Phyllobacterium bourgognense 31-25a | Isolate | Rhizoplane |
| 200 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 201 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 202 | 2773857925 | Microvirga vignae BR3299 | Isolate | Unclassified |
| 203 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 204 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 205 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 206 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 207 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 208 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 209 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 210 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 211 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 212 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 213 | 2791355253 | Rhizobium rhizosphaerae RD15 | Isolate | Rhizosphere |
| 214 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 215 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 216 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 217 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 218 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 219 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 220 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 221 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 222 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 223 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 224 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 225 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 226 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 227 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 228 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 229 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 230 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 231 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 232 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 233 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 234 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 235 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 236 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 237 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 238 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 239 | 2818991272 | Rhizobium sp. SLBN-4 | Isolate | Unclassified |
| 240 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 241 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 242 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 243 | 2835312727 | Microvirga calopogonii CCBAU 65841 | Isolate | Nodule |
| 244 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 245 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 246 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 247 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 248 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 249 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 250 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 251 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 252 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 253 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 254 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 255 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 256 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 257 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 258 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 259 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 260 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 261 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 262 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 263 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 264 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 265 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 266 | 2839993093 | Phyllobacterium endophyticum PEPV15 | Isolate | Unclassified |
| 267 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 268 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 269 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 270 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 271 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 272 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 273 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 274 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 275 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 276 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 277 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 278 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 279 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 280 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 281 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 282 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 283 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 284 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 285 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 286 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 287 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 288 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 289 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 290 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 291 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 292 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 293 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 294 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 295 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 296 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 297 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 298 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 299 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 300 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 301 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 302 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 303 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 304 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 305 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 306 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 307 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 308 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 309 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 310 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 311 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 312 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 313 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 314 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 315 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 316 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 317 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 318 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 319 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 320 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 321 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 322 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 323 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 324 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 325 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 326 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 327 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 328 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 329 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 330 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 331 | 2842871566 | Phyllobacterium sp. R-73111 | Isolate | Unclassified |
| 332 | 2842922631 | Pararhizobium sp. R-72066 | Isolate | Unclassified |
| 333 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 334 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 335 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 336 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 337 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 338 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 339 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 340 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 341 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 342 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 343 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 344 | 2854896431 | Neorhizobium alkalisoli DSM 21826 | Isolate | Unclassified |
| 345 | 2854911287 | Brucella lupini LUP21 | Isolate | Unclassified |
| 346 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 347 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 348 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 349 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 350 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 351 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 352 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 353 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 354 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 355 | 2856349417 | Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 | Isolate | Nodule |
| 356 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 357 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 358 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 359 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 360 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 361 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 362 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 363 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 364 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 365 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 366 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 367 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 368 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 369 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 370 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 371 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 372 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 373 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 374 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 375 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 376 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 377 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 378 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 379 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 380 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 381 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 382 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 383 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 384 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 385 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 386 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 387 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 388 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 389 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 390 | 2876377896 | Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 | Isolate | Nodule |
| 391 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 392 | 2876392853 | Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 | Isolate | Nodule |
| 393 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 394 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 395 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 396 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 397 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 398 | 2878730984 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 | Isolate | Nodule |
| 399 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 400 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 401 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 402 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 403 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 404 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 405 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 406 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 407 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 408 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 409 | 2881853255 | Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 | Isolate | Nodule |
| 410 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 411 | 2882456835 | Microvirga sp. KLBC 81 | Isolate | Unclassified |
| 412 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 413 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 414 | 2884298095 | Microvirga thermotolerans HR1 | Isolate | Rhizosphere |
| 415 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 416 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 417 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 418 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 419 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 420 | 2885342637 | Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 | Isolate | Nodule |
| 421 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 422 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 423 | 2888343758 | Mesorhizobium sp. AA22 | Isolate | Unclassified |
| 424 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 425 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 426 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 427 | 2889790730 | Chelativorans xinjiangense lm93 | Isolate | Rhizosphere |
| 428 | 2889914905 | Chelativorans alearense UJN715 | Isolate | Rhizosphere |
| 429 | 2891048133 | Martelella lutilitoris GH2-6 | Isolate | Rhizosphere |
| 430 | 2891373044 | Shinella sp. AETb1-6 | Isolate | Rhizosphere |
| 431 | 2894232714 | Microvirga tunisiensis Lmie10 | Isolate | Nodule |
| 432 | 2894652903 | Phyllobacterium sp. SYP-B3895 | Isolate | Rhizosphere |
| 433 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 434 | 2898795034 | Rhodobacter sp. SGA-6-6 | Isolate | Rhizosphere |
| 435 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 436 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 437 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 438 | 2902330777 | Methylobacterium sp. 2A | Isolate | Unclassified |
| 439 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 440 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 441 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 442 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 443 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 444 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 445 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 446 | 2904578770 | Phyllobacterium sp. 586 | Isolate | Unclassified |
| 447 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 448 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 449 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 450 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 451 | 2906354277 | Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 | Isolate | Nodule |
| 452 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 453 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 454 | 2906378014 | Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 | Isolate | Nodule |
| 455 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 456 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 457 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 458 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 459 | 2906427513 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 | Isolate | Nodule |
| 460 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 461 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 462 | 2909042592 | Labrys sp. LIt4 | Isolate | Nodule |
| 463 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 464 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 465 | 2915650412 | Ochrobactrum sp. CM-21-5 | Isolate | Rhizosphere |
| 466 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 467 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 468 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 469 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 470 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 471 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 472 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 473 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 474 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 475 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 476 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 477 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 478 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 479 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 480 | 2917554339 | Chthonobacter rhizosphaerae yh7-1 | Isolate | Rhizosphere |
| 481 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 482 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 483 | 2919119836 | Phyllobacterium sp. 1468 | Isolate | Rhizosphere |
| 484 | 2919166419 | Agrobacterium cavarae 2074 | Isolate | Unclassified |
| 485 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 486 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 487 | 2919679072 | Pseudotabrizicola sp. 4114 | Isolate | Unclassified |
| 488 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 489 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 490 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 491 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 492 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 493 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 494 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 495 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 496 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 497 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 498 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 499 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 500 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 501 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 502 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 503 | 2922178524 | Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 | Isolate | Nodule |
| 504 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 505 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 506 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 507 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 508 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 509 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 510 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 511 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 512 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 513 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 514 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 515 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 516 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 517 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 518 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 519 | 2924710171 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 | Isolate | Nodule |
| 520 | 2924718760 | Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 | Isolate | Nodule |
| 521 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 522 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 523 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 524 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 525 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 526 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 527 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 528 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 529 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 530 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 531 | 2928521798 | Phyllobacterium ifriqiyense 1451 | Isolate | Rhizosphere |
| 532 | 2932401849 | Devosia sp. 2618 | Isolate | Rhizosphere |
| 533 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 534 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 535 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 536 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 537 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 538 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 539 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 540 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 541 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 542 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 543 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 544 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 545 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 546 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 547 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 548 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 549 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 550 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 551 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 552 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 553 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 554 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 555 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 556 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 557 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 558 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 559 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 560 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 561 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 562 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 563 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 564 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 565 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 566 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 567 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 568 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 569 | 2937868953 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 | Isolate | Nodule |
| 570 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 571 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 572 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 573 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 574 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 575 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 576 | 2939669807 | Kaistia defluvii 3207 | Isolate | Rhizosphere |
| 577 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 578 | 2954011201 | Phyllobacterium ifrigiyense W4I11 | Isolate | Rhizosphere |
| 579 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 580 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 581 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 582 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 583 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 584 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 585 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 586 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 587 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 588 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 589 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 590 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 591 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 592 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 593 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 594 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 595 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 596 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 597 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 598 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 599 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 600 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 601 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 602 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 603 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 604 | 2958092219 | Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 | Isolate | Nodule |
| 605 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 606 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 607 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 608 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 609 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 610 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 611 | 2958144490 | Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 | Isolate | Nodule |
| 612 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 613 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 614 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 615 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 616 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 617 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 618 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 619 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 620 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 621 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 622 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 623 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 624 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 625 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 626 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 627 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 628 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 629 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 630 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 631 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 632 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 633 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 634 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 635 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 636 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 637 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 638 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 639 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 640 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 641 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 642 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 643 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 644 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 645 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 646 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 647 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 648 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 649 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 650 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 651 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 652 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 653 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 654 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 655 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 656 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 657 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 658 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 659 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 660 | 2965047637 | Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 | Isolate | Nodule |
| 661 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 662 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 663 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 664 | 2965110997 | Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 | Isolate | Nodule |
| 665 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 666 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 667 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 668 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 669 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 670 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 671 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 672 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 673 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 674 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 675 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 676 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 677 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 678 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 679 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 680 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 681 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 682 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 683 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 684 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 685 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 686 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 687 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 688 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 689 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 690 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 691 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 692 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 693 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 694 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 695 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 696 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 697 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 698 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 699 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 700 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 701 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 702 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 703 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 704 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 705 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 706 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 707 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 708 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 709 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 710 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 711 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 712 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 713 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 714 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 715 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 716 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 717 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 718 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 719 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 720 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 721 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 722 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 723 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 724 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 725 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 726 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 727 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 728 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 729 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 730 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 731 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 732 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 733 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 734 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 735 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 736 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 737 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 738 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 739 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 740 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 741 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 742 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 743 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 744 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 745 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 746 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 747 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 748 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 749 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 750 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 751 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 752 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 753 | 2977971508 | Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 | Isolate | Nodule |
| 754 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 755 | 2978969890 | Agrobacterium sp. SORGH_AS 787 | Isolate | Unclassified |
| 756 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 757 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 758 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 759 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 760 | 2979742915 | Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 | Isolate | Nodule |
| 761 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 762 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 763 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 764 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 765 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 766 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 767 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 768 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 769 | 2984587000 | Agrobacterium larrymoorei SORGH_AS974 | Isolate | Aerial Root |
| 770 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 771 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 772 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 773 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 774 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 775 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 776 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 777 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 778 | 2989776772 | Rhizobium glycinendophyticum CL12 | Isolate | Unclassified |
| 779 | 2995392953 | Martelella limonii NBRC 109441 | Isolate | Unclassified |
| 780 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 781 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 782 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 783 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 784 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 785 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 786 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 787 | 3002141150 | Phyllobacterium sp. 628 | Isolate | Unclassified |
| 788 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 789 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 790 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 791 | 3004195979 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 | Isolate | Nodule |
| 792 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 793 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 794 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 795 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 796 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 797 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 798 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 799 | 3004289098 | Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 | Isolate | Nodule |
| 800 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 801 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 802 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 803 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 804 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 805 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 806 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 807 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 808 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 809 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 810 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 811 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 812 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 813 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 814 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 815 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 816 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 817 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 818 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 819 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 820 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 821 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 822 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 823 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 824 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 825 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 826 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 827 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 828 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 829 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 830 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 831 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 832 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 833 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 834 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 835 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 836 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 837 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 838 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 839 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 840 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 841 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 842 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 843 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 844 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 845 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 846 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 847 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 848 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 849 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 850 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 851 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 852 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 853 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 854 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 855 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 856 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 857 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 858 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 859 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 860 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 861 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 862 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 863 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 864 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 865 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 866 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 867 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 868 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 869 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 870 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 871 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 872 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 873 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 874 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 875 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 876 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 877 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 878 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 879 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 880 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 881 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 882 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 883 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 884 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 885 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 886 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 887 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 888 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 889 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 890 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 891 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 892 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 893 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 894 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 895 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 896 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 897 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 898 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 899 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 900 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 901 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 902 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 903 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 904 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 905 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 906 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 907 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 908 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 909 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 910 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 911 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 912 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 913 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 914 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 915 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 916 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 917 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 918 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 919 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 920 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 921 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 922 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 923 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 924 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 925 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 926 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 927 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 928 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 929 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 930 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 931 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 932 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 933 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 934 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 935 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 936 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 937 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 938 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 939 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 940 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 941 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 942 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 943 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 944 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 945 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 946 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 947 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 948 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 949 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 950 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 951 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 952 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 953 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 954 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 955 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 956 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 957 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 958 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 959 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 960 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 961 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 962 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 963 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 964 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 965 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 966 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 967 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 968 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 969 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 970 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 971 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 972 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 973 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 974 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 975 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 976 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 977 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 978 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 979 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 980 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 981 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 982 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 983 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 984 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 985 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 986 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 987 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 988 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 989 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 990 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 991 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 992 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 993 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 994 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 995 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 996 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 997 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 998 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 999 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 1000 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 1001 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 1002 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 1003 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 1004 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 1005 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 1006 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 1007 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 1008 | 3300038727 | Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 | Metagenome | Unclassified |
| 1009 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 1010 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 1011 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 1012 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 1013 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 1014 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 1015 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 1016 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 1017 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 1018 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 1019 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 1020 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 1021 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 1022 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 1023 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 1024 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 1025 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 1026 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 1027 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 1028 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 1029 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 1030 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 1031 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 1032 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 1033 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 1034 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 1035 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 1036 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 1037 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 1038 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 1039 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 1040 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 1041 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 1042 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 1043 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 1044 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 1045 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 1046 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 1047 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 1048 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 1049 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 1050 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 1051 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 1052 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 1053 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 1054 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 1055 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 1056 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 1057 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 1058 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 1059 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 1060 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 1061 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 1062 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 1063 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 1064 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 1065 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 1066 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 1067 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 1068 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 1069 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 1070 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 1071 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 1072 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 1073 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 1074 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 1075 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 1076 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 1077 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 1078 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 1079 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 1080 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 1081 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 1082 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 1083 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 1084 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 1085 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 1086 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 1087 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 1088 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 1089 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 1090 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 1091 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 1092 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 1093 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 1094 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 1095 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 1096 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 1097 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 1098 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 1099 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 1100 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 1101 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 1102 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 1103 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 1104 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 1105 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 1106 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 1107 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 1108 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 1109 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 1110 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 1111 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 1112 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1113 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1114 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1115 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1116 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1117 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1118 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1119 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1120 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1121 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1122 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1123 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1124 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1125 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1126 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1127 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1128 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 1129 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1130 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1131 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 1132 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1133 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1134 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1135 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1136 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1137 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1138 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 1139 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1140 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1141 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1142 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 1143 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 1144 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 1145 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 1146 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 1147 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 1148 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 1149 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 1150 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 1151 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 1152 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 1153 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 1154 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 1155 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 1156 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 1157 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 1158 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 1159 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 1160 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 1161 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 1162 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 1163 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 1164 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 1165 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 1166 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 1167 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 1168 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 1169 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 1170 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 1171 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 1172 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 1173 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 1174 | 3300053733 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere | Metagenome | Endosphere |
| 1175 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 1176 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 1177 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1178 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1179 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1180 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1181 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 1182 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 1183 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 1184 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 1185 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 1186 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 1187 | 8002285264 | Aminobacter anthyllidis LMG 26462 | Isolate | Nodule |
| 1188 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 1189 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 1190 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 1191 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 1192 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 1193 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 1194 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 1195 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 1196 | 8004395343 | Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 | Isolate | Nodule |
| 1197 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 1198 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 1199 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 1200 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 1201 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 1202 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 1203 | 8005246636 | Rhizobium wuzhouense W44 | Isolate | Rhizosphere |
| 1204 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 1205 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 1206 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 1207 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 1208 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 1209 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 1210 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 1211 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 1212 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 1213 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 1214 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 1215 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 1216 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 1217 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 1218 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 1219 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 1220 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 1221 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 1222 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 1223 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 1224 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 1225 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 1226 | 8005658619 | Rhizobium terrae CC-HIH110 | Isolate | Unclassified |
| 1227 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 1228 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 1229 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 1230 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 1231 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 1232 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 1233 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
| 1234 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 1235 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 1236 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 1237 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 1238 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 1239 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 1240 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 1241 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 1242 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 1243 | 8054460903 | Agrobacterium vaccinii B7.6 | Isolate | Unclassified |
| 1244 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 1245 | 8055431914 | Allorhizobium sonneratiae BGMRC 0089 | Isolate | Unclassified |
| 1246 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
| 1247 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 1248 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 1249 | 8056875544 | Rhizobium halophilum TRM95001 | Isolate | Rhizosphere |
| 1250 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
| 1251 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
| 1252 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 46.31 |
| Metatranscriptomes | 0.15 |
| Isolates | 53.54 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.25 |
| Bulb | 0 |
| Endosphere | 12.36 |
| Nodule | 41.69 |
| Rhizoplane | 1.51 |
| Rhizosphere | 29.33 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.87 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10000201 | 3300001979 | Bacteria | 24790 |
| 2 | JGI25155J39150_1000014 | 3300002704 | Bacteria | 196159 |
| 3 | JGI25156J39149_1000083 | 3300002705 | Bacteria | 70138 |
| 4 | JGI25156J39149_1010500 | 3300002705 | Bacteria | 2171 |
| 5 | JGI25162J39368_1000532 | 3300002737 | Bacteria | 28366 |
| 6 | JGI25154J39366_1000139 | 3300002738 | Bacteria | 56829 |
| 7 | JGI25157J39369_1000110 | 3300002741 | Bacteria | 69643 |
| 8 | JGI25157J39369_1000647 | 3300002741 | Bacteria | 19446 |
| 9 | JGI25152J39213_1000492 | 3300002773 | Bacteria | 22380 |
| 10 | JGI25152J39213_1001051 | 3300002773 | Bacteria | 13115 |
| 11 | JGI25152J39213_1004576 | 3300002773 | Bacteria | 4310 |
| 12 | JGI25152J39213_1007948 | 3300002773 | Bacteria | 2685 |
| 13 | JGI25152J39213_1009306 | 3300002773 | Bacteria | 2344 |
| 14 | JGI25152J39213_1016172 | 3300002773 | Bacteria | 1448 |
| 15 | JGI25150J39212_1000533 | 3300002774 | Bacteria | 15466 |
| 16 | JGI25159J45721_1000008 | 3300002987 | Bacteria | 172667 |
| 17 | JGI25159J45721_1000251 | 3300002987 | Bacteria | 25319 |
| 18 | JGI25151J46595_10000152 | 3300003187 | Bacteria | 90443 |
| 19 | JGI25151J46595_10003146 | 3300003187 | Bacteria | 9276 |
| 20 | JGI25151J46595_10003216 | 3300003187 | Bacteria | 9137 |
| 21 | JGI25151J46595_10020830 | 3300003187 | Bacteria | 2756 |
| 22 | JGI25165J46597_1000078 | 3300003214 | Bacteria | 179320 |
| 23 | JGI25165J46597_1000692 | 3300003214 | Bacteria | 26996 |
| 24 | JGI25165J46597_1000752 | 3300003214 | Bacteria | 24944 |
| 25 | JGI25165J46597_1001515 | 3300003214 | Bacteria | 11760 |
| 26 | JGI25153J46596_10000299 | 3300003215 | Bacteria | 37025 |
| 27 | JGI25153J46596_10003676 | 3300003215 | Bacteria | 8492 |
| 28 | JGI25153J46596_10005962 | 3300003215 | Bacteria | 6274 |
| 29 | JGI25153J46596_10018655 | 3300003215 | Bacteria | 2685 |
| 30 | JGI25160J50197_1000001 | 3300003354 | Bacteria | 782301 |
| 31 | JGI25160J50197_1000033 | 3300003354 | Bacteria | 172667 |
| 32 | JGI25160J50197_1005675 | 3300003354 | Bacteria | 5158 |
| 33 | JGI25160J50197_1015468 | 3300003354 | Bacteria | 2502 |
| 34 | JGI25160J50197_1023193 | 3300003354 | Bacteria | 1799 |
| 35 | JGI25161J50226_1000001 | 3300003374 | Bacteria | 655036 |
| 36 | JGI25161J50226_1000725 | 3300003374 | Bacteria | 12789 |
| 37 | JGI25161J50226_1001797 | 3300003374 | Bacteria | 6040 |
| 38 | JGI25161J50226_1007057 | 3300003374 | Bacteria | 1942 |
| 39 | Ga0055542_1001263 | 3300003762 | Bacteria | 13787 |
| 40 | Ga0055542_1009118 | 3300003762 | Bacteria | 1891 |
| 41 | Ga0055529_1005120 | 3300003763 | Bacteria | 1931 |
| 42 | Ga0055526_1000440 | 3300003771 | Bacteria | 33129 |
| 43 | Ga0055526_1001356 | 3300003771 | Bacteria | 17508 |
| 44 | Ga0055526_1008472 | 3300003771 | Bacteria | 5126 |
| 45 | Ga0055524_1001932 | 3300003775 | Bacteria | 11167 |
| 46 | Ga0055524_1017411 | 3300003775 | Bacteria | 2536 |
| 47 | Ga0055524_1021528 | 3300003775 | Bacteria | 2133 |
| 48 | Ga0055524_1022564 | 3300003775 | Bacteria | 2052 |
| 49 | Ga0055536_1002504 | 3300003781 | Bacteria | 10308 |
| 50 | Ga0055536_1006866 | 3300003781 | Bacteria | 5200 |
| 51 | Ga0055536_1009791 | 3300003781 | Bacteria | 3907 |
| 52 | Ga0055528_1000921 | 3300003790 | Bacteria | 19731 |
| 53 | Ga0055528_1002280 | 3300003790 | Bacteria | 10402 |
| 54 | Ga0055528_1007362 | 3300003790 | Bacteria | 4872 |
| 55 | Ga0055528_1007666 | 3300003790 | Bacteria | 4737 |
| 56 | Ga0055528_1013344 | 3300003790 | Bacteria | 3117 |
| 57 | Ga0055528_1021283 | 3300003790 | Bacteria | 2064 |
| 58 | Ga0055528_1027023 | 3300003790 | Bacteria | 1628 |
| 59 | Ga0055540_1000396 | 3300003792 | Bacteria | 35757 |
| 60 | Ga0055540_1002497 | 3300003792 | Bacteria | 9639 |
| 61 | Ga0055540_1004246 | 3300003792 | Bacteria | 6563 |
| 62 | Ga0055540_1005022 | 3300003792 | Bacteria | 5742 |
| 63 | Ga0055531_10003672 | 3300003794 | Bacteria | 9667 |
| 64 | Ga0055531_10009548 | 3300003794 | Bacteria | 4947 |
| 65 | Ga0058692_1000942 | 3300003856 | Bacteria | 11449 |
| 66 | Ga0058692_1003656 | 3300003856 | Bacteria | 4702 |
| 67 | Ga0055543_1000026 | 3300004625 | Bacteria | 136177 |
| 68 | Ga0055543_1000089 | 3300004625 | Bacteria | 79924 |
| 69 | Ga0055543_1000104 | 3300004625 | Bacteria | 73576 |
| 70 | Ga0055543_1003556 | 3300004625 | Bacteria | 4522 |
| 71 | Ga0065165_1000008 | 3300005262 | Bacteria | 334429 |
| 72 | Ga0065165_1000178 | 3300005262 | Bacteria | 113319 |
| 73 | Ga0065165_1003404 | 3300005262 | Bacteria | 11229 |
| 74 | Ga0070658_10060723 | 3300005327 | Bacteria | 3079 |
| 75 | Ga0070658_10267132 | 3300005327 | Bacteria | 1454 |
| 76 | Ga0070670_100009022 | 3300005331 | Bacteria | 8520 |
| 77 | Ga0068869_100165540 | 3300005334 | Bacteria | 1724 |
| 78 | Ga0068868_100108886 | 3300005338 | Bacteria | 2250 |
| 79 | Ga0070661_100002923 | 3300005344 | Bacteria | 11779 |
| 80 | Ga0070668_100069929 | 3300005347 | Bacteria | 2732 |
| 81 | Ga0070675_100104576 | 3300005354 | Bacteria | 2389 |
| 82 | Ga0070671_100007376 | 3300005355 | Bacteria | 8785 |
| 83 | Ga0070659_100124159 | 3300005366 | Bacteria | 2093 |
| 84 | Ga0070667_100259791 | 3300005367 | Bacteria | 1555 |
| 85 | Ga0070667_100290597 | 3300005367 | Bacteria | 1470 |
| 86 | Ga0070663_100248245 | 3300005455 | Bacteria | 1408 |
| 87 | Ga0070681_10342373 | 3300005458 | Bacteria | 1405 |
| 88 | Ga0068867_100142145 | 3300005459 | Bacteria | 1877 |
| 89 | Ga0070707_100047434 | 3300005468 | Bacteria | 4113 |
| 90 | Ga0070684_100089357 | 3300005535 | Bacteria | 2738 |
| 91 | Ga0068853_100008908 | 3300005539 | Bacteria | 8077 |
| 92 | Ga0068853_100052482 | 3300005539 | Bacteria | 3512 |
| 93 | Ga0068853_100160419 | 3300005539 | Bacteria | 2029 |
| 94 | Ga0070665_100009435 | 3300005548 | Bacteria | 9877 |
| 95 | Ga0070665_100055085 | 3300005548 | Bacteria | 3988 |
| 96 | Ga0070665_100125686 | 3300005548 | Bacteria | 2567 |
| 97 | Ga0068855_100116311 | 3300005563 | Bacteria | 3065 |
| 98 | Ga0068855_100410450 | 3300005563 | Bacteria | 1483 |
| 99 | Ga0070664_100037537 | 3300005564 | Bacteria | 4074 |
| 100 | Ga0070664_100167619 | 3300005564 | Bacteria | 1947 |
| 101 | Ga0068857_100390461 | 3300005577 | Bacteria | 1294 |
| 102 | Ga0068854_100025684 | 3300005578 | Bacteria | 4042 |
| 103 | Ga0068854_100058022 | 3300005578 | Bacteria | 2793 |
| 104 | Ga0068854_100071955 | 3300005578 | Bacteria | 2531 |
| 105 | Ga0068856_100006424 | 3300005614 | Bacteria | 11534 |
| 106 | Ga0068856_100087342 | 3300005614 | Bacteria | 3100 |
| 107 | Ga0068856_100360183 | 3300005614 | Bacteria | 1473 |
| 108 | Ga0068852_100027054 | 3300005616 | Bacteria | 4669 |
| 109 | Ga0068852_100072527 | 3300005616 | Bacteria | 3026 |
| 110 | Ga0068852_100223585 | 3300005616 | Bacteria | 1791 |
| 111 | Ga0068859_100210192 | 3300005617 | Bacteria | 2032 |
| 112 | Ga0068859_100226096 | 3300005617 | Bacteria | 1959 |
| 113 | Ga0068864_100005685 | 3300005618 | Bacteria | 10219 |
| 114 | Ga0068851_10017316 | 3300005834 | Bacteria | 3459 |
| 115 | Ga0068863_100089005 | 3300005841 | Bacteria | 2926 |
| 116 | Ga0068858_100249145 | 3300005842 | Bacteria | 1687 |
| 117 | Ga0070717_10174906 | 3300006028 | Bacteria | 1869 |
| 118 | Ga0075365_10000918 | 3300006038 | Bacteria | 12405 |
| 119 | Ga0075365_10006255 | 3300006038 | Bacteria | 6530 |
| 120 | Ga0075365_10007236 | 3300006038 | Bacteria | 6201 |
| 121 | Ga0075368_10043333 | 3300006042 | Bacteria | 1773 |
| 122 | Ga0075368_10049549 | 3300006042 | Bacteria | 1666 |
| 123 | Ga0075368_10062261 | 3300006042 | Bacteria | 1495 |
| 124 | Ga0075368_10087624 | 3300006042 | Bacteria | 1271 |
| 125 | Ga0075363_100021836 | 3300006048 | Bacteria | 3230 |
| 126 | Ga0075363_100102632 | 3300006048 | Bacteria | 1584 |
| 127 | Ga0075364_10005164 | 3300006051 | Bacteria | 7571 |
| 128 | Ga0075364_10136435 | 3300006051 | Bacteria | 1648 |
| 129 | Ga0075364_10243653 | 3300006051 | Bacteria | 1221 |
| 130 | Ga0075362_10008658 | 3300006177 | Bacteria | 3905 |
| 131 | Ga0075362_10014364 | 3300006177 | Bacteria | 3194 |
| 132 | Ga0075362_10080238 | 3300006177 | Bacteria | 1503 |
| 133 | Ga0075367_10016682 | 3300006178 | Bacteria | 4014 |
| 134 | Ga0075369_10016027 | 3300006186 | Bacteria | 3016 |
| 135 | Ga0075369_10021994 | 3300006186 | Bacteria | 2627 |
| 136 | Ga0075369_10028100 | 3300006186 | Bacteria | 2356 |
| 137 | Ga0075366_10018014 | 3300006195 | Bacteria | 4075 |
| 138 | Ga0075366_10098274 | 3300006195 | Bacteria | 1756 |
| 139 | Ga0075370_10004915 | 3300006353 | Bacteria | 6565 |
| 140 | Ga0075370_10047656 | 3300006353 | Bacteria | 2427 |
| 141 | Ga0075370_10079099 | 3300006353 | Bacteria | 1888 |
| 142 | Ga0075370_10084296 | 3300006353 | Bacteria | 1829 |
| 143 | Ga0075428_100005831 | 3300006844 | Bacteria | 13687 |
| 144 | Ga0075431_100223808 | 3300006847 | Bacteria | 1919 |
| 145 | Ga0068865_100124914 | 3300006881 | Bacteria | 1919 |
| 146 | Ga0097620_100210201 | 3300006931 | Bacteria | 2032 |
| 147 | Ga0097620_100226094 | 3300006931 | Bacteria | 1959 |
| 148 | Ga0079104_1002347 | 3300006946 | Bacteria | 10364 |
| 149 | Ga0079104_1002740 | 3300006946 | Bacteria | 8966 |
| 150 | Ga0099826_10012941 | 3300006948 | Bacteria | 6289 |
| 151 | Ga0105251_10019755 | 3300009011 | Bacteria | 3550 |
| 152 | Ga0105240_10000014 | 3300009093 | Bacteria | 482033 |
| 153 | Ga0105240_10010969 | 3300009093 | Bacteria | 12690 |
| 154 | Ga0105240_10047959 | 3300009093 | Bacteria | 5402 |
| 155 | Ga0105240_10114335 | 3300009093 | Bacteria | 3260 |
| 156 | Ga0105240_10120900 | 3300009093 | Bacteria | 3153 |
| 157 | Ga0111539_10023692 | 3300009094 | Bacteria | 7543 |
| 158 | Ga0105245_10130450 | 3300009098 | Bacteria | 2357 |
| 159 | Ga0105245_10133991 | 3300009098 | Bacteria | 2326 |
| 160 | Ga0105243_10025395 | 3300009148 | Bacteria | 4527 |
| 161 | Ga0105241_10076691 | 3300009174 | Bacteria | 2607 |
| 162 | Ga0105241_10236086 | 3300009174 | Bacteria | 1543 |
| 163 | Ga0105248_10021814 | 3300009177 | Bacteria | 7097 |
| 164 | Ga0105248_10172269 | 3300009177 | Bacteria | 2440 |
| 165 | Ga0105248_10197854 | 3300009177 | Bacteria | 2265 |
| 166 | Ga0105237_10000038 | 3300009545 | Bacteria | 190707 |
| 167 | Ga0105237_10003649 | 3300009545 | Bacteria | 18153 |
| 168 | Ga0105237_10032245 | 3300009545 | Bacteria | 5305 |
| 169 | Ga0105237_10038932 | 3300009545 | Bacteria | 4801 |
| 170 | Ga0105237_10051914 | 3300009545 | Bacteria | 4118 |
| 171 | Ga0105237_10098212 | 3300009545 | Bacteria | 2919 |
| 172 | Ga0105237_10161699 | 3300009545 | Bacteria | 2238 |
| 173 | Ga0105238_10001985 | 3300009551 | Bacteria | 20609 |
| 174 | Ga0105238_10015974 | 3300009551 | Bacteria | 7595 |
| 175 | Ga0105238_10078391 | 3300009551 | Bacteria | 3294 |
| 176 | Ga0105238_10452502 | 3300009551 | Bacteria | 1281 |
| 177 | Ga0123341_1000035 | 3300009765 | Bacteria | 62072 |
| 178 | Ga0123342_1009384 | 3300009766 | Bacteria | 11748 |
| 179 | Ga0123342_1026071 | 3300009766 | Bacteria | 3439 |
| 180 | Ga0123342_1028788 | 3300009766 | Bacteria | 2956 |
| 181 | Ga0105239_10000108 | 3300010375 | Bacteria | 116364 |
| 182 | Ga0105239_10122340 | 3300010375 | Bacteria | 2891 |
| 183 | Ga0105239_10153248 | 3300010375 | Bacteria | 2573 |
| 184 | Ga0105239_10161994 | 3300010375 | Bacteria | 2500 |
| 185 | Ga0105239_10354527 | 3300010375 | Bacteria | 1656 |
| 186 | Ga0105246_10076598 | 3300011119 | Bacteria | 2370 |
| 187 | Ga0105246_10091436 | 3300011119 | Bacteria | 2193 |
| 188 | Ga0105246_10207784 | 3300011119 | Bacteria | 1526 |
| 189 | Ga0157371_10000187 | 3300013102 | Bacteria | 91186 |
| 190 | Ga0157370_10000037 | 3300013104 | Bacteria | 136803 |
| 191 | Ga0157370_10002430 | 3300013104 | Bacteria | 22453 |
| 192 | Ga0157370_10085310 | 3300013104 | Bacteria | 2966 |
| 193 | Ga0157370_10114034 | 3300013104 | Bacteria | 2525 |
| 194 | Ga0157369_10109741 | 3300013105 | Bacteria | 2933 |
| 195 | Ga0157369_10150925 | 3300013105 | Bacteria | 2456 |
| 196 | Ga0157369_10330089 | 3300013105 | Bacteria | 1585 |
| 197 | Ga0157369_10336235 | 3300013105 | Bacteria | 1569 |
| 198 | Ga0157369_10391754 | 3300013105 | Bacteria | 1441 |
| 199 | Ga0171463_1007 | 3300013249 | Bacteria | 301198 |
| 200 | Ga0163162_10240771 | 3300013306 | Bacteria | 1940 |
| 201 | Ga0157375_10552081 | 3300013308 | Bacteria | 1314 |
| 202 | Ga0163163_10270264 | 3300014325 | Bacteria | 1751 |
| 203 | Ga0157379_10051127 | 3300014968 | Bacteria | 3691 |
| 204 | Ga0157379_10158340 | 3300014968 | Bacteria | 2044 |
| 205 | Ga0182007_10002682 | 3300015262 | Bacteria | 8718 |
| 206 | Ga0182005_1020059 | 3300015265 | Bacteria | 1841 |
| 207 | Ga0182005_1021965 | 3300015265 | Bacteria | 1748 |
| 208 | Ga0183363_1061 | 3300015690 | Bacteria | 33598 |
| 209 | Ga0214544_1000110 | 3300021320 | Bacteria | 113143 |
| 210 | Ga0214542_1000032 | 3300021321 | Bacteria | 171690 |
| 211 | Ga0214543_1000016 | 3300021327 | Bacteria | 295257 |
| 212 | Ga0214543_1000022 | 3300021327 | Bacteria | 241930 |
| 213 | Ga0213876_10043875 | 3300021384 | Bacteria | 2363 |
| 214 | Ga0213875_10001555 | 3300021388 | Bacteria | 14697 |
| 215 | Ga0228710_1005902 | 3300022740 | Bacteria | 18839 |
| 216 | Ga0209435_100027 | 3300025206 | Bacteria | 196217 |
| 217 | Ga0209672_104167 | 3300025228 | Bacteria | 2754 |
| 218 | Ga0209563_111216 | 3300025230 | Bacteria | 1272 |
| 219 | Ga0207427_105205 | 3300025231 | Bacteria | 1899 |
| 220 | Ga0209437_100058 | 3300025233 | Bacteria | 357279 |
| 221 | Ga0209437_100060 | 3300025233 | Bacteria | 355034 |
| 222 | Ga0207425_1000046 | 3300025245 | Bacteria | 189433 |
| 223 | Ga0207425_1000162 | 3300025245 | Bacteria | 56293 |
| 224 | Ga0207425_1004007 | 3300025245 | Bacteria | 4530 |
| 225 | Ga0207425_1006686 | 3300025245 | Bacteria | 3127 |
| 226 | Ga0207425_1011735 | 3300025245 | Bacteria | 2076 |
| 227 | Ga0209646_1000086 | 3300025246 | Bacteria | 196217 |
| 228 | Ga0209646_1004880 | 3300025246 | Bacteria | 2402 |
| 229 | Ga0209026_1000082 | 3300025250 | Bacteria | 196315 |
| 230 | Ga0209026_1000151 | 3300025250 | Bacteria | 110338 |
| 231 | Ga0209677_100453 | 3300025253 | Bacteria | 23786 |
| 232 | Ga0209148_1000032 | 3300025254 | Bacteria | 557660 |
| 233 | Ga0209148_1000213 | 3300025254 | Bacteria | 100190 |
| 234 | Ga0209759_1000063 | 3300025256 | Bacteria | 196315 |
| 235 | Ga0209759_1000076 | 3300025256 | Bacteria | 175911 |
| 236 | Ga0209759_1000350 | 3300025256 | Bacteria | 60056 |
| 237 | Ga0209129_1000170 | 3300025258 | Bacteria | 95792 |
| 238 | Ga0209129_1000283 | 3300025258 | Bacteria | 48305 |
| 239 | Ga0209129_1000287 | 3300025258 | Bacteria | 48153 |
| 240 | Ga0209129_1000820 | 3300025258 | Bacteria | 19533 |
| 241 | Ga0209129_1000868 | 3300025258 | Bacteria | 18737 |
| 242 | Ga0209129_1001663 | 3300025258 | Bacteria | 12034 |
| 243 | Ga0209129_1006477 | 3300025258 | Bacteria | 3769 |
| 244 | Ga0209233_1000149 | 3300025261 | Bacteria | 181183 |
| 245 | Ga0209233_1000150 | 3300025261 | Bacteria | 179401 |
| 246 | Ga0209233_1000160 | 3300025261 | Bacteria | 159035 |
| 247 | Ga0209455_1000085 | 3300025272 | Bacteria | 247601 |
| 248 | Ga0209455_1001483 | 3300025272 | Bacteria | 10523 |
| 249 | Ga0209673_1000010 | 3300025273 | Bacteria | 596656 |
| 250 | Ga0209673_1000025 | 3300025273 | Bacteria | 404572 |
| 251 | Ga0209673_1000112 | 3300025273 | Bacteria | 179676 |
| 252 | Ga0209673_1001637 | 3300025273 | Bacteria | 19386 |
| 253 | Ga0209673_1002172 | 3300025273 | Bacteria | 14482 |
| 254 | Ga0209673_1002919 | 3300025273 | Bacteria | 10778 |
| 255 | Ga0209673_1005722 | 3300025273 | Bacteria | 6194 |
| 256 | Ga0209673_1015525 | 3300025273 | Bacteria | 2888 |
| 257 | Ga0209130_1000003 | 3300025284 | Bacteria | 677988 |
| 258 | Ga0209130_1000017 | 3300025284 | Bacteria | 388431 |
| 259 | Ga0209130_1000023 | 3300025284 | Bacteria | 359355 |
| 260 | Ga0209676_1000300 | 3300025292 | Bacteria | 100399 |
| 261 | Ga0209676_1001942 | 3300025292 | Bacteria | 16657 |
| 262 | Ga0209676_1006115 | 3300025292 | Bacteria | 6044 |
| 263 | Ga0209676_1029563 | 3300025292 | Bacteria | 1690 |
| 264 | Ga0209025_1000091 | 3300025294 | Bacteria | 250401 |
| 265 | Ga0209025_1000137 | 3300025294 | Bacteria | 190136 |
| 266 | Ga0209025_1000153 | 3300025294 | Bacteria | 170548 |
| 267 | Ga0209025_1000545 | 3300025294 | Bacteria | 70608 |
| 268 | Ga0209025_1000689 | 3300025294 | Bacteria | 57945 |
| 269 | Ga0209025_1001424 | 3300025294 | Bacteria | 31618 |
| 270 | Ga0209025_1002940 | 3300025294 | Bacteria | 16948 |
| 271 | Ga0209025_1005549 | 3300025294 | Bacteria | 10227 |
| 272 | Ga0209025_1008460 | 3300025294 | Bacteria | 7404 |
| 273 | Ga0209025_1009032 | 3300025294 | Bacteria | 7033 |
| 274 | Ga0209025_1018454 | 3300025294 | Bacteria | 3950 |
| 275 | Ga0209025_1030110 | 3300025294 | Bacteria | 2606 |
| 276 | Ga0209025_1030429 | 3300025294 | Bacteria | 2585 |
| 277 | Ga0209564_1000013 | 3300025295 | Bacteria | 775755 |
| 278 | Ga0209564_1000365 | 3300025295 | Bacteria | 84031 |
| 279 | Ga0209564_1000564 | 3300025295 | Bacteria | 58801 |
| 280 | Ga0209564_1001004 | 3300025295 | Bacteria | 35075 |
| 281 | Ga0209564_1005883 | 3300025295 | Bacteria | 6803 |
| 282 | Ga0209564_1015988 | 3300025295 | Bacteria | 3020 |
| 283 | Ga0209564_1023190 | 3300025295 | Bacteria | 2165 |
| 284 | Ga0209758_1000123 | 3300025297 | Bacteria | 190136 |
| 285 | Ga0209758_1000130 | 3300025297 | Bacteria | 184456 |
| 286 | Ga0209758_1000317 | 3300025297 | Bacteria | 93209 |
| 287 | Ga0209758_1001220 | 3300025297 | Bacteria | 32262 |
| 288 | Ga0209758_1002966 | 3300025297 | Bacteria | 16273 |
| 289 | Ga0209758_1003416 | 3300025297 | Bacteria | 14487 |
| 290 | Ga0209758_1004613 | 3300025297 | Bacteria | 11313 |
| 291 | Ga0209758_1005604 | 3300025297 | Bacteria | 9546 |
| 292 | Ga0209758_1006234 | 3300025297 | Bacteria | 8699 |
| 293 | Ga0209758_1008951 | 3300025297 | Bacteria | 6343 |
| 294 | Ga0209758_1009161 | 3300025297 | Bacteria | 6227 |
| 295 | Ga0209758_1009728 | 3300025297 | Bacteria | 5907 |
| 296 | Ga0209050_1004328 | 3300025298 | Bacteria | 9685 |
| 297 | Ga0209050_1005211 | 3300025298 | Bacteria | 8310 |
| 298 | Ga0209050_1008301 | 3300025298 | Bacteria | 5585 |
| 299 | Ga0209050_1026405 | 3300025298 | Bacteria | 1945 |
| 300 | Ga0209256_1000211 | 3300025299 | Bacteria | 110131 |
| 301 | Ga0209256_1000315 | 3300025299 | Bacteria | 84048 |
| 302 | Ga0209256_1003516 | 3300025299 | Bacteria | 10911 |
| 303 | Ga0209256_1004669 | 3300025299 | Bacteria | 8420 |
| 304 | Ga0209256_1005396 | 3300025299 | Bacteria | 7392 |
| 305 | Ga0209256_1010874 | 3300025299 | Bacteria | 3737 |
| 306 | Ga0209256_1013599 | 3300025299 | Bacteria | 3008 |
| 307 | Ga0209256_1019942 | 3300025299 | Bacteria | 2114 |
| 308 | Ga0207426_1000006 | 3300025302 | Bacteria | 1025969 |
| 309 | Ga0207426_1000011 | 3300025302 | Bacteria | 791203 |
| 310 | Ga0207426_1000087 | 3300025302 | Bacteria | 288870 |
| 311 | Ga0207426_1000208 | 3300025302 | Bacteria | 140385 |
| 312 | Ga0207426_1000511 | 3300025302 | Bacteria | 56595 |
| 313 | Ga0207426_1002922 | 3300025302 | Bacteria | 10067 |
| 314 | Ga0209051_1000410 | 3300025303 | Bacteria | 59186 |
| 315 | Ga0209051_1001459 | 3300025303 | Bacteria | 20047 |
| 316 | Ga0209051_1004728 | 3300025303 | Bacteria | 8253 |
| 317 | Ga0209051_1007779 | 3300025303 | Bacteria | 5795 |
| 318 | Ga0209051_1038366 | 3300025303 | Bacteria | 1744 |
| 319 | Ga0209257_1001148 | 3300025304 | Bacteria | 33708 |
| 320 | Ga0209257_1003036 | 3300025304 | Bacteria | 15160 |
| 321 | Ga0207697_10020847 | 3300025315 | Bacteria | 2683 |
| 322 | Ga0207656_10019890 | 3300025321 | Bacteria | 2660 |
| 323 | Ga0207680_10142919 | 3300025903 | Bacteria | 1588 |
| 324 | Ga0207645_10126175 | 3300025907 | Bacteria | 1663 |
| 325 | Ga0207654_10032483 | 3300025911 | Bacteria | 2885 |
| 326 | Ga0207695_10000037 | 3300025913 | Bacteria | 476303 |
| 327 | Ga0207695_10011688 | 3300025913 | Bacteria | 10610 |
| 328 | Ga0207695_10064942 | 3300025913 | Bacteria | 3754 |
| 329 | Ga0207695_10159132 | 3300025913 | Bacteria | 2191 |
| 330 | Ga0207671_10000045 | 3300025914 | Bacteria | 201245 |
| 331 | Ga0207671_10001017 | 3300025914 | Bacteria | 34299 |
| 332 | Ga0207657_10019972 | 3300025919 | Bacteria | 6346 |
| 333 | Ga0207646_10130835 | 3300025922 | Bacteria | 2258 |
| 334 | Ga0207694_10017681 | 3300025924 | Bacteria | 5389 |
| 335 | Ga0207694_10208538 | 3300025924 | Bacteria | 1591 |
| 336 | Ga0207650_10001778 | 3300025925 | Bacteria | 15244 |
| 337 | Ga0207687_10013924 | 3300025927 | Bacteria | 5256 |
| 338 | Ga0207644_10054517 | 3300025931 | Bacteria | 2880 |
| 339 | Ga0207706_10004852 | 3300025933 | Bacteria | 12593 |
| 340 | Ga0207709_10022407 | 3300025935 | Bacteria | 3583 |
| 341 | Ga0207709_10070629 | 3300025935 | Bacteria | 2215 |
| 342 | Ga0207669_10039242 | 3300025937 | Bacteria | 2734 |
| 343 | Ga0207704_10228189 | 3300025938 | Bacteria | 1383 |
| 344 | Ga0207691_10193477 | 3300025940 | Bacteria | 1773 |
| 345 | Ga0207679_10261820 | 3300025945 | Bacteria | 1475 |
| 346 | Ga0207667_10012150 | 3300025949 | Bacteria | 9945 |
| 347 | Ga0207667_10569510 | 3300025949 | Bacteria | 1144 |
| 348 | Ga0207651_10048219 | 3300025960 | Bacteria | 2878 |
| 349 | Ga0207668_10159940 | 3300025972 | Bacteria | 1754 |
| 350 | Ga0207640_10027943 | 3300025981 | Bacteria | 3442 |
| 351 | Ga0207640_10071336 | 3300025981 | Bacteria | 2339 |
| 352 | Ga0207658_10065037 | 3300025986 | Bacteria | 2738 |
| 353 | Ga0207658_10218541 | 3300025986 | Bacteria | 1602 |
| 354 | Ga0207658_10245784 | 3300025986 | Bacteria | 1518 |
| 355 | Ga0207639_10013742 | 3300026041 | Bacteria | 5677 |
| 356 | Ga0207639_10039484 | 3300026041 | Bacteria | 3518 |
| 357 | Ga0207639_10201713 | 3300026041 | Bacteria | 1706 |
| 358 | Ga0207639_10216235 | 3300026041 | Bacteria | 1652 |
| 359 | Ga0207678_10187385 | 3300026067 | Bacteria | 1768 |
| 360 | Ga0207678_10189062 | 3300026067 | Bacteria | 1759 |
| 361 | Ga0207702_10033194 | 3300026078 | Bacteria | 4310 |
| 362 | Ga0207702_10163641 | 3300026078 | Bacteria | 2033 |
| 363 | Ga0207702_10178055 | 3300026078 | Bacteria | 1956 |
| 364 | Ga0207702_10179524 | 3300026078 | Bacteria | 1948 |
| 365 | Ga0207702_10187355 | 3300026078 | Bacteria | 1909 |
| 366 | Ga0207702_10189687 | 3300026078 | Bacteria | 1898 |
| 367 | Ga0207641_10035203 | 3300026088 | Bacteria | 4170 |
| 368 | Ga0207648_10143703 | 3300026089 | Bacteria | 2104 |
| 369 | Ga0207676_10030998 | 3300026095 | Bacteria | 4018 |
| 370 | Ga0207674_10327952 | 3300026116 | Bacteria | 1480 |
| 371 | Ga0207674_10467961 | 3300026116 | Bacteria | 1218 |
| 372 | Ga0207683_10131269 | 3300026121 | Bacteria | 2253 |
| 373 | Ga0207683_10236442 | 3300026121 | Bacteria | 1666 |
| 374 | Ga0207698_10029130 | 3300026142 | Bacteria | 3949 |
| 375 | Ga0209281_1000375 | 3300027111 | Bacteria | 71407 |
| 376 | Ga0209281_1001291 | 3300027111 | Bacteria | 16043 |
| 377 | Ga0209371_1000035 | 3300027312 | Bacteria | 368979 |
| 378 | Ga0209371_1000901 | 3300027312 | Bacteria | 23610 |
| 379 | Ga0209371_1003138 | 3300027312 | Bacteria | 8395 |
| 380 | Ga0209282_1001148 | 3300027666 | Bacteria | 14196 |
| 381 | Ga0209282_1001830 | 3300027666 | Bacteria | 11949 |
| 382 | Ga0209282_1044420 | 3300027666 | Bacteria | 2606 |
| 383 | Ga0209813_10000800 | 3300027866 | Bacteria | 7134 |
| 384 | Ga0209813_10032907 | 3300027866 | Bacteria | 1539 |
| 385 | Ga0207428_10253406 | 3300027907 | Bacteria | 1312 |
| 386 | Ga0268266_10024005 | 3300028379 | Bacteria | 5189 |
| 387 | Ga0268266_10054593 | 3300028379 | Bacteria | 3433 |
| 388 | Ga0268266_10070198 | 3300028379 | Bacteria | 3036 |
| 389 | Ga0268266_10274954 | 3300028379 | Bacteria | 1565 |
| 390 | Ga0265318_10028336 | 3300028577 | Bacteria | 2191 |
| 391 | Ga0307515_10000017 | 3300028794 | Bacteria | 550465 |
| 392 | Ga0307515_10000285 | 3300028794 | Bacteria | 124535 |
| 393 | Ga0307515_10021612 | 3300028794 | Bacteria | 11395 |
| 394 | Ga0307515_10022262 | 3300028794 | Bacteria | 11178 |
| 395 | Ga0307515_10111250 | 3300028794 | Bacteria | 3198 |
| 396 | Ga0268256_1000037 | 3300030500 | Bacteria | 367024 |
| 397 | Ga0268256_1003000 | 3300030500 | Bacteria | 7971 |
| 398 | Ga0268256_1003068 | 3300030500 | Bacteria | 7827 |
| 399 | Ga0316181_1025508 | 3300030744 | Bacteria | 3401 |
| 400 | Ga0265330_10018309 | 3300031235 | Bacteria | 3218 |
| 401 | Ga0265320_10036211 | 3300031240 | Bacteria | 2496 |
| 402 | Ga0265325_10006250 | 3300031241 | Bacteria | 7259 |
| 403 | Ga0265325_10013585 | 3300031241 | Bacteria | 4630 |
| 404 | Ga0265340_10028955 | 3300031247 | Bacteria | 2783 |
| 405 | Ga0265340_10078080 | 3300031247 | Bacteria | 1561 |
| 406 | Ga0265340_10113579 | 3300031247 | Bacteria | 1250 |
| 407 | Ga0265339_10002978 | 3300031249 | Bacteria | 11969 |
| 408 | Ga0265339_10062419 | 3300031249 | Bacteria | 2003 |
| 409 | Ga0265331_10047132 | 3300031250 | Bacteria | 2075 |
| 410 | Ga0265316_10013087 | 3300031344 | Bacteria | 7399 |
| 411 | Ga0265316_10032893 | 3300031344 | Bacteria | 4229 |
| 412 | Ga0265316_10167437 | 3300031344 | Bacteria | 1641 |
| 413 | Ga0307513_10005235 | 3300031456 | Bacteria | 17180 |
| 414 | Ga0307513_10080307 | 3300031456 | Bacteria | 3365 |
| 415 | Ga0307513_10083898 | 3300031456 | Bacteria | 3275 |
| 416 | Ga0307513_10151987 | 3300031456 | Bacteria | 2222 |
| 417 | Ga0307509_10053450 | 3300031507 | Bacteria | 4307 |
| 418 | Ga0307408_100022636 | 3300031548 | Bacteria | 4272 |
| 419 | Ga0307408_100054513 | 3300031548 | Bacteria | 2891 |
| 420 | Ga0265313_10000044 | 3300031595 | Bacteria | 117063 |
| 421 | Ga0265313_10000481 | 3300031595 | Bacteria | 41874 |
| 422 | Ga0265313_10011274 | 3300031595 | Bacteria | 5569 |
| 423 | Ga0265313_10072214 | 3300031595 | Bacteria | 1586 |
| 424 | Ga0265313_10115121 | 3300031595 | Bacteria | 1178 |
| 425 | Ga0307508_10000430 | 3300031616 | Bacteria | 49980 |
| 426 | Ga0307508_10012324 | 3300031616 | Bacteria | 7819 |
| 427 | Ga0307508_10068533 | 3300031616 | Bacteria | 3118 |
| 428 | Ga0265314_10010039 | 3300031711 | Bacteria | 7937 |
| 429 | Ga0265314_10025241 | 3300031711 | Bacteria | 4489 |
| 430 | Ga0265342_10000926 | 3300031712 | Bacteria | 29144 |
| 431 | Ga0265342_10018725 | 3300031712 | Bacteria | 4476 |
| 432 | Ga0265342_10047051 | 3300031712 | Bacteria | 2590 |
| 433 | Ga0307405_10000323 | 3300031731 | Bacteria | 17725 |
| 434 | Ga0307410_10338188 | 3300031852 | Bacteria | 1199 |
| 435 | Ga0307406_10053211 | 3300031901 | Bacteria | 2578 |
| 436 | Ga0307406_10106957 | 3300031901 | Bacteria | 1917 |
| 437 | Ga0307407_10079643 | 3300031903 | Bacteria | 1977 |
| 438 | Ga0307412_10001545 | 3300031911 | Bacteria | 12730 |
| 439 | Ga0307412_10169124 | 3300031911 | Bacteria | 1632 |
| 440 | Ga0315914_1008120 | 3300031967 | Bacteria | 14195 |
| 441 | Ga0307414_10118438 | 3300032004 | Bacteria | 2031 |
| 442 | Ga0307414_10124889 | 3300032004 | Bacteria | 1986 |
| 443 | Ga0307414_10284487 | 3300032004 | Bacteria | 1391 |
| 444 | Ga0307414_10545162 | 3300032004 | Bacteria | 1033 |
| 445 | Ga0315913_1006432 | 3300033430 | Bacteria | 14196 |
| 446 | Ga0315915_1000007 | 3300033464 | Bacteria | 319225 |
| 447 | Ga0316574_0027919 | 3300035398 | Bacteria | 3401 |
| 448 | Ga0373935_0145884 | 3300035692 | Bacteria | 1602 |
| 449 | Ga0373927_0000245 | 3300035695 | Bacteria | 42703 |
| 450 | Ga0373927_0041025 | 3300035695 | Bacteria | 3002 |
| 451 | Ga0373927_0163962 | 3300035695 | Bacteria | 1456 |
| 452 | Ga0373937_0037906 | 3300036401 | Bacteria | 4393 |
| 453 | Ga0373925_0003713 | 3300037068 | Bacteria | 11724 |
| 454 | Ga0373925_0148449 | 3300037068 | Bacteria | 1839 |
| 455 | Ga0395899_0000044 | 3300037312 | Bacteria | 248735 |
| 456 | Ga0395900_0000042 | 3300037418 | Bacteria | 242667 |
| 457 | Ga0395900_0029099 | 3300037418 | Bacteria | 5666 |
| 458 | Ga0395900_0207837 | 3300037418 | Bacteria | 1978 |
| 459 | Ga0395898_0000080 | 3300037466 | Bacteria | 242667 |
| 460 | Ga0395905_0000044 | 3300037471 | Bacteria | 242916 |
| 461 | Ga0395905_0007581 | 3300037471 | Bacteria | 10783 |
| 462 | Ga0395905_0009048 | 3300037471 | Bacteria | 9769 |
| 463 | Ga0395905_0013886 | 3300037471 | Bacteria | 7706 |
| 464 | Ga0395905_0020532 | 3300037471 | Bacteria | 6256 |
| 465 | Ga0395905_0054804 | 3300037471 | Bacteria | 3731 |
| 466 | Ga0395905_0095843 | 3300037471 | Bacteria | 2785 |
| 467 | Ga0395905_0423218 | 3300037471 | Bacteria | 1228 |
| 468 | Ga0436364_0046669 | 3300037853 | Bacteria | 24459 |
| 469 | Ga0436364_1130693 | 3300037853 | Bacteria | 2367 |
| 470 | Ga0395901_0000027 | 3300038443 | Bacteria | 244204 |
| 471 | Ga0395901_0014960 | 3300038443 | Bacteria | 7885 |
| 472 | Ga0395901_0031758 | 3300038443 | Bacteria | 5445 |
| 473 | Ga0400484_20998 | 3300038725 | Bacteria | 5474 |
| 474 | Ga0400484_40515 | 3300038725 | Bacteria | 4110 |
| 475 | Ga0400490_19842 | 3300038726 | Bacteria | 1121 |
| 476 | Ga0400490_38094 | 3300038726 | Bacteria | 26956 |
| 477 | Ga0400491_13401 | 3300038727 | Bacteria | 2392 |
| 478 | Ga0400488_17246 | 3300038741 | Bacteria | 1238 |
| 479 | Ga0400486_25732 | 3300038742 | Bacteria | 2805 |
| 480 | Ga0400483_021750 | 3300039062 | Bacteria | 11370 |
| 481 | Ga0400483_172664 | 3300039062 | Bacteria | 1750 |
| 482 | Ga0400483_246637 | 3300039062 | Bacteria | 4069 |
| 483 | Ga0400483_247668 | 3300039062 | Bacteria | 26775 |
| 484 | Ga0400487_11494 | 3300039110 | Bacteria | 1718 |
| 485 | Ga0400487_13197 | 3300039110 | Bacteria | 19734 |
| 486 | Ga0436365_1547706 | 3300039437 | Bacteria | 2641 |
| 487 | Ga0436360_0960231 | 3300039438 | Bacteria | 2126 |
| 488 | Ga0436361_0290928 | 3300039447 | Bacteria | 3299 |
| 489 | Ga0436363_0280076 | 3300039450 | Bacteria | 3396 |
| 490 | Ga0439436_0048435 | 3300041404 | Bacteria | 1205 |
| 491 | Ga0439465_0001270 | 3300041413 | Bacteria | 8114 |
| 492 | Ga0439465_0008472 | 3300041413 | Bacteria | 3246 |
| 493 | Ga0439465_0008513 | 3300041413 | Bacteria | 3236 |
| 494 | Ga0439465_0037731 | 3300041413 | Bacteria | 1554 |
| 495 | Ga0451793_1386411 | 3300041452 | Bacteria | 1102 |
| 496 | Ga0451839_0836516 | 3300041496 | Bacteria | 1683 |
| 497 | Ga0451841_0340568 | 3300041498 | Bacteria | 1343 |
| 498 | Ga0451851_0361118 | 3300041507 | Bacteria | 7123 |
| 499 | Ga0451851_1012485 | 3300041507 | Bacteria | 1982 |
| 500 | Ga0451843_0294688 | 3300041509 | Bacteria | 4833 |
| 501 | Ga0451853_3094484 | 3300041512 | Bacteria | 3219 |
| 502 | Ga0439433_0022253 | 3300041999 | Bacteria | 1421 |
| 503 | Ga0439443_001481 | 3300042003 | Bacteria | 2602 |
| 504 | Ga0439432_019512 | 3300042006 | Bacteria | 2258 |
| 505 | Ga0439449_0009295 | 3300042007 | Bacteria | 3726 |
| 506 | Ga0450906_002412 | 3300042145 | Bacteria | 4089 |
| 507 | Ga0439458_0017550 | 3300042157 | Bacteria | 1636 |
| 508 | Ga0439435_0011342 | 3300042436 | Bacteria | 2137 |
| 509 | Ga0466972_0016192 | 3300044658 | Bacteria | 3727 |
| 510 | Ga0466966_0022293 | 3300044684 | Bacteria | 4156 |
| 511 | Ga0466963_0013253 | 3300044694 | Bacteria | 5060 |
| 512 | Ga0466968_0012727 | 3300044735 | Bacteria | 3300 |
| 513 | Ga0466970_0005599 | 3300044765 | Bacteria | 6241 |
| 514 | Ga0466957_0077697 | 3300044842 | Bacteria | 2063 |
| 515 | Ga0466960_0082946 | 3300044901 | Bacteria | 1619 |
| 516 | Ga0451576_0002330 | 3300045051 | Bacteria | 28726 |
| 517 | Ga0451576_0036965 | 3300045051 | Bacteria | 5174 |
| 518 | Ga0466958_0024660 | 3300045836 | Bacteria | 3539 |
| 519 | Ga0495629_0004985 | 3300046459 | Bacteria | 9957 |
| 520 | Ga0495629_0029471 | 3300046459 | Bacteria | 3891 |
| 521 | Ga0495638_0008120 | 3300046460 | Bacteria | 7465 |
| 522 | Ga0495638_0019366 | 3300046460 | Bacteria | 4502 |
| 523 | Ga0495641_0005527 | 3300046461 | Bacteria | 8495 |
| 524 | Ga0495651_0067244 | 3300046462 | Bacteria | 2734 |
| 525 | Ga0495651_0098693 | 3300046462 | Bacteria | 2179 |
| 526 | Ga0495651_0101799 | 3300046462 | Bacteria | 2137 |
| 527 | Ga0495650_0064423 | 3300046471 | Bacteria | 1458 |
| 528 | Ga0495605_0015829 | 3300046474 | Bacteria | 4095 |
| 529 | Ga0495605_0020662 | 3300046474 | Bacteria | 3497 |
| 530 | Ga0495605_0038126 | 3300046474 | Bacteria | 2413 |
| 531 | Ga0495662_0067685 | 3300046476 | Bacteria | 1728 |
| 532 | Ga0495664_0074572 | 3300046477 | Bacteria | 2030 |
| 533 | Ga0495585_0037863 | 3300046492 | Bacteria | 2716 |
| 534 | Ga0495585_0164218 | 3300046492 | Bacteria | 1151 |
| 535 | Ga0495607_0016552 | 3300046501 | Bacteria | 4757 |
| 536 | Ga0495607_0023263 | 3300046501 | Bacteria | 3879 |
| 537 | Ga0495607_0062768 | 3300046501 | Bacteria | 2104 |
| 538 | Ga0495583_0012467 | 3300046506 | Bacteria | 4806 |
| 539 | Ga0495606_0006240 | 3300046507 | Bacteria | 11067 |
| 540 | Ga0495606_0133561 | 3300046507 | Bacteria | 1473 |
| 541 | Ga0495610_0008335 | 3300046512 | Bacteria | 6725 |
| 542 | Ga0495610_0036426 | 3300046512 | Bacteria | 2514 |
| 543 | Ga0495610_0059015 | 3300046512 | Bacteria | 1833 |
| 544 | Ga0495620_0012292 | 3300046515 | Bacteria | 4433 |
| 545 | Ga0495631_0016798 | 3300046518 | Bacteria | 3478 |
| 546 | Ga0495632_0008302 | 3300046519 | Bacteria | 6395 |
| 547 | Ga0495632_0016392 | 3300046519 | Bacteria | 4125 |
| 548 | Ga0495637_0003753 | 3300046520 | Bacteria | 8016 |
| 549 | Ga0495637_0096499 | 3300046520 | Bacteria | 1160 |
| 550 | Ga0495643_0001039 | 3300046522 | Bacteria | 28149 |
| 551 | Ga0495643_0033843 | 3300046522 | Bacteria | 2823 |
| 552 | Ga0495643_0075017 | 3300046522 | Bacteria | 1770 |
| 553 | Ga0495663_0025419 | 3300046525 | Bacteria | 1726 |
| 554 | Ga0495652_0158528 | 3300046529 | Bacteria | 1760 |
| 555 | Ga0495654_0017636 | 3300046530 | Bacteria | 3748 |
| 556 | Ga0495640_0008734 | 3300046533 | Bacteria | 7940 |
| 557 | Ga0495587_0168157 | 3300046536 | Bacteria | 1246 |
| 558 | Ga0495609_0003026 | 3300046538 | Bacteria | 9907 |
| 559 | Ga0495609_0018475 | 3300046538 | Bacteria | 3230 |
| 560 | Ga0495622_0031741 | 3300046557 | Bacteria | 2467 |
| 561 | Ga0495633_0034951 | 3300046558 | Bacteria | 2415 |
| 562 | Ga0495667_0082887 | 3300046559 | Bacteria | 2083 |
| 563 | Ga0495668_0013586 | 3300046616 | Bacteria | 4798 |
| 564 | Ga0495668_0032094 | 3300046616 | Bacteria | 2957 |
| 565 | Ga0495625_0004663 | 3300046660 | Bacteria | 12870 |
| 566 | Ga0495625_0011866 | 3300046660 | Bacteria | 7075 |
| 567 | Ga0495625_0015174 | 3300046660 | Bacteria | 6114 |
| 568 | Ga0495635_0017864 | 3300046663 | Bacteria | 4953 |
| 569 | Ga0495588_0002642 | 3300046674 | Bacteria | 7679 |
| 570 | Ga0495588_0005393 | 3300046674 | Bacteria | 5687 |
| 571 | Ga0495588_0071038 | 3300046674 | Bacteria | 1810 |
| 572 | Ga0495588_0097048 | 3300046674 | Bacteria | 1546 |
| 573 | Ga0495657_0060563 | 3300046675 | Bacteria | 2507 |
| 574 | Ga0495658_0030878 | 3300046683 | Bacteria | 2913 |
| 575 | Ga0495613_0023071 | 3300046689 | Bacteria | 4638 |
| 576 | Ga0495670_0090149 | 3300046691 | Bacteria | 1569 |
| 577 | Ga0495671_0154940 | 3300046692 | Bacteria | 1115 |
| 578 | Ga0495649_0010787 | 3300046694 | Bacteria | 5383 |
| 579 | Ga0495600_0008492 | 3300046809 | Bacteria | 6311 |
| 580 | Ga0495600_0033078 | 3300046809 | Bacteria | 3356 |
| 581 | Ga0495600_0131177 | 3300046809 | Bacteria | 1629 |
| 582 | Ga0495604_0041248 | 3300047317 | Bacteria | 3620 |
| 583 | Ga0495636_0022191 | 3300047318 | Bacteria | 2565 |
| 584 | Ga0495674_0162196 | 3300047319 | Bacteria | 1870 |
| 585 | Ga0495676_0038748 | 3300047321 | Bacteria | 3956 |
| 586 | Ga0495683_0142301 | 3300047323 | Bacteria | 1123 |
| 587 | Ga0495687_003786 | 3300047443 | Bacteria | 10680 |
| 588 | Ga0495679_043826 | 3300047446 | Bacteria | 1373 |
| 589 | Ga0495673_0052838 | 3300047469 | Bacteria | 1774 |
| 590 | Ga0495673_0058904 | 3300047469 | Bacteria | 1653 |
| 591 | Ga0495681_0000773 | 3300047470 | Bacteria | 24644 |
| 592 | Ga0495681_0002912 | 3300047470 | Bacteria | 12094 |
| 593 | Ga0495681_0039636 | 3300047470 | Bacteria | 2298 |
| 594 | Ga0495686_0009447 | 3300047472 | Bacteria | 7025 |
| 595 | Ga0495686_0023819 | 3300047472 | Bacteria | 4029 |
| 596 | Ga0495686_0026678 | 3300047472 | Bacteria | 3779 |
| 597 | Ga0495686_0050941 | 3300047472 | Bacteria | 2600 |
| 598 | Ga0495602_0140246 | 3300048088 | Bacteria | 1914 |
| 599 | Ga0496102_0002097 | 3300048905 | Bacteria | 17170 |
| 600 | Ga0496102_0013152 | 3300048905 | Bacteria | 7160 |
| 601 | Ga0496102_0240698 | 3300048905 | Bacteria | 1706 |
| 602 | Ga0496104_0003414 | 3300048907 | Bacteria | 13707 |
| 603 | Ga0496104_0044031 | 3300048907 | Bacteria | 4194 |
| 604 | Ga0496104_0376879 | 3300048907 | Bacteria | 1331 |
| 605 | Ga0496105_0000404 | 3300048908 | Bacteria | 28412 |
| 606 | Ga0496106_0014285 | 3300048909 | Bacteria | 5867 |
| 607 | Ga0496110_0092323 | 3300048913 | Bacteria | 2709 |
| 608 | Ga0496110_0196010 | 3300048913 | Bacteria | 1834 |
| 609 | Ga0496110_0266985 | 3300048913 | Bacteria | 1558 |
| 610 | Ga0496111_0064513 | 3300048914 | Bacteria | 2657 |
| 611 | Ga0496112_0232458 | 3300048915 | Bacteria | 1798 |
| 612 | Ga0496113_0072655 | 3300048916 | Bacteria | 2619 |
| 613 | Ga0496113_0264337 | 3300048916 | Bacteria | 1375 |
| 614 | Ga0496114_0110058 | 3300048917 | Bacteria | 2359 |
| 615 | Ga0496114_0127631 | 3300048917 | Bacteria | 2193 |
| 616 | Ga0496115_0030928 | 3300048918 | Bacteria | 4216 |
| 617 | Ga0496115_0062272 | 3300048918 | Bacteria | 3009 |
| 618 | Ga0496116_0000026 | 3300048919 | Bacteria | 450803 |
| 619 | Ga0496116_0012142 | 3300048919 | Bacteria | 7052 |
| 620 | Ga0496116_0016325 | 3300048919 | Bacteria | 5812 |
| 621 | Ga0496116_0016678 | 3300048919 | Bacteria | 5737 |
| 622 | Ga0496116_0063997 | 3300048919 | Bacteria | 2365 |
| 623 | Ga0496116_0064545 | 3300048919 | Bacteria | 2353 |
| 624 | Ga0496116_0065103 | 3300048919 | Bacteria | 2340 |
| 625 | Ga0496117_0000066 | 3300048920 | Bacteria | 253534 |
| 626 | Ga0496117_0000674 | 3300048920 | Bacteria | 54521 |
| 627 | Ga0496117_0017033 | 3300048920 | Bacteria | 6086 |
| 628 | Ga0496117_0017065 | 3300048920 | Bacteria | 6080 |
| 629 | Ga0496117_0070009 | 3300048920 | Bacteria | 2359 |
| 630 | Ga0496117_0101947 | 3300048920 | Bacteria | 1813 |
| 631 | Ga0496118_0001442 | 3300048921 | Bacteria | 35788 |
| 632 | Ga0496118_0007072 | 3300048921 | Bacteria | 12054 |
| 633 | Ga0496118_0015274 | 3300048921 | Bacteria | 7121 |
| 634 | Ga0496118_0015441 | 3300048921 | Bacteria | 7067 |
| 635 | Ga0496118_0028061 | 3300048921 | Bacteria | 4749 |
| 636 | Ga0496118_0028682 | 3300048921 | Bacteria | 4682 |
| 637 | Ga0496118_0038269 | 3300048921 | Bacteria | 3847 |
| 638 | Ga0496118_0051085 | 3300048921 | Bacteria | 3166 |
| 639 | Ga0496118_0059249 | 3300048921 | Bacteria | 2853 |
| 640 | Ga0496119_0000887 | 3300048922 | Bacteria | 39179 |
| 641 | Ga0496119_0012012 | 3300048922 | Bacteria | 7086 |
| 642 | Ga0496119_0021565 | 3300048922 | Bacteria | 4650 |
| 643 | Ga0496119_0028988 | 3300048922 | Bacteria | 3764 |
| 644 | Ga0496119_0041198 | 3300048922 | Bacteria | 2944 |
| 645 | Ga0496119_0050527 | 3300048922 | Bacteria | 2562 |
| 646 | Ga0496120_0000100 | 3300048923 | Bacteria | 143064 |
| 647 | Ga0496120_0000724 | 3300048923 | Bacteria | 48314 |
| 648 | Ga0496120_0001458 | 3300048923 | Bacteria | 28286 |
| 649 | Ga0496120_0001956 | 3300048923 | Bacteria | 22555 |
| 650 | Ga0496120_0005160 | 3300048923 | Bacteria | 10549 |
| 651 | Ga0496120_0017730 | 3300048923 | Bacteria | 4604 |
| 652 | Ga0496120_0030888 | 3300048923 | Bacteria | 3251 |
| 653 | Ga0496121_0000991 | 3300048924 | Bacteria | 50787 |
| 654 | Ga0496121_0016095 | 3300048924 | Bacteria | 7749 |
| 655 | Ga0496121_0017992 | 3300048924 | Bacteria | 7161 |
| 656 | Ga0496121_0037009 | 3300048924 | Bacteria | 4340 |
| 657 | Ga0496122_0000057 | 3300048925 | Bacteria | 253452 |
| 658 | Ga0496122_0000172 | 3300048925 | Bacteria | 153862 |
| 659 | Ga0496122_0000414 | 3300048925 | Bacteria | 90664 |
| 660 | Ga0496122_0007724 | 3300048925 | Bacteria | 11838 |
| 661 | Ga0496122_0008827 | 3300048925 | Bacteria | 10762 |
| 662 | Ga0496122_0009607 | 3300048925 | Bacteria | 10131 |
| 663 | Ga0496122_0013054 | 3300048925 | Bacteria | 8181 |
| 664 | Ga0496122_0015011 | 3300048925 | Bacteria | 7439 |
| 665 | Ga0496122_0017434 | 3300048925 | Bacteria | 6715 |
| 666 | Ga0496122_0021546 | 3300048925 | Bacteria | 5765 |
| 667 | Ga0496122_0046010 | 3300048925 | Bacteria | 3385 |
| 668 | Ga0496122_0077875 | 3300048925 | Bacteria | 2325 |
| 669 | Ga0496123_0000096 | 3300048926 | Bacteria | 173914 |
| 670 | Ga0496123_0000132 | 3300048926 | Bacteria | 153568 |
| 671 | Ga0496123_0000839 | 3300048926 | Bacteria | 49128 |
| 672 | Ga0496123_0008281 | 3300048926 | Bacteria | 9579 |
| 673 | Ga0496123_0014229 | 3300048926 | Bacteria | 6613 |
| 674 | Ga0496123_0015265 | 3300048926 | Bacteria | 6310 |
| 675 | Ga0496123_0031285 | 3300048926 | Bacteria | 3874 |
| 676 | Ga0496124_0000091 | 3300048927 | Bacteria | 189706 |
| 677 | Ga0496124_0008171 | 3300048927 | Bacteria | 10979 |
| 678 | Ga0496124_0009055 | 3300048927 | Bacteria | 10296 |
| 679 | Ga0496124_0009134 | 3300048927 | Bacteria | 10240 |
| 680 | Ga0496124_0020257 | 3300048927 | Bacteria | 6154 |
| 681 | Ga0496124_0050863 | 3300048927 | Bacteria | 3528 |
| 682 | Ga0496124_0069578 | 3300048927 | Bacteria | 2922 |
| 683 | Ga0496124_0189062 | 3300048927 | Bacteria | 1578 |
| 684 | Ga0496124_0197883 | 3300048927 | Bacteria | 1531 |
| 685 | Ga0496125_0000276 | 3300048928 | Bacteria | 103024 |
| 686 | Ga0496125_0002982 | 3300048928 | Bacteria | 21249 |
| 687 | Ga0496125_0005688 | 3300048928 | Bacteria | 13748 |
| 688 | Ga0496125_0019065 | 3300048928 | Bacteria | 6489 |
| 689 | Ga0496125_0020551 | 3300048928 | Bacteria | 6195 |
| 690 | Ga0496125_0024814 | 3300048928 | Bacteria | 5504 |
| 691 | Ga0496125_0027777 | 3300048928 | Bacteria | 5122 |
| 692 | Ga0496125_0063263 | 3300048928 | Bacteria | 2952 |
| 693 | Ga0496125_0121785 | 3300048928 | Bacteria | 1859 |
| 694 | Ga0496126_0000069 | 3300048929 | Bacteria | 246935 |
| 695 | Ga0496126_0000188 | 3300048929 | Bacteria | 139625 |
| 696 | Ga0496126_0002934 | 3300048929 | Bacteria | 22170 |
| 697 | Ga0496126_0012848 | 3300048929 | Bacteria | 8557 |
| 698 | Ga0496126_0022017 | 3300048929 | Bacteria | 6211 |
| 699 | Ga0496126_0327368 | 3300048929 | Bacteria | 1258 |
| 700 | Ga0495678_019335 | 3300049459 | Bacteria | 3041 |
| 701 | Ga0501031_0000002 | 3300049568 | Bacteria | 217588 |
| 702 | Ga0501031_0038885 | 3300049568 | Bacteria | 3103 |
| 703 | Ga0501032_0000004 | 3300049569 | Bacteria | 310855 |
| 704 | Ga0501032_0000774 | 3300049569 | Bacteria | 25923 |
| 705 | Ga0501032_0006865 | 3300049569 | Bacteria | 8345 |
| 706 | Ga0501032_0064798 | 3300049569 | Bacteria | 2445 |
| 707 | Ga0501033_0000016 | 3300049570 | Bacteria | 217458 |
| 708 | Ga0501033_0000776 | 3300049570 | Bacteria | 29378 |
| 709 | Ga0501033_0003501 | 3300049570 | Bacteria | 12871 |
| 710 | Ga0501033_0006590 | 3300049570 | Bacteria | 9082 |
| 711 | Ga0501033_0071410 | 3300049570 | Bacteria | 2550 |
| 712 | Ga0501033_0109483 | 3300049570 | Bacteria | 2011 |
| 713 | Ga0501033_0186557 | 3300049570 | Bacteria | 1485 |
| 714 | Ga0501034_0000011 | 3300049571 | Bacteria | 310855 |
| 715 | Ga0501034_0000012 | 3300049571 | Bacteria | 310504 |
| 716 | Ga0501034_0002012 | 3300049571 | Bacteria | 25645 |
| 717 | Ga0501034_0031563 | 3300049571 | Bacteria | 5381 |
| 718 | Ga0501034_0033922 | 3300049571 | Bacteria | 5174 |
| 719 | Ga0501034_0052163 | 3300049571 | Bacteria | 4121 |
| 720 | Ga0501034_0064350 | 3300049571 | Bacteria | 3681 |
| 721 | Ga0501034_0073266 | 3300049571 | Bacteria | 3433 |
| 722 | Ga0501034_0096713 | 3300049571 | Bacteria | 2948 |
| 723 | Ga0501034_0181817 | 3300049571 | Bacteria | 2067 |
| 724 | Ga0501034_0266330 | 3300049571 | Bacteria | 1655 |
| 725 | Ga0501034_0340606 | 3300049571 | Bacteria | 1429 |
| 726 | Ga0501036_0000001 | 3300049572 | Bacteria | 310855 |
| 727 | Ga0501036_0042543 | 3300049572 | Bacteria | 3846 |
| 728 | Ga0501036_0061431 | 3300049572 | Bacteria | 3182 |
| 729 | Ga0501036_0209735 | 3300049572 | Bacteria | 1637 |
| 730 | Ga0501037_0000006 | 3300049573 | Bacteria | 217461 |
| 731 | Ga0501037_0000227 | 3300049573 | Bacteria | 49134 |
| 732 | Ga0501037_0048724 | 3300049573 | Bacteria | 3103 |
| 733 | Ga0501037_0073188 | 3300049573 | Bacteria | 2491 |
| 734 | Ga0501038_0000003 | 3300049574 | Bacteria | 310855 |
| 735 | Ga0501038_0013672 | 3300049574 | Bacteria | 7398 |
| 736 | Ga0501038_0052891 | 3300049574 | Bacteria | 3499 |
| 737 | Ga0501038_0068912 | 3300049574 | Bacteria | 3006 |
| 738 | Ga0501038_0100886 | 3300049574 | Bacteria | 2404 |
| 739 | Ga0501038_0132517 | 3300049574 | Bacteria | 2044 |
| 740 | Ga0501038_0141728 | 3300049574 | Bacteria | 1966 |
| 741 | Ga0501038_0177975 | 3300049574 | Bacteria | 1718 |
| 742 | Ga0501038_0274653 | 3300049574 | Bacteria | 1328 |
| 743 | Ga0501039_0000004 | 3300049575 | Bacteria | 310855 |
| 744 | Ga0501039_0015661 | 3300049575 | Bacteria | 5803 |
| 745 | Ga0501039_0015913 | 3300049575 | Bacteria | 5759 |
| 746 | Ga0501039_0082646 | 3300049575 | Bacteria | 2501 |
| 747 | Ga0501039_0127525 | 3300049575 | Bacteria | 1996 |
| 748 | Ga0501039_0190371 | 3300049575 | Bacteria | 1613 |
| 749 | Ga0501040_0007583 | 3300049576 | Bacteria | 7020 |
| 750 | Ga0501040_0126861 | 3300049576 | Bacteria | 1793 |
| 751 | Ga0501040_0190331 | 3300049576 | Bacteria | 1456 |
| 752 | Ga0501042_0053434 | 3300049578 | Bacteria | 2882 |
| 753 | Ga0501043_0000396 | 3300049579 | Bacteria | 39180 |
| 754 | Ga0501043_0000765 | 3300049579 | Bacteria | 28587 |
| 755 | Ga0501043_0002095 | 3300049579 | Bacteria | 17029 |
| 756 | Ga0501043_0044244 | 3300049579 | Bacteria | 3500 |
| 757 | Ga0501043_0166340 | 3300049579 | Bacteria | 1722 |
| 758 | Ga0501043_0192321 | 3300049579 | Bacteria | 1586 |
| 759 | Ga0501043_0234804 | 3300049579 | Bacteria | 1415 |
| 760 | Ga0501043_0279836 | 3300049579 | Bacteria | 1279 |
| 761 | Ga0501043_0317325 | 3300049579 | Bacteria | 1188 |
| 762 | Ga0501046_0016578 | 3300049580 | Bacteria | 6164 |
| 763 | Ga0501046_0108020 | 3300049580 | Bacteria | 2128 |
| 764 | Ga0501046_0233102 | 3300049580 | Bacteria | 1359 |
| 765 | Ga0501047_0002673 | 3300049581 | Bacteria | 16963 |
| 766 | Ga0501047_0007626 | 3300049581 | Bacteria | 10188 |
| 767 | Ga0501047_0010616 | 3300049581 | Bacteria | 8710 |
| 768 | Ga0501047_0024548 | 3300049581 | Bacteria | 5785 |
| 769 | Ga0501047_0059646 | 3300049581 | Bacteria | 3684 |
| 770 | Ga0501047_0100030 | 3300049581 | Unclassified | 2778 |
| 771 | Ga0501047_0123583 | 3300049581 | Bacteria | 2468 |
| 772 | Ga0501047_0163647 | 3300049581 | Bacteria | 2096 |
| 773 | Ga0501047_0230545 | 3300049581 | Bacteria | 1705 |
| 774 | Ga0501048_0007377 | 3300049582 | Bacteria | 8331 |
| 775 | Ga0501048_0037725 | 3300049582 | Bacteria | 3470 |
| 776 | Ga0501048_0072598 | 3300049582 | Bacteria | 2429 |
| 777 | Ga0501048_0195843 | 3300049582 | Bacteria | 1432 |
| 778 | Ga0501048_0257784 | 3300049582 | Bacteria | 1239 |
| 779 | Ga0501048_0310847 | 3300049582 | Bacteria | 1122 |
| 780 | Ga0501067_0028463 | 3300049583 | Bacteria | 3096 |
| 781 | Ga0501067_0056370 | 3300049583 | Bacteria | 2177 |
| 782 | Ga0501067_0120288 | 3300049583 | Bacteria | 1461 |
| 783 | Ga0501068_0032215 | 3300049584 | Bacteria | 3116 |
| 784 | Ga0501068_0045529 | 3300049584 | Bacteria | 2643 |
| 785 | Ga0501068_0066759 | 3300049584 | Bacteria | 2191 |
| 786 | Ga0501068_0070346 | 3300049584 | Bacteria | 2135 |
| 787 | Ga0501068_0109845 | 3300049584 | Bacteria | 1714 |
| 788 | Ga0501069_0000068 | 3300049585 | Bacteria | 54324 |
| 789 | Ga0501069_0007152 | 3300049585 | Bacteria | 5850 |
| 790 | Ga0501069_0008694 | 3300049585 | Bacteria | 5349 |
| 791 | Ga0501069_0059544 | 3300049585 | Bacteria | 2131 |
| 792 | Ga0501070_0000313 | 3300049586 | Bacteria | 44225 |
| 793 | Ga0501070_0001073 | 3300049586 | Bacteria | 24478 |
| 794 | Ga0501070_0003655 | 3300049586 | Bacteria | 13297 |
| 795 | Ga0501070_0068526 | 3300049586 | Unclassified | 2937 |
| 796 | Ga0501070_0069127 | 3300049586 | Bacteria | 2924 |
| 797 | Ga0501070_0093798 | 3300049586 | Bacteria | 2483 |
| 798 | Ga0501070_0163989 | 3300049586 | Bacteria | 1831 |
| 799 | Ga0501070_0194627 | 3300049586 | Bacteria | 1665 |
| 800 | Ga0501071_0083141 | 3300049587 | Bacteria | 2345 |
| 801 | Ga0501071_0262865 | 3300049587 | Bacteria | 1304 |
| 802 | Ga0501072_0108870 | 3300049588 | Bacteria | 2205 |
| 803 | Ga0501073_0039656 | 3300049589 | Bacteria | 3335 |
| 804 | Ga0501073_0052415 | 3300049589 | Bacteria | 2857 |
| 805 | Ga0501073_0055592 | 3300049589 | Bacteria | 2769 |
| 806 | Ga0501073_0084925 | 3300049589 | Bacteria | 2203 |
| 807 | Ga0501073_0121049 | 3300049589 | Bacteria | 1814 |
| 808 | Ga0501073_0182092 | 3300049589 | Bacteria | 1454 |
| 809 | Ga0501074_0000088 | 3300049590 | Bacteria | 44911 |
| 810 | Ga0501074_0006992 | 3300049590 | Bacteria | 8151 |
| 811 | Ga0501074_0031138 | 3300049590 | Bacteria | 3865 |
| 812 | Ga0501074_0095861 | 3300049590 | Bacteria | 2125 |
| 813 | Ga0501076_0110323 | 3300049592 | Unclassified | 2224 |
| 814 | Ga0501079_0055154 | 3300049741 | Bacteria | 3067 |
| 815 | Ga0501080_0000128 | 3300049742 | Bacteria | 53662 |
| 816 | Ga0501080_0014162 | 3300049742 | Bacteria | 7339 |
| 817 | Ga0501080_0027719 | 3300049742 | Bacteria | 5267 |
| 818 | Ga0501080_0030375 | 3300049742 | Bacteria | 5034 |
| 819 | Ga0501080_0053592 | 3300049742 | Bacteria | 3756 |
| 820 | Ga0501080_0055629 | 3300049742 | Bacteria | 3685 |
| 821 | Ga0501080_0116669 | 3300049742 | Bacteria | 2474 |
| 822 | Ga0501080_0124974 | 3300049742 | Bacteria | 2383 |
| 823 | Ga0501083_0000065 | 3300049744 | Bacteria | 73075 |
| 824 | Ga0501083_0010520 | 3300049744 | Bacteria | 6510 |
| 825 | Ga0501083_0024054 | 3300049744 | Bacteria | 4223 |
| 826 | Ga0501083_0087623 | 3300049744 | Bacteria | 2058 |
| 827 | Ga0501280_001626 | 3300049776 | Bacteria | 4031 |
| 828 | Ga0501035_0000009 | 3300049822 | Bacteria | 310827 |
| 829 | Ga0501035_0000185 | 3300049822 | Bacteria | 76291 |
| 830 | Ga0501035_0000245 | 3300049822 | Bacteria | 65283 |
| 831 | Ga0501035_0000882 | 3300049822 | Bacteria | 31844 |
| 832 | Ga0501035_0011959 | 3300049822 | Bacteria | 8030 |
| 833 | Ga0501035_0022247 | 3300049822 | Bacteria | 5822 |
| 834 | Ga0501035_0037310 | 3300049822 | Bacteria | 4401 |
| 835 | Ga0501035_0048273 | 3300049822 | Bacteria | 3818 |
| 836 | Ga0501035_0123885 | 3300049822 | Bacteria | 2257 |
| 837 | Ga0501035_0134079 | 3300049822 | Bacteria | 2157 |
| 838 | Ga0501035_0258123 | 3300049822 | Bacteria | 1478 |
| 839 | Ga0501035_0291825 | 3300049822 | Bacteria | 1376 |
| 840 | Ga0501044_0000003 | 3300049823 | Bacteria | 345647 |
| 841 | Ga0501044_0000005 | 3300049823 | Bacteria | 310855 |
| 842 | Ga0501044_0019083 | 3300049823 | Bacteria | 7341 |
| 843 | Ga0501044_0034463 | 3300049823 | Bacteria | 5308 |
| 844 | Ga0501044_0039557 | 3300049823 | Bacteria | 4919 |
| 845 | Ga0501044_0071681 | 3300049823 | Bacteria | 3523 |
| 846 | Ga0501044_0073722 | 3300049823 | Bacteria | 3469 |
| 847 | Ga0501044_0089823 | 3300049823 | Bacteria | 3100 |
| 848 | Ga0501044_0097372 | 3300049823 | Bacteria | 2963 |
| 849 | Ga0501044_0098444 | 3300049823 | Bacteria | 2944 |
| 850 | Ga0501044_0116107 | 3300049823 | Bacteria | 2682 |
| 851 | Ga0501044_0137519 | 3300049823 | Bacteria | 2433 |
| 852 | Ga0501044_0433311 | 3300049823 | Bacteria | 1223 |
| 853 | Ga0501045_0051974 | 3300049824 | Bacteria | 2991 |
| 854 | Ga0501045_0094563 | 3300049824 | Bacteria | 2210 |
| 855 | nmdc:mga03683_3851_c1 | 3300050489 | Bacteria | 4899 |
| 856 | nmdc:mga03683_53243_c1 | 3300050489 | Bacteria | 1694 |
| 857 | nmdc:mga03683_86217_c1 | 3300050489 | Bacteria | 1363 |
| 858 | nmdc:mga03n38_64472_c1 | 3300050490 | Bacteria | 1677 |
| 859 | nmdc:mga03n38_68907_c1 | 3300050490 | Bacteria | 1632 |
| 860 | nmdc:mga00v17_130629_c1 | 3300050491 | Bacteria | 1605 |
| 861 | nmdc:mga00v17_17_c1 | 3300050491 | Bacteria | 121949 |
| 862 | nmdc:mga00v17_20007_c1 | 3300050491 | Bacteria | 3829 |
| 863 | nmdc:mga0yw44_101_c1 | 3300050492 | Bacteria | 29987 |
| 864 | nmdc:mga0yw44_19418_c1 | 3300050492 | Bacteria | 3748 |
| 865 | nmdc:mga0yw44_9041_c1 | 3300050492 | Bacteria | 5009 |
| 866 | nmdc:mga0k408_8787_c1 | 3300050493 | Bacteria | 5436 |
| 867 | nmdc:mga06z11_13972_c1 | 3300050494 | Bacteria | 3542 |
| 868 | nmdc:mga07m45_5169_c1 | 3300050496 | Bacteria | 6468 |
| 869 | nmdc:mga08y16_207702_c1 | 3300050511 | Bacteria | 2028 |
| 870 | nmdc:mga0sz30_10915_c1 | 3300050516 | Bacteria | 2332 |
| 871 | nmdc:mga0sz30_121_c1 | 3300050516 | Bacteria | 29087 |
| 872 | nmdc:mga0sz30_19108_c2 | 3300050516 | Bacteria | 2358 |
| 873 | nmdc:mga0sz30_42061_c1 | 3300050516 | Bacteria | 1922 |
| 874 | Ga0495619_0024481 | 3300053085 | Bacteria | 3872 |
| 875 | Ga0500578_0076274 | 3300053086 | Bacteria | 2134 |
| 876 | Ga0500578_0132496 | 3300053086 | Bacteria | 1562 |
| 877 | Ga0500651_0162265 | 3300053093 | Bacteria | 1336 |
| 878 | Ga0500560_001265 | 3300053107 | Bacteria | 4270 |
| 879 | Ga0500569_001415 | 3300053109 | Bacteria | 4516 |
| 880 | Ga0500569_012531 | 3300053109 | Bacteria | 2054 |
| 881 | Ga0500594_0003013 | 3300053118 | Bacteria | 3686 |
| 882 | Ga0500594_0004523 | 3300053118 | Bacteria | 3067 |
| 883 | Ga0500595_031768 | 3300053119 | Bacteria | 1768 |
| 884 | Ga0500608_029243 | 3300053122 | Bacteria | 2605 |
| 885 | Ga0500618_006729 | 3300053125 | Bacteria | 3347 |
| 886 | Ga0500618_011157 | 3300053125 | Bacteria | 2392 |
| 887 | Ga0500658_0002401 | 3300053134 | Bacteria | 7252 |
| 888 | Ga0500658_0002414 | 3300053134 | Bacteria | 7230 |
| 889 | Ga0500559_0002424 | 3300053136 | Bacteria | 9652 |
| 890 | Ga0500559_0012232 | 3300053136 | Bacteria | 3651 |
| 891 | Ga0500561_0006852 | 3300053137 | Bacteria | 2193 |
| 892 | Ga0500568_0000143 | 3300053139 | Bacteria | 63442 |
| 893 | Ga0500568_0007107 | 3300053139 | Bacteria | 5532 |
| 894 | Ga0500577_0046987 | 3300053142 | Bacteria | 1603 |
| 895 | Ga0500590_017641 | 3300053148 | Bacteria | 3690 |
| 896 | Ga0500590_061267 | 3300053148 | Bacteria | 1890 |
| 897 | Ga0500616_0000771 | 3300053153 | Bacteria | 36893 |
| 898 | Ga0500616_0015338 | 3300053153 | Bacteria | 4384 |
| 899 | Ga0500616_0017450 | 3300053153 | Bacteria | 4071 |
| 900 | Ga0500616_0018766 | 3300053153 | Bacteria | 3907 |
| 901 | Ga0500620_000347 | 3300053155 | Bacteria | 8678 |
| 902 | Ga0500622_0000174 | 3300053156 | Bacteria | 69403 |
| 903 | Ga0500622_0000780 | 3300053156 | Bacteria | 27667 |
| 904 | Ga0500622_0005550 | 3300053156 | Bacteria | 7542 |
| 905 | Ga0500624_000443 | 3300053157 | Bacteria | 12488 |
| 906 | Ga0500627_0019857 | 3300053158 | Bacteria | 2685 |
| 907 | Ga0500633_0001730 | 3300053160 | Bacteria | 4249 |
| 908 | Ga0500634_0000019 | 3300053161 | Bacteria | 109764 |
| 909 | Ga0500636_0000038 | 3300053177 | Bacteria | 70653 |
| 910 | Ga0500636_0003227 | 3300053177 | Bacteria | 9131 |
| 911 | Ga0500636_0015051 | 3300053177 | Bacteria | 4553 |
| 912 | Ga0500552_010052 | 3300053733 | Bacteria | 1156 |
| 913 | Ga0501084_0007726 | 3300054114 | Bacteria | 8855 |
| 914 | Ga0501084_0017035 | 3300054114 | Bacteria | 6038 |
| 915 | Ga0501084_0077503 | 3300054114 | Bacteria | 2787 |
| 916 | Ga0501084_0164476 | 3300054114 | Bacteria | 1872 |
| 917 | Ga0500661_014073 | 3300055283 | Bacteria | 1441 |
| 918 | Ga0587077_023705 | 3300059493 | Bacteria | 1110 |
| 919 | Ga0587083_0029198 | 3300059505 | Bacteria | 1085 |
| 920 | Ga0587090_000202 | 3300059510 | Bacteria | 4293 |
| 921 | Ga0501082_0042195 | 3300060353 | Bacteria | 3933 |
| 922 | Ga0501082_0126927 | 3300060353 | Bacteria | 2212 |
| 923 | Ga0501082_0300925 | 3300060353 | Bacteria | 1397 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300036401 | Ga0373937_0037906 | Ga0373937_0037906_1026_2003 | 274 |
| 2 | 3300046529 | Ga0495652_0158528 | Ga0495652_0158528_181_1158 | 274 |
| 3 | 3300047319 | Ga0495674_0162196 | Ga0495674_0162196_633_1610 | 274 |
| 4 | 3300035692 | Ga0373935_0145884 | Ga0373935_0145884_722_1579 | 285 |
| 5 | 3300048913 | Ga0496110_0092323 | Ga0496110_0092323_309_1358 | 289 |
| 6 | 3300048918 | Ga0496115_0062272 | Ga0496115_0062272_1584_2633 | 289 |
| 7 | 3300048916 | Ga0496113_0264337 | Ga0496113_0264337_38_1030 | 291 |
| 8 | 3300048917 | Ga0496114_0110058 | Ga0496114_0110058_215_1126 | 300 |
| 9 | 3300046536 | Ga0495587_0168157 | Ga0495587_0168157_208_1185 | 302 |
| 10 | iso_pu_bacteria | 2924214083 | 2924217077 | 305 |
| 11 | 3300038726 | Ga0400490_19842 | Ga0400490_19842_150_1088 | 306 |
| 12 | 3300038741 | Ga0400488_17246 | Ga0400488_17246_199_1137 | 306 |
| 13 | 3300044901 | Ga0466960_0082946 | Ga0466960_0082946_153_1157 | 308 |
| 14 | 3300042157 | Ga0439458_0017550 | Ga0439458_0017550_263_1255 | 309 |
| 15 | 3300048905 | Ga0496102_0013152 | Ga0496102_0013152_3270_4202 | 310 |
| 16 | 3300048920 | Ga0496117_0017033 | Ga0496117_0017033_1800_2732 | 310 |
| 17 | 3300048921 | Ga0496118_0015441 | Ga0496118_0015441_3400_4332 | 310 |
| 18 | 3300048923 | Ga0496120_0017730 | Ga0496120_0017730_2677_3609 | 310 |
| 19 | 3300048924 | Ga0496121_0016095 | Ga0496121_0016095_3343_4275 | 310 |
| 20 | 3300048925 | Ga0496122_0015011 | Ga0496122_0015011_3243_4175 | 310 |
| 21 | 3300039062 | Ga0400483_021750 | Ga0400483_021750_6818_7831 | 311 |
| 22 | iso_pu_bacteria | 2965110997 | 2965112214 | 311 |
| 23 | 3300002773 | JGI25152J39213_1000492 | JGI25152J39213_10004925 | 315 |
| 24 | 3300003215 | JGI25153J46596_10000299 | JGI25153J46596_1000029920 | 315 |
| 25 | 3300025245 | Ga0207425_1000162 | Ga0207425_100016230 | 315 |
| 26 | 3300025258 | Ga0209129_1000287 | Ga0209129_100028720 | 315 |
| 27 | 3300025294 | Ga0209025_1005549 | Ga0209025_10055494 | 315 |
| 28 | 3300025297 | Ga0209758_1000317 | Ga0209758_100031761 | 315 |
| 29 | 3300041496 | Ga0451839_0836516 | Ga0451839_0836516_718_1668 | 315 |
| 30 | 3300048921 | Ga0496118_0007072 | Ga0496118_0007072_6409_7401 | 315 |
| 31 | 3300049579 | Ga0501043_0166340 | Ga0501043_0166340_600_1616 | 316 |
| 32 | 3300046461 | Ga0495641_0005527 | Ga0495641_0005527_4805_5773 | 317 |
| 33 | 3300049584 | Ga0501068_0070346 | Ga0501068_0070346_1068_2072 | 317 |
| 34 | 3300049587 | Ga0501071_0262865 | Ga0501071_0262865_172_1176 | 317 |
| 35 | 3300049742 | Ga0501080_0116669 | Ga0501080_0116669_357_1361 | 317 |
| 36 | 3300049744 | Ga0501083_0024054 | Ga0501083_0024054_2798_3802 | 317 |
| 37 | 3300049823 | Ga0501044_0071681 | Ga0501044_0071681_2246_3250 | 317 |
| 38 | 3300054114 | Ga0501084_0164476 | Ga0501084_0164476_626_1630 | 317 |
| 39 | 3300041507 | Ga0451851_0361118 | Ga0451851_0361118_5882_6874 | 318 |
| 40 | 3300048913 | Ga0496110_0266985 | Ga0496110_0266985_131_1120 | 318 |
| 41 | 3300053119 | Ga0500595_031768 | Ga0500595_031768_365_1369 | 318 |
| 42 | 3300053156 | Ga0500622_0000780 | Ga0500622_0000780_5832_6821 | 318 |
| 43 | 3300048925 | Ga0496122_0013054 | Ga0496122_0013054_4514_5527 | 320 |
| 44 | 3300048928 | Ga0496125_0020551 | Ga0496125_0020551_2910_3923 | 320 |
| 45 | 3300048929 | Ga0496126_0022017 | Ga0496126_0022017_4614_5579 | 321 |
| 46 | 3300049585 | Ga0501069_0059544 | Ga0501069_0059544_401_1405 | 321 |
| 47 | 3300049742 | Ga0501080_0053592 | Ga0501080_0053592_1785_2789 | 321 |
| 48 | 3300049822 | Ga0501035_0048273 | Ga0501035_0048273_503_1507 | 321 |
| 49 | 3300049823 | Ga0501044_0116107 | Ga0501044_0116107_1334_2338 | 321 |
| 50 | 3300009545 | Ga0105237_10000038 | Ga0105237_1000003894 | 322 |
| 51 | 3300025914 | Ga0207671_10000045 | Ga0207671_10000045147 | 322 |
| 52 | 3300042003 | Ga0439443_001481 | Ga0439443_001481_374_1357 | 322 |
| 53 | 3300042436 | Ga0439435_0011342 | Ga0439435_0011342_594_1577 | 322 |
| 54 | 3300048913 | Ga0496110_0196010 | Ga0496110_0196010_405_1442 | 322 |
| 55 | 3300048914 | Ga0496111_0064513 | Ga0496111_0064513_74_1111 | 322 |
| 56 | 3300048925 | Ga0496122_0021546 | Ga0496122_0021546_4229_5221 | 322 |
| 57 | 3300048928 | Ga0496125_0000276 | Ga0496125_0000276_17740_18777 | 322 |
| 58 | 3300053136 | Ga0500559_0002424 | Ga0500559_0002424_5700_6668 | 322 |
| 59 | iso_pu_bacteria | 2534681786 | 2535486666 | 322 |
| 60 | 3300009177 | Ga0105248_10197854 | Ga0105248_101978542 | 323 |
| 61 | iso_pu_bacteria | 2902330777 | 2902335105 | 323 |
| 62 | 3300035695 | Ga0373927_0041025 | Ga0373927_0041025_1435_2442 | 324 |
| 63 | iso_pu_bacteria | 2508501009 | 2508542185 | 324 |
| 64 | iso_pu_bacteria | 2508501050 | 2508731531 | 324 |
| 65 | iso_pu_bacteria | 2508501114 | 2509076931 | 324 |
| 66 | iso_pu_bacteria | 2773857925 | 2774868462 | 324 |
| 67 | iso_pu_bacteria | 2775506901 | 2776262671 | 324 |
| 68 | iso_pu_bacteria | 2835312727 | 2835313136 | 324 |
| 69 | iso_pu_bacteria | 2844315083 | 2844319628 | 324 |
| 70 | iso_pu_bacteria | 2882456835 | 2882459259 | 324 |
| 71 | iso_pu_bacteria | 2884298095 | 2884298657 | 324 |
| 72 | iso_pu_bacteria | 2894232714 | 2894233190 | 324 |
| 73 | iso_pu_bacteria | 2903727486 | 2903730691 | 324 |
| 74 | iso_pu_bacteria | 2906602504 | 2906609360 | 324 |
| 75 | iso_pu_bacteria | 2909042592 | 2909044189 | 324 |
| 76 | iso_pu_bacteria | 8056875544 | 8056877597 | 324 |
| 77 | 3300005458 | Ga0070681_10342373 | Ga0070681_103423731 | 325 |
| 78 | 3300006028 | Ga0070717_10174906 | Ga0070717_101749062 | 325 |
| 79 | 3300035695 | Ga0373927_0163962 | Ga0373927_0163962_276_1253 | 325 |
| 80 | iso_pu_bacteria | 2508501123 | 2509118376 | 325 |
| 81 | iso_pu_bacteria | 2509276022 | 2509395826 | 325 |
| 82 | iso_pu_bacteria | 2510917028 | 2511186277 | 325 |
| 83 | iso_pu_bacteria | 2511231027 | 2511390259 | 325 |
| 84 | iso_pu_bacteria | 2513237085 | 2513576163 | 325 |
| 85 | iso_pu_bacteria | 2513237088 | 2513599247 | 325 |
| 86 | iso_pu_bacteria | 2513237090 | 2513610688 | 325 |
| 87 | iso_pu_bacteria | 2513237144 | 2513912092 | 325 |
| 88 | iso_pu_bacteria | 2513237162 | 2514019037 | 325 |
| 89 | iso_pu_bacteria | 2515154113 | 2515633012 | 325 |
| 90 | iso_pu_bacteria | 2515154114 | 2515640228 | 325 |
| 91 | iso_pu_bacteria | 2515154134 | 2515742411 | 325 |
| 92 | iso_pu_bacteria | 2516653085 | 2517081626 | 325 |
| 93 | iso_pu_bacteria | 2517287029 | 2517411239 | 325 |
| 94 | iso_pu_bacteria | 2519899620 | 2520381140 | 325 |
| 95 | iso_pu_bacteria | 2529292951 | 2530648710 | 325 |
| 96 | iso_pu_bacteria | 2582581308 | 2585283768 | 325 |
| 97 | iso_pu_bacteria | 2582581308 | 2585283856 | 325 |
| 98 | iso_pu_bacteria | 2582581316 | 2585334549 | 325 |
| 99 | iso_pu_bacteria | 2585427526 | 2585528702 | 325 |
| 100 | iso_pu_bacteria | 2585427531 | 2585562831 | 325 |
| 101 | iso_pu_bacteria | 2585427608 | 2585899120 | 325 |
| 102 | iso_pu_bacteria | 2585427609 | 2585903248 | 325 |
| 103 | iso_pu_bacteria | 2585428125 | 2587978676 | 325 |
| 104 | iso_pu_bacteria | 2599185301 | 2599935289 | 325 |
| 105 | iso_pu_bacteria | 2615840626 | 2616309775 | 325 |
| 106 | iso_pu_bacteria | 2615840698 | 2616550952 | 325 |
| 107 | iso_pu_bacteria | 2643221558 | 2643813452 | 325 |
| 108 | iso_pu_bacteria | 2643221568 | 2643853836 | 325 |
| 109 | iso_pu_bacteria | 2643221582 | 2643922073 | 325 |
| 110 | iso_pu_bacteria | 2643221623 | 2644133144 | 325 |
| 111 | iso_pu_bacteria | 2693429783 | 2694628004 | 325 |
| 112 | iso_pu_bacteria | 2693429784 | 2694641139 | 325 |
| 113 | iso_pu_bacteria | 2718217927 | 2719389816 | 325 |
| 114 | iso_pu_bacteria | 2718217997 | 2719668959 | 325 |
| 115 | iso_pu_bacteria | 2718218199 | 2720489652 | 325 |
| 116 | iso_pu_bacteria | 2718218232 | 2720610372 | 325 |
| 117 | iso_pu_bacteria | 2718218233 | 2720617791 | 325 |
| 118 | iso_pu_bacteria | 2718218235 | 2720628933 | 325 |
| 119 | iso_pu_bacteria | 2718218269 | 2720772881 | 325 |
| 120 | iso_pu_bacteria | 2718218423 | 2721403459 | 325 |
| 121 | iso_pu_bacteria | 2721755556 | 2723030326 | 325 |
| 122 | iso_pu_bacteria | 2721755684 | 2723564688 | 325 |
| 123 | iso_pu_bacteria | 2721755685 | 2723569626 | 325 |
| 124 | iso_pu_bacteria | 2721755809 | 2724035035 | 325 |
| 125 | iso_pu_bacteria | 2721755819 | 2724092910 | 325 |
| 126 | iso_pu_bacteria | 2721755822 | 2724101173 | 325 |
| 127 | iso_pu_bacteria | 2721755823 | 2724113299 | 325 |
| 128 | iso_pu_bacteria | 2728369352 | 2730110859 | 325 |
| 129 | iso_pu_bacteria | 2765235802 | 2765466428 | 325 |
| 130 | iso_pu_bacteria | 2767802442 | 2770197049 | 325 |
| 131 | iso_pu_bacteria | 2775506902 | 2776270331 | 325 |
| 132 | iso_pu_bacteria | 2775506904 | 2776282321 | 325 |
| 133 | iso_pu_bacteria | 2791355256 | 2793297373 | 325 |
| 134 | iso_pu_bacteria | 2791355259 | 2793316741 | 325 |
| 135 | iso_pu_bacteria | 2791355262 | 2793334122 | 325 |
| 136 | iso_pu_bacteria | 2791355265 | 2793354577 | 325 |
| 137 | iso_pu_bacteria | 2802429605 | 2805930170 | 325 |
| 138 | iso_pu_bacteria | 2802429606 | 2805934805 | 325 |
| 139 | iso_pu_bacteria | 2838016132 | 2838016959 | 325 |
| 140 | iso_pu_bacteria | 2838042994 | 2838047182 | 325 |
| 141 | iso_pu_bacteria | 2838048938 | 2838050173 | 325 |
| 142 | iso_pu_bacteria | 2838061910 | 2838062333 | 325 |
| 143 | iso_pu_bacteria | 2838068647 | 2838069295 | 325 |
| 144 | iso_pu_bacteria | 2838668709 | 2838673113 | 325 |
| 145 | iso_pu_bacteria | 2838686498 | 2838688121 | 325 |
| 146 | iso_pu_bacteria | 2838701080 | 2838705683 | 325 |
| 147 | iso_pu_bacteria | 2838729681 | 2838732299 | 325 |
| 148 | iso_pu_bacteria | 2838742623 | 2838745281 | 325 |
| 149 | iso_pu_bacteria | 2839993093 | 2839998214 | 325 |
| 150 | iso_pu_bacteria | 2840764183 | 2840769052 | 325 |
| 151 | iso_pu_bacteria | 2841851746 | 2841851862 | 325 |
| 152 | iso_pu_bacteria | 2842156927 | 2842159063 | 325 |
| 153 | iso_pu_bacteria | 2842163707 | 2842165959 | 325 |
| 154 | iso_pu_bacteria | 2842180545 | 2842182677 | 325 |
| 155 | iso_pu_bacteria | 2842192696 | 2842196636 | 325 |
| 156 | iso_pu_bacteria | 2842205361 | 2842209222 | 325 |
| 157 | iso_pu_bacteria | 2842229732 | 2842233040 | 325 |
| 158 | iso_pu_bacteria | 2842243621 | 2842247457 | 325 |
| 159 | iso_pu_bacteria | 2842250916 | 2842255363 | 325 |
| 160 | iso_pu_bacteria | 2842257432 | 2842261453 | 325 |
| 161 | iso_pu_bacteria | 2842264693 | 2842268545 | 325 |
| 162 | iso_pu_bacteria | 2842271015 | 2842272929 | 325 |
| 163 | iso_pu_bacteria | 2842278818 | 2842282734 | 325 |
| 164 | iso_pu_bacteria | 2842304105 | 2842309590 | 325 |
| 165 | iso_pu_bacteria | 2842311132 | 2842316209 | 325 |
| 166 | iso_pu_bacteria | 2842317721 | 2842320463 | 325 |
| 167 | iso_pu_bacteria | 2842402390 | 2842405618 | 325 |
| 168 | iso_pu_bacteria | 2842409023 | 2842412202 | 325 |
| 169 | iso_pu_bacteria | 2842415677 | 2842418848 | 325 |
| 170 | iso_pu_bacteria | 2842422224 | 2842422486 | 325 |
| 171 | iso_pu_bacteria | 2842428310 | 2842432517 | 325 |
| 172 | iso_pu_bacteria | 2842434925 | 2842438821 | 325 |
| 173 | iso_pu_bacteria | 2842441272 | 2842445342 | 325 |
| 174 | iso_pu_bacteria | 2842447887 | 2842449647 | 325 |
| 175 | iso_pu_bacteria | 2842462802 | 2842466506 | 325 |
| 176 | iso_pu_bacteria | 2842469257 | 2842473436 | 325 |
| 177 | iso_pu_bacteria | 2842489311 | 2842489423 | 325 |
| 178 | iso_pu_bacteria | 2842495871 | 2842497918 | 325 |
| 179 | iso_pu_bacteria | 2842509118 | 2842515726 | 325 |
| 180 | iso_pu_bacteria | 2842871566 | 2842872226 | 325 |
| 181 | iso_pu_bacteria | 2844454524 | 2844461827 | 325 |
| 182 | iso_pu_bacteria | 2847670302 | 2847671853 | 325 |
| 183 | iso_pu_bacteria | 2854896431 | 2854899780 | 325 |
| 184 | iso_pu_bacteria | 2854916844 | 2854920259 | 325 |
| 185 | iso_pu_bacteria | 2854916844 | 2854921000 | 325 |
| 186 | iso_pu_bacteria | 2856314179 | 2856318417 | 325 |
| 187 | iso_pu_bacteria | 2856364286 | 2856370005 | 325 |
| 188 | iso_pu_bacteria | 2857349434 | 2857352801 | 325 |
| 189 | iso_pu_bacteria | 2869285874 | 2869290812 | 325 |
| 190 | iso_pu_bacteria | 2871429161 | 2871433094 | 325 |
| 191 | iso_pu_bacteria | 2871495908 | 2871502267 | 325 |
| 192 | iso_pu_bacteria | 2874123672 | 2874128237 | 325 |
| 193 | iso_pu_bacteria | 2874146452 | 2874153745 | 325 |
| 194 | iso_pu_bacteria | 2874155637 | 2874161010 | 325 |
| 195 | iso_pu_bacteria | 2876369609 | 2876376026 | 325 |
| 196 | iso_pu_bacteria | 2876377896 | 2876382967 | 325 |
| 197 | iso_pu_bacteria | 2876392853 | 2876397162 | 325 |
| 198 | iso_pu_bacteria | 2876413966 | 2876419050 | 325 |
| 199 | iso_pu_bacteria | 2878035449 | 2878037753 | 325 |
| 200 | iso_pu_bacteria | 2878745973 | 2878750707 | 325 |
| 201 | iso_pu_bacteria | 2878760144 | 2878766158 | 325 |
| 202 | iso_pu_bacteria | 2878767105 | 2878773359 | 325 |
| 203 | iso_pu_bacteria | 2881147464 | 2881148067 | 325 |
| 204 | iso_pu_bacteria | 2881161766 | 2881164858 | 325 |
| 205 | iso_pu_bacteria | 2885305155 | 2885306730 | 325 |
| 206 | iso_pu_bacteria | 2885334103 | 2885337796 | 325 |
| 207 | iso_pu_bacteria | 2888350351 | 2888353033 | 325 |
| 208 | iso_pu_bacteria | 2889010040 | 2889014776 | 325 |
| 209 | iso_pu_bacteria | 2889016732 | 2889020137 | 325 |
| 210 | iso_pu_bacteria | 2894652903 | 2894655655 | 325 |
| 211 | iso_pu_bacteria | 2903492973 | 2903496314 | 325 |
| 212 | iso_pu_bacteria | 2903540706 | 2903547204 | 325 |
| 213 | iso_pu_bacteria | 2904578770 | 2904582186 | 325 |
| 214 | iso_pu_bacteria | 2904659560 | 2904663916 | 325 |
| 215 | iso_pu_bacteria | 2906308376 | 2906313632 | 325 |
| 216 | iso_pu_bacteria | 2906321335 | 2906326341 | 325 |
| 217 | iso_pu_bacteria | 2906354277 | 2906360708 | 325 |
| 218 | iso_pu_bacteria | 2906414383 | 2906418454 | 325 |
| 219 | iso_pu_bacteria | 2919119836 | 2919123034 | 325 |
| 220 | iso_pu_bacteria | 2919166419 | 2919168316 | 325 |
| 221 | iso_pu_bacteria | 2919171160 | 2919176553 | 325 |
| 222 | iso_pu_bacteria | 2922130491 | 2922137559 | 325 |
| 223 | iso_pu_bacteria | 2922185730 | 2922193043 | 325 |
| 224 | iso_pu_bacteria | 2924718760 | 2924723590 | 325 |
| 225 | iso_pu_bacteria | 2928521798 | 2928524155 | 325 |
| 226 | iso_pu_bacteria | 2933570622 | 2933576035 | 325 |
| 227 | iso_pu_bacteria | 2933599457 | 2933599959 | 325 |
| 228 | iso_pu_bacteria | 2935901341 | 2935906398 | 325 |
| 229 | iso_pu_bacteria | 2937813078 | 2937820063 | 325 |
| 230 | iso_pu_bacteria | 2937972304 | 2937974381 | 325 |
| 231 | iso_pu_bacteria | 2937994558 | 2938001067 | 325 |
| 232 | iso_pu_bacteria | 2938014810 | 2938016538 | 325 |
| 233 | iso_pu_bacteria | 2954011201 | 2954013102 | 325 |
| 234 | iso_pu_bacteria | 2958064165 | 2958064758 | 325 |
| 235 | iso_pu_bacteria | 2958100919 | 2958101988 | 325 |
| 236 | iso_pu_bacteria | 2958130278 | 2958135212 | 325 |
| 237 | iso_pu_bacteria | 2958165035 | 2958171333 | 325 |
| 238 | iso_pu_bacteria | 2958179912 | 2958184241 | 325 |
| 239 | iso_pu_bacteria | 2961077736 | 2961082296 | 325 |
| 240 | iso_pu_bacteria | 2961114664 | 2961118944 | 325 |
| 241 | iso_pu_bacteria | 2961163497 | 2961169774 | 325 |
| 242 | iso_pu_bacteria | 2965018300 | 2965024534 | 325 |
| 243 | iso_pu_bacteria | 2965119406 | 2965126022 | 325 |
| 244 | iso_pu_bacteria | 2968110612 | 2968115055 | 325 |
| 245 | iso_pu_bacteria | 2968117919 | 2968122793 | 325 |
| 246 | iso_pu_bacteria | 2968171901 | 2968178166 | 325 |
| 247 | iso_pu_bacteria | 2970554993 | 2970561012 | 325 |
| 248 | iso_pu_bacteria | 2977843712 | 2977850393 | 325 |
| 249 | iso_pu_bacteria | 2977864932 | 2977867308 | 325 |
| 250 | iso_pu_bacteria | 2977942078 | 2977943477 | 325 |
| 251 | iso_pu_bacteria | 2977971508 | 2977975333 | 325 |
| 252 | iso_pu_bacteria | 2978969890 | 2978970937 | 325 |
| 253 | iso_pu_bacteria | 2979710463 | 2979711066 | 325 |
| 254 | iso_pu_bacteria | 2979742915 | 2979747810 | 325 |
| 255 | iso_pu_bacteria | 2984587000 | 2984588045 | 325 |
| 256 | iso_pu_bacteria | 2987636660 | 2987641393 | 325 |
| 257 | iso_pu_bacteria | 2987652177 | 2987658753 | 325 |
| 258 | iso_pu_bacteria | 2987659509 | 2987665998 | 325 |
| 259 | iso_pu_bacteria | 2996348954 | 2996355816 | 325 |
| 260 | iso_pu_bacteria | 2996887358 | 2996891089 | 325 |
| 261 | iso_pu_bacteria | 2996893221 | 2996895598 | 325 |
| 262 | iso_pu_bacteria | 3002141150 | 3002145048 | 325 |
| 263 | iso_pu_bacteria | 3004188549 | 3004195021 | 325 |
| 264 | iso_pu_bacteria | 3004203850 | 3004210203 | 325 |
| 265 | iso_pu_bacteria | 3004275668 | 3004282242 | 325 |
| 266 | iso_pu_bacteria | 3004289098 | 3004293743 | 325 |
| 267 | iso_pu_bacteria | 3005452660 | 3005454423 | 325 |
| 268 | iso_pu_bacteria | 8004387939 | 8004393101 | 325 |
| 269 | iso_pu_bacteria | 8004640170 | 8004641598 | 325 |
| 270 | iso_pu_bacteria | 8004714634 | 8004719888 | 325 |
| 271 | iso_pu_bacteria | 8005275841 | 8005275939 | 325 |
| 272 | iso_pu_bacteria | 8005282627 | 8005285942 | 325 |
| 273 | iso_pu_bacteria | 8005289223 | 8005295380 | 325 |
| 274 | iso_pu_bacteria | 8005307578 | 8005311700 | 325 |
| 275 | iso_pu_bacteria | 8005321885 | 8005325616 | 325 |
| 276 | iso_pu_bacteria | 8005382845 | 8005382903 | 325 |
| 277 | iso_pu_bacteria | 8005395548 | 8005398072 | 325 |
| 278 | iso_pu_bacteria | 8005430974 | 8005433478 | 325 |
| 279 | iso_pu_bacteria | 8005497431 | 8005502101 | 325 |
| 280 | iso_pu_bacteria | 8005570704 | 8005576536 | 325 |
| 281 | iso_pu_bacteria | 8005619151 | 8005624390 | 325 |
| 282 | iso_pu_bacteria | 8005626139 | 8005629652 | 325 |
| 283 | iso_pu_bacteria | 8005658619 | 8005662550 | 325 |
| 284 | iso_pu_bacteria | 8005668836 | 8005673524 | 325 |
| 285 | iso_pu_bacteria | 8005695170 | 8005695476 | 325 |
| 286 | iso_pu_bacteria | 8018176218 | 8018180827 | 325 |
| 287 | iso_pu_bacteria | 8023680758 | 8023684749 | 325 |
| 288 | iso_pu_bacteria | 8024501048 | 8024502950 | 325 |
| 289 | iso_pu_bacteria | 8055431914 | 8055433872 | 325 |
| 290 | iso_pu_bacteria | 8056382006 | 8056382321 | 325 |
| 291 | 3300021388 | Ga0213875_10001555 | Ga0213875_1000155516 | 326 |
| 292 | 3300037853 | Ga0436364_0046669 | Ga0436364_0046669_396_1385 | 326 |
| 293 | iso_pu_bacteria | 2503198000 | 2503198480 | 326 |
| 294 | iso_pu_bacteria | 2508501122 | 2509108085 | 326 |
| 295 | iso_pu_bacteria | 2508501123 | 2509114030 | 326 |
| 296 | iso_pu_bacteria | 2508501127 | 2509140753 | 326 |
| 297 | iso_pu_bacteria | 2509276018 | 2509368548 | 326 |
| 298 | iso_pu_bacteria | 2509276019 | 2509376740 | 326 |
| 299 | iso_pu_bacteria | 2509276021 | 2509391704 | 326 |
| 300 | iso_pu_bacteria | 2509276022 | 2509393533 | 326 |
| 301 | iso_pu_bacteria | 2509276033 | 2509447431 | 326 |
| 302 | iso_pu_bacteria | 2510065019 | 2510134267 | 326 |
| 303 | iso_pu_bacteria | 2510065057 | 2510302688 | 326 |
| 304 | iso_pu_bacteria | 2510461069 | 2510842109 | 326 |
| 305 | iso_pu_bacteria | 2510461069 | 2510842182 | 326 |
| 306 | iso_pu_bacteria | 2510461076 | 2510895706 | 326 |
| 307 | iso_pu_bacteria | 2510917022 | 2511131868 | 326 |
| 308 | iso_pu_bacteria | 2510917026 | 2511172370 | 326 |
| 309 | iso_pu_bacteria | 2510917028 | 2511186077 | 326 |
| 310 | iso_pu_bacteria | 2510917030 | 2511199351 | 326 |
| 311 | iso_pu_bacteria | 2511231027 | 2511388634 | 326 |
| 312 | iso_pu_bacteria | 2511231052 | 2511497738 | 326 |
| 313 | iso_pu_bacteria | 2512047086 | 2512528772 | 326 |
| 314 | iso_pu_bacteria | 2512875016 | 2512934055 | 326 |
| 315 | iso_pu_bacteria | 2512875024 | 2512962344 | 326 |
| 316 | iso_pu_bacteria | 2512875026 | 2512969599 | 326 |
| 317 | iso_pu_bacteria | 2513237084 | 2513567653 | 326 |
| 318 | iso_pu_bacteria | 2513237085 | 2513577940 | 326 |
| 319 | iso_pu_bacteria | 2513237086 | 2513584603 | 326 |
| 320 | iso_pu_bacteria | 2513237088 | 2513599464 | 326 |
| 321 | iso_pu_bacteria | 2513237089 | 2513607185 | 326 |
| 322 | iso_pu_bacteria | 2513237090 | 2513610662 | 326 |
| 323 | iso_pu_bacteria | 2513237091 | 2513618421 | 326 |
| 324 | iso_pu_bacteria | 2513237093 | 2513631912 | 326 |
| 325 | iso_pu_bacteria | 2513237103 | 2513707949 | 326 |
| 326 | iso_pu_bacteria | 2513237138 | 2513870151 | 326 |
| 327 | iso_pu_bacteria | 2513237140 | 2513883851 | 326 |
| 328 | iso_pu_bacteria | 2513237143 | 2513902045 | 326 |
| 329 | iso_pu_bacteria | 2513237144 | 2513908465 | 326 |
| 330 | iso_pu_bacteria | 2513237146 | 2513928171 | 326 |
| 331 | iso_pu_bacteria | 2513237156 | 2513988360 | 326 |
| 332 | iso_pu_bacteria | 2513237159 | 2513997606 | 326 |
| 333 | iso_pu_bacteria | 2513237160 | 2514008950 | 326 |
| 334 | iso_pu_bacteria | 2513237162 | 2514017982 | 326 |
| 335 | iso_pu_bacteria | 2513237164 | 2514038696 | 326 |
| 336 | iso_pu_bacteria | 2513237305 | 2514418241 | 326 |
| 337 | iso_pu_bacteria | 2515075009 | 2515113438 | 326 |
| 338 | iso_pu_bacteria | 2515154107 | 2515612006 | 326 |
| 339 | iso_pu_bacteria | 2515154113 | 2515635152 | 326 |
| 340 | iso_pu_bacteria | 2515154114 | 2515645594 | 326 |
| 341 | iso_pu_bacteria | 2515154116 | 2515655022 | 326 |
| 342 | iso_pu_bacteria | 2515154134 | 2515739800 | 326 |
| 343 | iso_pu_bacteria | 2516143018 | 2516206128 | 326 |
| 344 | iso_pu_bacteria | 2516653046 | 2516896610 | 326 |
| 345 | iso_pu_bacteria | 2516653077 | 2517037045 | 326 |
| 346 | iso_pu_bacteria | 2516653085 | 2517077396 | 326 |
| 347 | iso_pu_bacteria | 2517093000 | 2517096161 | 326 |
| 348 | iso_pu_bacteria | 2517287029 | 2517407777 | 326 |
| 349 | iso_pu_bacteria | 2517487022 | 2517565523 | 326 |
| 350 | iso_pu_bacteria | 2519899620 | 2520380330 | 326 |
| 351 | iso_pu_bacteria | 2523231067 | 2523466447 | 326 |
| 352 | iso_pu_bacteria | 2524023207 | 2524452107 | 326 |
| 353 | iso_pu_bacteria | 2524023209 | 2524458938 | 326 |
| 354 | iso_pu_bacteria | 2529292951 | 2530646471 | 326 |
| 355 | iso_pu_bacteria | 2534681796 | 2535517183 | 326 |
| 356 | iso_pu_bacteria | 2537561587 | 2537875331 | 326 |
| 357 | iso_pu_bacteria | 2551306084 | 2551681469 | 326 |
| 358 | iso_pu_bacteria | 2551306085 | 2551684704 | 326 |
| 359 | iso_pu_bacteria | 2551306086 | 2551692707 | 326 |
| 360 | iso_pu_bacteria | 2551306087 | 2551700303 | 326 |
| 361 | iso_pu_bacteria | 2551306089 | 2551713042 | 326 |
| 362 | iso_pu_bacteria | 2551306090 | 2551718161 | 326 |
| 363 | iso_pu_bacteria | 2551306090 | 2551722862 | 326 |
| 364 | iso_pu_bacteria | 2551306091 | 2551731536 | 326 |
| 365 | iso_pu_bacteria | 2551306092 | 2551737061 | 326 |
| 366 | iso_pu_bacteria | 2551306093 | 2551744381 | 326 |
| 367 | iso_pu_bacteria | 2554235003 | 2554244949 | 326 |
| 368 | iso_pu_bacteria | 2558860100 | 2558863896 | 326 |
| 369 | iso_pu_bacteria | 2558860242 | 2559297218 | 326 |
| 370 | iso_pu_bacteria | 2582581283 | 2585167523 | 326 |
| 371 | iso_pu_bacteria | 2582581294 | 2585201922 | 326 |
| 372 | iso_pu_bacteria | 2582581298 | 2585225316 | 326 |
| 373 | iso_pu_bacteria | 2582581299 | 2585228607 | 326 |
| 374 | iso_pu_bacteria | 2582581304 | 2585259414 | 326 |
| 375 | iso_pu_bacteria | 2582581306 | 2585265749 | 326 |
| 376 | iso_pu_bacteria | 2582581307 | 2585271429 | 326 |
| 377 | iso_pu_bacteria | 2582581308 | 2585279366 | 326 |
| 378 | iso_pu_bacteria | 2582581315 | 2585323028 | 326 |
| 379 | iso_pu_bacteria | 2582581316 | 2585331142 | 326 |
| 380 | iso_pu_bacteria | 2582581865 | 2585388955 | 326 |
| 381 | iso_pu_bacteria | 2582581866 | 2585395140 | 326 |
| 382 | iso_pu_bacteria | 2582581867 | 2585401040 | 326 |
| 383 | iso_pu_bacteria | 2585427526 | 2585524826 | 326 |
| 384 | iso_pu_bacteria | 2585427527 | 2585531149 | 326 |
| 385 | iso_pu_bacteria | 2585427528 | 2585538505 | 326 |
| 386 | iso_pu_bacteria | 2585427529 | 2585547872 | 326 |
| 387 | iso_pu_bacteria | 2585427530 | 2585552927 | 326 |
| 388 | iso_pu_bacteria | 2585427531 | 2585559172 | 326 |
| 389 | iso_pu_bacteria | 2585427590 | 2585822059 | 326 |
| 390 | iso_pu_bacteria | 2585427593 | 2585836458 | 326 |
| 391 | iso_pu_bacteria | 2585427608 | 2585898554 | 326 |
| 392 | iso_pu_bacteria | 2585427609 | 2585903882 | 326 |
| 393 | iso_pu_bacteria | 2585427633 | 2585993742 | 326 |
| 394 | iso_pu_bacteria | 2585427634 | 2586004591 | 326 |
| 395 | iso_pu_bacteria | 2585428125 | 2587981000 | 326 |
| 396 | iso_pu_bacteria | 2588253730 | 2588520195 | 326 |
| 397 | iso_pu_bacteria | 2599185156 | 2599332059 | 326 |
| 398 | iso_pu_bacteria | 2599185170 | 2599416939 | 326 |
| 399 | iso_pu_bacteria | 2599185210 | 2599605163 | 326 |
| 400 | iso_pu_bacteria | 2599185301 | 2599935262 | 326 |
| 401 | iso_pu_bacteria | 2599185352 | 2600196126 | 326 |
| 402 | iso_pu_bacteria | 2600255279 | 2601611677 | 326 |
| 403 | iso_pu_bacteria | 2600255308 | 2601748771 | 326 |
| 404 | iso_pu_bacteria | 2615840624 | 2616293047 | 326 |
| 405 | iso_pu_bacteria | 2615840626 | 2616311109 | 326 |
| 406 | iso_pu_bacteria | 2615840698 | 2616554548 | 326 |
| 407 | iso_pu_bacteria | 2617270742 | 2617385390 | 326 |
| 408 | iso_pu_bacteria | 2643221550 | 2643770647 | 326 |
| 409 | iso_pu_bacteria | 2643221551 | 2643777572 | 326 |
| 410 | iso_pu_bacteria | 2643221555 | 2643796020 | 326 |
| 411 | iso_pu_bacteria | 2643221557 | 2643804328 | 326 |
| 412 | iso_pu_bacteria | 2643221558 | 2643810932 | 326 |
| 413 | iso_pu_bacteria | 2643221564 | 2643838237 | 326 |
| 414 | iso_pu_bacteria | 2643221580 | 2643910115 | 326 |
| 415 | iso_pu_bacteria | 2643221580 | 2643912100 | 326 |
| 416 | iso_pu_bacteria | 2643221582 | 2643921760 | 326 |
| 417 | iso_pu_bacteria | 2643221591 | 2643963930 | 326 |
| 418 | iso_pu_bacteria | 2643221595 | 2643983773 | 326 |
| 419 | iso_pu_bacteria | 2643221599 | 2644006958 | 326 |
| 420 | iso_pu_bacteria | 2643221607 | 2644050155 | 326 |
| 421 | iso_pu_bacteria | 2643221610 | 2644065099 | 326 |
| 422 | iso_pu_bacteria | 2643221618 | 2644105402 | 326 |
| 423 | iso_pu_bacteria | 2643221626 | 2644145736 | 326 |
| 424 | iso_pu_bacteria | 2643221627 | 2644155906 | 326 |
| 425 | iso_pu_bacteria | 2643221634 | 2644191734 | 326 |
| 426 | iso_pu_bacteria | 2643221636 | 2644204786 | 326 |
| 427 | iso_pu_bacteria | 2643221637 | 2644208728 | 326 |
| 428 | iso_pu_bacteria | 2643221643 | 2644242637 | 326 |
| 429 | iso_pu_bacteria | 2643221653 | 2644299419 | 326 |
| 430 | iso_pu_bacteria | 2643221655 | 2644311371 | 326 |
| 431 | iso_pu_bacteria | 2643221659 | 2644331230 | 326 |
| 432 | iso_pu_bacteria | 2643221668 | 2644377508 | 326 |
| 433 | iso_pu_bacteria | 2643221674 | 2644410873 | 326 |
| 434 | iso_pu_bacteria | 2643221675 | 2644416771 | 326 |
| 435 | iso_pu_bacteria | 2643221680 | 2644449811 | 326 |
| 436 | iso_pu_bacteria | 2643221686 | 2644483076 | 326 |
| 437 | iso_pu_bacteria | 2643221688 | 2644494245 | 326 |
| 438 | iso_pu_bacteria | 2643221689 | 2644497722 | 326 |
| 439 | iso_pu_bacteria | 2643221693 | 2644519728 | 326 |
| 440 | iso_pu_bacteria | 2643221698 | 2644544675 | 326 |
| 441 | iso_pu_bacteria | 2643221712 | 2644617045 | 326 |
| 442 | iso_pu_bacteria | 2643221718 | 2644652258 | 326 |
| 443 | iso_pu_bacteria | 2643221719 | 2644657647 | 326 |
| 444 | iso_pu_bacteria | 2643221723 | 2644672832 | 326 |
| 445 | iso_pu_bacteria | 2643221726 | 2644689945 | 326 |
| 446 | iso_pu_bacteria | 2657244999 | 2657684898 | 326 |
| 447 | iso_pu_bacteria | 2667528174 | 2671111135 | 326 |
| 448 | iso_pu_bacteria | 2687453392 | 2688595802 | 326 |
| 449 | iso_pu_bacteria | 2690316117 | 2692315225 | 326 |
| 450 | iso_pu_bacteria | 2693429783 | 2694627978 | 326 |
| 451 | iso_pu_bacteria | 2693429784 | 2694636227 | 326 |
| 452 | iso_pu_bacteria | 2718217882 | 2719182107 | 326 |
| 453 | iso_pu_bacteria | 2718217927 | 2719386733 | 326 |
| 454 | iso_pu_bacteria | 2718217997 | 2719666471 | 326 |
| 455 | iso_pu_bacteria | 2718218009 | 2719732823 | 326 |
| 456 | iso_pu_bacteria | 2718218199 | 2720492891 | 326 |
| 457 | iso_pu_bacteria | 2718218232 | 2720614355 | 326 |
| 458 | iso_pu_bacteria | 2718218233 | 2720621127 | 326 |
| 459 | iso_pu_bacteria | 2718218235 | 2720632456 | 326 |
| 460 | iso_pu_bacteria | 2718218269 | 2720776178 | 326 |
| 461 | iso_pu_bacteria | 2718218363 | 2721148198 | 326 |
| 462 | iso_pu_bacteria | 2718218365 | 2721159651 | 326 |
| 463 | iso_pu_bacteria | 2718218366 | 2721165034 | 326 |
| 464 | iso_pu_bacteria | 2718218423 | 2721400439 | 326 |
| 465 | iso_pu_bacteria | 2721755514 | 2722841204 | 326 |
| 466 | iso_pu_bacteria | 2721755556 | 2723027775 | 326 |
| 467 | iso_pu_bacteria | 2721755684 | 2723561405 | 326 |
| 468 | iso_pu_bacteria | 2721755685 | 2723568028 | 326 |
| 469 | iso_pu_bacteria | 2721755686 | 2723573050 | 326 |
| 470 | iso_pu_bacteria | 2721755809 | 2724039252 | 326 |
| 471 | iso_pu_bacteria | 2721755810 | 2724045579 | 326 |
| 472 | iso_pu_bacteria | 2721755819 | 2724090785 | 326 |
| 473 | iso_pu_bacteria | 2721755822 | 2724105293 | 326 |
| 474 | iso_pu_bacteria | 2721755823 | 2724111120 | 326 |
| 475 | iso_pu_bacteria | 2724679232 | 2725950329 | 326 |
| 476 | iso_pu_bacteria | 2728369352 | 2730108711 | 326 |
| 477 | iso_pu_bacteria | 2728369365 | 2730165342 | 326 |
| 478 | iso_pu_bacteria | 2728369397 | 2730299283 | 326 |
| 479 | iso_pu_bacteria | 2738541293 | 2738804998 | 326 |
| 480 | iso_pu_bacteria | 2738541317 | 2738944699 | 326 |
| 481 | iso_pu_bacteria | 2738541333 | 2739033147 | 326 |
| 482 | iso_pu_bacteria | 2738543024 | 2739307410 | 326 |
| 483 | iso_pu_bacteria | 2738543031 | 2739350584 | 326 |
| 484 | iso_pu_bacteria | 2751185800 | 2753358098 | 326 |
| 485 | iso_pu_bacteria | 2756170246 | 2756674873 | 326 |
| 486 | iso_pu_bacteria | 2758568016 | 2758639124 | 326 |
| 487 | iso_pu_bacteria | 2765235942 | 2766066192 | 326 |
| 488 | iso_pu_bacteria | 2775507049 | 2776910367 | 326 |
| 489 | iso_pu_bacteria | 2775507266 | 2778175725 | 326 |
| 490 | iso_pu_bacteria | 2791355082 | 2792580104 | 326 |
| 491 | iso_pu_bacteria | 2791355082 | 2792581502 | 326 |
| 492 | iso_pu_bacteria | 2791355091 | 2792620525 | 326 |
| 493 | iso_pu_bacteria | 2791355092 | 2792625883 | 326 |
| 494 | iso_pu_bacteria | 2791355094 | 2792638822 | 326 |
| 495 | iso_pu_bacteria | 2791355123 | 2792746990 | 326 |
| 496 | iso_pu_bacteria | 2791355253 | 2793280046 | 326 |
| 497 | iso_pu_bacteria | 2791355256 | 2793294124 | 326 |
| 498 | iso_pu_bacteria | 2791355259 | 2793318120 | 326 |
| 499 | iso_pu_bacteria | 2791355260 | 2793319521 | 326 |
| 500 | iso_pu_bacteria | 2791355261 | 2793328886 | 326 |
| 501 | iso_pu_bacteria | 2791355262 | 2793334883 | 326 |
| 502 | iso_pu_bacteria | 2791355263 | 2793343020 | 326 |
| 503 | iso_pu_bacteria | 2791355264 | 2793346940 | 326 |
| 504 | iso_pu_bacteria | 2791355265 | 2793351527 | 326 |
| 505 | iso_pu_bacteria | 2791355266 | 2793362459 | 326 |
| 506 | iso_pu_bacteria | 2791355267 | 2793367576 | 326 |
| 507 | iso_pu_bacteria | 2802428858 | 2802716029 | 326 |
| 508 | iso_pu_bacteria | 2802428859 | 2802722947 | 326 |
| 509 | iso_pu_bacteria | 2802428860 | 2802728922 | 326 |
| 510 | iso_pu_bacteria | 2802428861 | 2802735288 | 326 |
| 511 | iso_pu_bacteria | 2802428862 | 2802742108 | 326 |
| 512 | iso_pu_bacteria | 2802428863 | 2802748556 | 326 |
| 513 | iso_pu_bacteria | 2802429268 | 2804752974 | 326 |
| 514 | iso_pu_bacteria | 2802429605 | 2805926761 | 326 |
| 515 | iso_pu_bacteria | 2802429606 | 2805932669 | 326 |
| 516 | iso_pu_bacteria | 2802429633 | 2806045286 | 326 |
| 517 | iso_pu_bacteria | 2802429634 | 2806049919 | 326 |
| 518 | iso_pu_bacteria | 2802429635 | 2806056757 | 326 |
| 519 | iso_pu_bacteria | 2802429636 | 2806064139 | 326 |
| 520 | iso_pu_bacteria | 2802429637 | 2806071407 | 326 |
| 521 | iso_pu_bacteria | 2808606387 | 2808988824 | 326 |
| 522 | iso_pu_bacteria | 2818991272 | 2819243992 | 326 |
| 523 | iso_pu_bacteria | 2818991439 | 2819561313 | 326 |
| 524 | iso_pu_bacteria | 2818991448 | 2819609435 | 326 |
| 525 | iso_pu_bacteria | 2818991453 | 2819641254 | 326 |
| 526 | iso_pu_bacteria | 2838016132 | 2838020038 | 326 |
| 527 | iso_pu_bacteria | 2838022645 | 2838023537 | 326 |
| 528 | iso_pu_bacteria | 2838029111 | 2838033300 | 326 |
| 529 | iso_pu_bacteria | 2838035591 | 2838041732 | 326 |
| 530 | iso_pu_bacteria | 2838042994 | 2838045283 | 326 |
| 531 | iso_pu_bacteria | 2838048938 | 2838052848 | 326 |
| 532 | iso_pu_bacteria | 2838061910 | 2838065106 | 326 |
| 533 | iso_pu_bacteria | 2838068647 | 2838069833 | 326 |
| 534 | iso_pu_bacteria | 2838074704 | 2838079725 | 326 |
| 535 | iso_pu_bacteria | 2838661181 | 2838661294 | 326 |
| 536 | iso_pu_bacteria | 2838668709 | 2838674835 | 326 |
| 537 | iso_pu_bacteria | 2838675328 | 2838679538 | 326 |
| 538 | iso_pu_bacteria | 2838680041 | 2838683129 | 326 |
| 539 | iso_pu_bacteria | 2838686498 | 2838686729 | 326 |
| 540 | iso_pu_bacteria | 2838694306 | 2838697927 | 326 |
| 541 | iso_pu_bacteria | 2838701080 | 2838707112 | 326 |
| 542 | iso_pu_bacteria | 2838707686 | 2838711042 | 326 |
| 543 | iso_pu_bacteria | 2838714209 | 2838718895 | 326 |
| 544 | iso_pu_bacteria | 2838719591 | 2838723894 | 326 |
| 545 | iso_pu_bacteria | 2838724970 | 2838729216 | 326 |
| 546 | iso_pu_bacteria | 2838729681 | 2838730313 | 326 |
| 547 | iso_pu_bacteria | 2838742623 | 2838742672 | 326 |
| 548 | iso_pu_bacteria | 2841734538 | 2841736223 | 326 |
| 549 | iso_pu_bacteria | 2841846520 | 2841851014 | 326 |
| 550 | iso_pu_bacteria | 2841851746 | 2841854557 | 326 |
| 551 | iso_pu_bacteria | 2841859092 | 2841863822 | 326 |
| 552 | iso_pu_bacteria | 2841864319 | 2841867281 | 326 |
| 553 | iso_pu_bacteria | 2842077413 | 2842079217 | 326 |
| 554 | iso_pu_bacteria | 2842110456 | 2842112948 | 326 |
| 555 | iso_pu_bacteria | 2842118031 | 2842118272 | 326 |
| 556 | iso_pu_bacteria | 2842124991 | 2842129915 | 326 |
| 557 | iso_pu_bacteria | 2842130223 | 2842134343 | 326 |
| 558 | iso_pu_bacteria | 2842146304 | 2842151756 | 326 |
| 559 | iso_pu_bacteria | 2842152218 | 2842156339 | 326 |
| 560 | iso_pu_bacteria | 2842156927 | 2842158424 | 326 |
| 561 | iso_pu_bacteria | 2842163707 | 2842170201 | 326 |
| 562 | iso_pu_bacteria | 2842170452 | 2842175141 | 326 |
| 563 | iso_pu_bacteria | 2842175837 | 2842180057 | 326 |
| 564 | iso_pu_bacteria | 2842180545 | 2842182039 | 326 |
| 565 | iso_pu_bacteria | 2842187318 | 2842191524 | 326 |
| 566 | iso_pu_bacteria | 2842192696 | 2842195738 | 326 |
| 567 | iso_pu_bacteria | 2842198810 | 2842199051 | 326 |
| 568 | iso_pu_bacteria | 2842205361 | 2842209497 | 326 |
| 569 | iso_pu_bacteria | 2842211629 | 2842215841 | 326 |
| 570 | iso_pu_bacteria | 2842217011 | 2842218276 | 326 |
| 571 | iso_pu_bacteria | 2842224351 | 2842228659 | 326 |
| 572 | iso_pu_bacteria | 2842229732 | 2842229962 | 326 |
| 573 | iso_pu_bacteria | 2842237096 | 2842240186 | 326 |
| 574 | iso_pu_bacteria | 2842243621 | 2842243851 | 326 |
| 575 | iso_pu_bacteria | 2842250916 | 2842256950 | 326 |
| 576 | iso_pu_bacteria | 2842257432 | 2842258064 | 326 |
| 577 | iso_pu_bacteria | 2842264693 | 2842267759 | 326 |
| 578 | iso_pu_bacteria | 2842271015 | 2842271733 | 326 |
| 579 | iso_pu_bacteria | 2842278818 | 2842282951 | 326 |
| 580 | iso_pu_bacteria | 2842285085 | 2842285295 | 326 |
| 581 | iso_pu_bacteria | 2842291075 | 2842292879 | 326 |
| 582 | iso_pu_bacteria | 2842298080 | 2842298290 | 326 |
| 583 | iso_pu_bacteria | 2842304105 | 2842305366 | 326 |
| 584 | iso_pu_bacteria | 2842311132 | 2842313908 | 326 |
| 585 | iso_pu_bacteria | 2842317721 | 2842319856 | 326 |
| 586 | iso_pu_bacteria | 2842341865 | 2842347910 | 326 |
| 587 | iso_pu_bacteria | 2842357229 | 2842360110 | 326 |
| 588 | iso_pu_bacteria | 2842363717 | 2842368415 | 326 |
| 589 | iso_pu_bacteria | 2842370503 | 2842373759 | 326 |
| 590 | iso_pu_bacteria | 2842377471 | 2842379276 | 326 |
| 591 | iso_pu_bacteria | 2842384541 | 2842384783 | 326 |
| 592 | iso_pu_bacteria | 2842395702 | 2842400689 | 326 |
| 593 | iso_pu_bacteria | 2842402390 | 2842402654 | 326 |
| 594 | iso_pu_bacteria | 2842409023 | 2842409974 | 326 |
| 595 | iso_pu_bacteria | 2842415677 | 2842416623 | 326 |
| 596 | iso_pu_bacteria | 2842422224 | 2842423447 | 326 |
| 597 | iso_pu_bacteria | 2842428310 | 2842430403 | 326 |
| 598 | iso_pu_bacteria | 2842434925 | 2842436785 | 326 |
| 599 | iso_pu_bacteria | 2842441272 | 2842443373 | 326 |
| 600 | iso_pu_bacteria | 2842447887 | 2842449243 | 326 |
| 601 | iso_pu_bacteria | 2842462802 | 2842466657 | 326 |
| 602 | iso_pu_bacteria | 2842469257 | 2842471345 | 326 |
| 603 | iso_pu_bacteria | 2842475841 | 2842480035 | 326 |
| 604 | iso_pu_bacteria | 2842482326 | 2842483775 | 326 |
| 605 | iso_pu_bacteria | 2842489311 | 2842493603 | 326 |
| 606 | iso_pu_bacteria | 2842495871 | 2842497754 | 326 |
| 607 | iso_pu_bacteria | 2842502639 | 2842505180 | 326 |
| 608 | iso_pu_bacteria | 2842509118 | 2842514192 | 326 |
| 609 | iso_pu_bacteria | 2842515876 | 2842520604 | 326 |
| 610 | iso_pu_bacteria | 2842521101 | 2842522151 | 326 |
| 611 | iso_pu_bacteria | 2842922631 | 2842924394 | 326 |
| 612 | iso_pu_bacteria | 2844002411 | 2844003650 | 326 |
| 613 | iso_pu_bacteria | 2844009547 | 2844010607 | 326 |
| 614 | iso_pu_bacteria | 2844163670 | 2844163943 | 326 |
| 615 | iso_pu_bacteria | 2844454524 | 2844458026 | 326 |
| 616 | iso_pu_bacteria | 2847417321 | 2847419718 | 326 |
| 617 | iso_pu_bacteria | 2847670302 | 2847673359 | 326 |
| 618 | iso_pu_bacteria | 2847686936 | 2847689869 | 326 |
| 619 | iso_pu_bacteria | 2848992105 | 2848994720 | 326 |
| 620 | iso_pu_bacteria | 2850079185 | 2850081742 | 326 |
| 621 | iso_pu_bacteria | 2852387548 | 2852390575 | 326 |
| 622 | iso_pu_bacteria | 2854911287 | 2854916347 | 326 |
| 623 | iso_pu_bacteria | 2855825444 | 2855828557 | 326 |
| 624 | iso_pu_bacteria | 2855839649 | 2855843682 | 326 |
| 625 | iso_pu_bacteria | 2855872281 | 2855877235 | 326 |
| 626 | iso_pu_bacteria | 2856314179 | 2856319172 | 326 |
| 627 | iso_pu_bacteria | 2856320880 | 2856322229 | 326 |
| 628 | iso_pu_bacteria | 2856328259 | 2856332712 | 326 |
| 629 | iso_pu_bacteria | 2856334872 | 2856340699 | 326 |
| 630 | iso_pu_bacteria | 2856342000 | 2856342843 | 326 |
| 631 | iso_pu_bacteria | 2856349417 | 2856355177 | 326 |
| 632 | iso_pu_bacteria | 2856364286 | 2856369976 | 326 |
| 633 | iso_pu_bacteria | 2857349434 | 2857352829 | 326 |
| 634 | iso_pu_bacteria | 2857367948 | 2857369256 | 326 |
| 635 | iso_pu_bacteria | 2857516855 | 2857517103 | 326 |
| 636 | iso_pu_bacteria | 2858800743 | 2858807072 | 326 |
| 637 | iso_pu_bacteria | 2869162929 | 2869165342 | 326 |
| 638 | iso_pu_bacteria | 2869169390 | 2869173703 | 326 |
| 639 | iso_pu_bacteria | 2869242130 | 2869245191 | 326 |
| 640 | iso_pu_bacteria | 2869249662 | 2869255857 | 326 |
| 641 | iso_pu_bacteria | 2869256925 | 2869257097 | 326 |
| 642 | iso_pu_bacteria | 2869264136 | 2869265112 | 326 |
| 643 | iso_pu_bacteria | 2869271264 | 2869277354 | 326 |
| 644 | iso_pu_bacteria | 2869278585 | 2869284676 | 326 |
| 645 | iso_pu_bacteria | 2869285874 | 2869290783 | 326 |
| 646 | iso_pu_bacteria | 2871429161 | 2871433065 | 326 |
| 647 | iso_pu_bacteria | 2871435913 | 2871438860 | 326 |
| 648 | iso_pu_bacteria | 2871451962 | 2871452184 | 326 |
| 649 | iso_pu_bacteria | 2871459585 | 2871465920 | 326 |
| 650 | iso_pu_bacteria | 2871466892 | 2871472939 | 326 |
| 651 | iso_pu_bacteria | 2871474448 | 2871475651 | 326 |
| 652 | iso_pu_bacteria | 2871481445 | 2871484382 | 326 |
| 653 | iso_pu_bacteria | 2871495908 | 2871502296 | 326 |
| 654 | iso_pu_bacteria | 2874102143 | 2874108445 | 326 |
| 655 | iso_pu_bacteria | 2874109183 | 2874109490 | 326 |
| 656 | iso_pu_bacteria | 2874116593 | 2874122028 | 326 |
| 657 | iso_pu_bacteria | 2874123672 | 2874124233 | 326 |
| 658 | iso_pu_bacteria | 2874131515 | 2874138688 | 326 |
| 659 | iso_pu_bacteria | 2874139085 | 2874143004 | 326 |
| 660 | iso_pu_bacteria | 2874146452 | 2874153774 | 326 |
| 661 | iso_pu_bacteria | 2874155637 | 2874161039 | 326 |
| 662 | iso_pu_bacteria | 2874162495 | 2874168334 | 326 |
| 663 | iso_pu_bacteria | 2874168670 | 2874172213 | 326 |
| 664 | iso_pu_bacteria | 2876363079 | 2876363687 | 326 |
| 665 | iso_pu_bacteria | 2876369609 | 2876376015 | 326 |
| 666 | iso_pu_bacteria | 2876377896 | 2876381382 | 326 |
| 667 | iso_pu_bacteria | 2876386047 | 2876386049 | 326 |
| 668 | iso_pu_bacteria | 2876392853 | 2876397139 | 326 |
| 669 | iso_pu_bacteria | 2876399893 | 2876403786 | 326 |
| 670 | iso_pu_bacteria | 2876406927 | 2876407917 | 326 |
| 671 | iso_pu_bacteria | 2876413966 | 2876419079 | 326 |
| 672 | iso_pu_bacteria | 2876420981 | 2876424492 | 326 |
| 673 | iso_pu_bacteria | 2878035449 | 2878039561 | 326 |
| 674 | iso_pu_bacteria | 2878730984 | 2878731909 | 326 |
| 675 | iso_pu_bacteria | 2878738818 | 2878740927 | 326 |
| 676 | iso_pu_bacteria | 2878745973 | 2878750678 | 326 |
| 677 | iso_pu_bacteria | 2878753008 | 2878754313 | 326 |
| 678 | iso_pu_bacteria | 2878760144 | 2878766187 | 326 |
| 679 | iso_pu_bacteria | 2878767105 | 2878773388 | 326 |
| 680 | iso_pu_bacteria | 2878774303 | 2878778243 | 326 |
| 681 | iso_pu_bacteria | 2878781027 | 2878785543 | 326 |
| 682 | iso_pu_bacteria | 2881147464 | 2881148229 | 326 |
| 683 | iso_pu_bacteria | 2881155292 | 2881159187 | 326 |
| 684 | iso_pu_bacteria | 2881161766 | 2881164883 | 326 |
| 685 | iso_pu_bacteria | 2881853255 | 2881856291 | 326 |
| 686 | iso_pu_bacteria | 2881861095 | 2881867259 | 326 |
| 687 | iso_pu_bacteria | 2882632389 | 2882634584 | 326 |
| 688 | iso_pu_bacteria | 2882912400 | 2882913261 | 326 |
| 689 | iso_pu_bacteria | 2885305155 | 2885306758 | 326 |
| 690 | iso_pu_bacteria | 2885312484 | 2885314315 | 326 |
| 691 | iso_pu_bacteria | 2885318864 | 2885323614 | 326 |
| 692 | iso_pu_bacteria | 2885326080 | 2885332988 | 326 |
| 693 | iso_pu_bacteria | 2885334103 | 2885335734 | 326 |
| 694 | iso_pu_bacteria | 2885342637 | 2885344602 | 326 |
| 695 | iso_pu_bacteria | 2885350715 | 2885355668 | 326 |
| 696 | iso_pu_bacteria | 2888337043 | 2888343446 | 326 |
| 697 | iso_pu_bacteria | 2888343758 | 2888344183 | 326 |
| 698 | iso_pu_bacteria | 2888350351 | 2888353057 | 326 |
| 699 | iso_pu_bacteria | 2889010040 | 2889014803 | 326 |
| 700 | iso_pu_bacteria | 2889016732 | 2889020113 | 326 |
| 701 | iso_pu_bacteria | 2889790730 | 2889792025 | 326 |
| 702 | iso_pu_bacteria | 2889914905 | 2889918346 | 326 |
| 703 | iso_pu_bacteria | 2891048133 | 2891051656 | 326 |
| 704 | iso_pu_bacteria | 2891373044 | 2891373659 | 326 |
| 705 | iso_pu_bacteria | 2896384573 | 2896391162 | 326 |
| 706 | iso_pu_bacteria | 2898795034 | 2898796591 | 326 |
| 707 | iso_pu_bacteria | 2899792073 | 2899793261 | 326 |
| 708 | iso_pu_bacteria | 2899803654 | 2899808422 | 326 |
| 709 | iso_pu_bacteria | 2899845264 | 2899850504 | 326 |
| 710 | iso_pu_bacteria | 2903448605 | 2903454228 | 326 |
| 711 | iso_pu_bacteria | 2903492973 | 2903496285 | 326 |
| 712 | iso_pu_bacteria | 2903492973 | 2903497372 | 326 |
| 713 | iso_pu_bacteria | 2903513507 | 2903517504 | 326 |
| 714 | iso_pu_bacteria | 2903521522 | 2903523252 | 326 |
| 715 | iso_pu_bacteria | 2903528002 | 2903529291 | 326 |
| 716 | iso_pu_bacteria | 2903540706 | 2903547233 | 326 |
| 717 | iso_pu_bacteria | 2904659560 | 2904663893 | 326 |
| 718 | iso_pu_bacteria | 2906308376 | 2906313603 | 326 |
| 719 | iso_pu_bacteria | 2906321335 | 2906326312 | 326 |
| 720 | iso_pu_bacteria | 2906328253 | 2906334269 | 326 |
| 721 | iso_pu_bacteria | 2906363423 | 2906369755 | 326 |
| 722 | iso_pu_bacteria | 2906370794 | 2906372837 | 326 |
| 723 | iso_pu_bacteria | 2906378014 | 2906384940 | 326 |
| 724 | iso_pu_bacteria | 2906393657 | 2906394006 | 326 |
| 725 | iso_pu_bacteria | 2906401398 | 2906407733 | 326 |
| 726 | iso_pu_bacteria | 2906408224 | 2906408501 | 326 |
| 727 | iso_pu_bacteria | 2906414383 | 2906419244 | 326 |
| 728 | iso_pu_bacteria | 2906427513 | 2906433331 | 326 |
| 729 | iso_pu_bacteria | 2906626472 | 2906632611 | 326 |
| 730 | iso_pu_bacteria | 2913295892 | 2913296182 | 326 |
| 731 | iso_pu_bacteria | 2913308742 | 2913309320 | 326 |
| 732 | iso_pu_bacteria | 2915650412 | 2915652760 | 326 |
| 733 | iso_pu_bacteria | 2915980308 | 2915983695 | 326 |
| 734 | iso_pu_bacteria | 2915986958 | 2915988610 | 326 |
| 735 | iso_pu_bacteria | 2915993759 | 2916000230 | 326 |
| 736 | iso_pu_bacteria | 2916000859 | 2916007336 | 326 |
| 737 | iso_pu_bacteria | 2916007675 | 2916013471 | 326 |
| 738 | iso_pu_bacteria | 2916014648 | 2916020746 | 326 |
| 739 | iso_pu_bacteria | 2916021584 | 2916028088 | 326 |
| 740 | iso_pu_bacteria | 2916028427 | 2916031155 | 326 |
| 741 | iso_pu_bacteria | 2916035215 | 2916041553 | 326 |
| 742 | iso_pu_bacteria | 2916041962 | 2916043670 | 326 |
| 743 | iso_pu_bacteria | 2916048683 | 2916054052 | 326 |
| 744 | iso_pu_bacteria | 2916055098 | 2916057791 | 326 |
| 745 | iso_pu_bacteria | 2916061851 | 2916068331 | 326 |
| 746 | iso_pu_bacteria | 2916076590 | 2916082558 | 326 |
| 747 | iso_pu_bacteria | 2917554339 | 2917558630 | 326 |
| 748 | iso_pu_bacteria | 2919100787 | 2919105518 | 326 |
| 749 | iso_pu_bacteria | 2919114240 | 2919118730 | 326 |
| 750 | iso_pu_bacteria | 2919171160 | 2919174038 | 326 |
| 751 | iso_pu_bacteria | 2919408235 | 2919410299 | 326 |
| 752 | iso_pu_bacteria | 2919679072 | 2919681404 | 326 |
| 753 | iso_pu_bacteria | 2920760137 | 2920761244 | 326 |
| 754 | iso_pu_bacteria | 2920822456 | 2920825555 | 326 |
| 755 | iso_pu_bacteria | 2921201388 | 2921204325 | 326 |
| 756 | iso_pu_bacteria | 2921208531 | 2921213252 | 326 |
| 757 | iso_pu_bacteria | 2921237296 | 2921243249 | 326 |
| 758 | iso_pu_bacteria | 2921244191 | 2921245723 | 326 |
| 759 | iso_pu_bacteria | 2921250672 | 2921256934 | 326 |
| 760 | iso_pu_bacteria | 2921263974 | 2921266562 | 326 |
| 761 | iso_pu_bacteria | 2921282425 | 2921284676 | 326 |
| 762 | iso_pu_bacteria | 2921289301 | 2921290719 | 326 |
| 763 | iso_pu_bacteria | 2921296804 | 2921302626 | 326 |
| 764 | iso_pu_bacteria | 2922130491 | 2922132602 | 326 |
| 765 | iso_pu_bacteria | 2922151315 | 2922154956 | 326 |
| 766 | iso_pu_bacteria | 2922158528 | 2922159724 | 326 |
| 767 | iso_pu_bacteria | 2922172374 | 2922174386 | 326 |
| 768 | iso_pu_bacteria | 2922178524 | 2922181927 | 326 |
| 769 | iso_pu_bacteria | 2922185730 | 2922193607 | 326 |
| 770 | iso_pu_bacteria | 2923556063 | 2923560184 | 326 |
| 771 | iso_pu_bacteria | 2924144063 | 2924148108 | 326 |
| 772 | iso_pu_bacteria | 2924150972 | 2924158260 | 326 |
| 773 | iso_pu_bacteria | 2924158325 | 2924164268 | 326 |
| 774 | iso_pu_bacteria | 2924165586 | 2924168450 | 326 |
| 775 | iso_pu_bacteria | 2924172951 | 2924174830 | 326 |
| 776 | iso_pu_bacteria | 2924179722 | 2924182025 | 326 |
| 777 | iso_pu_bacteria | 2924186466 | 2924188901 | 326 |
| 778 | iso_pu_bacteria | 2924193448 | 2924195751 | 326 |
| 779 | iso_pu_bacteria | 2924200457 | 2924202979 | 326 |
| 780 | iso_pu_bacteria | 2924207177 | 2924210013 | 326 |
| 781 | iso_pu_bacteria | 2924221636 | 2924222652 | 326 |
| 782 | iso_pu_bacteria | 2924228884 | 2924231051 | 326 |
| 783 | iso_pu_bacteria | 2924710171 | 2924717161 | 326 |
| 784 | iso_pu_bacteria | 2924726620 | 2924728926 | 326 |
| 785 | iso_pu_bacteria | 2924733363 | 2924736509 | 326 |
| 786 | iso_pu_bacteria | 2924741084 | 2924745487 | 326 |
| 787 | iso_pu_bacteria | 2924748358 | 2924748630 | 326 |
| 788 | iso_pu_bacteria | 2924754689 | 2924756974 | 326 |
| 789 | iso_pu_bacteria | 2924762789 | 2924765602 | 326 |
| 790 | iso_pu_bacteria | 2924776078 | 2924778528 | 326 |
| 791 | iso_pu_bacteria | 2924784321 | 2924785001 | 326 |
| 792 | iso_pu_bacteria | 2926754445 | 2926758249 | 326 |
| 793 | iso_pu_bacteria | 2926760298 | 2926764186 | 326 |
| 794 | iso_pu_bacteria | 2932401849 | 2932403748 | 326 |
| 795 | iso_pu_bacteria | 2933006813 | 2933011113 | 326 |
| 796 | iso_pu_bacteria | 2933011516 | 2933016347 | 326 |
| 797 | iso_pu_bacteria | 2933016740 | 2933018557 | 326 |
| 798 | iso_pu_bacteria | 2933570622 | 2933571173 | 326 |
| 799 | iso_pu_bacteria | 2933586486 | 2933588995 | 326 |
| 800 | iso_pu_bacteria | 2933594066 | 2933599057 | 326 |
| 801 | iso_pu_bacteria | 2933599457 | 2933600639 | 326 |
| 802 | iso_pu_bacteria | 2935894831 | 2935896688 | 326 |
| 803 | iso_pu_bacteria | 2935901341 | 2935901635 | 326 |
| 804 | iso_pu_bacteria | 2936367885 | 2936371724 | 326 |
| 805 | iso_pu_bacteria | 2936375103 | 2936379559 | 326 |
| 806 | iso_pu_bacteria | 2936381700 | 2936383306 | 326 |
| 807 | iso_pu_bacteria | 2936996657 | 2937001561 | 326 |
| 808 | iso_pu_bacteria | 2937002841 | 2937005559 | 326 |
| 809 | iso_pu_bacteria | 2937009748 | 2937014271 | 326 |
| 810 | iso_pu_bacteria | 2937016420 | 2937019195 | 326 |
| 811 | iso_pu_bacteria | 2937023124 | 2937026137 | 326 |
| 812 | iso_pu_bacteria | 2937029754 | 2937035046 | 326 |
| 813 | iso_pu_bacteria | 2937042894 | 2937045771 | 326 |
| 814 | iso_pu_bacteria | 2937049772 | 2937054073 | 326 |
| 815 | iso_pu_bacteria | 2937056579 | 2937056827 | 326 |
| 816 | iso_pu_bacteria | 2937063883 | 2937066111 | 326 |
| 817 | iso_pu_bacteria | 2937071275 | 2937077650 | 326 |
| 818 | iso_pu_bacteria | 2937078374 | 2937084310 | 326 |
| 819 | iso_pu_bacteria | 2937084907 | 2937091748 | 326 |
| 820 | iso_pu_bacteria | 2937091812 | 2937093315 | 326 |
| 821 | iso_pu_bacteria | 2937098957 | 2937105068 | 326 |
| 822 | iso_pu_bacteria | 2937106411 | 2937111493 | 326 |
| 823 | iso_pu_bacteria | 2937113482 | 2937118866 | 326 |
| 824 | iso_pu_bacteria | 2937119839 | 2937120701 | 326 |
| 825 | iso_pu_bacteria | 2937126314 | 2937128962 | 326 |
| 826 | iso_pu_bacteria | 2937813078 | 2937820092 | 326 |
| 827 | iso_pu_bacteria | 2937822353 | 2937826499 | 326 |
| 828 | iso_pu_bacteria | 2937836603 | 2937840593 | 326 |
| 829 | iso_pu_bacteria | 2937848649 | 2937849570 | 326 |
| 830 | iso_pu_bacteria | 2937861824 | 2937866108 | 326 |
| 831 | iso_pu_bacteria | 2937868953 | 2937877294 | 326 |
| 832 | iso_pu_bacteria | 2937877337 | 2937878838 | 326 |
| 833 | iso_pu_bacteria | 2937891427 | 2937897365 | 326 |
| 834 | iso_pu_bacteria | 2937980651 | 2937985214 | 326 |
| 835 | iso_pu_bacteria | 2937994558 | 2938001096 | 326 |
| 836 | iso_pu_bacteria | 2938014810 | 2938019701 | 326 |
| 837 | iso_pu_bacteria | 2939669807 | 2939671713 | 326 |
| 838 | iso_pu_bacteria | 2941499720 | 2941504658 | 326 |
| 839 | iso_pu_bacteria | 2957375807 | 2957381022 | 326 |
| 840 | iso_pu_bacteria | 2957382221 | 2957382976 | 326 |
| 841 | iso_pu_bacteria | 2957388812 | 2957391933 | 326 |
| 842 | iso_pu_bacteria | 2957395598 | 2957401399 | 326 |
| 843 | iso_pu_bacteria | 2957402308 | 2957402972 | 326 |
| 844 | iso_pu_bacteria | 2957408893 | 2957411328 | 326 |
| 845 | iso_pu_bacteria | 2957415311 | 2957418333 | 326 |
| 846 | iso_pu_bacteria | 2957422303 | 2957428029 | 326 |
| 847 | iso_pu_bacteria | 2957430029 | 2957436139 | 326 |
| 848 | iso_pu_bacteria | 2957437181 | 2957442263 | 326 |
| 849 | iso_pu_bacteria | 2957443900 | 2957443908 | 326 |
| 850 | iso_pu_bacteria | 2957450854 | 2957454871 | 326 |
| 851 | iso_pu_bacteria | 2957457609 | 2957464081 | 326 |
| 852 | iso_pu_bacteria | 2957464669 | 2957464864 | 326 |
| 853 | iso_pu_bacteria | 2957471148 | 2957477498 | 326 |
| 854 | iso_pu_bacteria | 2957478035 | 2957480499 | 326 |
| 855 | iso_pu_bacteria | 2957484790 | 2957487067 | 326 |
| 856 | iso_pu_bacteria | 2957491536 | 2957491729 | 326 |
| 857 | iso_pu_bacteria | 2957498199 | 2957498986 | 326 |
| 858 | iso_pu_bacteria | 2957505466 | 2957510113 | 326 |
| 859 | iso_pu_bacteria | 2958034702 | 2958041469 | 326 |
| 860 | iso_pu_bacteria | 2958041894 | 2958042443 | 326 |
| 861 | iso_pu_bacteria | 2958064165 | 2958069535 | 326 |
| 862 | iso_pu_bacteria | 2958071322 | 2958077184 | 326 |
| 863 | iso_pu_bacteria | 2958084443 | 2958085989 | 326 |
| 864 | iso_pu_bacteria | 2958092219 | 2958098952 | 326 |
| 865 | iso_pu_bacteria | 2958100919 | 2958101964 | 326 |
| 866 | iso_pu_bacteria | 2958108152 | 2958112523 | 326 |
| 867 | iso_pu_bacteria | 2958115193 | 2958119250 | 326 |
| 868 | iso_pu_bacteria | 2958122699 | 2958123249 | 326 |
| 869 | iso_pu_bacteria | 2958130278 | 2958135183 | 326 |
| 870 | iso_pu_bacteria | 2958137437 | 2958140070 | 326 |
| 871 | iso_pu_bacteria | 2958144490 | 2958147315 | 326 |
| 872 | iso_pu_bacteria | 2958158011 | 2958163727 | 326 |
| 873 | iso_pu_bacteria | 2958165035 | 2958171362 | 326 |
| 874 | iso_pu_bacteria | 2958172287 | 2958174405 | 326 |
| 875 | iso_pu_bacteria | 2958179912 | 2958184212 | 326 |
| 876 | iso_pu_bacteria | 2960584000 | 2960584638 | 326 |
| 877 | iso_pu_bacteria | 2960591022 | 2960596518 | 326 |
| 878 | iso_pu_bacteria | 2960597568 | 2960598428 | 326 |
| 879 | iso_pu_bacteria | 2960603979 | 2960604969 | 326 |
| 880 | iso_pu_bacteria | 2960610863 | 2960613637 | 326 |
| 881 | iso_pu_bacteria | 2960617483 | 2960622159 | 326 |
| 882 | iso_pu_bacteria | 2960624210 | 2960625738 | 326 |
| 883 | iso_pu_bacteria | 2960631154 | 2960634414 | 326 |
| 884 | iso_pu_bacteria | 2960637947 | 2960640718 | 326 |
| 885 | iso_pu_bacteria | 2960645483 | 2960645680 | 326 |
| 886 | iso_pu_bacteria | 2960652885 | 2960658138 | 326 |
| 887 | iso_pu_bacteria | 2960660292 | 2960662774 | 326 |
| 888 | iso_pu_bacteria | 2960667422 | 2960669735 | 326 |
| 889 | iso_pu_bacteria | 2960674078 | 2960680359 | 326 |
| 890 | iso_pu_bacteria | 2960680706 | 2960683357 | 326 |
| 891 | iso_pu_bacteria | 2960687367 | 2960690846 | 326 |
| 892 | iso_pu_bacteria | 2960693952 | 2960695345 | 326 |
| 893 | iso_pu_bacteria | 2961077736 | 2961082267 | 326 |
| 894 | iso_pu_bacteria | 2961114664 | 2961118967 | 326 |
| 895 | iso_pu_bacteria | 2961163497 | 2961169803 | 326 |
| 896 | iso_pu_bacteria | 2961170736 | 2961176370 | 326 |
| 897 | iso_pu_bacteria | 2961183825 | 2961190669 | 326 |
| 898 | iso_pu_bacteria | 2963644680 | 2963645147 | 326 |
| 899 | iso_pu_bacteria | 2964607997 | 2964610802 | 326 |
| 900 | iso_pu_bacteria | 2964615318 | 2964615983 | 326 |
| 901 | iso_pu_bacteria | 2964621998 | 2964624169 | 326 |
| 902 | iso_pu_bacteria | 2964628898 | 2964632527 | 326 |
| 903 | iso_pu_bacteria | 2964636051 | 2964637320 | 326 |
| 904 | iso_pu_bacteria | 2964643177 | 2964644566 | 326 |
| 905 | iso_pu_bacteria | 2964649959 | 2964655586 | 326 |
| 906 | iso_pu_bacteria | 2964656573 | 2964657557 | 326 |
| 907 | iso_pu_bacteria | 2964663802 | 2964666785 | 326 |
| 908 | iso_pu_bacteria | 2964670856 | 2964677160 | 326 |
| 909 | iso_pu_bacteria | 2964678106 | 2964681971 | 326 |
| 910 | iso_pu_bacteria | 2964685014 | 2964685598 | 326 |
| 911 | iso_pu_bacteria | 2964691889 | 2964698601 | 326 |
| 912 | iso_pu_bacteria | 2964698721 | 2964703258 | 326 |
| 913 | iso_pu_bacteria | 2964705432 | 2964711624 | 326 |
| 914 | iso_pu_bacteria | 2964712639 | 2964714036 | 326 |
| 915 | iso_pu_bacteria | 2964719344 | 2964721110 | 326 |
| 916 | iso_pu_bacteria | 2965018300 | 2965024563 | 326 |
| 917 | iso_pu_bacteria | 2965025482 | 2965030161 | 326 |
| 918 | iso_pu_bacteria | 2965032056 | 2965038630 | 326 |
| 919 | iso_pu_bacteria | 2965040258 | 2965044012 | 326 |
| 920 | iso_pu_bacteria | 2965047637 | 2965054737 | 326 |
| 921 | iso_pu_bacteria | 2965062239 | 2965062395 | 326 |
| 922 | iso_pu_bacteria | 2965089291 | 2965096600 | 326 |
| 923 | iso_pu_bacteria | 2965102966 | 2965109871 | 326 |
| 924 | iso_pu_bacteria | 2965119406 | 2965127211 | 326 |
| 925 | iso_pu_bacteria | 2967664464 | 2967669628 | 326 |
| 926 | iso_pu_bacteria | 2967671571 | 2967677047 | 326 |
| 927 | iso_pu_bacteria | 2967678726 | 2967679171 | 326 |
| 928 | iso_pu_bacteria | 2967686174 | 2967692147 | 326 |
| 929 | iso_pu_bacteria | 2967693043 | 2967698842 | 326 |
| 930 | iso_pu_bacteria | 2967699805 | 2967703787 | 326 |
| 931 | iso_pu_bacteria | 2967706974 | 2967708933 | 326 |
| 932 | iso_pu_bacteria | 2967714385 | 2967716966 | 326 |
| 933 | iso_pu_bacteria | 2967721400 | 2967723533 | 326 |
| 934 | iso_pu_bacteria | 2967728569 | 2967728837 | 326 |
| 935 | iso_pu_bacteria | 2967735183 | 2967740671 | 326 |
| 936 | iso_pu_bacteria | 2967742019 | 2967747842 | 326 |
| 937 | iso_pu_bacteria | 2967748971 | 2967750821 | 326 |
| 938 | iso_pu_bacteria | 2967755722 | 2967761857 | 326 |
| 939 | iso_pu_bacteria | 2967762386 | 2967765081 | 326 |
| 940 | iso_pu_bacteria | 2967769361 | 2967772315 | 326 |
| 941 | iso_pu_bacteria | 2967775926 | 2967777583 | 326 |
| 942 | iso_pu_bacteria | 2967996073 | 2967996715 | 326 |
| 943 | iso_pu_bacteria | 2968003550 | 2968004777 | 326 |
| 944 | iso_pu_bacteria | 2968016561 | 2968022989 | 326 |
| 945 | iso_pu_bacteria | 2968083720 | 2968089954 | 326 |
| 946 | iso_pu_bacteria | 2968091066 | 2968093681 | 326 |
| 947 | iso_pu_bacteria | 2968097103 | 2968098511 | 326 |
| 948 | iso_pu_bacteria | 2968110612 | 2968115032 | 326 |
| 949 | iso_pu_bacteria | 2968117919 | 2968122766 | 326 |
| 950 | iso_pu_bacteria | 2968128360 | 2968133886 | 326 |
| 951 | iso_pu_bacteria | 2968138860 | 2968139294 | 326 |
| 952 | iso_pu_bacteria | 2968171901 | 2968178195 | 326 |
| 953 | iso_pu_bacteria | 2970019648 | 2970022409 | 326 |
| 954 | iso_pu_bacteria | 2970026789 | 2970032735 | 326 |
| 955 | iso_pu_bacteria | 2970033650 | 2970039031 | 326 |
| 956 | iso_pu_bacteria | 2970040964 | 2970047131 | 326 |
| 957 | iso_pu_bacteria | 2970047711 | 2970053746 | 326 |
| 958 | iso_pu_bacteria | 2970054988 | 2970058632 | 326 |
| 959 | iso_pu_bacteria | 2970061556 | 2970067940 | 326 |
| 960 | iso_pu_bacteria | 2970068827 | 2970071270 | 326 |
| 961 | iso_pu_bacteria | 2970076120 | 2970078396 | 326 |
| 962 | iso_pu_bacteria | 2970082768 | 2970083953 | 326 |
| 963 | iso_pu_bacteria | 2970088815 | 2970090182 | 326 |
| 964 | iso_pu_bacteria | 2970095765 | 2970097380 | 326 |
| 965 | iso_pu_bacteria | 2970102677 | 2970105645 | 326 |
| 966 | iso_pu_bacteria | 2970109326 | 2970109793 | 326 |
| 967 | iso_pu_bacteria | 2970116247 | 2970121550 | 326 |
| 968 | iso_pu_bacteria | 2970122695 | 2970126651 | 326 |
| 969 | iso_pu_bacteria | 2970129317 | 2970135049 | 326 |
| 970 | iso_pu_bacteria | 2970136068 | 2970143343 | 326 |
| 971 | iso_pu_bacteria | 2970143518 | 2970143929 | 326 |
| 972 | iso_pu_bacteria | 2970149975 | 2970154141 | 326 |
| 973 | iso_pu_bacteria | 2970156795 | 2970162921 | 326 |
| 974 | iso_pu_bacteria | 2970164137 | 2970167733 | 326 |
| 975 | iso_pu_bacteria | 2970170962 | 2970176659 | 326 |
| 976 | iso_pu_bacteria | 2970177841 | 2970179509 | 326 |
| 977 | iso_pu_bacteria | 2970184632 | 2970188381 | 326 |
| 978 | iso_pu_bacteria | 2970191845 | 2970194646 | 326 |
| 979 | iso_pu_bacteria | 2970469710 | 2970475574 | 326 |
| 980 | iso_pu_bacteria | 2970489779 | 2970492395 | 326 |
| 981 | iso_pu_bacteria | 2970503327 | 2970509041 | 326 |
| 982 | iso_pu_bacteria | 2970510686 | 2970510880 | 326 |
| 983 | iso_pu_bacteria | 2970524798 | 2970525894 | 326 |
| 984 | iso_pu_bacteria | 2970540015 | 2970544445 | 326 |
| 985 | iso_pu_bacteria | 2970547951 | 2970550137 | 326 |
| 986 | iso_pu_bacteria | 2970554993 | 2970561041 | 326 |
| 987 | iso_pu_bacteria | 2970593180 | 2970599287 | 326 |
| 988 | iso_pu_bacteria | 2970619444 | 2970623878 | 326 |
| 989 | iso_pu_bacteria | 2970627176 | 2970628677 | 326 |
| 990 | iso_pu_bacteria | 2977516862 | 2977518893 | 326 |
| 991 | iso_pu_bacteria | 2977523885 | 2977524038 | 326 |
| 992 | iso_pu_bacteria | 2977523885 | 2977524055 | 326 |
| 993 | iso_pu_bacteria | 2977530762 | 2977532688 | 326 |
| 994 | iso_pu_bacteria | 2977537788 | 2977540078 | 326 |
| 995 | iso_pu_bacteria | 2977544691 | 2977547943 | 326 |
| 996 | iso_pu_bacteria | 2977551784 | 2977557363 | 326 |
| 997 | iso_pu_bacteria | 2977558990 | 2977559600 | 326 |
| 998 | iso_pu_bacteria | 2977565890 | 2977570915 | 326 |
| 999 | iso_pu_bacteria | 2977572785 | 2977579252 | 326 |
| 1000 | iso_pu_bacteria | 2977579622 | 2977585265 | 326 |
| 1001 | iso_pu_bacteria | 2977821940 | 2977823527 | 326 |
| 1002 | iso_pu_bacteria | 2977828996 | 2977835404 | 326 |
| 1003 | iso_pu_bacteria | 2977843712 | 2977850364 | 326 |
| 1004 | iso_pu_bacteria | 2977851361 | 2977855241 | 326 |
| 1005 | iso_pu_bacteria | 2977864932 | 2977870237 | 326 |
| 1006 | iso_pu_bacteria | 2977907340 | 2977911561 | 326 |
| 1007 | iso_pu_bacteria | 2977915119 | 2977919642 | 326 |
| 1008 | iso_pu_bacteria | 2977922695 | 2977925724 | 326 |
| 1009 | iso_pu_bacteria | 2977935797 | 2977938201 | 326 |
| 1010 | iso_pu_bacteria | 2977942078 | 2977943450 | 326 |
| 1011 | iso_pu_bacteria | 2977950692 | 2977954488 | 326 |
| 1012 | iso_pu_bacteria | 2977957713 | 2977965264 | 326 |
| 1013 | iso_pu_bacteria | 2977971508 | 2977977548 | 326 |
| 1014 | iso_pu_bacteria | 2977986579 | 2977987137 | 326 |
| 1015 | iso_pu_bacteria | 2979089926 | 2979090715 | 326 |
| 1016 | iso_pu_bacteria | 2979095461 | 2979096238 | 326 |
| 1017 | iso_pu_bacteria | 2979100975 | 2979101764 | 326 |
| 1018 | iso_pu_bacteria | 2979710463 | 2979714683 | 326 |
| 1019 | iso_pu_bacteria | 2979742915 | 2979746477 | 326 |
| 1020 | iso_pu_bacteria | 2979764755 | 2979769026 | 326 |
| 1021 | iso_pu_bacteria | 2979772303 | 2979774345 | 326 |
| 1022 | iso_pu_bacteria | 2979779861 | 2979781797 | 326 |
| 1023 | iso_pu_bacteria | 2979793036 | 2979798627 | 326 |
| 1024 | iso_pu_bacteria | 2979808191 | 2979813720 | 326 |
| 1025 | iso_pu_bacteria | 2984509177 | 2984510283 | 326 |
| 1026 | iso_pu_bacteria | 2984518228 | 2984519012 | 326 |
| 1027 | iso_pu_bacteria | 2984537506 | 2984538632 | 326 |
| 1028 | iso_pu_bacteria | 2984601300 | 2984605340 | 326 |
| 1029 | iso_pu_bacteria | 2987636660 | 2987641421 | 326 |
| 1030 | iso_pu_bacteria | 2987652177 | 2987656407 | 326 |
| 1031 | iso_pu_bacteria | 2987659509 | 2987666027 | 326 |
| 1032 | iso_pu_bacteria | 2987666974 | 2987669347 | 326 |
| 1033 | iso_pu_bacteria | 2987673487 | 2987675260 | 326 |
| 1034 | iso_pu_bacteria | 2989349275 | 2989350142 | 326 |
| 1035 | iso_pu_bacteria | 2989771324 | 2989773280 | 326 |
| 1036 | iso_pu_bacteria | 2989776772 | 2989777518 | 326 |
| 1037 | iso_pu_bacteria | 2989776772 | 2989780531 | 326 |
| 1038 | iso_pu_bacteria | 2995392953 | 2995394713 | 326 |
| 1039 | iso_pu_bacteria | 2996310559 | 2996313987 | 326 |
| 1040 | iso_pu_bacteria | 2996341866 | 2996342432 | 326 |
| 1041 | iso_pu_bacteria | 2996386984 | 2996387511 | 326 |
| 1042 | iso_pu_bacteria | 2996887358 | 2996892734 | 326 |
| 1043 | iso_pu_bacteria | 2996893221 | 2996897959 | 326 |
| 1044 | iso_pu_bacteria | 3000135777 | 3000137170 | 326 |
| 1045 | iso_pu_bacteria | 3003930520 | 3003935459 | 326 |
| 1046 | iso_pu_bacteria | 3004167301 | 3004173036 | 326 |
| 1047 | iso_pu_bacteria | 3004188549 | 3004195050 | 326 |
| 1048 | iso_pu_bacteria | 3004195979 | 3004202819 | 326 |
| 1049 | iso_pu_bacteria | 3004203850 | 3004210230 | 326 |
| 1050 | iso_pu_bacteria | 3004211236 | 3004217262 | 326 |
| 1051 | iso_pu_bacteria | 3004218560 | 3004220472 | 326 |
| 1052 | iso_pu_bacteria | 3004232784 | 3004233462 | 326 |
| 1053 | iso_pu_bacteria | 3004239961 | 3004245835 | 326 |
| 1054 | iso_pu_bacteria | 3004268573 | 3004275069 | 326 |
| 1055 | iso_pu_bacteria | 3004334049 | 3004337589 | 326 |
| 1056 | iso_pu_bacteria | 3005409236 | 3005414254 | 326 |
| 1057 | iso_pu_bacteria | 3005416602 | 3005418880 | 326 |
| 1058 | iso_pu_bacteria | 3005445848 | 3005448768 | 326 |
| 1059 | iso_pu_bacteria | 3005452660 | 3005455000 | 326 |
| 1060 | iso_pu_bacteria | 637000159 | 637077205 | 326 |
| 1061 | iso_pu_bacteria | 639633055 | 639649498 | 326 |
| 1062 | iso_pu_bacteria | 643692032 | 643826614 | 326 |
| 1063 | iso_pu_bacteria | 648276728 | 648739884 | 326 |
| 1064 | iso_pu_bacteria | 649633066 | 649870369 | 326 |
| 1065 | iso_pu_bacteria | 650716007 | 650843646 | 326 |
| 1066 | iso_pu_bacteria | 8002285264 | 8002291744 | 326 |
| 1067 | iso_pu_bacteria | 8003570095 | 8003574090 | 326 |
| 1068 | iso_pu_bacteria | 8003992118 | 8003996243 | 326 |
| 1069 | iso_pu_bacteria | 8003999396 | 8004004000 | 326 |
| 1070 | iso_pu_bacteria | 8004300914 | 8004304035 | 326 |
| 1071 | iso_pu_bacteria | 8004312739 | 8004315498 | 326 |
| 1072 | iso_pu_bacteria | 8004361976 | 8004364816 | 326 |
| 1073 | iso_pu_bacteria | 8004374579 | 8004375889 | 326 |
| 1074 | iso_pu_bacteria | 8004387939 | 8004393072 | 326 |
| 1075 | iso_pu_bacteria | 8004395343 | 8004402523 | 326 |
| 1076 | iso_pu_bacteria | 8004445564 | 8004452201 | 326 |
| 1077 | iso_pu_bacteria | 8004633249 | 8004638402 | 326 |
| 1078 | iso_pu_bacteria | 8004640170 | 8004641560 | 326 |
| 1079 | iso_pu_bacteria | 8004703790 | 8004706834 | 326 |
| 1080 | iso_pu_bacteria | 8004714634 | 8004719859 | 326 |
| 1081 | iso_pu_bacteria | 8004727605 | 8004734837 | 326 |
| 1082 | iso_pu_bacteria | 8005246636 | 8005250311 | 326 |
| 1083 | iso_pu_bacteria | 8005258706 | 8005259499 | 326 |
| 1084 | iso_pu_bacteria | 8005275841 | 8005281543 | 326 |
| 1085 | iso_pu_bacteria | 8005282627 | 8005284500 | 326 |
| 1086 | iso_pu_bacteria | 8005289223 | 8005295830 | 326 |
| 1087 | iso_pu_bacteria | 8005301065 | 8005303437 | 326 |
| 1088 | iso_pu_bacteria | 8005307578 | 8005313917 | 326 |
| 1089 | iso_pu_bacteria | 8005314921 | 8005318228 | 326 |
| 1090 | iso_pu_bacteria | 8005321885 | 8005327261 | 326 |
| 1091 | iso_pu_bacteria | 8005376324 | 8005381243 | 326 |
| 1092 | iso_pu_bacteria | 8005382845 | 8005384743 | 326 |
| 1093 | iso_pu_bacteria | 8005395548 | 8005395780 | 326 |
| 1094 | iso_pu_bacteria | 8005430974 | 8005435583 | 326 |
| 1095 | iso_pu_bacteria | 8005460587 | 8005464124 | 326 |
| 1096 | iso_pu_bacteria | 8005484373 | 8005488894 | 326 |
| 1097 | iso_pu_bacteria | 8005497431 | 8005501211 | 326 |
| 1098 | iso_pu_bacteria | 8005542996 | 8005545999 | 326 |
| 1099 | iso_pu_bacteria | 8005556819 | 8005561536 | 326 |
| 1100 | iso_pu_bacteria | 8005563573 | 8005568314 | 326 |
| 1101 | iso_pu_bacteria | 8005570704 | 8005573148 | 326 |
| 1102 | iso_pu_bacteria | 8005619151 | 8005622578 | 326 |
| 1103 | iso_pu_bacteria | 8005626139 | 8005630080 | 326 |
| 1104 | iso_pu_bacteria | 8005645114 | 8005645978 | 326 |
| 1105 | iso_pu_bacteria | 8005682033 | 8005682585 | 326 |
| 1106 | iso_pu_bacteria | 8005688590 | 8005691791 | 326 |
| 1107 | iso_pu_bacteria | 8005695170 | 8005697733 | 326 |
| 1108 | iso_pu_bacteria | 8006926726 | 8006932633 | 326 |
| 1109 | iso_pu_bacteria | 8018127388 | 8018127455 | 326 |
| 1110 | iso_pu_bacteria | 8018150411 | 8018150970 | 326 |
| 1111 | iso_pu_bacteria | 8018163183 | 8018164250 | 326 |
| 1112 | iso_pu_bacteria | 8018176218 | 8018179564 | 326 |
| 1113 | iso_pu_bacteria | 8019648815 | 8019658859 | 326 |
| 1114 | iso_pu_bacteria | 8023680758 | 8023682849 | 326 |
| 1115 | iso_pu_bacteria | 8024479707 | 8024486259 | 326 |
| 1116 | iso_pu_bacteria | 8024486573 | 8024488346 | 326 |
| 1117 | iso_pu_bacteria | 8024501048 | 8024504755 | 326 |
| 1118 | iso_pu_bacteria | 8046767195 | 8046770527 | 326 |
| 1119 | iso_pu_bacteria | 8049293176 | 8049295583 | 326 |
| 1120 | iso_pu_bacteria | 8049293176 | 8049298861 | 326 |
| 1121 | iso_pu_bacteria | 8054460903 | 8054465303 | 326 |
| 1122 | iso_pu_bacteria | 8054558443 | 8054561942 | 326 |
| 1123 | iso_pu_bacteria | 8055617313 | 8055617707 | 326 |
| 1124 | iso_pu_bacteria | 8056375014 | 8056377520 | 326 |
| 1125 | iso_pu_bacteria | 8056382006 | 8056387228 | 326 |
| 1126 | iso_pu_bacteria | 8056967851 | 8056968625 | 326 |
| 1127 | iso_pu_bacteria | 8057575449 | 8057576655 | 326 |
| 1128 | iso_pu_bacteria | 8057874678 | 8057882025 | 326 |
| 1129 | 3300003781 | Ga0055536_1006866 | Ga0055536_10068664 | 327 |
| 1130 | 3300005354 | Ga0070675_100104576 | Ga0070675_1001045763 | 327 |
| 1131 | 3300009094 | Ga0111539_10023692 | Ga0111539_100236922 | 327 |
| 1132 | 3300013105 | Ga0157369_10330089 | Ga0157369_103300892 | 327 |
| 1133 | 3300025292 | Ga0209676_1000300 | Ga0209676_100030048 | 327 |
| 1134 | 3300025298 | Ga0209050_1026405 | Ga0209050_10264052 | 327 |
| 1135 | 3300027907 | Ga0207428_10253406 | Ga0207428_102534062 | 327 |
| 1136 | 3300037853 | Ga0436364_1130693 | Ga0436364_1130693_58_1050 | 327 |
| 1137 | 3300049569 | Ga0501032_0064798 | Ga0501032_0064798_946_1941 | 327 |
| 1138 | 3300049570 | Ga0501033_0006590 | Ga0501033_0006590_4797_5792 | 327 |
| 1139 | 3300049571 | Ga0501034_0052163 | Ga0501034_0052163_2181_3176 | 327 |
| 1140 | 3300049574 | Ga0501038_0013672 | Ga0501038_0013672_168_1163 | 327 |
| 1141 | 3300049575 | Ga0501039_0015661 | Ga0501039_0015661_3336_4331 | 327 |
| 1142 | 3300049575 | Ga0501039_0190371 | Ga0501039_0190371_167_1162 | 327 |
| 1143 | 3300049579 | Ga0501043_0234804 | Ga0501043_0234804_18_1013 | 327 |
| 1144 | 3300049580 | Ga0501046_0108020 | Ga0501046_0108020_1079_2074 | 327 |
| 1145 | 3300049580 | Ga0501046_0233102 | Ga0501046_0233102_213_1208 | 327 |
| 1146 | 3300049581 | Ga0501047_0100030 | Ga0501047_0100030_337_1332 | 327 |
| 1147 | 3300049581 | Ga0501047_0123583 | Ga0501047_0123583_481_1476 | 327 |
| 1148 | 3300049581 | Ga0501047_0230545 | Ga0501047_0230545_69_1064 | 327 |
| 1149 | 3300049582 | Ga0501048_0037725 | Ga0501048_0037725_1110_2105 | 327 |
| 1150 | 3300049582 | Ga0501048_0072598 | Ga0501048_0072598_314_1309 | 327 |
| 1151 | 3300049582 | Ga0501048_0195843 | Ga0501048_0195843_209_1204 | 327 |
| 1152 | 3300049583 | Ga0501067_0056370 | Ga0501067_0056370_578_1573 | 327 |
| 1153 | 3300049583 | Ga0501067_0120288 | Ga0501067_0120288_301_1296 | 327 |
| 1154 | 3300049584 | Ga0501068_0066759 | Ga0501068_0066759_353_1348 | 327 |
| 1155 | 3300049586 | Ga0501070_0068526 | Ga0501070_0068526_1479_2474 | 327 |
| 1156 | 3300049586 | Ga0501070_0069127 | Ga0501070_0069127_325_1320 | 327 |
| 1157 | 3300049589 | Ga0501073_0084925 | Ga0501073_0084925_27_1022 | 327 |
| 1158 | 3300049590 | Ga0501074_0031138 | Ga0501074_0031138_1971_2966 | 327 |
| 1159 | 3300049592 | Ga0501076_0110323 | Ga0501076_0110323_979_1974 | 327 |
| 1160 | 3300049742 | Ga0501080_0014162 | Ga0501080_0014162_4538_5533 | 327 |
| 1161 | 3300049744 | Ga0501083_0010520 | Ga0501083_0010520_2127_3122 | 327 |
| 1162 | 3300049822 | Ga0501035_0291825 | Ga0501035_0291825_219_1214 | 327 |
| 1163 | 3300049823 | Ga0501044_0019083 | Ga0501044_0019083_6319_7314 | 327 |
| 1164 | 3300049823 | Ga0501044_0034463 | Ga0501044_0034463_204_1199 | 327 |
| 1165 | 3300049823 | Ga0501044_0137519 | Ga0501044_0137519_1121_2116 | 327 |
| 1166 | 3300050511 | nmdc:mga08y16_207702_c1 | nmdc:mga08y16_207702_c1_224_1207 | 327 |
| 1167 | 3300054114 | Ga0501084_0017035 | Ga0501084_0017035_4747_5742 | 327 |
| 1168 | 3300060353 | Ga0501082_0042195 | Ga0501082_0042195_1817_2812 | 327 |
| 1169 | 3300003762 | Ga0055542_1009118 | Ga0055542_10091182 | 328 |
| 1170 | 3300005327 | Ga0070658_10267132 | Ga0070658_102671322 | 328 |
| 1171 | 3300005459 | Ga0068867_100142145 | Ga0068867_1001421452 | 328 |
| 1172 | 3300005564 | Ga0070664_100037537 | Ga0070664_1000375373 | 328 |
| 1173 | 3300006038 | Ga0075365_10006255 | Ga0075365_100062554 | 328 |
| 1174 | 3300006051 | Ga0075364_10005164 | Ga0075364_100051645 | 328 |
| 1175 | 3300006186 | Ga0075369_10028100 | Ga0075369_100281001 | 328 |
| 1176 | 3300006353 | Ga0075370_10004915 | Ga0075370_100049153 | 328 |
| 1177 | 3300009093 | Ga0105240_10114335 | Ga0105240_101143353 | 328 |
| 1178 | 3300009545 | Ga0105237_10161699 | Ga0105237_101616992 | 328 |
| 1179 | 3300010375 | Ga0105239_10153248 | Ga0105239_101532482 | 328 |
| 1180 | 3300021384 | Ga0213876_10043875 | Ga0213876_100438751 | 328 |
| 1181 | 3300025913 | Ga0207695_10064942 | Ga0207695_100649422 | 328 |
| 1182 | 3300025933 | Ga0207706_10004852 | Ga0207706_100048529 | 328 |
| 1183 | 3300025935 | Ga0207709_10070629 | Ga0207709_100706292 | 328 |
| 1184 | 3300025945 | Ga0207679_10261820 | Ga0207679_102618202 | 328 |
| 1185 | 3300025986 | Ga0207658_10065037 | Ga0207658_100650372 | 328 |
| 1186 | 3300026041 | Ga0207639_10201713 | Ga0207639_102017131 | 328 |
| 1187 | 3300026089 | Ga0207648_10143703 | Ga0207648_101437032 | 328 |
| 1188 | 3300031456 | Ga0307513_10083898 | Ga0307513_100838983 | 328 |
| 1189 | 3300031548 | Ga0307408_100022636 | Ga0307408_1000226363 | 328 |
| 1190 | 3300031901 | Ga0307406_10106957 | Ga0307406_101069572 | 328 |
| 1191 | 3300031903 | Ga0307407_10079643 | Ga0307407_100796432 | 328 |
| 1192 | 3300035398 | Ga0316574_0027919 | Ga0316574_0027919_231_1229 | 328 |
| 1193 | 3300038725 | Ga0400484_40515 | Ga0400484_40515_1120_2133 | 328 |
| 1194 | 3300038742 | Ga0400486_25732 | Ga0400486_25732_1305_2318 | 328 |
| 1195 | 3300039437 | Ga0436365_1547706 | Ga0436365_1547706_151_1137 | 328 |
| 1196 | 3300039438 | Ga0436360_0960231 | Ga0436360_0960231_927_1913 | 328 |
| 1197 | 3300039447 | Ga0436361_0290928 | Ga0436361_0290928_1586_2575 | 328 |
| 1198 | 3300039450 | Ga0436363_0280076 | Ga0436363_0280076_1226_2215 | 328 |
| 1199 | 3300044658 | Ga0466972_0016192 | Ga0466972_0016192_2337_3326 | 328 |
| 1200 | 3300044842 | Ga0466957_0077697 | Ga0466957_0077697_50_1042 | 328 |
| 1201 | 3300046512 | Ga0495610_0059015 | Ga0495610_0059015_448_1446 | 328 |
| 1202 | 3300046616 | Ga0495668_0032094 | Ga0495668_0032094_17_1003 | 328 |
| 1203 | 3300048923 | Ga0496120_0001458 | Ga0496120_0001458_3176_4171 | 328 |
| 1204 | 3300049569 | Ga0501032_0006865 | Ga0501032_0006865_5474_6475 | 328 |
| 1205 | 3300049571 | Ga0501034_0073266 | Ga0501034_0073266_1512_2513 | 328 |
| 1206 | 3300049571 | Ga0501034_0340606 | Ga0501034_0340606_288_1286 | 328 |
| 1207 | 3300049572 | Ga0501036_0042543 | Ga0501036_0042543_2245_3246 | 328 |
| 1208 | 3300049574 | Ga0501038_0068912 | Ga0501038_0068912_1196_2197 | 328 |
| 1209 | 3300049575 | Ga0501039_0015913 | Ga0501039_0015913_2316_3317 | 328 |
| 1210 | 3300049579 | Ga0501043_0002095 | Ga0501043_0002095_4037_5035 | 328 |
| 1211 | 3300049581 | Ga0501047_0002673 | Ga0501047_0002673_3292_4290 | 328 |
| 1212 | 3300049581 | Ga0501047_0059646 | Ga0501047_0059646_2574_3572 | 328 |
| 1213 | 3300049582 | Ga0501048_0310847 | Ga0501048_0310847_39_1037 | 328 |
| 1214 | 3300049583 | Ga0501067_0028463 | Ga0501067_0028463_676_1677 | 328 |
| 1215 | 3300049585 | Ga0501069_0008694 | Ga0501069_0008694_3170_4171 | 328 |
| 1216 | 3300049586 | Ga0501070_0000313 | Ga0501070_0000313_18092_19090 | 328 |
| 1217 | 3300049589 | Ga0501073_0121049 | Ga0501073_0121049_138_1124 | 328 |
| 1218 | 3300049742 | Ga0501080_0000128 | Ga0501080_0000128_39242_40240 | 328 |
| 1219 | 3300049742 | Ga0501080_0027719 | Ga0501080_0027719_385_1386 | 328 |
| 1220 | 3300049744 | Ga0501083_0087623 | Ga0501083_0087623_123_1121 | 328 |
| 1221 | 3300049823 | Ga0501044_0089823 | Ga0501044_0089823_505_1506 | 328 |
| 1222 | 3300049823 | Ga0501044_0097372 | Ga0501044_0097372_1887_2885 | 328 |
| 1223 | 3300050491 | nmdc:mga00v17_20007_c1 | nmdc:mga00v17_20007_c1_1598_2587 | 328 |
| 1224 | 3300050496 | nmdc:mga07m45_5169_c1 | nmdc:mga07m45_5169_c1_5354_6343 | 328 |
| 1225 | 3300053109 | Ga0500569_012531 | Ga0500569_012531_350_1348 | 328 |
| 1226 | 3300053177 | Ga0500636_0015051 | Ga0500636_0015051_593_1591 | 328 |
| 1227 | 3300054114 | Ga0501084_0007726 | Ga0501084_0007726_4840_5838 | 328 |
| 1228 | 3300060353 | Ga0501082_0126927 | Ga0501082_0126927_701_1702 | 328 |
| 1229 | 3300002705 | JGI25156J39149_1010500 | JGI25156J39149_10105002 | 329 |
| 1230 | 3300002741 | JGI25157J39369_1000647 | JGI25157J39369_100064711 | 329 |
| 1231 | 3300003214 | JGI25165J46597_1000078 | JGI25165J46597_1000078101 | 329 |
| 1232 | 3300003781 | Ga0055536_1009791 | Ga0055536_10097913 | 329 |
| 1233 | 3300003790 | Ga0055528_1002280 | Ga0055528_10022806 | 329 |
| 1234 | 3300005367 | Ga0070667_100259791 | Ga0070667_1002597912 | 329 |
| 1235 | 3300005468 | Ga0070707_100047434 | Ga0070707_1000474342 | 329 |
| 1236 | 3300005539 | Ga0068853_100052482 | Ga0068853_1000524823 | 329 |
| 1237 | 3300005548 | Ga0070665_100125686 | Ga0070665_1001256863 | 329 |
| 1238 | 3300005577 | Ga0068857_100390461 | Ga0068857_1003904612 | 329 |
| 1239 | 3300005617 | Ga0068859_100226096 | Ga0068859_1002260962 | 329 |
| 1240 | 3300006048 | Ga0075363_100021836 | Ga0075363_1000218363 | 329 |
| 1241 | 3300006177 | Ga0075362_10008658 | Ga0075362_100086583 | 329 |
| 1242 | 3300006177 | Ga0075362_10080238 | Ga0075362_100802382 | 329 |
| 1243 | 3300006178 | Ga0075367_10016682 | Ga0075367_100166821 | 329 |
| 1244 | 3300006195 | Ga0075366_10098274 | Ga0075366_100982742 | 329 |
| 1245 | 3300006881 | Ga0068865_100124914 | Ga0068865_1001249142 | 329 |
| 1246 | 3300006931 | Ga0097620_100226094 | Ga0097620_1002260942 | 329 |
| 1247 | 3300009093 | Ga0105240_10010969 | Ga0105240_100109695 | 329 |
| 1248 | 3300009093 | Ga0105240_10047959 | Ga0105240_100479592 | 329 |
| 1249 | 3300009093 | Ga0105240_10120900 | Ga0105240_101209003 | 329 |
| 1250 | 3300009098 | Ga0105245_10133991 | Ga0105245_101339912 | 329 |
| 1251 | 3300009545 | Ga0105237_10032245 | Ga0105237_100322455 | 329 |
| 1252 | 3300009545 | Ga0105237_10038932 | Ga0105237_100389324 | 329 |
| 1253 | 3300009551 | Ga0105238_10015974 | Ga0105238_100159743 | 329 |
| 1254 | 3300009551 | Ga0105238_10452502 | Ga0105238_104525021 | 329 |
| 1255 | 3300009766 | Ga0123342_1028788 | Ga0123342_10287882 | 329 |
| 1256 | 3300010375 | Ga0105239_10000108 | Ga0105239_1000010893 | 329 |
| 1257 | 3300010375 | Ga0105239_10122340 | Ga0105239_101223403 | 329 |
| 1258 | 3300010375 | Ga0105239_10161994 | Ga0105239_101619942 | 329 |
| 1259 | 3300013105 | Ga0157369_10150925 | Ga0157369_101509253 | 329 |
| 1260 | 3300013105 | Ga0157369_10336235 | Ga0157369_103362352 | 329 |
| 1261 | 3300013308 | Ga0157375_10552081 | Ga0157375_105520811 | 329 |
| 1262 | 3300025250 | Ga0209026_1000151 | Ga0209026_100015148 | 329 |
| 1263 | 3300025256 | Ga0209759_1000350 | Ga0209759_100035054 | 329 |
| 1264 | 3300025261 | Ga0209233_1000150 | Ga0209233_100015081 | 329 |
| 1265 | 3300025273 | Ga0209673_1002172 | Ga0209673_10021729 | 329 |
| 1266 | 3300025292 | Ga0209676_1006115 | Ga0209676_10061156 | 329 |
| 1267 | 3300025294 | Ga0209025_1009032 | Ga0209025_10090327 | 329 |
| 1268 | 3300025295 | Ga0209564_1023190 | Ga0209564_10231902 | 329 |
| 1269 | 3300025297 | Ga0209758_1000130 | Ga0209758_1000130141 | 329 |
| 1270 | 3300025297 | Ga0209758_1003416 | Ga0209758_100341611 | 329 |
| 1271 | 3300025297 | Ga0209758_1005604 | Ga0209758_10056046 | 329 |
| 1272 | 3300025297 | Ga0209758_1009728 | Ga0209758_10097282 | 329 |
| 1273 | 3300025299 | Ga0209256_1003516 | Ga0209256_10035166 | 329 |
| 1274 | 3300025302 | Ga0207426_1000511 | Ga0207426_100051146 | 329 |
| 1275 | 3300025304 | Ga0209257_1001148 | Ga0209257_100114820 | 329 |
| 1276 | 3300025913 | Ga0207695_10011688 | Ga0207695_100116885 | 329 |
| 1277 | 3300025913 | Ga0207695_10159132 | Ga0207695_101591322 | 329 |
| 1278 | 3300025922 | Ga0207646_10130835 | Ga0207646_101308352 | 329 |
| 1279 | 3300025924 | Ga0207694_10017681 | Ga0207694_100176815 | 329 |
| 1280 | 3300025924 | Ga0207694_10208538 | Ga0207694_102085382 | 329 |
| 1281 | 3300025938 | Ga0207704_10228189 | Ga0207704_102281892 | 329 |
| 1282 | 3300025986 | Ga0207658_10218541 | Ga0207658_102185412 | 329 |
| 1283 | 3300026041 | Ga0207639_10013742 | Ga0207639_100137423 | 329 |
| 1284 | 3300026078 | Ga0207702_10189687 | Ga0207702_101896872 | 329 |
| 1285 | 3300028794 | Ga0307515_10000285 | Ga0307515_1000028534 | 329 |
| 1286 | 3300028794 | Ga0307515_10111250 | Ga0307515_101112502 | 329 |
| 1287 | 3300031507 | Ga0307509_10053450 | Ga0307509_100534504 | 329 |
| 1288 | 3300031616 | Ga0307508_10000430 | Ga0307508_1000043045 | 329 |
| 1289 | 3300031616 | Ga0307508_10012324 | Ga0307508_100123244 | 329 |
| 1290 | 3300031616 | Ga0307508_10068533 | Ga0307508_100685332 | 329 |
| 1291 | 3300035695 | Ga0373927_0000245 | Ga0373927_0000245_30863_31852 | 329 |
| 1292 | 3300037068 | Ga0373925_0003713 | Ga0373925_0003713_3747_4736 | 329 |
| 1293 | 3300037418 | Ga0395900_0029099 | Ga0395900_0029099_4194_5186 | 329 |
| 1294 | 3300037418 | Ga0395900_0207837 | Ga0395900_0207837_10_1002 | 329 |
| 1295 | 3300037471 | Ga0395905_0007581 | Ga0395905_0007581_9361_10389 | 329 |
| 1296 | 3300037471 | Ga0395905_0009048 | Ga0395905_0009048_7487_8476 | 329 |
| 1297 | 3300037471 | Ga0395905_0013886 | Ga0395905_0013886_6500_7489 | 329 |
| 1298 | 3300037471 | Ga0395905_0020532 | Ga0395905_0020532_3872_4864 | 329 |
| 1299 | 3300037471 | Ga0395905_0054804 | Ga0395905_0054804_1500_2492 | 329 |
| 1300 | 3300037471 | Ga0395905_0095843 | Ga0395905_0095843_742_1734 | 329 |
| 1301 | 3300038443 | Ga0395901_0014960 | Ga0395901_0014960_1042_2034 | 329 |
| 1302 | 3300038443 | Ga0395901_0031758 | Ga0395901_0031758_1228_2220 | 329 |
| 1303 | 3300038725 | Ga0400484_20998 | Ga0400484_20998_987_1976 | 329 |
| 1304 | 3300038726 | Ga0400490_38094 | Ga0400490_38094_8503_9492 | 329 |
| 1305 | 3300038727 | Ga0400491_13401 | Ga0400491_13401_1196_2185 | 329 |
| 1306 | 3300039062 | Ga0400483_247668 | Ga0400483_247668_17040_18029 | 329 |
| 1307 | 3300039110 | Ga0400487_11494 | Ga0400487_11494_94_1083 | 329 |
| 1308 | 3300039110 | Ga0400487_13197 | Ga0400487_13197_12302_13291 | 329 |
| 1309 | 3300041404 | Ga0439436_0048435 | Ga0439436_0048435_19_1011 | 329 |
| 1310 | 3300041413 | Ga0439465_0037731 | Ga0439465_0037731_95_1087 | 329 |
| 1311 | 3300041498 | Ga0451841_0340568 | Ga0451841_0340568_219_1211 | 329 |
| 1312 | 3300041507 | Ga0451851_1012485 | Ga0451851_1012485_324_1316 | 329 |
| 1313 | 3300041512 | Ga0451853_3094484 | Ga0451853_3094484_474_1466 | 329 |
| 1314 | 3300042007 | Ga0439449_0009295 | Ga0439449_0009295_2369_3361 | 329 |
| 1315 | 3300046471 | Ga0495650_0064423 | Ga0495650_0064423_231_1223 | 329 |
| 1316 | 3300046474 | Ga0495605_0015829 | Ga0495605_0015829_2200_3192 | 329 |
| 1317 | 3300046501 | Ga0495607_0016552 | Ga0495607_0016552_759_1751 | 329 |
| 1318 | 3300046501 | Ga0495607_0023263 | Ga0495607_0023263_1145_2137 | 329 |
| 1319 | 3300046501 | Ga0495607_0062768 | Ga0495607_0062768_908_1900 | 329 |
| 1320 | 3300046515 | Ga0495620_0012292 | Ga0495620_0012292_310_1302 | 329 |
| 1321 | 3300046518 | Ga0495631_0016798 | Ga0495631_0016798_2298_3290 | 329 |
| 1322 | 3300046519 | Ga0495632_0016392 | Ga0495632_0016392_3071_4063 | 329 |
| 1323 | 3300046520 | Ga0495637_0003753 | Ga0495637_0003753_861_1853 | 329 |
| 1324 | 3300046522 | Ga0495643_0001039 | Ga0495643_0001039_12165_13157 | 329 |
| 1325 | 3300046525 | Ga0495663_0025419 | Ga0495663_0025419_382_1374 | 329 |
| 1326 | 3300046530 | Ga0495654_0017636 | Ga0495654_0017636_1328_2320 | 329 |
| 1327 | 3300046538 | Ga0495609_0003026 | Ga0495609_0003026_3119_4111 | 329 |
| 1328 | 3300046538 | Ga0495609_0018475 | Ga0495609_0018475_429_1421 | 329 |
| 1329 | 3300046558 | Ga0495633_0034951 | Ga0495633_0034951_39_1031 | 329 |
| 1330 | 3300046660 | Ga0495625_0004663 | Ga0495625_0004663_5785_6777 | 329 |
| 1331 | 3300046660 | Ga0495625_0015174 | Ga0495625_0015174_3683_4675 | 329 |
| 1332 | 3300046674 | Ga0495588_0005393 | Ga0495588_0005393_4538_5530 | 329 |
| 1333 | 3300046692 | Ga0495671_0154940 | Ga0495671_0154940_20_1012 | 329 |
| 1334 | 3300046694 | Ga0495649_0010787 | Ga0495649_0010787_583_1575 | 329 |
| 1335 | 3300047318 | Ga0495636_0022191 | Ga0495636_0022191_140_1132 | 329 |
| 1336 | 3300047323 | Ga0495683_0142301 | Ga0495683_0142301_71_1063 | 329 |
| 1337 | 3300047443 | Ga0495687_003786 | Ga0495687_003786_49_1041 | 329 |
| 1338 | 3300047446 | Ga0495679_043826 | Ga0495679_043826_166_1158 | 329 |
| 1339 | 3300047469 | Ga0495673_0052838 | Ga0495673_0052838_353_1345 | 329 |
| 1340 | 3300047470 | Ga0495681_0002912 | Ga0495681_0002912_2080_3072 | 329 |
| 1341 | 3300047470 | Ga0495681_0039636 | Ga0495681_0039636_982_1974 | 329 |
| 1342 | 3300048905 | Ga0496102_0002097 | Ga0496102_0002097_11969_12961 | 329 |
| 1343 | 3300048915 | Ga0496112_0232458 | Ga0496112_0232458_457_1449 | 329 |
| 1344 | 3300048919 | Ga0496116_0000026 | Ga0496116_0000026_110497_111489 | 329 |
| 1345 | 3300048920 | Ga0496117_0000674 | Ga0496117_0000674_30107_31099 | 329 |
| 1346 | 3300048920 | Ga0496117_0070009 | Ga0496117_0070009_655_1647 | 329 |
| 1347 | 3300048921 | Ga0496118_0001442 | Ga0496118_0001442_23423_24415 | 329 |
| 1348 | 3300048922 | Ga0496119_0000887 | Ga0496119_0000887_16265_17257 | 329 |
| 1349 | 3300048923 | Ga0496120_0000724 | Ga0496120_0000724_24855_25847 | 329 |
| 1350 | 3300048923 | Ga0496120_0001956 | Ga0496120_0001956_2413_3405 | 329 |
| 1351 | 3300048924 | Ga0496121_0000991 | Ga0496121_0000991_26373_27365 | 329 |
| 1352 | 3300048925 | Ga0496122_0009607 | Ga0496122_0009607_6226_7218 | 329 |
| 1353 | 3300048925 | Ga0496122_0046010 | Ga0496122_0046010_1238_2230 | 329 |
| 1354 | 3300048926 | Ga0496123_0008281 | Ga0496123_0008281_5901_6893 | 329 |
| 1355 | 3300048927 | Ga0496124_0069578 | Ga0496124_0069578_1394_2386 | 329 |
| 1356 | 3300048929 | Ga0496126_0000069 | Ga0496126_0000069_165152_166144 | 329 |
| 1357 | 3300048929 | Ga0496126_0002934 | Ga0496126_0002934_8540_9532 | 329 |
| 1358 | 3300049459 | Ga0495678_019335 | Ga0495678_019335_436_1428 | 329 |
| 1359 | 3300049568 | Ga0501031_0038885 | Ga0501031_0038885_718_1707 | 329 |
| 1360 | 3300049570 | Ga0501033_0109483 | Ga0501033_0109483_24_1013 | 329 |
| 1361 | 3300049571 | Ga0501034_0033922 | Ga0501034_0033922_2612_3601 | 329 |
| 1362 | 3300049571 | Ga0501034_0064350 | Ga0501034_0064350_2250_3239 | 329 |
| 1363 | 3300049571 | Ga0501034_0096713 | Ga0501034_0096713_1009_1998 | 329 |
| 1364 | 3300049572 | Ga0501036_0061431 | Ga0501036_0061431_1599_2588 | 329 |
| 1365 | 3300049576 | Ga0501040_0190331 | Ga0501040_0190331_208_1197 | 329 |
| 1366 | 3300049578 | Ga0501042_0053434 | Ga0501042_0053434_1117_2106 | 329 |
| 1367 | 3300049579 | Ga0501043_0044244 | Ga0501043_0044244_893_1882 | 329 |
| 1368 | 3300049580 | Ga0501046_0016578 | Ga0501046_0016578_2539_3528 | 329 |
| 1369 | 3300049581 | Ga0501047_0024548 | Ga0501047_0024548_4330_5319 | 329 |
| 1370 | 3300049582 | Ga0501048_0007377 | Ga0501048_0007377_653_1642 | 329 |
| 1371 | 3300049584 | Ga0501068_0045529 | Ga0501068_0045529_1563_2552 | 329 |
| 1372 | 3300049586 | Ga0501070_0163989 | Ga0501070_0163989_238_1227 | 329 |
| 1373 | 3300049586 | Ga0501070_0194627 | Ga0501070_0194627_397_1386 | 329 |
| 1374 | 3300049587 | Ga0501071_0083141 | Ga0501071_0083141_923_1912 | 329 |
| 1375 | 3300049590 | Ga0501074_0095861 | Ga0501074_0095861_971_1960 | 329 |
| 1376 | 3300049741 | Ga0501079_0055154 | Ga0501079_0055154_1731_2720 | 329 |
| 1377 | 3300049823 | Ga0501044_0098444 | Ga0501044_0098444_1574_2563 | 329 |
| 1378 | 3300049824 | Ga0501045_0094563 | Ga0501045_0094563_392_1381 | 329 |
| 1379 | 3300050489 | nmdc:mga03683_3851_c1 | nmdc:mga03683_3851_c1_1580_2572 | 329 |
| 1380 | 3300050489 | nmdc:mga03683_86217_c1 | nmdc:mga03683_86217_c1_270_1262 | 329 |
| 1381 | 3300050490 | nmdc:mga03n38_68907_c1 | nmdc:mga03n38_68907_c1_124_1116 | 329 |
| 1382 | 3300050492 | nmdc:mga0yw44_9041_c1 | nmdc:mga0yw44_9041_c1_307_1299 | 329 |
| 1383 | 3300053086 | Ga0500578_0076274 | Ga0500578_0076274_906_1898 | 329 |
| 1384 | 3300053093 | Ga0500651_0162265 | Ga0500651_0162265_254_1246 | 329 |
| 1385 | 3300053107 | Ga0500560_001265 | Ga0500560_001265_721_1713 | 329 |
| 1386 | 3300053109 | Ga0500569_001415 | Ga0500569_001415_2534_3526 | 329 |
| 1387 | 3300053118 | Ga0500594_0004523 | Ga0500594_0004523_623_1615 | 329 |
| 1388 | 3300053122 | Ga0500608_029243 | Ga0500608_029243_1245_2234 | 329 |
| 1389 | 3300053125 | Ga0500618_006729 | Ga0500618_006729_1339_2331 | 329 |
| 1390 | 3300053134 | Ga0500658_0002414 | Ga0500658_0002414_5343_6335 | 329 |
| 1391 | 3300053136 | Ga0500559_0012232 | Ga0500559_0012232_796_1791 | 329 |
| 1392 | 3300053139 | Ga0500568_0000143 | Ga0500568_0000143_60852_61841 | 329 |
| 1393 | 3300053142 | Ga0500577_0046987 | Ga0500577_0046987_377_1369 | 329 |
| 1394 | 3300053156 | Ga0500622_0000174 | Ga0500622_0000174_62501_63493 | 329 |
| 1395 | 3300054114 | Ga0501084_0077503 | Ga0501084_0077503_185_1177 | 329 |
| 1396 | 3300060353 | Ga0501082_0300925 | Ga0501082_0300925_246_1247 | 329 |
| 1397 | 3300001979 | JGI24740J21852_10000201 | JGI24740J21852_1000020112 | 330 |
| 1398 | 3300002704 | JGI25155J39150_1000014 | JGI25155J39150_1000014169 | 330 |
| 1399 | 3300002705 | JGI25156J39149_1000083 | JGI25156J39149_100008340 | 330 |
| 1400 | 3300002737 | JGI25162J39368_1000532 | JGI25162J39368_100053218 | 330 |
| 1401 | 3300002738 | JGI25154J39366_1000139 | JGI25154J39366_100013923 | 330 |
| 1402 | 3300002741 | JGI25157J39369_1000110 | JGI25157J39369_100011039 | 330 |
| 1403 | 3300002773 | JGI25152J39213_1001051 | JGI25152J39213_10010518 | 330 |
| 1404 | 3300002773 | JGI25152J39213_1004576 | JGI25152J39213_10045763 | 330 |
| 1405 | 3300002773 | JGI25152J39213_1007948 | JGI25152J39213_10079482 | 330 |
| 1406 | 3300002773 | JGI25152J39213_1009306 | JGI25152J39213_10093061 | 330 |
| 1407 | 3300002773 | JGI25152J39213_1016172 | JGI25152J39213_10161721 | 330 |
| 1408 | 3300002774 | JGI25150J39212_1000533 | JGI25150J39212_10005336 | 330 |
| 1409 | 3300002987 | JGI25159J45721_1000008 | JGI25159J45721_1000008166 | 330 |
| 1410 | 3300002987 | JGI25159J45721_1000251 | JGI25159J45721_100025113 | 330 |
| 1411 | 3300003187 | JGI25151J46595_10000152 | JGI25151J46595_100001525 | 330 |
| 1412 | 3300003187 | JGI25151J46595_10003146 | JGI25151J46595_100031465 | 330 |
| 1413 | 3300003187 | JGI25151J46595_10003216 | JGI25151J46595_100032162 | 330 |
| 1414 | 3300003187 | JGI25151J46595_10020830 | JGI25151J46595_100208302 | 330 |
| 1415 | 3300003214 | JGI25165J46597_1000692 | JGI25165J46597_100069216 | 330 |
| 1416 | 3300003214 | JGI25165J46597_1000752 | JGI25165J46597_100075224 | 330 |
| 1417 | 3300003214 | JGI25165J46597_1001515 | JGI25165J46597_10015155 | 330 |
| 1418 | 3300003215 | JGI25153J46596_10003676 | JGI25153J46596_100036766 | 330 |
| 1419 | 3300003215 | JGI25153J46596_10005962 | JGI25153J46596_100059621 | 330 |
| 1420 | 3300003215 | JGI25153J46596_10018655 | JGI25153J46596_100186552 | 330 |
| 1421 | 3300003354 | JGI25160J50197_1000001 | JGI25160J50197_1000001302 | 330 |
| 1422 | 3300003354 | JGI25160J50197_1000033 | JGI25160J50197_10000339 | 330 |
| 1423 | 3300003354 | JGI25160J50197_1005675 | JGI25160J50197_10056753 | 330 |
| 1424 | 3300003354 | JGI25160J50197_1015468 | JGI25160J50197_10154683 | 330 |
| 1425 | 3300003354 | JGI25160J50197_1023193 | JGI25160J50197_10231931 | 330 |
| 1426 | 3300003374 | JGI25161J50226_1000001 | JGI25161J50226_1000001459 | 330 |
| 1427 | 3300003374 | JGI25161J50226_1000725 | JGI25161J50226_10007253 | 330 |
| 1428 | 3300003374 | JGI25161J50226_1001797 | JGI25161J50226_10017974 | 330 |
| 1429 | 3300003374 | JGI25161J50226_1007057 | JGI25161J50226_10070573 | 330 |
| 1430 | 3300003762 | Ga0055542_1001263 | Ga0055542_100126310 | 330 |
| 1431 | 3300003763 | Ga0055529_1005120 | Ga0055529_10051202 | 330 |
| 1432 | 3300003771 | Ga0055526_1000440 | Ga0055526_100044027 | 330 |
| 1433 | 3300003771 | Ga0055526_1001356 | Ga0055526_10013569 | 330 |
| 1434 | 3300003771 | Ga0055526_1008472 | Ga0055526_10084724 | 330 |
| 1435 | 3300003775 | Ga0055524_1001932 | Ga0055524_10019325 | 330 |
| 1436 | 3300003775 | Ga0055524_1017411 | Ga0055524_10174113 | 330 |
| 1437 | 3300003775 | Ga0055524_1021528 | Ga0055524_10215282 | 330 |
| 1438 | 3300003775 | Ga0055524_1022564 | Ga0055524_10225643 | 330 |
| 1439 | 3300003781 | Ga0055536_1002504 | Ga0055536_10025048 | 330 |
| 1440 | 3300003790 | Ga0055528_1000921 | Ga0055528_10009215 | 330 |
| 1441 | 3300003790 | Ga0055528_1007362 | Ga0055528_10073624 | 330 |
| 1442 | 3300003790 | Ga0055528_1007666 | Ga0055528_10076662 | 330 |
| 1443 | 3300003790 | Ga0055528_1013344 | Ga0055528_10133442 | 330 |
| 1444 | 3300003790 | Ga0055528_1021283 | Ga0055528_10212831 | 330 |
| 1445 | 3300003790 | Ga0055528_1027023 | Ga0055528_10270231 | 330 |
| 1446 | 3300003792 | Ga0055540_1000396 | Ga0055540_100039629 | 330 |
| 1447 | 3300003792 | Ga0055540_1002497 | Ga0055540_10024974 | 330 |
| 1448 | 3300003792 | Ga0055540_1004246 | Ga0055540_10042463 | 330 |
| 1449 | 3300003792 | Ga0055540_1005022 | Ga0055540_10050226 | 330 |
| 1450 | 3300003794 | Ga0055531_10003672 | Ga0055531_100036724 | 330 |
| 1451 | 3300003794 | Ga0055531_10009548 | Ga0055531_100095483 | 330 |
| 1452 | 3300003856 | Ga0058692_1000942 | Ga0058692_10009429 | 330 |
| 1453 | 3300003856 | Ga0058692_1003656 | Ga0058692_10036564 | 330 |
| 1454 | 3300004625 | Ga0055543_1000026 | Ga0055543_1000026130 | 330 |
| 1455 | 3300004625 | Ga0055543_1000089 | Ga0055543_100008961 | 330 |
| 1456 | 3300004625 | Ga0055543_1000104 | Ga0055543_10001043 | 330 |
| 1457 | 3300004625 | Ga0055543_1003556 | Ga0055543_10035562 | 330 |
| 1458 | 3300005262 | Ga0065165_1000008 | Ga0065165_1000008154 | 330 |
| 1459 | 3300005262 | Ga0065165_1000178 | Ga0065165_10001789 | 330 |
| 1460 | 3300005262 | Ga0065165_1003404 | Ga0065165_10034048 | 330 |
| 1461 | 3300005327 | Ga0070658_10060723 | Ga0070658_100607233 | 330 |
| 1462 | 3300005331 | Ga0070670_100009022 | Ga0070670_1000090224 | 330 |
| 1463 | 3300005334 | Ga0068869_100165540 | Ga0068869_1001655402 | 330 |
| 1464 | 3300005338 | Ga0068868_100108886 | Ga0068868_1001088862 | 330 |
| 1465 | 3300005344 | Ga0070661_100002923 | Ga0070661_1000029235 | 330 |
| 1466 | 3300005347 | Ga0070668_100069929 | Ga0070668_1000699292 | 330 |
| 1467 | 3300005355 | Ga0070671_100007376 | Ga0070671_1000073768 | 330 |
| 1468 | 3300005366 | Ga0070659_100124159 | Ga0070659_1001241592 | 330 |
| 1469 | 3300005367 | Ga0070667_100290597 | Ga0070667_1002905971 | 330 |
| 1470 | 3300005455 | Ga0070663_100248245 | Ga0070663_1002482451 | 330 |
| 1471 | 3300005535 | Ga0070684_100089357 | Ga0070684_1000893571 | 330 |
| 1472 | 3300005539 | Ga0068853_100008908 | Ga0068853_1000089082 | 330 |
| 1473 | 3300005539 | Ga0068853_100160419 | Ga0068853_1001604192 | 330 |
| 1474 | 3300005548 | Ga0070665_100009435 | Ga0070665_10000943510 | 330 |
| 1475 | 3300005548 | Ga0070665_100055085 | Ga0070665_1000550855 | 330 |
| 1476 | 3300005563 | Ga0068855_100116311 | Ga0068855_1001163113 | 330 |
| 1477 | 3300005563 | Ga0068855_100410450 | Ga0068855_1004104502 | 330 |
| 1478 | 3300005564 | Ga0070664_100167619 | Ga0070664_1001676192 | 330 |
| 1479 | 3300005578 | Ga0068854_100025684 | Ga0068854_1000256843 | 330 |
| 1480 | 3300005578 | Ga0068854_100058022 | Ga0068854_1000580222 | 330 |
| 1481 | 3300005578 | Ga0068854_100071955 | Ga0068854_1000719553 | 330 |
| 1482 | 3300005614 | Ga0068856_100006424 | Ga0068856_1000064243 | 330 |
| 1483 | 3300005614 | Ga0068856_100087342 | Ga0068856_1000873423 | 330 |
| 1484 | 3300005614 | Ga0068856_100360183 | Ga0068856_1003601831 | 330 |
| 1485 | 3300005616 | Ga0068852_100027054 | Ga0068852_1000270544 | 330 |
| 1486 | 3300005616 | Ga0068852_100072527 | Ga0068852_1000725274 | 330 |
| 1487 | 3300005616 | Ga0068852_100223585 | Ga0068852_1002235852 | 330 |
| 1488 | 3300005617 | Ga0068859_100210192 | Ga0068859_1002101922 | 330 |
| 1489 | 3300005618 | Ga0068864_100005685 | Ga0068864_1000056857 | 330 |
| 1490 | 3300005834 | Ga0068851_10017316 | Ga0068851_100173162 | 330 |
| 1491 | 3300005841 | Ga0068863_100089005 | Ga0068863_1000890053 | 330 |
| 1492 | 3300005842 | Ga0068858_100249145 | Ga0068858_1002491451 | 330 |
| 1493 | 3300006038 | Ga0075365_10000918 | Ga0075365_100009187 | 330 |
| 1494 | 3300006038 | Ga0075365_10007236 | Ga0075365_100072366 | 330 |
| 1495 | 3300006042 | Ga0075368_10043333 | Ga0075368_100433332 | 330 |
| 1496 | 3300006042 | Ga0075368_10049549 | Ga0075368_100495492 | 330 |
| 1497 | 3300006042 | Ga0075368_10062261 | Ga0075368_100622611 | 330 |
| 1498 | 3300006042 | Ga0075368_10087624 | Ga0075368_100876242 | 330 |
| 1499 | 3300006048 | Ga0075363_100102632 | Ga0075363_1001026322 | 330 |
| 1500 | 3300006051 | Ga0075364_10136435 | Ga0075364_101364352 | 330 |
| 1501 | 3300006051 | Ga0075364_10243653 | Ga0075364_102436531 | 330 |
| 1502 | 3300006177 | Ga0075362_10014364 | Ga0075362_100143642 | 330 |
| 1503 | 3300006186 | Ga0075369_10016027 | Ga0075369_100160273 | 330 |
| 1504 | 3300006186 | Ga0075369_10021994 | Ga0075369_100219943 | 330 |
| 1505 | 3300006195 | Ga0075366_10018014 | Ga0075366_100180144 | 330 |
| 1506 | 3300006353 | Ga0075370_10047656 | Ga0075370_100476562 | 330 |
| 1507 | 3300006353 | Ga0075370_10079099 | Ga0075370_100790992 | 330 |
| 1508 | 3300006353 | Ga0075370_10084296 | Ga0075370_100842962 | 330 |
| 1509 | 3300006844 | Ga0075428_100005831 | Ga0075428_1000058313 | 330 |
| 1510 | 3300006847 | Ga0075431_100223808 | Ga0075431_1002238082 | 330 |
| 1511 | 3300006931 | Ga0097620_100210201 | Ga0097620_1002102012 | 330 |
| 1512 | 3300006946 | Ga0079104_1002347 | Ga0079104_10023472 | 330 |
| 1513 | 3300006946 | Ga0079104_1002740 | Ga0079104_10027404 | 330 |
| 1514 | 3300006948 | Ga0099826_10012941 | Ga0099826_100129416 | 330 |
| 1515 | 3300009011 | Ga0105251_10019755 | Ga0105251_100197553 | 330 |
| 1516 | 3300009093 | Ga0105240_10000014 | Ga0105240_10000014219 | 330 |
| 1517 | 3300009098 | Ga0105245_10130450 | Ga0105245_101304502 | 330 |
| 1518 | 3300009148 | Ga0105243_10025395 | Ga0105243_100253953 | 330 |
| 1519 | 3300009174 | Ga0105241_10076691 | Ga0105241_100766914 | 330 |
| 1520 | 3300009174 | Ga0105241_10236086 | Ga0105241_102360862 | 330 |
| 1521 | 3300009177 | Ga0105248_10021814 | Ga0105248_100218143 | 330 |
| 1522 | 3300009177 | Ga0105248_10172269 | Ga0105248_101722693 | 330 |
| 1523 | 3300009545 | Ga0105237_10003649 | Ga0105237_1000364912 | 330 |
| 1524 | 3300009545 | Ga0105237_10051914 | Ga0105237_100519144 | 330 |
| 1525 | 3300009545 | Ga0105237_10098212 | Ga0105237_100982122 | 330 |
| 1526 | 3300009551 | Ga0105238_10001985 | Ga0105238_1000198514 | 330 |
| 1527 | 3300009551 | Ga0105238_10078391 | Ga0105238_100783911 | 330 |
| 1528 | 3300009765 | Ga0123341_1000035 | Ga0123341_10000352 | 330 |
| 1529 | 3300009766 | Ga0123342_1009384 | Ga0123342_10093849 | 330 |
| 1530 | 3300009766 | Ga0123342_1026071 | Ga0123342_10260713 | 330 |
| 1531 | 3300010375 | Ga0105239_10354527 | Ga0105239_103545272 | 330 |
| 1532 | 3300011119 | Ga0105246_10076598 | Ga0105246_100765982 | 330 |
| 1533 | 3300011119 | Ga0105246_10091436 | Ga0105246_100914362 | 330 |
| 1534 | 3300011119 | Ga0105246_10207784 | Ga0105246_102077841 | 330 |
| 1535 | 3300013102 | Ga0157371_10000187 | Ga0157371_1000018781 | 330 |
| 1536 | 3300013104 | Ga0157370_10000037 | Ga0157370_1000003767 | 330 |
| 1537 | 3300013104 | Ga0157370_10002430 | Ga0157370_1000243014 | 330 |
| 1538 | 3300013104 | Ga0157370_10085310 | Ga0157370_100853103 | 330 |
| 1539 | 3300013104 | Ga0157370_10114034 | Ga0157370_101140342 | 330 |
| 1540 | 3300013105 | Ga0157369_10109741 | Ga0157369_101097412 | 330 |
| 1541 | 3300013105 | Ga0157369_10391754 | Ga0157369_103917541 | 330 |
| 1542 | 3300013249 | Ga0171463_1007 | Ga0171463_1007114 | 330 |
| 1543 | 3300013306 | Ga0163162_10240771 | Ga0163162_102407713 | 330 |
| 1544 | 3300014325 | Ga0163163_10270264 | Ga0163163_102702641 | 330 |
| 1545 | 3300014968 | Ga0157379_10051127 | Ga0157379_100511273 | 330 |
| 1546 | 3300014968 | Ga0157379_10158340 | Ga0157379_101583402 | 330 |
| 1547 | 3300015262 | Ga0182007_10002682 | Ga0182007_100026826 | 330 |
| 1548 | 3300015265 | Ga0182005_1020059 | Ga0182005_10200592 | 330 |
| 1549 | 3300015265 | Ga0182005_1021965 | Ga0182005_10219651 | 330 |
| 1550 | 3300015690 | Ga0183363_1061 | Ga0183363_106129 | 330 |
| 1551 | 3300021320 | Ga0214544_1000110 | Ga0214544_100011015 | 330 |
| 1552 | 3300021321 | Ga0214542_1000032 | Ga0214542_100003211 | 330 |
| 1553 | 3300021327 | Ga0214543_1000016 | Ga0214543_1000016267 | 330 |
| 1554 | 3300021327 | Ga0214543_1000022 | Ga0214543_1000022164 | 330 |
| 1555 | 3300022740 | Ga0228710_1005902 | Ga0228710_10059029 | 330 |
| 1556 | 3300025206 | Ga0209435_100027 | Ga0209435_100027165 | 330 |
| 1557 | 3300025228 | Ga0209672_104167 | Ga0209672_1041674 | 330 |
| 1558 | 3300025230 | Ga0209563_111216 | Ga0209563_1112162 | 330 |
| 1559 | 3300025231 | Ga0207427_105205 | Ga0207427_1052053 | 330 |
| 1560 | 3300025233 | Ga0209437_100058 | Ga0209437_10005811 | 330 |
| 1561 | 3300025233 | Ga0209437_100060 | Ga0209437_100060217 | 330 |
| 1562 | 3300025245 | Ga0207425_1000046 | Ga0207425_1000046108 | 330 |
| 1563 | 3300025245 | Ga0207425_1004007 | Ga0207425_10040073 | 330 |
| 1564 | 3300025245 | Ga0207425_1006686 | Ga0207425_10066863 | 330 |
| 1565 | 3300025245 | Ga0207425_1011735 | Ga0207425_10117353 | 330 |
| 1566 | 3300025246 | Ga0209646_1000086 | Ga0209646_1000086165 | 330 |
| 1567 | 3300025246 | Ga0209646_1004880 | Ga0209646_10048804 | 330 |
| 1568 | 3300025250 | Ga0209026_1000082 | Ga0209026_1000082165 | 330 |
| 1569 | 3300025250 | Ga0209026_1000151 | Ga0209026_100015177 | 330 |
| 1570 | 3300025253 | Ga0209677_100453 | Ga0209677_10045321 | 330 |
| 1571 | 3300025254 | Ga0209148_1000032 | Ga0209148_1000032489 | 330 |
| 1572 | 3300025254 | Ga0209148_1000213 | Ga0209148_100021321 | 330 |
| 1573 | 3300025256 | Ga0209759_1000063 | Ga0209759_100006336 | 330 |
| 1574 | 3300025256 | Ga0209759_1000076 | Ga0209759_10000767 | 330 |
| 1575 | 3300025258 | Ga0209129_1000170 | Ga0209129_10001708 | 330 |
| 1576 | 3300025258 | Ga0209129_1000283 | Ga0209129_100028337 | 330 |
| 1577 | 3300025258 | Ga0209129_1000820 | Ga0209129_10008203 | 330 |
| 1578 | 3300025258 | Ga0209129_1000868 | Ga0209129_10008684 | 330 |
| 1579 | 3300025258 | Ga0209129_1001663 | Ga0209129_100166312 | 330 |
| 1580 | 3300025258 | Ga0209129_1006477 | Ga0209129_10064772 | 330 |
| 1581 | 3300025261 | Ga0209233_1000149 | Ga0209233_1000149172 | 330 |
| 1582 | 3300025261 | Ga0209233_1000150 | Ga0209233_100015053 | 330 |
| 1583 | 3300025261 | Ga0209233_1000160 | Ga0209233_100016013 | 330 |
| 1584 | 3300025272 | Ga0209455_1000085 | Ga0209455_1000085183 | 330 |
| 1585 | 3300025272 | Ga0209455_1001483 | Ga0209455_100148311 | 330 |
| 1586 | 3300025273 | Ga0209673_1000010 | Ga0209673_1000010586 | 330 |
| 1587 | 3300025273 | Ga0209673_1000025 | Ga0209673_1000025122 | 330 |
| 1588 | 3300025273 | Ga0209673_1000112 | Ga0209673_1000112100 | 330 |
| 1589 | 3300025273 | Ga0209673_1001637 | Ga0209673_10016374 | 330 |
| 1590 | 3300025273 | Ga0209673_1002919 | Ga0209673_10029196 | 330 |
| 1591 | 3300025273 | Ga0209673_1005722 | Ga0209673_10057223 | 330 |
| 1592 | 3300025273 | Ga0209673_1015525 | Ga0209673_10155252 | 330 |
| 1593 | 3300025284 | Ga0209130_1000003 | Ga0209130_1000003473 | 330 |
| 1594 | 3300025284 | Ga0209130_1000017 | Ga0209130_1000017168 | 330 |
| 1595 | 3300025284 | Ga0209130_1000023 | Ga0209130_100002375 | 330 |
| 1596 | 3300025292 | Ga0209676_1001942 | Ga0209676_10019429 | 330 |
| 1597 | 3300025292 | Ga0209676_1029563 | Ga0209676_10295631 | 330 |
| 1598 | 3300025294 | Ga0209025_1000091 | Ga0209025_1000091215 | 330 |
| 1599 | 3300025294 | Ga0209025_1000137 | Ga0209025_100013783 | 330 |
| 1600 | 3300025294 | Ga0209025_1000153 | Ga0209025_10001538 | 330 |
| 1601 | 3300025294 | Ga0209025_1000545 | Ga0209025_100054535 | 330 |
| 1602 | 3300025294 | Ga0209025_1000689 | Ga0209025_100068939 | 330 |
| 1603 | 3300025294 | Ga0209025_1001424 | Ga0209025_10014244 | 330 |
| 1604 | 3300025294 | Ga0209025_1002940 | Ga0209025_10029404 | 330 |
| 1605 | 3300025294 | Ga0209025_1008460 | Ga0209025_10084604 | 330 |
| 1606 | 3300025294 | Ga0209025_1018454 | Ga0209025_10184542 | 330 |
| 1607 | 3300025294 | Ga0209025_1030110 | Ga0209025_10301102 | 330 |
| 1608 | 3300025294 | Ga0209025_1030429 | Ga0209025_10304292 | 330 |
| 1609 | 3300025295 | Ga0209564_1000013 | Ga0209564_1000013616 | 330 |
| 1610 | 3300025295 | Ga0209564_1000365 | Ga0209564_100036571 | 330 |
| 1611 | 3300025295 | Ga0209564_1000564 | Ga0209564_100056412 | 330 |
| 1612 | 3300025295 | Ga0209564_1001004 | Ga0209564_100100438 | 330 |
| 1613 | 3300025295 | Ga0209564_1005883 | Ga0209564_10058832 | 330 |
| 1614 | 3300025295 | Ga0209564_1015988 | Ga0209564_10159883 | 330 |
| 1615 | 3300025297 | Ga0209758_1000123 | Ga0209758_100012383 | 330 |
| 1616 | 3300025297 | Ga0209758_1001220 | Ga0209758_100122015 | 330 |
| 1617 | 3300025297 | Ga0209758_1002966 | Ga0209758_10029663 | 330 |
| 1618 | 3300025297 | Ga0209758_1004613 | Ga0209758_10046134 | 330 |
| 1619 | 3300025297 | Ga0209758_1006234 | Ga0209758_10062347 | 330 |
| 1620 | 3300025297 | Ga0209758_1008951 | Ga0209758_10089514 | 330 |
| 1621 | 3300025297 | Ga0209758_1009161 | Ga0209758_10091616 | 330 |
| 1622 | 3300025298 | Ga0209050_1004328 | Ga0209050_10043283 | 330 |
| 1623 | 3300025298 | Ga0209050_1005211 | Ga0209050_10052115 | 330 |
| 1624 | 3300025298 | Ga0209050_1008301 | Ga0209050_10083014 | 330 |
| 1625 | 3300025299 | Ga0209256_1000211 | Ga0209256_1000211111 | 330 |
| 1626 | 3300025299 | Ga0209256_1000315 | Ga0209256_10003154 | 330 |
| 1627 | 3300025299 | Ga0209256_1004669 | Ga0209256_10046696 | 330 |
| 1628 | 3300025299 | Ga0209256_1005396 | Ga0209256_10053966 | 330 |
| 1629 | 3300025299 | Ga0209256_1010874 | Ga0209256_10108744 | 330 |
| 1630 | 3300025299 | Ga0209256_1013599 | Ga0209256_10135993 | 330 |
| 1631 | 3300025299 | Ga0209256_1019942 | Ga0209256_10199421 | 330 |
| 1632 | 3300025302 | Ga0207426_1000006 | Ga0207426_1000006167 | 330 |
| 1633 | 3300025302 | Ga0207426_1000011 | Ga0207426_1000011303 | 330 |
| 1634 | 3300025302 | Ga0207426_1000087 | Ga0207426_1000087288 | 330 |
| 1635 | 3300025302 | Ga0207426_1000208 | Ga0207426_10002084 | 330 |
| 1636 | 3300025302 | Ga0207426_1002922 | Ga0207426_10029222 | 330 |
| 1637 | 3300025303 | Ga0209051_1000410 | Ga0209051_100041026 | 330 |
| 1638 | 3300025303 | Ga0209051_1001459 | Ga0209051_100145911 | 330 |
| 1639 | 3300025303 | Ga0209051_1004728 | Ga0209051_10047284 | 330 |
| 1640 | 3300025303 | Ga0209051_1007779 | Ga0209051_10077792 | 330 |
| 1641 | 3300025303 | Ga0209051_1038366 | Ga0209051_10383662 | 330 |
| 1642 | 3300025304 | Ga0209257_1003036 | Ga0209257_10030364 | 330 |
| 1643 | 3300025315 | Ga0207697_10020847 | Ga0207697_100208473 | 330 |
| 1644 | 3300025321 | Ga0207656_10019890 | Ga0207656_100198903 | 330 |
| 1645 | 3300025903 | Ga0207680_10142919 | Ga0207680_101429192 | 330 |
| 1646 | 3300025907 | Ga0207645_10126175 | Ga0207645_101261751 | 330 |
| 1647 | 3300025911 | Ga0207654_10032483 | Ga0207654_100324833 | 330 |
| 1648 | 3300025913 | Ga0207695_10000037 | Ga0207695_10000037220 | 330 |
| 1649 | 3300025914 | Ga0207671_10001017 | Ga0207671_1000101718 | 330 |
| 1650 | 3300025919 | Ga0207657_10019972 | Ga0207657_100199724 | 330 |
| 1651 | 3300025925 | Ga0207650_10001778 | Ga0207650_100017785 | 330 |
| 1652 | 3300025927 | Ga0207687_10013924 | Ga0207687_100139243 | 330 |
| 1653 | 3300025931 | Ga0207644_10054517 | Ga0207644_100545173 | 330 |
| 1654 | 3300025935 | Ga0207709_10022407 | Ga0207709_100224072 | 330 |
| 1655 | 3300025937 | Ga0207669_10039242 | Ga0207669_100392422 | 330 |
| 1656 | 3300025940 | Ga0207691_10193477 | Ga0207691_101934771 | 330 |
| 1657 | 3300025949 | Ga0207667_10012150 | Ga0207667_100121507 | 330 |
| 1658 | 3300025949 | Ga0207667_10569510 | Ga0207667_105695101 | 330 |
| 1659 | 3300025960 | Ga0207651_10048219 | Ga0207651_100482193 | 330 |
| 1660 | 3300025972 | Ga0207668_10159940 | Ga0207668_101599401 | 330 |
| 1661 | 3300025981 | Ga0207640_10027943 | Ga0207640_100279433 | 330 |
| 1662 | 3300025981 | Ga0207640_10071336 | Ga0207640_100713361 | 330 |
| 1663 | 3300025986 | Ga0207658_10245784 | Ga0207658_102457841 | 330 |
| 1664 | 3300026041 | Ga0207639_10039484 | Ga0207639_100394842 | 330 |
| 1665 | 3300026041 | Ga0207639_10216235 | Ga0207639_102162352 | 330 |
| 1666 | 3300026067 | Ga0207678_10187385 | Ga0207678_101873852 | 330 |
| 1667 | 3300026067 | Ga0207678_10189062 | Ga0207678_101890622 | 330 |
| 1668 | 3300026078 | Ga0207702_10033194 | Ga0207702_100331943 | 330 |
| 1669 | 3300026078 | Ga0207702_10163641 | Ga0207702_101636412 | 330 |
| 1670 | 3300026078 | Ga0207702_10178055 | Ga0207702_101780552 | 330 |
| 1671 | 3300026078 | Ga0207702_10179524 | Ga0207702_101795242 | 330 |
| 1672 | 3300026078 | Ga0207702_10187355 | Ga0207702_101873552 | 330 |
| 1673 | 3300026088 | Ga0207641_10035203 | Ga0207641_100352033 | 330 |
| 1674 | 3300026095 | Ga0207676_10030998 | Ga0207676_100309983 | 330 |
| 1675 | 3300026116 | Ga0207674_10327952 | Ga0207674_103279522 | 330 |
| 1676 | 3300026116 | Ga0207674_10467961 | Ga0207674_104679612 | 330 |
| 1677 | 3300026121 | Ga0207683_10131269 | Ga0207683_101312692 | 330 |
| 1678 | 3300026121 | Ga0207683_10236442 | Ga0207683_102364422 | 330 |
| 1679 | 3300026142 | Ga0207698_10029130 | Ga0207698_100291303 | 330 |
| 1680 | 3300027111 | Ga0209281_1000375 | Ga0209281_100037510 | 330 |
| 1681 | 3300027111 | Ga0209281_1001291 | Ga0209281_10012919 | 330 |
| 1682 | 3300027312 | Ga0209371_1000035 | Ga0209371_1000035162 | 330 |
| 1683 | 3300027312 | Ga0209371_1000901 | Ga0209371_100090111 | 330 |
| 1684 | 3300027312 | Ga0209371_1003138 | Ga0209371_10031385 | 330 |
| 1685 | 3300027666 | Ga0209282_1001148 | Ga0209282_10011489 | 330 |
| 1686 | 3300027666 | Ga0209282_1001830 | Ga0209282_100183013 | 330 |
| 1687 | 3300027666 | Ga0209282_1044420 | Ga0209282_10444202 | 330 |
| 1688 | 3300027866 | Ga0209813_10000800 | Ga0209813_100008005 | 330 |
| 1689 | 3300027866 | Ga0209813_10032907 | Ga0209813_100329072 | 330 |
| 1690 | 3300028379 | Ga0268266_10024005 | Ga0268266_100240056 | 330 |
| 1691 | 3300028379 | Ga0268266_10054593 | Ga0268266_100545933 | 330 |
| 1692 | 3300028379 | Ga0268266_10070198 | Ga0268266_100701984 | 330 |
| 1693 | 3300028379 | Ga0268266_10274954 | Ga0268266_102749542 | 330 |
| 1694 | 3300028577 | Ga0265318_10028336 | Ga0265318_100283363 | 330 |
| 1695 | 3300028794 | Ga0307515_10000017 | Ga0307515_10000017168 | 330 |
| 1696 | 3300028794 | Ga0307515_10021612 | Ga0307515_100216123 | 330 |
| 1697 | 3300028794 | Ga0307515_10022262 | Ga0307515_100222629 | 330 |
| 1698 | 3300030500 | Ga0268256_1000037 | Ga0268256_1000037161 | 330 |
| 1699 | 3300030500 | Ga0268256_1003000 | Ga0268256_10030005 | 330 |
| 1700 | 3300030500 | Ga0268256_1003068 | Ga0268256_10030686 | 330 |
| 1701 | 3300030744 | Ga0316181_1025508 | Ga0316181_10255083 | 330 |
| 1702 | 3300031235 | Ga0265330_10018309 | Ga0265330_100183093 | 330 |
| 1703 | 3300031240 | Ga0265320_10036211 | Ga0265320_100362112 | 330 |
| 1704 | 3300031241 | Ga0265325_10006250 | Ga0265325_100062504 | 330 |
| 1705 | 3300031241 | Ga0265325_10013585 | Ga0265325_100135853 | 330 |
| 1706 | 3300031247 | Ga0265340_10028955 | Ga0265340_100289553 | 330 |
| 1707 | 3300031247 | Ga0265340_10078080 | Ga0265340_100780802 | 330 |
| 1708 | 3300031247 | Ga0265340_10113579 | Ga0265340_101135791 | 330 |
| 1709 | 3300031249 | Ga0265339_10002978 | Ga0265339_100029784 | 330 |
| 1710 | 3300031249 | Ga0265339_10062419 | Ga0265339_100624192 | 330 |
| 1711 | 3300031250 | Ga0265331_10047132 | Ga0265331_100471323 | 330 |
| 1712 | 3300031344 | Ga0265316_10013087 | Ga0265316_100130876 | 330 |
| 1713 | 3300031344 | Ga0265316_10032893 | Ga0265316_100328934 | 330 |
| 1714 | 3300031344 | Ga0265316_10167437 | Ga0265316_101674372 | 330 |
| 1715 | 3300031456 | Ga0307513_10005235 | Ga0307513_1000523511 | 330 |
| 1716 | 3300031456 | Ga0307513_10080307 | Ga0307513_100803074 | 330 |
| 1717 | 3300031456 | Ga0307513_10151987 | Ga0307513_101519872 | 330 |
| 1718 | 3300031548 | Ga0307408_100054513 | Ga0307408_1000545131 | 330 |
| 1719 | 3300031595 | Ga0265313_10000044 | Ga0265313_1000004480 | 330 |
| 1720 | 3300031595 | Ga0265313_10000481 | Ga0265313_1000048130 | 330 |
| 1721 | 3300031595 | Ga0265313_10011274 | Ga0265313_100112744 | 330 |
| 1722 | 3300031595 | Ga0265313_10072214 | Ga0265313_100722142 | 330 |
| 1723 | 3300031595 | Ga0265313_10115121 | Ga0265313_101151212 | 330 |
| 1724 | 3300031711 | Ga0265314_10010039 | Ga0265314_100100395 | 330 |
| 1725 | 3300031711 | Ga0265314_10025241 | Ga0265314_100252414 | 330 |
| 1726 | 3300031712 | Ga0265342_10000926 | Ga0265342_1000092623 | 330 |
| 1727 | 3300031712 | Ga0265342_10018725 | Ga0265342_100187254 | 330 |
| 1728 | 3300031712 | Ga0265342_10047051 | Ga0265342_100470512 | 330 |
| 1729 | 3300031731 | Ga0307405_10000323 | Ga0307405_1000032316 | 330 |
| 1730 | 3300031852 | Ga0307410_10338188 | Ga0307410_103381881 | 330 |
| 1731 | 3300031901 | Ga0307406_10053211 | Ga0307406_100532113 | 330 |
| 1732 | 3300031911 | Ga0307412_10001545 | Ga0307412_100015454 | 330 |
| 1733 | 3300031911 | Ga0307412_10169124 | Ga0307412_101691241 | 330 |
| 1734 | 3300031967 | Ga0315914_1008120 | Ga0315914_10081207 | 330 |
| 1735 | 3300032004 | Ga0307414_10118438 | Ga0307414_101184382 | 330 |
| 1736 | 3300032004 | Ga0307414_10124889 | Ga0307414_101248892 | 330 |
| 1737 | 3300032004 | Ga0307414_10284487 | Ga0307414_102844871 | 330 |
| 1738 | 3300032004 | Ga0307414_10545162 | Ga0307414_105451621 | 330 |
| 1739 | 3300033430 | Ga0315913_1006432 | Ga0315913_10064329 | 330 |
| 1740 | 3300033464 | Ga0315915_1000007 | Ga0315915_1000007234 | 330 |
| 1741 | 3300037068 | Ga0373925_0148449 | Ga0373925_0148449_584_1588 | 330 |
| 1742 | 3300037312 | Ga0395899_0000044 | Ga0395899_0000044_18459_19469 | 330 |
| 1743 | 3300037418 | Ga0395900_0000042 | Ga0395900_0000042_12619_13629 | 330 |
| 1744 | 3300037466 | Ga0395898_0000080 | Ga0395898_0000080_12619_13629 | 330 |
| 1745 | 3300037471 | Ga0395905_0000044 | Ga0395905_0000044_229288_230298 | 330 |
| 1746 | 3300037471 | Ga0395905_0423218 | Ga0395905_0423218_24_1016 | 330 |
| 1747 | 3300038443 | Ga0395901_0000027 | Ga0395901_0000027_229254_230264 | 330 |
| 1748 | 3300039062 | Ga0400483_172664 | Ga0400483_172664_150_1151 | 330 |
| 1749 | 3300039062 | Ga0400483_246637 | Ga0400483_246637_2031_3035 | 330 |
| 1750 | 3300041413 | Ga0439465_0001270 | Ga0439465_0001270_643_1635 | 330 |
| 1751 | 3300041413 | Ga0439465_0008472 | Ga0439465_0008472_86_1081 | 330 |
| 1752 | 3300041413 | Ga0439465_0008513 | Ga0439465_0008513_813_1805 | 330 |
| 1753 | 3300041452 | Ga0451793_1386411 | Ga0451793_1386411_22_1014 | 330 |
| 1754 | 3300041509 | Ga0451843_0294688 | Ga0451843_0294688_2948_3940 | 330 |
| 1755 | 3300041999 | Ga0439433_0022253 | Ga0439433_0022253_126_1121 | 330 |
| 1756 | 3300042006 | Ga0439432_019512 | Ga0439432_019512_425_1420 | 330 |
| 1757 | 3300042145 | Ga0450906_002412 | Ga0450906_002412_1146_2141 | 330 |
| 1758 | 3300044684 | Ga0466966_0022293 | Ga0466966_0022293_41_1033 | 330 |
| 1759 | 3300044694 | Ga0466963_0013253 | Ga0466963_0013253_2127_3119 | 330 |
| 1760 | 3300044735 | Ga0466968_0012727 | Ga0466968_0012727_151_1146 | 330 |
| 1761 | 3300044765 | Ga0466970_0005599 | Ga0466970_0005599_3208_4200 | 330 |
| 1762 | 3300045051 | Ga0451576_0002330 | Ga0451576_0002330_4320_5321 | 330 |
| 1763 | 3300045051 | Ga0451576_0036965 | Ga0451576_0036965_3743_4747 | 330 |
| 1764 | 3300045836 | Ga0466958_0024660 | Ga0466958_0024660_826_1818 | 330 |
| 1765 | 3300046459 | Ga0495629_0004985 | Ga0495629_0004985_4881_5885 | 330 |
| 1766 | 3300046459 | Ga0495629_0029471 | Ga0495629_0029471_2814_3812 | 330 |
| 1767 | 3300046460 | Ga0495638_0008120 | Ga0495638_0008120_3934_4926 | 330 |
| 1768 | 3300046460 | Ga0495638_0019366 | Ga0495638_0019366_2397_3389 | 330 |
| 1769 | 3300046462 | Ga0495651_0067244 | Ga0495651_0067244_881_1891 | 330 |
| 1770 | 3300046462 | Ga0495651_0098693 | Ga0495651_0098693_49_1047 | 330 |
| 1771 | 3300046462 | Ga0495651_0101799 | Ga0495651_0101799_1100_2104 | 330 |
| 1772 | 3300046474 | Ga0495605_0020662 | Ga0495605_0020662_1831_2823 | 330 |
| 1773 | 3300046474 | Ga0495605_0038126 | Ga0495605_0038126_1323_2315 | 330 |
| 1774 | 3300046476 | Ga0495662_0067685 | Ga0495662_0067685_24_1022 | 330 |
| 1775 | 3300046477 | Ga0495664_0074572 | Ga0495664_0074572_112_1110 | 330 |
| 1776 | 3300046492 | Ga0495585_0037863 | Ga0495585_0037863_10_1002 | 330 |
| 1777 | 3300046492 | Ga0495585_0164218 | Ga0495585_0164218_41_1033 | 330 |
| 1778 | 3300046506 | Ga0495583_0012467 | Ga0495583_0012467_1748_2740 | 330 |
| 1779 | 3300046507 | Ga0495606_0006240 | Ga0495606_0006240_8863_9855 | 330 |
| 1780 | 3300046507 | Ga0495606_0133561 | Ga0495606_0133561_57_1049 | 330 |
| 1781 | 3300046512 | Ga0495610_0008335 | Ga0495610_0008335_2561_3553 | 330 |
| 1782 | 3300046512 | Ga0495610_0036426 | Ga0495610_0036426_1223_2215 | 330 |
| 1783 | 3300046519 | Ga0495632_0008302 | Ga0495632_0008302_2389_3381 | 330 |
| 1784 | 3300046520 | Ga0495637_0096499 | Ga0495637_0096499_59_1054 | 330 |
| 1785 | 3300046522 | Ga0495643_0033843 | Ga0495643_0033843_888_1880 | 330 |
| 1786 | 3300046522 | Ga0495643_0075017 | Ga0495643_0075017_417_1412 | 330 |
| 1787 | 3300046533 | Ga0495640_0008734 | Ga0495640_0008734_4115_5119 | 330 |
| 1788 | 3300046557 | Ga0495622_0031741 | Ga0495622_0031741_204_1208 | 330 |
| 1789 | 3300046559 | Ga0495667_0082887 | Ga0495667_0082887_423_1433 | 330 |
| 1790 | 3300046616 | Ga0495668_0013586 | Ga0495668_0013586_1748_2740 | 330 |
| 1791 | 3300046660 | Ga0495625_0011866 | Ga0495625_0011866_2374_3366 | 330 |
| 1792 | 3300046663 | Ga0495635_0017864 | Ga0495635_0017864_90_1094 | 330 |
| 1793 | 3300046674 | Ga0495588_0002642 | Ga0495588_0002642_3076_4068 | 330 |
| 1794 | 3300046674 | Ga0495588_0071038 | Ga0495588_0071038_247_1248 | 330 |
| 1795 | 3300046674 | Ga0495588_0097048 | Ga0495588_0097048_10_1008 | 330 |
| 1796 | 3300046675 | Ga0495657_0060563 | Ga0495657_0060563_442_1446 | 330 |
| 1797 | 3300046683 | Ga0495658_0030878 | Ga0495658_0030878_979_1977 | 330 |
| 1798 | 3300046689 | Ga0495613_0023071 | Ga0495613_0023071_2580_3584 | 330 |
| 1799 | 3300046691 | Ga0495670_0090149 | Ga0495670_0090149_429_1421 | 330 |
| 1800 | 3300046809 | Ga0495600_0008492 | Ga0495600_0008492_3323_4327 | 330 |
| 1801 | 3300046809 | Ga0495600_0033078 | Ga0495600_0033078_1920_2918 | 330 |
| 1802 | 3300046809 | Ga0495600_0131177 | Ga0495600_0131177_604_1614 | 330 |
| 1803 | 3300047317 | Ga0495604_0041248 | Ga0495604_0041248_909_1913 | 330 |
| 1804 | 3300047321 | Ga0495676_0038748 | Ga0495676_0038748_2557_3564 | 330 |
| 1805 | 3300047469 | Ga0495673_0058904 | Ga0495673_0058904_474_1466 | 330 |
| 1806 | 3300047470 | Ga0495681_0000773 | Ga0495681_0000773_4740_5732 | 330 |
| 1807 | 3300047472 | Ga0495686_0009447 | Ga0495686_0009447_2879_3871 | 330 |
| 1808 | 3300047472 | Ga0495686_0023819 | Ga0495686_0023819_91_1083 | 330 |
| 1809 | 3300047472 | Ga0495686_0026678 | Ga0495686_0026678_223_1215 | 330 |
| 1810 | 3300047472 | Ga0495686_0050941 | Ga0495686_0050941_84_1076 | 330 |
| 1811 | 3300048088 | Ga0495602_0140246 | Ga0495602_0140246_674_1678 | 330 |
| 1812 | 3300048905 | Ga0496102_0240698 | Ga0496102_0240698_632_1624 | 330 |
| 1813 | 3300048907 | Ga0496104_0003414 | Ga0496104_0003414_5088_6092 | 330 |
| 1814 | 3300048907 | Ga0496104_0044031 | Ga0496104_0044031_1049_2041 | 330 |
| 1815 | 3300048907 | Ga0496104_0376879 | Ga0496104_0376879_319_1311 | 330 |
| 1816 | 3300048908 | Ga0496105_0000404 | Ga0496105_0000404_17568_18572 | 330 |
| 1817 | 3300048909 | Ga0496106_0014285 | Ga0496106_0014285_2317_3309 | 330 |
| 1818 | 3300048916 | Ga0496113_0072655 | Ga0496113_0072655_1119_2111 | 330 |
| 1819 | 3300048917 | Ga0496114_0127631 | Ga0496114_0127631_823_1875 | 330 |
| 1820 | 3300048918 | Ga0496115_0030928 | Ga0496115_0030928_1301_2305 | 330 |
| 1821 | 3300048919 | Ga0496116_0012142 | Ga0496116_0012142_4135_5127 | 330 |
| 1822 | 3300048919 | Ga0496116_0016325 | Ga0496116_0016325_3054_4121 | 330 |
| 1823 | 3300048919 | Ga0496116_0016678 | Ga0496116_0016678_1920_2912 | 330 |
| 1824 | 3300048919 | Ga0496116_0063997 | Ga0496116_0063997_1211_2203 | 330 |
| 1825 | 3300048919 | Ga0496116_0064545 | Ga0496116_0064545_1235_2227 | 330 |
| 1826 | 3300048919 | Ga0496116_0065103 | Ga0496116_0065103_1155_2147 | 330 |
| 1827 | 3300048920 | Ga0496117_0000066 | Ga0496117_0000066_177316_178308 | 330 |
| 1828 | 3300048920 | Ga0496117_0017065 | Ga0496117_0017065_1804_2796 | 330 |
| 1829 | 3300048920 | Ga0496117_0101947 | Ga0496117_0101947_432_1436 | 330 |
| 1830 | 3300048921 | Ga0496118_0015274 | Ga0496118_0015274_4404_5396 | 330 |
| 1831 | 3300048921 | Ga0496118_0028061 | Ga0496118_0028061_471_1463 | 330 |
| 1832 | 3300048921 | Ga0496118_0028682 | Ga0496118_0028682_2228_3220 | 330 |
| 1833 | 3300048921 | Ga0496118_0038269 | Ga0496118_0038269_666_1658 | 330 |
| 1834 | 3300048921 | Ga0496118_0051085 | Ga0496118_0051085_1805_2800 | 330 |
| 1835 | 3300048921 | Ga0496118_0059249 | Ga0496118_0059249_94_1098 | 330 |
| 1836 | 3300048922 | Ga0496119_0012012 | Ga0496119_0012012_3503_4507 | 330 |
| 1837 | 3300048922 | Ga0496119_0021565 | Ga0496119_0021565_2119_3111 | 330 |
| 1838 | 3300048922 | Ga0496119_0028988 | Ga0496119_0028988_26_1018 | 330 |
| 1839 | 3300048922 | Ga0496119_0041198 | Ga0496119_0041198_1059_2054 | 330 |
| 1840 | 3300048922 | Ga0496119_0050527 | Ga0496119_0050527_187_1179 | 330 |
| 1841 | 3300048923 | Ga0496120_0000100 | Ga0496120_0000100_74201_75193 | 330 |
| 1842 | 3300048923 | Ga0496120_0005160 | Ga0496120_0005160_3234_4226 | 330 |
| 1843 | 3300048923 | Ga0496120_0030888 | Ga0496120_0030888_442_1434 | 330 |
| 1844 | 3300048924 | Ga0496121_0017992 | Ga0496121_0017992_1906_2898 | 330 |
| 1845 | 3300048924 | Ga0496121_0037009 | Ga0496121_0037009_3030_4022 | 330 |
| 1846 | 3300048925 | Ga0496122_0000057 | Ga0496122_0000057_74201_75193 | 330 |
| 1847 | 3300048925 | Ga0496122_0000172 | Ga0496122_0000172_109350_110345 | 330 |
| 1848 | 3300048925 | Ga0496122_0000414 | Ga0496122_0000414_86422_87414 | 330 |
| 1849 | 3300048925 | Ga0496122_0007724 | Ga0496122_0007724_7931_8923 | 330 |
| 1850 | 3300048925 | Ga0496122_0008827 | Ga0496122_0008827_4187_5179 | 330 |
| 1851 | 3300048925 | Ga0496122_0017434 | Ga0496122_0017434_864_1877 | 330 |
| 1852 | 3300048925 | Ga0496122_0077875 | Ga0496122_0077875_142_1134 | 330 |
| 1853 | 3300048926 | Ga0496123_0000096 | Ga0496123_0000096_98722_99714 | 330 |
| 1854 | 3300048926 | Ga0496123_0000132 | Ga0496123_0000132_109398_110393 | 330 |
| 1855 | 3300048926 | Ga0496123_0000839 | Ga0496123_0000839_18891_19883 | 330 |
| 1856 | 3300048926 | Ga0496123_0014229 | Ga0496123_0014229_3351_4343 | 330 |
| 1857 | 3300048926 | Ga0496123_0015265 | Ga0496123_0015265_1679_2671 | 330 |
| 1858 | 3300048926 | Ga0496123_0031285 | Ga0496123_0031285_1275_2267 | 330 |
| 1859 | 3300048927 | Ga0496124_0000091 | Ga0496124_0000091_8066_9070 | 330 |
| 1860 | 3300048927 | Ga0496124_0008171 | Ga0496124_0008171_1855_2847 | 330 |
| 1861 | 3300048927 | Ga0496124_0009055 | Ga0496124_0009055_7501_8493 | 330 |
| 1862 | 3300048927 | Ga0496124_0009134 | Ga0496124_0009134_1095_2087 | 330 |
| 1863 | 3300048927 | Ga0496124_0020257 | Ga0496124_0020257_3359_4426 | 330 |
| 1864 | 3300048927 | Ga0496124_0050863 | Ga0496124_0050863_1236_2228 | 330 |
| 1865 | 3300048927 | Ga0496124_0189062 | Ga0496124_0189062_446_1483 | 330 |
| 1866 | 3300048927 | Ga0496124_0197883 | Ga0496124_0197883_251_1246 | 330 |
| 1867 | 3300048928 | Ga0496125_0002982 | Ga0496125_0002982_13635_14627 | 330 |
| 1868 | 3300048928 | Ga0496125_0005688 | Ga0496125_0005688_1099_2091 | 330 |
| 1869 | 3300048928 | Ga0496125_0019065 | Ga0496125_0019065_2874_3866 | 330 |
| 1870 | 3300048928 | Ga0496125_0024814 | Ga0496125_0024814_1589_2581 | 330 |
| 1871 | 3300048928 | Ga0496125_0027777 | Ga0496125_0027777_216_1220 | 330 |
| 1872 | 3300048928 | Ga0496125_0063263 | Ga0496125_0063263_1552_2565 | 330 |
| 1873 | 3300048928 | Ga0496125_0121785 | Ga0496125_0121785_336_1328 | 330 |
| 1874 | 3300048929 | Ga0496126_0000188 | Ga0496126_0000188_42282_43274 | 330 |
| 1875 | 3300048929 | Ga0496126_0012848 | Ga0496126_0012848_98_1102 | 330 |
| 1876 | 3300048929 | Ga0496126_0327368 | Ga0496126_0327368_46_1041 | 330 |
| 1877 | 3300049568 | Ga0501031_0000002 | Ga0501031_0000002_171332_172327 | 330 |
| 1878 | 3300049569 | Ga0501032_0000004 | Ga0501032_0000004_45296_46291 | 330 |
| 1879 | 3300049569 | Ga0501032_0000774 | Ga0501032_0000774_22955_23959 | 330 |
| 1880 | 3300049570 | Ga0501033_0000016 | Ga0501033_0000016_171168_172163 | 330 |
| 1881 | 3300049570 | Ga0501033_0000776 | Ga0501033_0000776_3959_4951 | 330 |
| 1882 | 3300049570 | Ga0501033_0003501 | Ga0501033_0003501_125_1129 | 330 |
| 1883 | 3300049570 | Ga0501033_0071410 | Ga0501033_0071410_1023_2027 | 330 |
| 1884 | 3300049570 | Ga0501033_0186557 | Ga0501033_0186557_137_1135 | 330 |
| 1885 | 3300049571 | Ga0501034_0000011 | Ga0501034_0000011_45296_46291 | 330 |
| 1886 | 3300049571 | Ga0501034_0000012 | Ga0501034_0000012_265845_266849 | 330 |
| 1887 | 3300049571 | Ga0501034_0002012 | Ga0501034_0002012_3229_4302 | 330 |
| 1888 | 3300049571 | Ga0501034_0031563 | Ga0501034_0031563_4299_5303 | 330 |
| 1889 | 3300049571 | Ga0501034_0181817 | Ga0501034_0181817_675_1673 | 330 |
| 1890 | 3300049571 | Ga0501034_0266330 | Ga0501034_0266330_16_1089 | 330 |
| 1891 | 3300049572 | Ga0501036_0000001 | Ga0501036_0000001_45296_46291 | 330 |
| 1892 | 3300049572 | Ga0501036_0209735 | Ga0501036_0209735_80_1072 | 330 |
| 1893 | 3300049573 | Ga0501037_0000006 | Ga0501037_0000006_171171_172166 | 330 |
| 1894 | 3300049573 | Ga0501037_0000227 | Ga0501037_0000227_17199_18203 | 330 |
| 1895 | 3300049573 | Ga0501037_0048724 | Ga0501037_0048724_102_1139 | 330 |
| 1896 | 3300049573 | Ga0501037_0073188 | Ga0501037_0073188_1229_2233 | 330 |
| 1897 | 3300049574 | Ga0501038_0000003 | Ga0501038_0000003_45296_46291 | 330 |
| 1898 | 3300049574 | Ga0501038_0052891 | Ga0501038_0052891_661_1653 | 330 |
| 1899 | 3300049574 | Ga0501038_0100886 | Ga0501038_0100886_358_1362 | 330 |
| 1900 | 3300049574 | Ga0501038_0132517 | Ga0501038_0132517_312_1316 | 330 |
| 1901 | 3300049574 | Ga0501038_0141728 | Ga0501038_0141728_796_1800 | 330 |
| 1902 | 3300049574 | Ga0501038_0177975 | Ga0501038_0177975_66_1070 | 330 |
| 1903 | 3300049574 | Ga0501038_0274653 | Ga0501038_0274653_172_1182 | 330 |
| 1904 | 3300049575 | Ga0501039_0000004 | Ga0501039_0000004_45296_46291 | 330 |
| 1905 | 3300049575 | Ga0501039_0082646 | Ga0501039_0082646_161_1198 | 330 |
| 1906 | 3300049575 | Ga0501039_0127525 | Ga0501039_0127525_502_1506 | 330 |
| 1907 | 3300049576 | Ga0501040_0007583 | Ga0501040_0007583_3589_4584 | 330 |
| 1908 | 3300049576 | Ga0501040_0126861 | Ga0501040_0126861_546_1553 | 330 |
| 1909 | 3300049579 | Ga0501043_0000396 | Ga0501043_0000396_31555_32559 | 330 |
| 1910 | 3300049579 | Ga0501043_0000765 | Ga0501043_0000765_15248_16243 | 330 |
| 1911 | 3300049579 | Ga0501043_0192321 | Ga0501043_0192321_350_1348 | 330 |
| 1912 | 3300049579 | Ga0501043_0279836 | Ga0501043_0279836_256_1260 | 330 |
| 1913 | 3300049579 | Ga0501043_0317325 | Ga0501043_0317325_148_1152 | 330 |
| 1914 | 3300049581 | Ga0501047_0007626 | Ga0501047_0007626_6806_7801 | 330 |
| 1915 | 3300049581 | Ga0501047_0010616 | Ga0501047_0010616_1299_2303 | 330 |
| 1916 | 3300049581 | Ga0501047_0163647 | Ga0501047_0163647_123_1115 | 330 |
| 1917 | 3300049582 | Ga0501048_0257784 | Ga0501048_0257784_174_1178 | 330 |
| 1918 | 3300049584 | Ga0501068_0032215 | Ga0501068_0032215_1405_2409 | 330 |
| 1919 | 3300049584 | Ga0501068_0109845 | Ga0501068_0109845_347_1339 | 330 |
| 1920 | 3300049585 | Ga0501069_0000068 | Ga0501069_0000068_31116_32120 | 330 |
| 1921 | 3300049585 | Ga0501069_0007152 | Ga0501069_0007152_3353_4357 | 330 |
| 1922 | 3300049586 | Ga0501070_0001073 | Ga0501070_0001073_7447_8451 | 330 |
| 1923 | 3300049586 | Ga0501070_0003655 | Ga0501070_0003655_512_1516 | 330 |
| 1924 | 3300049586 | Ga0501070_0093798 | Ga0501070_0093798_817_1827 | 330 |
| 1925 | 3300049588 | Ga0501072_0108870 | Ga0501072_0108870_118_1125 | 330 |
| 1926 | 3300049589 | Ga0501073_0039656 | Ga0501073_0039656_138_1142 | 330 |
| 1927 | 3300049589 | Ga0501073_0052415 | Ga0501073_0052415_1348_2358 | 330 |
| 1928 | 3300049589 | Ga0501073_0055592 | Ga0501073_0055592_1745_2749 | 330 |
| 1929 | 3300049589 | Ga0501073_0182092 | Ga0501073_0182092_43_1035 | 330 |
| 1930 | 3300049590 | Ga0501074_0000088 | Ga0501074_0000088_42608_43612 | 330 |
| 1931 | 3300049590 | Ga0501074_0006992 | Ga0501074_0006992_277_1281 | 330 |
| 1932 | 3300049742 | Ga0501080_0030375 | Ga0501080_0030375_1640_2632 | 330 |
| 1933 | 3300049742 | Ga0501080_0055629 | Ga0501080_0055629_326_1330 | 330 |
| 1934 | 3300049742 | Ga0501080_0124974 | Ga0501080_0124974_409_1413 | 330 |
| 1935 | 3300049744 | Ga0501083_0000065 | Ga0501083_0000065_16658_17662 | 330 |
| 1936 | 3300049776 | Ga0501280_001626 | Ga0501280_001626_1983_2978 | 330 |
| 1937 | 3300049822 | Ga0501035_0000009 | Ga0501035_0000009_264537_265532 | 330 |
| 1938 | 3300049822 | Ga0501035_0000185 | Ga0501035_0000185_39570_40574 | 330 |
| 1939 | 3300049822 | Ga0501035_0000245 | Ga0501035_0000245_2719_3723 | 330 |
| 1940 | 3300049822 | Ga0501035_0000882 | Ga0501035_0000882_24657_25649 | 330 |
| 1941 | 3300049822 | Ga0501035_0011959 | Ga0501035_0011959_3880_4884 | 330 |
| 1942 | 3300049822 | Ga0501035_0022247 | Ga0501035_0022247_1679_2683 | 330 |
| 1943 | 3300049822 | Ga0501035_0037310 | Ga0501035_0037310_1330_2334 | 330 |
| 1944 | 3300049822 | Ga0501035_0123885 | Ga0501035_0123885_862_1866 | 330 |
| 1945 | 3300049822 | Ga0501035_0134079 | Ga0501035_0134079_1002_1994 | 330 |
| 1946 | 3300049822 | Ga0501035_0258123 | Ga0501035_0258123_302_1297 | 330 |
| 1947 | 3300049823 | Ga0501044_0000003 | Ga0501044_0000003_42610_43614 | 330 |
| 1948 | 3300049823 | Ga0501044_0000005 | Ga0501044_0000005_45296_46291 | 330 |
| 1949 | 3300049823 | Ga0501044_0039557 | Ga0501044_0039557_1338_2348 | 330 |
| 1950 | 3300049823 | Ga0501044_0073722 | Ga0501044_0073722_170_1162 | 330 |
| 1951 | 3300049823 | Ga0501044_0433311 | Ga0501044_0433311_147_1151 | 330 |
| 1952 | 3300049824 | Ga0501045_0051974 | Ga0501045_0051974_1582_2589 | 330 |
| 1953 | 3300050489 | nmdc:mga03683_53243_c1 | nmdc:mga03683_53243_c1_223_1215 | 330 |
| 1954 | 3300050490 | nmdc:mga03n38_64472_c1 | nmdc:mga03n38_64472_c1_610_1611 | 330 |
| 1955 | 3300050491 | nmdc:mga00v17_130629_c1 | nmdc:mga00v17_130629_c1_91_1083 | 330 |
| 1956 | 3300050491 | nmdc:mga00v17_17_c1 | nmdc:mga00v17_17_c1_47840_48832 | 330 |
| 1957 | 3300050492 | nmdc:mga0yw44_101_c1 | nmdc:mga0yw44_101_c1_21642_22634 | 330 |
| 1958 | 3300050492 | nmdc:mga0yw44_19418_c1 | nmdc:mga0yw44_19418_c1_247_1251 | 330 |
| 1959 | 3300050493 | nmdc:mga0k408_8787_c1 | nmdc:mga0k408_8787_c1_487_1479 | 330 |
| 1960 | 3300050494 | nmdc:mga06z11_13972_c1 | nmdc:mga06z11_13972_c1_2199_3191 | 330 |
| 1961 | 3300050516 | nmdc:mga0sz30_10915_c1 | nmdc:mga0sz30_10915_c1_643_1635 | 330 |
| 1962 | 3300050516 | nmdc:mga0sz30_121_c1 | nmdc:mga0sz30_121_c1_11831_12823 | 330 |
| 1963 | 3300050516 | nmdc:mga0sz30_19108_c2 | nmdc:mga0sz30_19108_c2_1225_2217 | 330 |
| 1964 | 3300050516 | nmdc:mga0sz30_42061_c1 | nmdc:mga0sz30_42061_c1_602_1594 | 330 |
| 1965 | 3300053085 | Ga0495619_0024481 | Ga0495619_0024481_1988_2986 | 330 |
| 1966 | 3300053086 | Ga0500578_0132496 | Ga0500578_0132496_483_1475 | 330 |
| 1967 | 3300053118 | Ga0500594_0003013 | Ga0500594_0003013_190_1182 | 330 |
| 1968 | 3300053125 | Ga0500618_011157 | Ga0500618_011157_859_1851 | 330 |
| 1969 | 3300053134 | Ga0500658_0002401 | Ga0500658_0002401_3112_4104 | 330 |
| 1970 | 3300053137 | Ga0500561_0006852 | Ga0500561_0006852_747_1739 | 330 |
| 1971 | 3300053139 | Ga0500568_0007107 | Ga0500568_0007107_2778_3770 | 330 |
| 1972 | 3300053148 | Ga0500590_017641 | Ga0500590_017641_2532_3530 | 330 |
| 1973 | 3300053148 | Ga0500590_061267 | Ga0500590_061267_360_1364 | 330 |
| 1974 | 3300053153 | Ga0500616_0000771 | Ga0500616_0000771_12833_13828 | 330 |
| 1975 | 3300053153 | Ga0500616_0015338 | Ga0500616_0015338_1042_2034 | 330 |
| 1976 | 3300053153 | Ga0500616_0017450 | Ga0500616_0017450_1994_2986 | 330 |
| 1977 | 3300053153 | Ga0500616_0018766 | Ga0500616_0018766_191_1270 | 330 |
| 1978 | 3300053155 | Ga0500620_000347 | Ga0500620_000347_7347_8342 | 330 |
| 1979 | 3300053156 | Ga0500622_0005550 | Ga0500622_0005550_4573_5565 | 330 |
| 1980 | 3300053157 | Ga0500624_000443 | Ga0500624_000443_2632_3624 | 330 |
| 1981 | 3300053158 | Ga0500627_0019857 | Ga0500627_0019857_452_1444 | 330 |
| 1982 | 3300053160 | Ga0500633_0001730 | Ga0500633_0001730_2041_3033 | 330 |
| 1983 | 3300053161 | Ga0500634_0000019 | Ga0500634_0000019_78134_79171 | 330 |
| 1984 | 3300053177 | Ga0500636_0000038 | Ga0500636_0000038_68889_69881 | 330 |
| 1985 | 3300053177 | Ga0500636_0003227 | Ga0500636_0003227_3061_4053 | 330 |
| 1986 | 3300053733 | Ga0500552_010052 | Ga0500552_010052_49_1053 | 330 |
| 1987 | 3300055283 | Ga0500661_014073 | Ga0500661_014073_110_1114 | 330 |
| 1988 | 3300059493 | Ga0587077_023705 | Ga0587077_023705_48_1043 | 330 |
| 1989 | 3300059505 | Ga0587083_0029198 | Ga0587083_0029198_11_1009 | 330 |
| 1990 | 3300059510 | Ga0587090_000202 | Ga0587090_000202_3282_4274 | 330 |
| 1991 | iso_pu_bacteria | 2751185821 | 2753463398 | 330 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4hkt-assembly1.cif.gz_D | crystal structure of a putative myo-inositol dehydrogenase from sinorhizobium meliloti 1021 (target psi-012312) | 0.985 | 2 | 330 |
| 4hkt-assembly1.cif.gz_D | crystal structure of a putative myo-inositol dehydrogenase from sinorhizobium meliloti 1021 (target psi-012312) | 0.9821 | 2 | 330 |
| 3ezy-assembly1.cif.gz_B | crystal structure of probable dehydrogenase tm_0414 from thermotoga maritima | 0.9702 | 3 | 329 |
| 3ezy-assembly1.cif.gz_C | crystal structure of probable dehydrogenase tm_0414 from thermotoga maritima | 0.9699 | 3 | 329 |
| 3euw-assembly1.cif.gz_B | crystal structure of a myo-inositol dehydrogenase from corynebacterium glutamicum atcc 13032 | 0.9692 | 1 | 330 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4hktB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 1.004 | 2 | 119 | 3.40.50.720 |
| 4hktB01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9956 | 2 | 119 | 3.40.50.720 |
| 4hktD02 | Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 | 0.9762 | 121 | 330 | 3.30.360.10 |
| 3ezyC02 | Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 | 0.971 | 121 | 329 | 3.30.360.10 |
| 4hktD02 | Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 | 0.967 | 121 | 330 | 3.30.360.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6M0QYP2-F1-model_v4 | Inositol 2-dehydrogenase (EC 1.1.1.18) | 0.9879 | 1 | 329 |
GO:0000166
GO:0050112 |
| AF-A0A7C3ZRM2-F1-model_v4 | Inositol 2-dehydrogenase (EC 1.1.1.18) | 0.9862 | 1 | 328 |
GO:0000166
GO:0050112 |
| AF-A0A6M0QYP2-F1-model_v4 | Inositol 2-dehydrogenase (EC 1.1.1.18) | 0.982 | 1 | 329 |
GO:0000166
GO:0050112 |
| AF-A0A7C3ZRM2-F1-model_v4 | Inositol 2-dehydrogenase (EC 1.1.1.18) | 0.9803 | 1 | 328 |
GO:0000166
GO:0050112 |
| AF-A0A6H5JKB6-F1-model_v4 | Uncharacterized protein | 0.9774 | 2 | 329 |
GO:0000166
GO:0005737 GO:0006740 GO:0016491 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar