F496211

General Info

Members Datasets Scaffolds Average Seq Length
1991 1252 923 328

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2751185821|2753463398
Length 381
Sequence ERGAWRGRKRPLPPLIDLLSADASRPQRLCAMSVNIIAHHPVWNRNSRETKMTVRFGLLGAGRIGKVHAKAVSGNPDAVLVAVADAFSAAAEAIAKAYGCEVRTIEAIEAASDIDAVVICTPTDTHADLIERFARAGKAIFCEKPIDLDVDRVKACLKVVSETRAKLMVGFNRRFDPHFMAVRKAIDDGRIGDVEMVTITSRDPGAPPVDYIKRSGGIFRDMTIHDFDMARFLLGEEPVSVTATAAVLVDKAIGEAGDFDSVSVILQTASGKQAVISNSRRATYGYDQRIEVHGSKGAVAAENQRPVSIEIATGEGYTRPPLHDFFMTRYTEAYANEIESFIAAIEKGAEITPSGKDGLAALALADAAVRSVAEKRQISVA

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501050 Microvirga lupini Lut6 Isolate Nodule
4 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
5 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
6 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
7 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
8 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
9 2509276019 Ensifer aridi TW10 Isolate Nodule
10 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
11 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
12 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
13 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
14 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
15 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
16 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
17 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
18 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
19 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
20 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
21 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
22 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
23 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
24 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
25 2512875024 Mesorhizobium loti R88b Isolate Nodule
26 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
27 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
28 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
29 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
30 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
31 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
32 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
33 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
34 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
35 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
36 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
37 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
38 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
39 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
40 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
41 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
42 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
43 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
44 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
45 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
46 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
47 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
48 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
49 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
50 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
51 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
52 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
53 2516143018 Ensifer sp. BR816 Isolate Nodule
54 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
55 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
56 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
57 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
58 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
59 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
60 2519899620 Rhizobium sp. Pop5 Isolate Nodule
61 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
62 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
63 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
64 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
65 2534681786 Brucella suis 92/29 Isolate Unclassified
66 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
67 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
68 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
69 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
70 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
71 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
72 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
73 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
74 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
75 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
76 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
77 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
78 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
79 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
80 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
81 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
82 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
83 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
84 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
85 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
86 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
87 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
88 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
89 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
90 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
91 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
92 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
93 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
94 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
95 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
96 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
97 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
98 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
99 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
100 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
101 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
102 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
103 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
104 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
105 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
106 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
107 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
108 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
109 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
110 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
111 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
112 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
113 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
114 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
115 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
116 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
117 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
118 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
119 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
120 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
121 2643221557 Ensifer sp. Root558 Isolate Unclassified
122 2643221558 Rhizobium sp. Root149 Isolate Unclassified
123 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
124 2643221568 Rhizobium sp. Root564 Isolate Unclassified
125 2643221580 Devosia sp. Root635 Isolate Unclassified
126 2643221582 Rhizobium sp. Root651 Isolate Unclassified
127 2643221591 Devosia sp. Root685 Isolate Unclassified
128 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
129 2643221599 Rhizobium sp. Root708 Isolate Unclassified
130 2643221607 Rhizobium sp. Root73 Isolate Unclassified
131 2643221610 Ensifer sp. Root74 Isolate Unclassified
132 2643221618 Ensifer sp. Root231 Isolate Unclassified
133 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
134 2643221626 Ensifer sp. Root31 Isolate Unclassified
135 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
136 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
137 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
138 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
139 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
140 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
141 2643221655 Ensifer sp. Root1252 Isolate Unclassified
142 2643221659 Ensifer sp. Root127 Isolate Unclassified
143 2643221668 Ensifer sp. Root423 Isolate Unclassified
144 2643221674 Devosia sp. Root436 Isolate Unclassified
145 2643221675 Ensifer sp. Root1298 Isolate Unclassified
146 2643221680 Ensifer sp. Root1312 Isolate Unclassified
147 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
148 2643221688 Rhizobium sp. Root482 Isolate Unclassified
149 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
150 2643221693 Rhizobium sp. Root491 Isolate Unclassified
151 2643221698 Ensifer sp. Root142 Isolate Unclassified
152 2643221712 Ensifer sp. Root258 Isolate Unclassified
153 2643221718 Rhizobium sp. Root268 Isolate Unclassified
154 2643221719 Rhizobium sp. Root274 Isolate Unclassified
155 2643221723 Ensifer sp. Root278 Isolate Unclassified
156 2643221726 Ensifer sp. Root954 Isolate Unclassified
157 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
158 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
159 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
160 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
161 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
162 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
163 2718217882 Rhizobium sp. N741 Isolate Nodule
164 2718217927 Rhizobium sp. N324 Isolate Nodule
165 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
166 2718218009 Rhizobium sp. N561 Isolate Nodule
167 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
168 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
169 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
170 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
171 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
172 2718218363 Rhizobium sp. N113 Isolate Nodule
173 2718218365 Rhizobium sp. N731 Isolate Nodule
174 2718218366 Rhizobium sp. N621 Isolate Nodule
175 2718218423 Rhizobium sp. N941 Isolate Nodule
176 2721755514 Rhizobium sp. N6212 Isolate Nodule
177 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
178 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
179 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
180 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
181 2721755809 Rhizobium sp. N541 Isolate Nodule
182 2721755810 Rhizobium sp. N871 Isolate Nodule
183 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
184 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
185 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
186 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
187 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
188 2728369365 Rhizobium sp. N1341 Isolate Nodule
189 2728369397 Rhizobium sp. N1314 Isolate Nodule
190 2738541293 Rhizobium sp. GV031 Isolate Unclassified
191 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
192 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
193 2738543024 Aminobacter sp. AP02 Isolate Unclassified
194 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
195 2751185800 Brucella pituitosa AA2 Isolate Unclassified
196 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
197 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
198 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
199 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
200 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
201 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
202 2773857925 Microvirga vignae BR3299 Isolate Unclassified
203 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
204 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
205 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
206 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
207 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
208 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
209 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
210 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
211 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
212 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
213 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
214 2791355256 Rhizobium sp. M10 Isolate Nodule
215 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
216 2791355260 Rhizobium sp. L9 Isolate Nodule
217 2791355261 Rhizobium sp. J15 Isolate Nodule
218 2791355262 Rhizobium sp. M1 Isolate Nodule
219 2791355263 Rhizobium chutanense C5 Isolate Nodule
220 2791355264 Rhizobium sp. S9 Isolate Nodule
221 2791355265 Rhizobium sp. H4 Isolate Nodule
222 2791355266 Rhizobium sp. L43 Isolate Nodule
223 2791355267 Rhizobium sp. L18 Isolate Nodule
224 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
225 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
226 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
227 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
228 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
229 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
230 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
231 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
232 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
233 2802429633 Rhizobium anhuiense J3 Isolate Nodule
234 2802429634 Rhizobium anhuiense S10 Isolate Nodule
235 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
236 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
237 2802429637 Rhizobium anhuiense C15 Isolate Nodule
238 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
239 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
240 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
241 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
242 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
243 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
244 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
245 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
246 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
247 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
248 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
249 2838048938 Rhizobium pisi 27/80 Isolate Nodule
250 2838061910 Rhizobium phaseoli L15 Isolate Nodule
251 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
252 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
253 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
254 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
255 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
256 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
257 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
258 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
259 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
260 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
261 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
262 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
263 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
264 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
265 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
266 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
267 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
268 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
269 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
270 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
271 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
272 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
273 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
274 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
275 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
276 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
277 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
278 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
279 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
280 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
281 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
282 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
283 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
284 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
285 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
286 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
287 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
288 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
289 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
290 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
291 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
292 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
293 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
294 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
295 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
296 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
297 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
298 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
299 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
300 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
301 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
302 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
303 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
304 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
305 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
306 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
307 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
308 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
309 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
310 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
311 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
312 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
313 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
314 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
315 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
316 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
317 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
318 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
319 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
320 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
321 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
322 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
323 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
324 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
325 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
326 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
327 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
328 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
329 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
330 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
331 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
332 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
333 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
334 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
335 2844163670 Ensifer sp. 1H6 Isolate Unclassified
336 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
337 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
338 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
339 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
340 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
341 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
342 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
343 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
344 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
345 2854911287 Brucella lupini LUP21 Isolate Unclassified
346 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
347 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
348 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
349 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
350 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
351 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
352 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
353 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
354 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
355 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
356 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
357 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
358 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
359 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
360 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
361 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
362 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
363 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
364 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
365 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
366 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
367 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
368 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
369 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
370 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
371 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
372 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
373 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
374 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
375 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
376 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
377 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
378 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
379 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
380 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
381 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
382 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
383 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
384 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
385 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
386 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
387 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
388 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
389 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
390 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
391 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
392 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
393 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
394 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
395 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
396 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
397 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
398 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
399 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
400 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
401 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
402 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
403 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
404 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
405 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
406 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
407 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
408 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
409 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
410 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
411 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
412 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
413 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
414 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
415 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
416 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
417 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
418 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
419 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
420 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
421 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
422 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
423 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
424 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
425 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
426 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
427 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
428 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
429 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
430 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
431 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
432 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
433 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
434 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
435 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
436 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
437 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
438 2902330777 Methylobacterium sp. 2A Isolate Unclassified
439 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
440 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
441 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
442 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
443 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
444 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
445 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
446 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
447 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
448 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
449 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
450 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
451 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
452 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
453 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
454 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
455 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
456 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
457 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
458 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
459 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
460 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
461 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
462 2909042592 Labrys sp. LIt4 Isolate Nodule
463 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
464 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
465 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
466 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
467 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
468 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
469 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
470 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
471 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
472 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
473 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
474 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
475 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
476 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
477 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
478 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
479 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
480 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
481 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
482 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
483 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
484 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
485 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
486 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
487 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified
488 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
489 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
490 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
491 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
492 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
493 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
494 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
495 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
496 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
497 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
498 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
499 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
500 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
501 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
502 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
503 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
504 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
505 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
506 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
507 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
508 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
509 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
510 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
511 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
512 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
513 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
514 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
515 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
516 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
517 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
518 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
519 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
520 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
521 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
522 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
523 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
524 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
525 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
526 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
527 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
528 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
529 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
530 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
531 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
532 2932401849 Devosia sp. 2618 Isolate Rhizosphere
533 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
534 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
535 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
536 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
537 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
538 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
539 2933599457 Rhizobium phaseoli M3 Isolate Nodule
540 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
541 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
542 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
543 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
544 2936381700 Rhizobium chutanense C16 Isolate Unclassified
545 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
546 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
547 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
548 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
549 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
550 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
551 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
552 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
553 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
554 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
555 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
556 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
557 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
558 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
559 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
560 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
561 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
562 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
563 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
564 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
565 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
566 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
567 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
568 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
569 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
570 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
571 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
572 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
573 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
574 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
575 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
576 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
577 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
578 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
579 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
580 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
581 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
582 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
583 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
584 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
585 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
586 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
587 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
588 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
589 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
590 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
591 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
592 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
593 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
594 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
595 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
596 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
597 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
598 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
599 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
600 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
601 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
602 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
603 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
604 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
605 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
606 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
607 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
608 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
609 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
610 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
611 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
612 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
613 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
614 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
615 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
616 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
617 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
618 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
619 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
620 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
621 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
622 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
623 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
624 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
625 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
626 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
627 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
628 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
629 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
630 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
631 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
632 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
633 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
634 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
635 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
636 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
637 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
638 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
639 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
640 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
641 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
642 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
643 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
644 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
645 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
646 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
647 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
648 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
649 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
650 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
651 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
652 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
653 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
654 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
655 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
656 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
657 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
658 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
659 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
660 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
661 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
662 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
663 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
664 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
665 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
666 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
667 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
668 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
669 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
670 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
671 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
672 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
673 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
674 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
675 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
676 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
677 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
678 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
679 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
680 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
681 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
682 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
683 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
684 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
685 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
686 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
687 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
688 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
689 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
690 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
691 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
692 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
693 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
694 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
695 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
696 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
697 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
698 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
699 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
700 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
701 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
702 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
703 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
704 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
705 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
706 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
707 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
708 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
709 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
710 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
711 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
712 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
713 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
714 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
715 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
716 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
717 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
718 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
719 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
720 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
721 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
722 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
723 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
724 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
725 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
726 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
727 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
728 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
729 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
730 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
731 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
732 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
733 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
734 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
735 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
736 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
737 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
738 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
739 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
740 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
741 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
742 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
743 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
744 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
745 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
746 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
747 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
748 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
749 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
750 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
751 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
752 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
753 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
754 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
755 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
756 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
757 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
758 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
759 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
760 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
761 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
762 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
763 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
764 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
765 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
766 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
767 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
768 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
769 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
770 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
771 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
772 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
773 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
774 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
775 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
776 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
777 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
778 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
779 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
780 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
781 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
782 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
783 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
784 2996887358 Rhizobium sp. R711 Isolate Nodule
785 2996893221 Rhizobium sp. R635 Isolate Nodule
786 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
787 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
788 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
789 3004167301 Mesorhizobium loti 582 Isolate Unclassified
790 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
791 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
792 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
793 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
794 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
795 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
796 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
797 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
798 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
799 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
800 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
801 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
802 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
803 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
804 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
805 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
806 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
807 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
808 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
809 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
810 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
811 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
812 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
813 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
814 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
815 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
816 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
817 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
818 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
819 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
820 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
821 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
822 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
823 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
824 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
825 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
826 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
827 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
828 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
829 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
830 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
831 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
832 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
833 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
834 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
835 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
836 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
837 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
838 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
839 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
840 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
841 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
842 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
843 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
844 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
845 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
846 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
847 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
848 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
849 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
850 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
851 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
852 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
853 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
854 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
855 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
856 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
857 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
858 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
859 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
860 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
861 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
862 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
863 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
864 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
865 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
866 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
867 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
868 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
869 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
870 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
871 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
872 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
873 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
874 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
875 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
876 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
877 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
878 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
879 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
880 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
881 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
882 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
883 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
884 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
885 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
886 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
887 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
888 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
889 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
890 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
891 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
892 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
893 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
894 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
895 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
896 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
897 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
898 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
899 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
900 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
901 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
902 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
903 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
904 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
905 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
906 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
907 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
908 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
909 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
910 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
911 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
912 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
913 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
914 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
915 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
916 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
917 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
918 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
919 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
920 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
921 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
922 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
923 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
924 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
925 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
926 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
927 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
928 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
929 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
930 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
931 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
932 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
933 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
934 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
935 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
936 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
937 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
938 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
939 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
940 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
941 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
942 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
943 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
944 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
945 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
946 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
947 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
948 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
949 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
950 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
951 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
952 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
953 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
954 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
955 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
956 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
957 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
958 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
959 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
960 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
961 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
962 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
963 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
964 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
965 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
966 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
967 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
968 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
969 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
970 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
971 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
972 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
973 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
974 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
975 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
976 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
977 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
978 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
979 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
980 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
981 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
982 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
983 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
984 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
985 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
986 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
987 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
988 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
989 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
990 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
991 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
992 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
993 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
994 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
995 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
996 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
997 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
998 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
999 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
1000 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
1001 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
1002 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
1003 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
1004 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
1005 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
1006 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
1007 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
1008 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
1009 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
1010 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
1011 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
1012 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
1013 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
1014 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
1015 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
1016 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
1017 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
1018 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
1019 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
1020 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
1021 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
1022 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
1023 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
1024 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
1025 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
1026 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
1027 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
1028 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
1029 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
1030 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
1031 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
1032 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
1033 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
1034 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
1035 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
1036 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
1037 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
1038 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
1039 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
1040 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
1041 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
1042 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
1043 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
1044 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
1045 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
1046 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
1047 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
1048 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
1049 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
1050 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
1051 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
1052 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
1053 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
1054 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
1055 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
1056 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
1057 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
1058 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
1059 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
1060 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
1061 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
1062 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
1063 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
1064 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
1065 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
1066 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
1067 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
1068 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
1069 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
1070 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
1071 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
1072 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
1073 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
1074 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
1075 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
1076 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
1077 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
1078 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
1079 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
1080 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
1081 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
1082 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
1083 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
1084 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
1085 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
1086 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
1087 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
1088 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
1089 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
1090 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
1091 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
1092 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
1093 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
1094 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
1095 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
1096 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
1097 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
1098 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
1099 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
1100 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
1101 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
1102 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
1103 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
1104 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
1105 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
1106 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
1107 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
1108 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
1109 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
1110 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
1111 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
1112 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
1113 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
1114 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
1115 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
1116 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
1117 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
1118 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
1119 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
1120 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
1121 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
1122 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
1123 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
1124 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
1125 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
1126 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
1127 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
1128 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
1129 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
1130 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
1131 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
1132 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
1133 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
1134 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
1135 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
1136 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
1137 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
1138 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
1139 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
1140 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
1141 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
1142 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
1143 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
1144 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
1145 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
1146 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
1147 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
1148 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
1149 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
1150 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
1151 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
1152 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
1153 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
1154 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
1155 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
1156 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
1157 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
1158 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
1159 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
1160 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
1161 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
1162 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
1163 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
1164 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
1165 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
1166 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
1167 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
1168 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
1169 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
1170 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
1171 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
1172 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
1173 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
1174 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
1175 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
1176 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
1177 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1178 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1179 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1180 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
1181 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
1182 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
1183 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
1184 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
1185 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
1186 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
1187 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
1188 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
1189 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
1190 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
1191 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
1192 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
1193 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
1194 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
1195 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
1196 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
1197 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
1198 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
1199 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
1200 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
1201 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
1202 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
1203 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
1204 8005258706 Rhizobium sp. R693 Isolate Nodule
1205 8005275841 Rhizobium sp. N4311 Isolate Nodule
1206 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
1207 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
1208 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
1209 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
1210 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
1211 8005321885 Rhizobium sp. R72 Isolate Nodule
1212 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
1213 8005382845 Rhizobium sp. R634 Isolate Nodule
1214 8005395548 Rhizobium sp. R339 Isolate Nodule
1215 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
1216 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
1217 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
1218 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
1219 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
1220 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
1221 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
1222 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
1223 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
1224 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
1225 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
1226 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
1227 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
1228 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
1229 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
1230 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
1231 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
1232 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
1233 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
1234 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
1235 8018176218 Rhizobium sp. N122 Isolate Nodule
1236 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
1237 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
1238 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
1239 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
1240 8024501048 Rhizobium sp. H4 Isolate Nodule
1241 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
1242 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
1243 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
1244 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
1245 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
1246 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
1247 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
1248 8056382006 Rhizobium croatiense 13T Isolate Nodule
1249 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
1250 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule
1251 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
1252 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 46.31
Metatranscriptomes 0.15
Isolates 53.54

Biome Distribution

Category Percentage (%)
Aerial Root 0.25
Bulb 0
Endosphere 12.36
Nodule 41.69
Rhizoplane 1.51
Rhizosphere 29.33
Stem 0
Stem Tuber 0
Unclassified 14.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000201 3300001979 Bacteria 24790
2 JGI25155J39150_1000014 3300002704 Bacteria 196159
3 JGI25156J39149_1000083 3300002705 Bacteria 70138
4 JGI25156J39149_1010500 3300002705 Bacteria 2171
5 JGI25162J39368_1000532 3300002737 Bacteria 28366
6 JGI25154J39366_1000139 3300002738 Bacteria 56829
7 JGI25157J39369_1000110 3300002741 Bacteria 69643
8 JGI25157J39369_1000647 3300002741 Bacteria 19446
9 JGI25152J39213_1000492 3300002773 Bacteria 22380
10 JGI25152J39213_1001051 3300002773 Bacteria 13115
11 JGI25152J39213_1004576 3300002773 Bacteria 4310
12 JGI25152J39213_1007948 3300002773 Bacteria 2685
13 JGI25152J39213_1009306 3300002773 Bacteria 2344
14 JGI25152J39213_1016172 3300002773 Bacteria 1448
15 JGI25150J39212_1000533 3300002774 Bacteria 15466
16 JGI25159J45721_1000008 3300002987 Bacteria 172667
17 JGI25159J45721_1000251 3300002987 Bacteria 25319
18 JGI25151J46595_10000152 3300003187 Bacteria 90443
19 JGI25151J46595_10003146 3300003187 Bacteria 9276
20 JGI25151J46595_10003216 3300003187 Bacteria 9137
21 JGI25151J46595_10020830 3300003187 Bacteria 2756
22 JGI25165J46597_1000078 3300003214 Bacteria 179320
23 JGI25165J46597_1000692 3300003214 Bacteria 26996
24 JGI25165J46597_1000752 3300003214 Bacteria 24944
25 JGI25165J46597_1001515 3300003214 Bacteria 11760
26 JGI25153J46596_10000299 3300003215 Bacteria 37025
27 JGI25153J46596_10003676 3300003215 Bacteria 8492
28 JGI25153J46596_10005962 3300003215 Bacteria 6274
29 JGI25153J46596_10018655 3300003215 Bacteria 2685
30 JGI25160J50197_1000001 3300003354 Bacteria 782301
31 JGI25160J50197_1000033 3300003354 Bacteria 172667
32 JGI25160J50197_1005675 3300003354 Bacteria 5158
33 JGI25160J50197_1015468 3300003354 Bacteria 2502
34 JGI25160J50197_1023193 3300003354 Bacteria 1799
35 JGI25161J50226_1000001 3300003374 Bacteria 655036
36 JGI25161J50226_1000725 3300003374 Bacteria 12789
37 JGI25161J50226_1001797 3300003374 Bacteria 6040
38 JGI25161J50226_1007057 3300003374 Bacteria 1942
39 Ga0055542_1001263 3300003762 Bacteria 13787
40 Ga0055542_1009118 3300003762 Bacteria 1891
41 Ga0055529_1005120 3300003763 Bacteria 1931
42 Ga0055526_1000440 3300003771 Bacteria 33129
43 Ga0055526_1001356 3300003771 Bacteria 17508
44 Ga0055526_1008472 3300003771 Bacteria 5126
45 Ga0055524_1001932 3300003775 Bacteria 11167
46 Ga0055524_1017411 3300003775 Bacteria 2536
47 Ga0055524_1021528 3300003775 Bacteria 2133
48 Ga0055524_1022564 3300003775 Bacteria 2052
49 Ga0055536_1002504 3300003781 Bacteria 10308
50 Ga0055536_1006866 3300003781 Bacteria 5200
51 Ga0055536_1009791 3300003781 Bacteria 3907
52 Ga0055528_1000921 3300003790 Bacteria 19731
53 Ga0055528_1002280 3300003790 Bacteria 10402
54 Ga0055528_1007362 3300003790 Bacteria 4872
55 Ga0055528_1007666 3300003790 Bacteria 4737
56 Ga0055528_1013344 3300003790 Bacteria 3117
57 Ga0055528_1021283 3300003790 Bacteria 2064
58 Ga0055528_1027023 3300003790 Bacteria 1628
59 Ga0055540_1000396 3300003792 Bacteria 35757
60 Ga0055540_1002497 3300003792 Bacteria 9639
61 Ga0055540_1004246 3300003792 Bacteria 6563
62 Ga0055540_1005022 3300003792 Bacteria 5742
63 Ga0055531_10003672 3300003794 Bacteria 9667
64 Ga0055531_10009548 3300003794 Bacteria 4947
65 Ga0058692_1000942 3300003856 Bacteria 11449
66 Ga0058692_1003656 3300003856 Bacteria 4702
67 Ga0055543_1000026 3300004625 Bacteria 136177
68 Ga0055543_1000089 3300004625 Bacteria 79924
69 Ga0055543_1000104 3300004625 Bacteria 73576
70 Ga0055543_1003556 3300004625 Bacteria 4522
71 Ga0065165_1000008 3300005262 Bacteria 334429
72 Ga0065165_1000178 3300005262 Bacteria 113319
73 Ga0065165_1003404 3300005262 Bacteria 11229
74 Ga0070658_10060723 3300005327 Bacteria 3079
75 Ga0070658_10267132 3300005327 Bacteria 1454
76 Ga0070670_100009022 3300005331 Bacteria 8520
77 Ga0068869_100165540 3300005334 Bacteria 1724
78 Ga0068868_100108886 3300005338 Bacteria 2250
79 Ga0070661_100002923 3300005344 Bacteria 11779
80 Ga0070668_100069929 3300005347 Bacteria 2732
81 Ga0070675_100104576 3300005354 Bacteria 2389
82 Ga0070671_100007376 3300005355 Bacteria 8785
83 Ga0070659_100124159 3300005366 Bacteria 2093
84 Ga0070667_100259791 3300005367 Bacteria 1555
85 Ga0070667_100290597 3300005367 Bacteria 1470
86 Ga0070663_100248245 3300005455 Bacteria 1408
87 Ga0070681_10342373 3300005458 Bacteria 1405
88 Ga0068867_100142145 3300005459 Bacteria 1877
89 Ga0070707_100047434 3300005468 Bacteria 4113
90 Ga0070684_100089357 3300005535 Bacteria 2738
91 Ga0068853_100008908 3300005539 Bacteria 8077
92 Ga0068853_100052482 3300005539 Bacteria 3512
93 Ga0068853_100160419 3300005539 Bacteria 2029
94 Ga0070665_100009435 3300005548 Bacteria 9877
95 Ga0070665_100055085 3300005548 Bacteria 3988
96 Ga0070665_100125686 3300005548 Bacteria 2567
97 Ga0068855_100116311 3300005563 Bacteria 3065
98 Ga0068855_100410450 3300005563 Bacteria 1483
99 Ga0070664_100037537 3300005564 Bacteria 4074
100 Ga0070664_100167619 3300005564 Bacteria 1947
101 Ga0068857_100390461 3300005577 Bacteria 1294
102 Ga0068854_100025684 3300005578 Bacteria 4042
103 Ga0068854_100058022 3300005578 Bacteria 2793
104 Ga0068854_100071955 3300005578 Bacteria 2531
105 Ga0068856_100006424 3300005614 Bacteria 11534
106 Ga0068856_100087342 3300005614 Bacteria 3100
107 Ga0068856_100360183 3300005614 Bacteria 1473
108 Ga0068852_100027054 3300005616 Bacteria 4669
109 Ga0068852_100072527 3300005616 Bacteria 3026
110 Ga0068852_100223585 3300005616 Bacteria 1791
111 Ga0068859_100210192 3300005617 Bacteria 2032
112 Ga0068859_100226096 3300005617 Bacteria 1959
113 Ga0068864_100005685 3300005618 Bacteria 10219
114 Ga0068851_10017316 3300005834 Bacteria 3459
115 Ga0068863_100089005 3300005841 Bacteria 2926
116 Ga0068858_100249145 3300005842 Bacteria 1687
117 Ga0070717_10174906 3300006028 Bacteria 1869
118 Ga0075365_10000918 3300006038 Bacteria 12405
119 Ga0075365_10006255 3300006038 Bacteria 6530
120 Ga0075365_10007236 3300006038 Bacteria 6201
121 Ga0075368_10043333 3300006042 Bacteria 1773
122 Ga0075368_10049549 3300006042 Bacteria 1666
123 Ga0075368_10062261 3300006042 Bacteria 1495
124 Ga0075368_10087624 3300006042 Bacteria 1271
125 Ga0075363_100021836 3300006048 Bacteria 3230
126 Ga0075363_100102632 3300006048 Bacteria 1584
127 Ga0075364_10005164 3300006051 Bacteria 7571
128 Ga0075364_10136435 3300006051 Bacteria 1648
129 Ga0075364_10243653 3300006051 Bacteria 1221
130 Ga0075362_10008658 3300006177 Bacteria 3905
131 Ga0075362_10014364 3300006177 Bacteria 3194
132 Ga0075362_10080238 3300006177 Bacteria 1503
133 Ga0075367_10016682 3300006178 Bacteria 4014
134 Ga0075369_10016027 3300006186 Bacteria 3016
135 Ga0075369_10021994 3300006186 Bacteria 2627
136 Ga0075369_10028100 3300006186 Bacteria 2356
137 Ga0075366_10018014 3300006195 Bacteria 4075
138 Ga0075366_10098274 3300006195 Bacteria 1756
139 Ga0075370_10004915 3300006353 Bacteria 6565
140 Ga0075370_10047656 3300006353 Bacteria 2427
141 Ga0075370_10079099 3300006353 Bacteria 1888
142 Ga0075370_10084296 3300006353 Bacteria 1829
143 Ga0075428_100005831 3300006844 Bacteria 13687
144 Ga0075431_100223808 3300006847 Bacteria 1919
145 Ga0068865_100124914 3300006881 Bacteria 1919
146 Ga0097620_100210201 3300006931 Bacteria 2032
147 Ga0097620_100226094 3300006931 Bacteria 1959
148 Ga0079104_1002347 3300006946 Bacteria 10364
149 Ga0079104_1002740 3300006946 Bacteria 8966
150 Ga0099826_10012941 3300006948 Bacteria 6289
151 Ga0105251_10019755 3300009011 Bacteria 3550
152 Ga0105240_10000014 3300009093 Bacteria 482033
153 Ga0105240_10010969 3300009093 Bacteria 12690
154 Ga0105240_10047959 3300009093 Bacteria 5402
155 Ga0105240_10114335 3300009093 Bacteria 3260
156 Ga0105240_10120900 3300009093 Bacteria 3153
157 Ga0111539_10023692 3300009094 Bacteria 7543
158 Ga0105245_10130450 3300009098 Bacteria 2357
159 Ga0105245_10133991 3300009098 Bacteria 2326
160 Ga0105243_10025395 3300009148 Bacteria 4527
161 Ga0105241_10076691 3300009174 Bacteria 2607
162 Ga0105241_10236086 3300009174 Bacteria 1543
163 Ga0105248_10021814 3300009177 Bacteria 7097
164 Ga0105248_10172269 3300009177 Bacteria 2440
165 Ga0105248_10197854 3300009177 Bacteria 2265
166 Ga0105237_10000038 3300009545 Bacteria 190707
167 Ga0105237_10003649 3300009545 Bacteria 18153
168 Ga0105237_10032245 3300009545 Bacteria 5305
169 Ga0105237_10038932 3300009545 Bacteria 4801
170 Ga0105237_10051914 3300009545 Bacteria 4118
171 Ga0105237_10098212 3300009545 Bacteria 2919
172 Ga0105237_10161699 3300009545 Bacteria 2238
173 Ga0105238_10001985 3300009551 Bacteria 20609
174 Ga0105238_10015974 3300009551 Bacteria 7595
175 Ga0105238_10078391 3300009551 Bacteria 3294
176 Ga0105238_10452502 3300009551 Bacteria 1281
177 Ga0123341_1000035 3300009765 Bacteria 62072
178 Ga0123342_1009384 3300009766 Bacteria 11748
179 Ga0123342_1026071 3300009766 Bacteria 3439
180 Ga0123342_1028788 3300009766 Bacteria 2956
181 Ga0105239_10000108 3300010375 Bacteria 116364
182 Ga0105239_10122340 3300010375 Bacteria 2891
183 Ga0105239_10153248 3300010375 Bacteria 2573
184 Ga0105239_10161994 3300010375 Bacteria 2500
185 Ga0105239_10354527 3300010375 Bacteria 1656
186 Ga0105246_10076598 3300011119 Bacteria 2370
187 Ga0105246_10091436 3300011119 Bacteria 2193
188 Ga0105246_10207784 3300011119 Bacteria 1526
189 Ga0157371_10000187 3300013102 Bacteria 91186
190 Ga0157370_10000037 3300013104 Bacteria 136803
191 Ga0157370_10002430 3300013104 Bacteria 22453
192 Ga0157370_10085310 3300013104 Bacteria 2966
193 Ga0157370_10114034 3300013104 Bacteria 2525
194 Ga0157369_10109741 3300013105 Bacteria 2933
195 Ga0157369_10150925 3300013105 Bacteria 2456
196 Ga0157369_10330089 3300013105 Bacteria 1585
197 Ga0157369_10336235 3300013105 Bacteria 1569
198 Ga0157369_10391754 3300013105 Bacteria 1441
199 Ga0171463_1007 3300013249 Bacteria 301198
200 Ga0163162_10240771 3300013306 Bacteria 1940
201 Ga0157375_10552081 3300013308 Bacteria 1314
202 Ga0163163_10270264 3300014325 Bacteria 1751
203 Ga0157379_10051127 3300014968 Bacteria 3691
204 Ga0157379_10158340 3300014968 Bacteria 2044
205 Ga0182007_10002682 3300015262 Bacteria 8718
206 Ga0182005_1020059 3300015265 Bacteria 1841
207 Ga0182005_1021965 3300015265 Bacteria 1748
208 Ga0183363_1061 3300015690 Bacteria 33598
209 Ga0214544_1000110 3300021320 Bacteria 113143
210 Ga0214542_1000032 3300021321 Bacteria 171690
211 Ga0214543_1000016 3300021327 Bacteria 295257
212 Ga0214543_1000022 3300021327 Bacteria 241930
213 Ga0213876_10043875 3300021384 Bacteria 2363
214 Ga0213875_10001555 3300021388 Bacteria 14697
215 Ga0228710_1005902 3300022740 Bacteria 18839
216 Ga0209435_100027 3300025206 Bacteria 196217
217 Ga0209672_104167 3300025228 Bacteria 2754
218 Ga0209563_111216 3300025230 Bacteria 1272
219 Ga0207427_105205 3300025231 Bacteria 1899
220 Ga0209437_100058 3300025233 Bacteria 357279
221 Ga0209437_100060 3300025233 Bacteria 355034
222 Ga0207425_1000046 3300025245 Bacteria 189433
223 Ga0207425_1000162 3300025245 Bacteria 56293
224 Ga0207425_1004007 3300025245 Bacteria 4530
225 Ga0207425_1006686 3300025245 Bacteria 3127
226 Ga0207425_1011735 3300025245 Bacteria 2076
227 Ga0209646_1000086 3300025246 Bacteria 196217
228 Ga0209646_1004880 3300025246 Bacteria 2402
229 Ga0209026_1000082 3300025250 Bacteria 196315
230 Ga0209026_1000151 3300025250 Bacteria 110338
231 Ga0209677_100453 3300025253 Bacteria 23786
232 Ga0209148_1000032 3300025254 Bacteria 557660
233 Ga0209148_1000213 3300025254 Bacteria 100190
234 Ga0209759_1000063 3300025256 Bacteria 196315
235 Ga0209759_1000076 3300025256 Bacteria 175911
236 Ga0209759_1000350 3300025256 Bacteria 60056
237 Ga0209129_1000170 3300025258 Bacteria 95792
238 Ga0209129_1000283 3300025258 Bacteria 48305
239 Ga0209129_1000287 3300025258 Bacteria 48153
240 Ga0209129_1000820 3300025258 Bacteria 19533
241 Ga0209129_1000868 3300025258 Bacteria 18737
242 Ga0209129_1001663 3300025258 Bacteria 12034
243 Ga0209129_1006477 3300025258 Bacteria 3769
244 Ga0209233_1000149 3300025261 Bacteria 181183
245 Ga0209233_1000150 3300025261 Bacteria 179401
246 Ga0209233_1000160 3300025261 Bacteria 159035
247 Ga0209455_1000085 3300025272 Bacteria 247601
248 Ga0209455_1001483 3300025272 Bacteria 10523
249 Ga0209673_1000010 3300025273 Bacteria 596656
250 Ga0209673_1000025 3300025273 Bacteria 404572
251 Ga0209673_1000112 3300025273 Bacteria 179676
252 Ga0209673_1001637 3300025273 Bacteria 19386
253 Ga0209673_1002172 3300025273 Bacteria 14482
254 Ga0209673_1002919 3300025273 Bacteria 10778
255 Ga0209673_1005722 3300025273 Bacteria 6194
256 Ga0209673_1015525 3300025273 Bacteria 2888
257 Ga0209130_1000003 3300025284 Bacteria 677988
258 Ga0209130_1000017 3300025284 Bacteria 388431
259 Ga0209130_1000023 3300025284 Bacteria 359355
260 Ga0209676_1000300 3300025292 Bacteria 100399
261 Ga0209676_1001942 3300025292 Bacteria 16657
262 Ga0209676_1006115 3300025292 Bacteria 6044
263 Ga0209676_1029563 3300025292 Bacteria 1690
264 Ga0209025_1000091 3300025294 Bacteria 250401
265 Ga0209025_1000137 3300025294 Bacteria 190136
266 Ga0209025_1000153 3300025294 Bacteria 170548
267 Ga0209025_1000545 3300025294 Bacteria 70608
268 Ga0209025_1000689 3300025294 Bacteria 57945
269 Ga0209025_1001424 3300025294 Bacteria 31618
270 Ga0209025_1002940 3300025294 Bacteria 16948
271 Ga0209025_1005549 3300025294 Bacteria 10227
272 Ga0209025_1008460 3300025294 Bacteria 7404
273 Ga0209025_1009032 3300025294 Bacteria 7033
274 Ga0209025_1018454 3300025294 Bacteria 3950
275 Ga0209025_1030110 3300025294 Bacteria 2606
276 Ga0209025_1030429 3300025294 Bacteria 2585
277 Ga0209564_1000013 3300025295 Bacteria 775755
278 Ga0209564_1000365 3300025295 Bacteria 84031
279 Ga0209564_1000564 3300025295 Bacteria 58801
280 Ga0209564_1001004 3300025295 Bacteria 35075
281 Ga0209564_1005883 3300025295 Bacteria 6803
282 Ga0209564_1015988 3300025295 Bacteria 3020
283 Ga0209564_1023190 3300025295 Bacteria 2165
284 Ga0209758_1000123 3300025297 Bacteria 190136
285 Ga0209758_1000130 3300025297 Bacteria 184456
286 Ga0209758_1000317 3300025297 Bacteria 93209
287 Ga0209758_1001220 3300025297 Bacteria 32262
288 Ga0209758_1002966 3300025297 Bacteria 16273
289 Ga0209758_1003416 3300025297 Bacteria 14487
290 Ga0209758_1004613 3300025297 Bacteria 11313
291 Ga0209758_1005604 3300025297 Bacteria 9546
292 Ga0209758_1006234 3300025297 Bacteria 8699
293 Ga0209758_1008951 3300025297 Bacteria 6343
294 Ga0209758_1009161 3300025297 Bacteria 6227
295 Ga0209758_1009728 3300025297 Bacteria 5907
296 Ga0209050_1004328 3300025298 Bacteria 9685
297 Ga0209050_1005211 3300025298 Bacteria 8310
298 Ga0209050_1008301 3300025298 Bacteria 5585
299 Ga0209050_1026405 3300025298 Bacteria 1945
300 Ga0209256_1000211 3300025299 Bacteria 110131
301 Ga0209256_1000315 3300025299 Bacteria 84048
302 Ga0209256_1003516 3300025299 Bacteria 10911
303 Ga0209256_1004669 3300025299 Bacteria 8420
304 Ga0209256_1005396 3300025299 Bacteria 7392
305 Ga0209256_1010874 3300025299 Bacteria 3737
306 Ga0209256_1013599 3300025299 Bacteria 3008
307 Ga0209256_1019942 3300025299 Bacteria 2114
308 Ga0207426_1000006 3300025302 Bacteria 1025969
309 Ga0207426_1000011 3300025302 Bacteria 791203
310 Ga0207426_1000087 3300025302 Bacteria 288870
311 Ga0207426_1000208 3300025302 Bacteria 140385
312 Ga0207426_1000511 3300025302 Bacteria 56595
313 Ga0207426_1002922 3300025302 Bacteria 10067
314 Ga0209051_1000410 3300025303 Bacteria 59186
315 Ga0209051_1001459 3300025303 Bacteria 20047
316 Ga0209051_1004728 3300025303 Bacteria 8253
317 Ga0209051_1007779 3300025303 Bacteria 5795
318 Ga0209051_1038366 3300025303 Bacteria 1744
319 Ga0209257_1001148 3300025304 Bacteria 33708
320 Ga0209257_1003036 3300025304 Bacteria 15160
321 Ga0207697_10020847 3300025315 Bacteria 2683
322 Ga0207656_10019890 3300025321 Bacteria 2660
323 Ga0207680_10142919 3300025903 Bacteria 1588
324 Ga0207645_10126175 3300025907 Bacteria 1663
325 Ga0207654_10032483 3300025911 Bacteria 2885
326 Ga0207695_10000037 3300025913 Bacteria 476303
327 Ga0207695_10011688 3300025913 Bacteria 10610
328 Ga0207695_10064942 3300025913 Bacteria 3754
329 Ga0207695_10159132 3300025913 Bacteria 2191
330 Ga0207671_10000045 3300025914 Bacteria 201245
331 Ga0207671_10001017 3300025914 Bacteria 34299
332 Ga0207657_10019972 3300025919 Bacteria 6346
333 Ga0207646_10130835 3300025922 Bacteria 2258
334 Ga0207694_10017681 3300025924 Bacteria 5389
335 Ga0207694_10208538 3300025924 Bacteria 1591
336 Ga0207650_10001778 3300025925 Bacteria 15244
337 Ga0207687_10013924 3300025927 Bacteria 5256
338 Ga0207644_10054517 3300025931 Bacteria 2880
339 Ga0207706_10004852 3300025933 Bacteria 12593
340 Ga0207709_10022407 3300025935 Bacteria 3583
341 Ga0207709_10070629 3300025935 Bacteria 2215
342 Ga0207669_10039242 3300025937 Bacteria 2734
343 Ga0207704_10228189 3300025938 Bacteria 1383
344 Ga0207691_10193477 3300025940 Bacteria 1773
345 Ga0207679_10261820 3300025945 Bacteria 1475
346 Ga0207667_10012150 3300025949 Bacteria 9945
347 Ga0207667_10569510 3300025949 Bacteria 1144
348 Ga0207651_10048219 3300025960 Bacteria 2878
349 Ga0207668_10159940 3300025972 Bacteria 1754
350 Ga0207640_10027943 3300025981 Bacteria 3442
351 Ga0207640_10071336 3300025981 Bacteria 2339
352 Ga0207658_10065037 3300025986 Bacteria 2738
353 Ga0207658_10218541 3300025986 Bacteria 1602
354 Ga0207658_10245784 3300025986 Bacteria 1518
355 Ga0207639_10013742 3300026041 Bacteria 5677
356 Ga0207639_10039484 3300026041 Bacteria 3518
357 Ga0207639_10201713 3300026041 Bacteria 1706
358 Ga0207639_10216235 3300026041 Bacteria 1652
359 Ga0207678_10187385 3300026067 Bacteria 1768
360 Ga0207678_10189062 3300026067 Bacteria 1759
361 Ga0207702_10033194 3300026078 Bacteria 4310
362 Ga0207702_10163641 3300026078 Bacteria 2033
363 Ga0207702_10178055 3300026078 Bacteria 1956
364 Ga0207702_10179524 3300026078 Bacteria 1948
365 Ga0207702_10187355 3300026078 Bacteria 1909
366 Ga0207702_10189687 3300026078 Bacteria 1898
367 Ga0207641_10035203 3300026088 Bacteria 4170
368 Ga0207648_10143703 3300026089 Bacteria 2104
369 Ga0207676_10030998 3300026095 Bacteria 4018
370 Ga0207674_10327952 3300026116 Bacteria 1480
371 Ga0207674_10467961 3300026116 Bacteria 1218
372 Ga0207683_10131269 3300026121 Bacteria 2253
373 Ga0207683_10236442 3300026121 Bacteria 1666
374 Ga0207698_10029130 3300026142 Bacteria 3949
375 Ga0209281_1000375 3300027111 Bacteria 71407
376 Ga0209281_1001291 3300027111 Bacteria 16043
377 Ga0209371_1000035 3300027312 Bacteria 368979
378 Ga0209371_1000901 3300027312 Bacteria 23610
379 Ga0209371_1003138 3300027312 Bacteria 8395
380 Ga0209282_1001148 3300027666 Bacteria 14196
381 Ga0209282_1001830 3300027666 Bacteria 11949
382 Ga0209282_1044420 3300027666 Bacteria 2606
383 Ga0209813_10000800 3300027866 Bacteria 7134
384 Ga0209813_10032907 3300027866 Bacteria 1539
385 Ga0207428_10253406 3300027907 Bacteria 1312
386 Ga0268266_10024005 3300028379 Bacteria 5189
387 Ga0268266_10054593 3300028379 Bacteria 3433
388 Ga0268266_10070198 3300028379 Bacteria 3036
389 Ga0268266_10274954 3300028379 Bacteria 1565
390 Ga0265318_10028336 3300028577 Bacteria 2191
391 Ga0307515_10000017 3300028794 Bacteria 550465
392 Ga0307515_10000285 3300028794 Bacteria 124535
393 Ga0307515_10021612 3300028794 Bacteria 11395
394 Ga0307515_10022262 3300028794 Bacteria 11178
395 Ga0307515_10111250 3300028794 Bacteria 3198
396 Ga0268256_1000037 3300030500 Bacteria 367024
397 Ga0268256_1003000 3300030500 Bacteria 7971
398 Ga0268256_1003068 3300030500 Bacteria 7827
399 Ga0316181_1025508 3300030744 Bacteria 3401
400 Ga0265330_10018309 3300031235 Bacteria 3218
401 Ga0265320_10036211 3300031240 Bacteria 2496
402 Ga0265325_10006250 3300031241 Bacteria 7259
403 Ga0265325_10013585 3300031241 Bacteria 4630
404 Ga0265340_10028955 3300031247 Bacteria 2783
405 Ga0265340_10078080 3300031247 Bacteria 1561
406 Ga0265340_10113579 3300031247 Bacteria 1250
407 Ga0265339_10002978 3300031249 Bacteria 11969
408 Ga0265339_10062419 3300031249 Bacteria 2003
409 Ga0265331_10047132 3300031250 Bacteria 2075
410 Ga0265316_10013087 3300031344 Bacteria 7399
411 Ga0265316_10032893 3300031344 Bacteria 4229
412 Ga0265316_10167437 3300031344 Bacteria 1641
413 Ga0307513_10005235 3300031456 Bacteria 17180
414 Ga0307513_10080307 3300031456 Bacteria 3365
415 Ga0307513_10083898 3300031456 Bacteria 3275
416 Ga0307513_10151987 3300031456 Bacteria 2222
417 Ga0307509_10053450 3300031507 Bacteria 4307
418 Ga0307408_100022636 3300031548 Bacteria 4272
419 Ga0307408_100054513 3300031548 Bacteria 2891
420 Ga0265313_10000044 3300031595 Bacteria 117063
421 Ga0265313_10000481 3300031595 Bacteria 41874
422 Ga0265313_10011274 3300031595 Bacteria 5569
423 Ga0265313_10072214 3300031595 Bacteria 1586
424 Ga0265313_10115121 3300031595 Bacteria 1178
425 Ga0307508_10000430 3300031616 Bacteria 49980
426 Ga0307508_10012324 3300031616 Bacteria 7819
427 Ga0307508_10068533 3300031616 Bacteria 3118
428 Ga0265314_10010039 3300031711 Bacteria 7937
429 Ga0265314_10025241 3300031711 Bacteria 4489
430 Ga0265342_10000926 3300031712 Bacteria 29144
431 Ga0265342_10018725 3300031712 Bacteria 4476
432 Ga0265342_10047051 3300031712 Bacteria 2590
433 Ga0307405_10000323 3300031731 Bacteria 17725
434 Ga0307410_10338188 3300031852 Bacteria 1199
435 Ga0307406_10053211 3300031901 Bacteria 2578
436 Ga0307406_10106957 3300031901 Bacteria 1917
437 Ga0307407_10079643 3300031903 Bacteria 1977
438 Ga0307412_10001545 3300031911 Bacteria 12730
439 Ga0307412_10169124 3300031911 Bacteria 1632
440 Ga0315914_1008120 3300031967 Bacteria 14195
441 Ga0307414_10118438 3300032004 Bacteria 2031
442 Ga0307414_10124889 3300032004 Bacteria 1986
443 Ga0307414_10284487 3300032004 Bacteria 1391
444 Ga0307414_10545162 3300032004 Bacteria 1033
445 Ga0315913_1006432 3300033430 Bacteria 14196
446 Ga0315915_1000007 3300033464 Bacteria 319225
447 Ga0316574_0027919 3300035398 Bacteria 3401
448 Ga0373935_0145884 3300035692 Bacteria 1602
449 Ga0373927_0000245 3300035695 Bacteria 42703
450 Ga0373927_0041025 3300035695 Bacteria 3002
451 Ga0373927_0163962 3300035695 Bacteria 1456
452 Ga0373937_0037906 3300036401 Bacteria 4393
453 Ga0373925_0003713 3300037068 Bacteria 11724
454 Ga0373925_0148449 3300037068 Bacteria 1839
455 Ga0395899_0000044 3300037312 Bacteria 248735
456 Ga0395900_0000042 3300037418 Bacteria 242667
457 Ga0395900_0029099 3300037418 Bacteria 5666
458 Ga0395900_0207837 3300037418 Bacteria 1978
459 Ga0395898_0000080 3300037466 Bacteria 242667
460 Ga0395905_0000044 3300037471 Bacteria 242916
461 Ga0395905_0007581 3300037471 Bacteria 10783
462 Ga0395905_0009048 3300037471 Bacteria 9769
463 Ga0395905_0013886 3300037471 Bacteria 7706
464 Ga0395905_0020532 3300037471 Bacteria 6256
465 Ga0395905_0054804 3300037471 Bacteria 3731
466 Ga0395905_0095843 3300037471 Bacteria 2785
467 Ga0395905_0423218 3300037471 Bacteria 1228
468 Ga0436364_0046669 3300037853 Bacteria 24459
469 Ga0436364_1130693 3300037853 Bacteria 2367
470 Ga0395901_0000027 3300038443 Bacteria 244204
471 Ga0395901_0014960 3300038443 Bacteria 7885
472 Ga0395901_0031758 3300038443 Bacteria 5445
473 Ga0400484_20998 3300038725 Bacteria 5474
474 Ga0400484_40515 3300038725 Bacteria 4110
475 Ga0400490_19842 3300038726 Bacteria 1121
476 Ga0400490_38094 3300038726 Bacteria 26956
477 Ga0400491_13401 3300038727 Bacteria 2392
478 Ga0400488_17246 3300038741 Bacteria 1238
479 Ga0400486_25732 3300038742 Bacteria 2805
480 Ga0400483_021750 3300039062 Bacteria 11370
481 Ga0400483_172664 3300039062 Bacteria 1750
482 Ga0400483_246637 3300039062 Bacteria 4069
483 Ga0400483_247668 3300039062 Bacteria 26775
484 Ga0400487_11494 3300039110 Bacteria 1718
485 Ga0400487_13197 3300039110 Bacteria 19734
486 Ga0436365_1547706 3300039437 Bacteria 2641
487 Ga0436360_0960231 3300039438 Bacteria 2126
488 Ga0436361_0290928 3300039447 Bacteria 3299
489 Ga0436363_0280076 3300039450 Bacteria 3396
490 Ga0439436_0048435 3300041404 Bacteria 1205
491 Ga0439465_0001270 3300041413 Bacteria 8114
492 Ga0439465_0008472 3300041413 Bacteria 3246
493 Ga0439465_0008513 3300041413 Bacteria 3236
494 Ga0439465_0037731 3300041413 Bacteria 1554
495 Ga0451793_1386411 3300041452 Bacteria 1102
496 Ga0451839_0836516 3300041496 Bacteria 1683
497 Ga0451841_0340568 3300041498 Bacteria 1343
498 Ga0451851_0361118 3300041507 Bacteria 7123
499 Ga0451851_1012485 3300041507 Bacteria 1982
500 Ga0451843_0294688 3300041509 Bacteria 4833
501 Ga0451853_3094484 3300041512 Bacteria 3219
502 Ga0439433_0022253 3300041999 Bacteria 1421
503 Ga0439443_001481 3300042003 Bacteria 2602
504 Ga0439432_019512 3300042006 Bacteria 2258
505 Ga0439449_0009295 3300042007 Bacteria 3726
506 Ga0450906_002412 3300042145 Bacteria 4089
507 Ga0439458_0017550 3300042157 Bacteria 1636
508 Ga0439435_0011342 3300042436 Bacteria 2137
509 Ga0466972_0016192 3300044658 Bacteria 3727
510 Ga0466966_0022293 3300044684 Bacteria 4156
511 Ga0466963_0013253 3300044694 Bacteria 5060
512 Ga0466968_0012727 3300044735 Bacteria 3300
513 Ga0466970_0005599 3300044765 Bacteria 6241
514 Ga0466957_0077697 3300044842 Bacteria 2063
515 Ga0466960_0082946 3300044901 Bacteria 1619
516 Ga0451576_0002330 3300045051 Bacteria 28726
517 Ga0451576_0036965 3300045051 Bacteria 5174
518 Ga0466958_0024660 3300045836 Bacteria 3539
519 Ga0495629_0004985 3300046459 Bacteria 9957
520 Ga0495629_0029471 3300046459 Bacteria 3891
521 Ga0495638_0008120 3300046460 Bacteria 7465
522 Ga0495638_0019366 3300046460 Bacteria 4502
523 Ga0495641_0005527 3300046461 Bacteria 8495
524 Ga0495651_0067244 3300046462 Bacteria 2734
525 Ga0495651_0098693 3300046462 Bacteria 2179
526 Ga0495651_0101799 3300046462 Bacteria 2137
527 Ga0495650_0064423 3300046471 Bacteria 1458
528 Ga0495605_0015829 3300046474 Bacteria 4095
529 Ga0495605_0020662 3300046474 Bacteria 3497
530 Ga0495605_0038126 3300046474 Bacteria 2413
531 Ga0495662_0067685 3300046476 Bacteria 1728
532 Ga0495664_0074572 3300046477 Bacteria 2030
533 Ga0495585_0037863 3300046492 Bacteria 2716
534 Ga0495585_0164218 3300046492 Bacteria 1151
535 Ga0495607_0016552 3300046501 Bacteria 4757
536 Ga0495607_0023263 3300046501 Bacteria 3879
537 Ga0495607_0062768 3300046501 Bacteria 2104
538 Ga0495583_0012467 3300046506 Bacteria 4806
539 Ga0495606_0006240 3300046507 Bacteria 11067
540 Ga0495606_0133561 3300046507 Bacteria 1473
541 Ga0495610_0008335 3300046512 Bacteria 6725
542 Ga0495610_0036426 3300046512 Bacteria 2514
543 Ga0495610_0059015 3300046512 Bacteria 1833
544 Ga0495620_0012292 3300046515 Bacteria 4433
545 Ga0495631_0016798 3300046518 Bacteria 3478
546 Ga0495632_0008302 3300046519 Bacteria 6395
547 Ga0495632_0016392 3300046519 Bacteria 4125
548 Ga0495637_0003753 3300046520 Bacteria 8016
549 Ga0495637_0096499 3300046520 Bacteria 1160
550 Ga0495643_0001039 3300046522 Bacteria 28149
551 Ga0495643_0033843 3300046522 Bacteria 2823
552 Ga0495643_0075017 3300046522 Bacteria 1770
553 Ga0495663_0025419 3300046525 Bacteria 1726
554 Ga0495652_0158528 3300046529 Bacteria 1760
555 Ga0495654_0017636 3300046530 Bacteria 3748
556 Ga0495640_0008734 3300046533 Bacteria 7940
557 Ga0495587_0168157 3300046536 Bacteria 1246
558 Ga0495609_0003026 3300046538 Bacteria 9907
559 Ga0495609_0018475 3300046538 Bacteria 3230
560 Ga0495622_0031741 3300046557 Bacteria 2467
561 Ga0495633_0034951 3300046558 Bacteria 2415
562 Ga0495667_0082887 3300046559 Bacteria 2083
563 Ga0495668_0013586 3300046616 Bacteria 4798
564 Ga0495668_0032094 3300046616 Bacteria 2957
565 Ga0495625_0004663 3300046660 Bacteria 12870
566 Ga0495625_0011866 3300046660 Bacteria 7075
567 Ga0495625_0015174 3300046660 Bacteria 6114
568 Ga0495635_0017864 3300046663 Bacteria 4953
569 Ga0495588_0002642 3300046674 Bacteria 7679
570 Ga0495588_0005393 3300046674 Bacteria 5687
571 Ga0495588_0071038 3300046674 Bacteria 1810
572 Ga0495588_0097048 3300046674 Bacteria 1546
573 Ga0495657_0060563 3300046675 Bacteria 2507
574 Ga0495658_0030878 3300046683 Bacteria 2913
575 Ga0495613_0023071 3300046689 Bacteria 4638
576 Ga0495670_0090149 3300046691 Bacteria 1569
577 Ga0495671_0154940 3300046692 Bacteria 1115
578 Ga0495649_0010787 3300046694 Bacteria 5383
579 Ga0495600_0008492 3300046809 Bacteria 6311
580 Ga0495600_0033078 3300046809 Bacteria 3356
581 Ga0495600_0131177 3300046809 Bacteria 1629
582 Ga0495604_0041248 3300047317 Bacteria 3620
583 Ga0495636_0022191 3300047318 Bacteria 2565
584 Ga0495674_0162196 3300047319 Bacteria 1870
585 Ga0495676_0038748 3300047321 Bacteria 3956
586 Ga0495683_0142301 3300047323 Bacteria 1123
587 Ga0495687_003786 3300047443 Bacteria 10680
588 Ga0495679_043826 3300047446 Bacteria 1373
589 Ga0495673_0052838 3300047469 Bacteria 1774
590 Ga0495673_0058904 3300047469 Bacteria 1653
591 Ga0495681_0000773 3300047470 Bacteria 24644
592 Ga0495681_0002912 3300047470 Bacteria 12094
593 Ga0495681_0039636 3300047470 Bacteria 2298
594 Ga0495686_0009447 3300047472 Bacteria 7025
595 Ga0495686_0023819 3300047472 Bacteria 4029
596 Ga0495686_0026678 3300047472 Bacteria 3779
597 Ga0495686_0050941 3300047472 Bacteria 2600
598 Ga0495602_0140246 3300048088 Bacteria 1914
599 Ga0496102_0002097 3300048905 Bacteria 17170
600 Ga0496102_0013152 3300048905 Bacteria 7160
601 Ga0496102_0240698 3300048905 Bacteria 1706
602 Ga0496104_0003414 3300048907 Bacteria 13707
603 Ga0496104_0044031 3300048907 Bacteria 4194
604 Ga0496104_0376879 3300048907 Bacteria 1331
605 Ga0496105_0000404 3300048908 Bacteria 28412
606 Ga0496106_0014285 3300048909 Bacteria 5867
607 Ga0496110_0092323 3300048913 Bacteria 2709
608 Ga0496110_0196010 3300048913 Bacteria 1834
609 Ga0496110_0266985 3300048913 Bacteria 1558
610 Ga0496111_0064513 3300048914 Bacteria 2657
611 Ga0496112_0232458 3300048915 Bacteria 1798
612 Ga0496113_0072655 3300048916 Bacteria 2619
613 Ga0496113_0264337 3300048916 Bacteria 1375
614 Ga0496114_0110058 3300048917 Bacteria 2359
615 Ga0496114_0127631 3300048917 Bacteria 2193
616 Ga0496115_0030928 3300048918 Bacteria 4216
617 Ga0496115_0062272 3300048918 Bacteria 3009
618 Ga0496116_0000026 3300048919 Bacteria 450803
619 Ga0496116_0012142 3300048919 Bacteria 7052
620 Ga0496116_0016325 3300048919 Bacteria 5812
621 Ga0496116_0016678 3300048919 Bacteria 5737
622 Ga0496116_0063997 3300048919 Bacteria 2365
623 Ga0496116_0064545 3300048919 Bacteria 2353
624 Ga0496116_0065103 3300048919 Bacteria 2340
625 Ga0496117_0000066 3300048920 Bacteria 253534
626 Ga0496117_0000674 3300048920 Bacteria 54521
627 Ga0496117_0017033 3300048920 Bacteria 6086
628 Ga0496117_0017065 3300048920 Bacteria 6080
629 Ga0496117_0070009 3300048920 Bacteria 2359
630 Ga0496117_0101947 3300048920 Bacteria 1813
631 Ga0496118_0001442 3300048921 Bacteria 35788
632 Ga0496118_0007072 3300048921 Bacteria 12054
633 Ga0496118_0015274 3300048921 Bacteria 7121
634 Ga0496118_0015441 3300048921 Bacteria 7067
635 Ga0496118_0028061 3300048921 Bacteria 4749
636 Ga0496118_0028682 3300048921 Bacteria 4682
637 Ga0496118_0038269 3300048921 Bacteria 3847
638 Ga0496118_0051085 3300048921 Bacteria 3166
639 Ga0496118_0059249 3300048921 Bacteria 2853
640 Ga0496119_0000887 3300048922 Bacteria 39179
641 Ga0496119_0012012 3300048922 Bacteria 7086
642 Ga0496119_0021565 3300048922 Bacteria 4650
643 Ga0496119_0028988 3300048922 Bacteria 3764
644 Ga0496119_0041198 3300048922 Bacteria 2944
645 Ga0496119_0050527 3300048922 Bacteria 2562
646 Ga0496120_0000100 3300048923 Bacteria 143064
647 Ga0496120_0000724 3300048923 Bacteria 48314
648 Ga0496120_0001458 3300048923 Bacteria 28286
649 Ga0496120_0001956 3300048923 Bacteria 22555
650 Ga0496120_0005160 3300048923 Bacteria 10549
651 Ga0496120_0017730 3300048923 Bacteria 4604
652 Ga0496120_0030888 3300048923 Bacteria 3251
653 Ga0496121_0000991 3300048924 Bacteria 50787
654 Ga0496121_0016095 3300048924 Bacteria 7749
655 Ga0496121_0017992 3300048924 Bacteria 7161
656 Ga0496121_0037009 3300048924 Bacteria 4340
657 Ga0496122_0000057 3300048925 Bacteria 253452
658 Ga0496122_0000172 3300048925 Bacteria 153862
659 Ga0496122_0000414 3300048925 Bacteria 90664
660 Ga0496122_0007724 3300048925 Bacteria 11838
661 Ga0496122_0008827 3300048925 Bacteria 10762
662 Ga0496122_0009607 3300048925 Bacteria 10131
663 Ga0496122_0013054 3300048925 Bacteria 8181
664 Ga0496122_0015011 3300048925 Bacteria 7439
665 Ga0496122_0017434 3300048925 Bacteria 6715
666 Ga0496122_0021546 3300048925 Bacteria 5765
667 Ga0496122_0046010 3300048925 Bacteria 3385
668 Ga0496122_0077875 3300048925 Bacteria 2325
669 Ga0496123_0000096 3300048926 Bacteria 173914
670 Ga0496123_0000132 3300048926 Bacteria 153568
671 Ga0496123_0000839 3300048926 Bacteria 49128
672 Ga0496123_0008281 3300048926 Bacteria 9579
673 Ga0496123_0014229 3300048926 Bacteria 6613
674 Ga0496123_0015265 3300048926 Bacteria 6310
675 Ga0496123_0031285 3300048926 Bacteria 3874
676 Ga0496124_0000091 3300048927 Bacteria 189706
677 Ga0496124_0008171 3300048927 Bacteria 10979
678 Ga0496124_0009055 3300048927 Bacteria 10296
679 Ga0496124_0009134 3300048927 Bacteria 10240
680 Ga0496124_0020257 3300048927 Bacteria 6154
681 Ga0496124_0050863 3300048927 Bacteria 3528
682 Ga0496124_0069578 3300048927 Bacteria 2922
683 Ga0496124_0189062 3300048927 Bacteria 1578
684 Ga0496124_0197883 3300048927 Bacteria 1531
685 Ga0496125_0000276 3300048928 Bacteria 103024
686 Ga0496125_0002982 3300048928 Bacteria 21249
687 Ga0496125_0005688 3300048928 Bacteria 13748
688 Ga0496125_0019065 3300048928 Bacteria 6489
689 Ga0496125_0020551 3300048928 Bacteria 6195
690 Ga0496125_0024814 3300048928 Bacteria 5504
691 Ga0496125_0027777 3300048928 Bacteria 5122
692 Ga0496125_0063263 3300048928 Bacteria 2952
693 Ga0496125_0121785 3300048928 Bacteria 1859
694 Ga0496126_0000069 3300048929 Bacteria 246935
695 Ga0496126_0000188 3300048929 Bacteria 139625
696 Ga0496126_0002934 3300048929 Bacteria 22170
697 Ga0496126_0012848 3300048929 Bacteria 8557
698 Ga0496126_0022017 3300048929 Bacteria 6211
699 Ga0496126_0327368 3300048929 Bacteria 1258
700 Ga0495678_019335 3300049459 Bacteria 3041
701 Ga0501031_0000002 3300049568 Bacteria 217588
702 Ga0501031_0038885 3300049568 Bacteria 3103
703 Ga0501032_0000004 3300049569 Bacteria 310855
704 Ga0501032_0000774 3300049569 Bacteria 25923
705 Ga0501032_0006865 3300049569 Bacteria 8345
706 Ga0501032_0064798 3300049569 Bacteria 2445
707 Ga0501033_0000016 3300049570 Bacteria 217458
708 Ga0501033_0000776 3300049570 Bacteria 29378
709 Ga0501033_0003501 3300049570 Bacteria 12871
710 Ga0501033_0006590 3300049570 Bacteria 9082
711 Ga0501033_0071410 3300049570 Bacteria 2550
712 Ga0501033_0109483 3300049570 Bacteria 2011
713 Ga0501033_0186557 3300049570 Bacteria 1485
714 Ga0501034_0000011 3300049571 Bacteria 310855
715 Ga0501034_0000012 3300049571 Bacteria 310504
716 Ga0501034_0002012 3300049571 Bacteria 25645
717 Ga0501034_0031563 3300049571 Bacteria 5381
718 Ga0501034_0033922 3300049571 Bacteria 5174
719 Ga0501034_0052163 3300049571 Bacteria 4121
720 Ga0501034_0064350 3300049571 Bacteria 3681
721 Ga0501034_0073266 3300049571 Bacteria 3433
722 Ga0501034_0096713 3300049571 Bacteria 2948
723 Ga0501034_0181817 3300049571 Bacteria 2067
724 Ga0501034_0266330 3300049571 Bacteria 1655
725 Ga0501034_0340606 3300049571 Bacteria 1429
726 Ga0501036_0000001 3300049572 Bacteria 310855
727 Ga0501036_0042543 3300049572 Bacteria 3846
728 Ga0501036_0061431 3300049572 Bacteria 3182
729 Ga0501036_0209735 3300049572 Bacteria 1637
730 Ga0501037_0000006 3300049573 Bacteria 217461
731 Ga0501037_0000227 3300049573 Bacteria 49134
732 Ga0501037_0048724 3300049573 Bacteria 3103
733 Ga0501037_0073188 3300049573 Bacteria 2491
734 Ga0501038_0000003 3300049574 Bacteria 310855
735 Ga0501038_0013672 3300049574 Bacteria 7398
736 Ga0501038_0052891 3300049574 Bacteria 3499
737 Ga0501038_0068912 3300049574 Bacteria 3006
738 Ga0501038_0100886 3300049574 Bacteria 2404
739 Ga0501038_0132517 3300049574 Bacteria 2044
740 Ga0501038_0141728 3300049574 Bacteria 1966
741 Ga0501038_0177975 3300049574 Bacteria 1718
742 Ga0501038_0274653 3300049574 Bacteria 1328
743 Ga0501039_0000004 3300049575 Bacteria 310855
744 Ga0501039_0015661 3300049575 Bacteria 5803
745 Ga0501039_0015913 3300049575 Bacteria 5759
746 Ga0501039_0082646 3300049575 Bacteria 2501
747 Ga0501039_0127525 3300049575 Bacteria 1996
748 Ga0501039_0190371 3300049575 Bacteria 1613
749 Ga0501040_0007583 3300049576 Bacteria 7020
750 Ga0501040_0126861 3300049576 Bacteria 1793
751 Ga0501040_0190331 3300049576 Bacteria 1456
752 Ga0501042_0053434 3300049578 Bacteria 2882
753 Ga0501043_0000396 3300049579 Bacteria 39180
754 Ga0501043_0000765 3300049579 Bacteria 28587
755 Ga0501043_0002095 3300049579 Bacteria 17029
756 Ga0501043_0044244 3300049579 Bacteria 3500
757 Ga0501043_0166340 3300049579 Bacteria 1722
758 Ga0501043_0192321 3300049579 Bacteria 1586
759 Ga0501043_0234804 3300049579 Bacteria 1415
760 Ga0501043_0279836 3300049579 Bacteria 1279
761 Ga0501043_0317325 3300049579 Bacteria 1188
762 Ga0501046_0016578 3300049580 Bacteria 6164
763 Ga0501046_0108020 3300049580 Bacteria 2128
764 Ga0501046_0233102 3300049580 Bacteria 1359
765 Ga0501047_0002673 3300049581 Bacteria 16963
766 Ga0501047_0007626 3300049581 Bacteria 10188
767 Ga0501047_0010616 3300049581 Bacteria 8710
768 Ga0501047_0024548 3300049581 Bacteria 5785
769 Ga0501047_0059646 3300049581 Bacteria 3684
770 Ga0501047_0100030 3300049581 Unclassified 2778
771 Ga0501047_0123583 3300049581 Bacteria 2468
772 Ga0501047_0163647 3300049581 Bacteria 2096
773 Ga0501047_0230545 3300049581 Bacteria 1705
774 Ga0501048_0007377 3300049582 Bacteria 8331
775 Ga0501048_0037725 3300049582 Bacteria 3470
776 Ga0501048_0072598 3300049582 Bacteria 2429
777 Ga0501048_0195843 3300049582 Bacteria 1432
778 Ga0501048_0257784 3300049582 Bacteria 1239
779 Ga0501048_0310847 3300049582 Bacteria 1122
780 Ga0501067_0028463 3300049583 Bacteria 3096
781 Ga0501067_0056370 3300049583 Bacteria 2177
782 Ga0501067_0120288 3300049583 Bacteria 1461
783 Ga0501068_0032215 3300049584 Bacteria 3116
784 Ga0501068_0045529 3300049584 Bacteria 2643
785 Ga0501068_0066759 3300049584 Bacteria 2191
786 Ga0501068_0070346 3300049584 Bacteria 2135
787 Ga0501068_0109845 3300049584 Bacteria 1714
788 Ga0501069_0000068 3300049585 Bacteria 54324
789 Ga0501069_0007152 3300049585 Bacteria 5850
790 Ga0501069_0008694 3300049585 Bacteria 5349
791 Ga0501069_0059544 3300049585 Bacteria 2131
792 Ga0501070_0000313 3300049586 Bacteria 44225
793 Ga0501070_0001073 3300049586 Bacteria 24478
794 Ga0501070_0003655 3300049586 Bacteria 13297
795 Ga0501070_0068526 3300049586 Unclassified 2937
796 Ga0501070_0069127 3300049586 Bacteria 2924
797 Ga0501070_0093798 3300049586 Bacteria 2483
798 Ga0501070_0163989 3300049586 Bacteria 1831
799 Ga0501070_0194627 3300049586 Bacteria 1665
800 Ga0501071_0083141 3300049587 Bacteria 2345
801 Ga0501071_0262865 3300049587 Bacteria 1304
802 Ga0501072_0108870 3300049588 Bacteria 2205
803 Ga0501073_0039656 3300049589 Bacteria 3335
804 Ga0501073_0052415 3300049589 Bacteria 2857
805 Ga0501073_0055592 3300049589 Bacteria 2769
806 Ga0501073_0084925 3300049589 Bacteria 2203
807 Ga0501073_0121049 3300049589 Bacteria 1814
808 Ga0501073_0182092 3300049589 Bacteria 1454
809 Ga0501074_0000088 3300049590 Bacteria 44911
810 Ga0501074_0006992 3300049590 Bacteria 8151
811 Ga0501074_0031138 3300049590 Bacteria 3865
812 Ga0501074_0095861 3300049590 Bacteria 2125
813 Ga0501076_0110323 3300049592 Unclassified 2224
814 Ga0501079_0055154 3300049741 Bacteria 3067
815 Ga0501080_0000128 3300049742 Bacteria 53662
816 Ga0501080_0014162 3300049742 Bacteria 7339
817 Ga0501080_0027719 3300049742 Bacteria 5267
818 Ga0501080_0030375 3300049742 Bacteria 5034
819 Ga0501080_0053592 3300049742 Bacteria 3756
820 Ga0501080_0055629 3300049742 Bacteria 3685
821 Ga0501080_0116669 3300049742 Bacteria 2474
822 Ga0501080_0124974 3300049742 Bacteria 2383
823 Ga0501083_0000065 3300049744 Bacteria 73075
824 Ga0501083_0010520 3300049744 Bacteria 6510
825 Ga0501083_0024054 3300049744 Bacteria 4223
826 Ga0501083_0087623 3300049744 Bacteria 2058
827 Ga0501280_001626 3300049776 Bacteria 4031
828 Ga0501035_0000009 3300049822 Bacteria 310827
829 Ga0501035_0000185 3300049822 Bacteria 76291
830 Ga0501035_0000245 3300049822 Bacteria 65283
831 Ga0501035_0000882 3300049822 Bacteria 31844
832 Ga0501035_0011959 3300049822 Bacteria 8030
833 Ga0501035_0022247 3300049822 Bacteria 5822
834 Ga0501035_0037310 3300049822 Bacteria 4401
835 Ga0501035_0048273 3300049822 Bacteria 3818
836 Ga0501035_0123885 3300049822 Bacteria 2257
837 Ga0501035_0134079 3300049822 Bacteria 2157
838 Ga0501035_0258123 3300049822 Bacteria 1478
839 Ga0501035_0291825 3300049822 Bacteria 1376
840 Ga0501044_0000003 3300049823 Bacteria 345647
841 Ga0501044_0000005 3300049823 Bacteria 310855
842 Ga0501044_0019083 3300049823 Bacteria 7341
843 Ga0501044_0034463 3300049823 Bacteria 5308
844 Ga0501044_0039557 3300049823 Bacteria 4919
845 Ga0501044_0071681 3300049823 Bacteria 3523
846 Ga0501044_0073722 3300049823 Bacteria 3469
847 Ga0501044_0089823 3300049823 Bacteria 3100
848 Ga0501044_0097372 3300049823 Bacteria 2963
849 Ga0501044_0098444 3300049823 Bacteria 2944
850 Ga0501044_0116107 3300049823 Bacteria 2682
851 Ga0501044_0137519 3300049823 Bacteria 2433
852 Ga0501044_0433311 3300049823 Bacteria 1223
853 Ga0501045_0051974 3300049824 Bacteria 2991
854 Ga0501045_0094563 3300049824 Bacteria 2210
855 nmdc:mga03683_3851_c1 3300050489 Bacteria 4899
856 nmdc:mga03683_53243_c1 3300050489 Bacteria 1694
857 nmdc:mga03683_86217_c1 3300050489 Bacteria 1363
858 nmdc:mga03n38_64472_c1 3300050490 Bacteria 1677
859 nmdc:mga03n38_68907_c1 3300050490 Bacteria 1632
860 nmdc:mga00v17_130629_c1 3300050491 Bacteria 1605
861 nmdc:mga00v17_17_c1 3300050491 Bacteria 121949
862 nmdc:mga00v17_20007_c1 3300050491 Bacteria 3829
863 nmdc:mga0yw44_101_c1 3300050492 Bacteria 29987
864 nmdc:mga0yw44_19418_c1 3300050492 Bacteria 3748
865 nmdc:mga0yw44_9041_c1 3300050492 Bacteria 5009
866 nmdc:mga0k408_8787_c1 3300050493 Bacteria 5436
867 nmdc:mga06z11_13972_c1 3300050494 Bacteria 3542
868 nmdc:mga07m45_5169_c1 3300050496 Bacteria 6468
869 nmdc:mga08y16_207702_c1 3300050511 Bacteria 2028
870 nmdc:mga0sz30_10915_c1 3300050516 Bacteria 2332
871 nmdc:mga0sz30_121_c1 3300050516 Bacteria 29087
872 nmdc:mga0sz30_19108_c2 3300050516 Bacteria 2358
873 nmdc:mga0sz30_42061_c1 3300050516 Bacteria 1922
874 Ga0495619_0024481 3300053085 Bacteria 3872
875 Ga0500578_0076274 3300053086 Bacteria 2134
876 Ga0500578_0132496 3300053086 Bacteria 1562
877 Ga0500651_0162265 3300053093 Bacteria 1336
878 Ga0500560_001265 3300053107 Bacteria 4270
879 Ga0500569_001415 3300053109 Bacteria 4516
880 Ga0500569_012531 3300053109 Bacteria 2054
881 Ga0500594_0003013 3300053118 Bacteria 3686
882 Ga0500594_0004523 3300053118 Bacteria 3067
883 Ga0500595_031768 3300053119 Bacteria 1768
884 Ga0500608_029243 3300053122 Bacteria 2605
885 Ga0500618_006729 3300053125 Bacteria 3347
886 Ga0500618_011157 3300053125 Bacteria 2392
887 Ga0500658_0002401 3300053134 Bacteria 7252
888 Ga0500658_0002414 3300053134 Bacteria 7230
889 Ga0500559_0002424 3300053136 Bacteria 9652
890 Ga0500559_0012232 3300053136 Bacteria 3651
891 Ga0500561_0006852 3300053137 Bacteria 2193
892 Ga0500568_0000143 3300053139 Bacteria 63442
893 Ga0500568_0007107 3300053139 Bacteria 5532
894 Ga0500577_0046987 3300053142 Bacteria 1603
895 Ga0500590_017641 3300053148 Bacteria 3690
896 Ga0500590_061267 3300053148 Bacteria 1890
897 Ga0500616_0000771 3300053153 Bacteria 36893
898 Ga0500616_0015338 3300053153 Bacteria 4384
899 Ga0500616_0017450 3300053153 Bacteria 4071
900 Ga0500616_0018766 3300053153 Bacteria 3907
901 Ga0500620_000347 3300053155 Bacteria 8678
902 Ga0500622_0000174 3300053156 Bacteria 69403
903 Ga0500622_0000780 3300053156 Bacteria 27667
904 Ga0500622_0005550 3300053156 Bacteria 7542
905 Ga0500624_000443 3300053157 Bacteria 12488
906 Ga0500627_0019857 3300053158 Bacteria 2685
907 Ga0500633_0001730 3300053160 Bacteria 4249
908 Ga0500634_0000019 3300053161 Bacteria 109764
909 Ga0500636_0000038 3300053177 Bacteria 70653
910 Ga0500636_0003227 3300053177 Bacteria 9131
911 Ga0500636_0015051 3300053177 Bacteria 4553
912 Ga0500552_010052 3300053733 Bacteria 1156
913 Ga0501084_0007726 3300054114 Bacteria 8855
914 Ga0501084_0017035 3300054114 Bacteria 6038
915 Ga0501084_0077503 3300054114 Bacteria 2787
916 Ga0501084_0164476 3300054114 Bacteria 1872
917 Ga0500661_014073 3300055283 Bacteria 1441
918 Ga0587077_023705 3300059493 Bacteria 1110
919 Ga0587083_0029198 3300059505 Bacteria 1085
920 Ga0587090_000202 3300059510 Bacteria 4293
921 Ga0501082_0042195 3300060353 Bacteria 3933
922 Ga0501082_0126927 3300060353 Bacteria 2212
923 Ga0501082_0300925 3300060353 Bacteria 1397

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300036401 Ga0373937_0037906 Ga0373937_0037906_1026_2003 274
2 3300046529 Ga0495652_0158528 Ga0495652_0158528_181_1158 274
3 3300047319 Ga0495674_0162196 Ga0495674_0162196_633_1610 274
4 3300035692 Ga0373935_0145884 Ga0373935_0145884_722_1579 285
5 3300048913 Ga0496110_0092323 Ga0496110_0092323_309_1358 289
6 3300048918 Ga0496115_0062272 Ga0496115_0062272_1584_2633 289
7 3300048916 Ga0496113_0264337 Ga0496113_0264337_38_1030 291
8 3300048917 Ga0496114_0110058 Ga0496114_0110058_215_1126 300
9 3300046536 Ga0495587_0168157 Ga0495587_0168157_208_1185 302
10 iso_pu_bacteria 2924214083 2924217077 305
11 3300038726 Ga0400490_19842 Ga0400490_19842_150_1088 306
12 3300038741 Ga0400488_17246 Ga0400488_17246_199_1137 306
13 3300044901 Ga0466960_0082946 Ga0466960_0082946_153_1157 308
14 3300042157 Ga0439458_0017550 Ga0439458_0017550_263_1255 309
15 3300048905 Ga0496102_0013152 Ga0496102_0013152_3270_4202 310
16 3300048920 Ga0496117_0017033 Ga0496117_0017033_1800_2732 310
17 3300048921 Ga0496118_0015441 Ga0496118_0015441_3400_4332 310
18 3300048923 Ga0496120_0017730 Ga0496120_0017730_2677_3609 310
19 3300048924 Ga0496121_0016095 Ga0496121_0016095_3343_4275 310
20 3300048925 Ga0496122_0015011 Ga0496122_0015011_3243_4175 310
21 3300039062 Ga0400483_021750 Ga0400483_021750_6818_7831 311
22 iso_pu_bacteria 2965110997 2965112214 311
23 3300002773 JGI25152J39213_1000492 JGI25152J39213_10004925 315
24 3300003215 JGI25153J46596_10000299 JGI25153J46596_1000029920 315
25 3300025245 Ga0207425_1000162 Ga0207425_100016230 315
26 3300025258 Ga0209129_1000287 Ga0209129_100028720 315
27 3300025294 Ga0209025_1005549 Ga0209025_10055494 315
28 3300025297 Ga0209758_1000317 Ga0209758_100031761 315
29 3300041496 Ga0451839_0836516 Ga0451839_0836516_718_1668 315
30 3300048921 Ga0496118_0007072 Ga0496118_0007072_6409_7401 315
31 3300049579 Ga0501043_0166340 Ga0501043_0166340_600_1616 316
32 3300046461 Ga0495641_0005527 Ga0495641_0005527_4805_5773 317
33 3300049584 Ga0501068_0070346 Ga0501068_0070346_1068_2072 317
34 3300049587 Ga0501071_0262865 Ga0501071_0262865_172_1176 317
35 3300049742 Ga0501080_0116669 Ga0501080_0116669_357_1361 317
36 3300049744 Ga0501083_0024054 Ga0501083_0024054_2798_3802 317
37 3300049823 Ga0501044_0071681 Ga0501044_0071681_2246_3250 317
38 3300054114 Ga0501084_0164476 Ga0501084_0164476_626_1630 317
39 3300041507 Ga0451851_0361118 Ga0451851_0361118_5882_6874 318
40 3300048913 Ga0496110_0266985 Ga0496110_0266985_131_1120 318
41 3300053119 Ga0500595_031768 Ga0500595_031768_365_1369 318
42 3300053156 Ga0500622_0000780 Ga0500622_0000780_5832_6821 318
43 3300048925 Ga0496122_0013054 Ga0496122_0013054_4514_5527 320
44 3300048928 Ga0496125_0020551 Ga0496125_0020551_2910_3923 320
45 3300048929 Ga0496126_0022017 Ga0496126_0022017_4614_5579 321
46 3300049585 Ga0501069_0059544 Ga0501069_0059544_401_1405 321
47 3300049742 Ga0501080_0053592 Ga0501080_0053592_1785_2789 321
48 3300049822 Ga0501035_0048273 Ga0501035_0048273_503_1507 321
49 3300049823 Ga0501044_0116107 Ga0501044_0116107_1334_2338 321
50 3300009545 Ga0105237_10000038 Ga0105237_1000003894 322
51 3300025914 Ga0207671_10000045 Ga0207671_10000045147 322
52 3300042003 Ga0439443_001481 Ga0439443_001481_374_1357 322
53 3300042436 Ga0439435_0011342 Ga0439435_0011342_594_1577 322
54 3300048913 Ga0496110_0196010 Ga0496110_0196010_405_1442 322
55 3300048914 Ga0496111_0064513 Ga0496111_0064513_74_1111 322
56 3300048925 Ga0496122_0021546 Ga0496122_0021546_4229_5221 322
57 3300048928 Ga0496125_0000276 Ga0496125_0000276_17740_18777 322
58 3300053136 Ga0500559_0002424 Ga0500559_0002424_5700_6668 322
59 iso_pu_bacteria 2534681786 2535486666 322
60 3300009177 Ga0105248_10197854 Ga0105248_101978542 323
61 iso_pu_bacteria 2902330777 2902335105 323
62 3300035695 Ga0373927_0041025 Ga0373927_0041025_1435_2442 324
63 iso_pu_bacteria 2508501009 2508542185 324
64 iso_pu_bacteria 2508501050 2508731531 324
65 iso_pu_bacteria 2508501114 2509076931 324
66 iso_pu_bacteria 2773857925 2774868462 324
67 iso_pu_bacteria 2775506901 2776262671 324
68 iso_pu_bacteria 2835312727 2835313136 324
69 iso_pu_bacteria 2844315083 2844319628 324
70 iso_pu_bacteria 2882456835 2882459259 324
71 iso_pu_bacteria 2884298095 2884298657 324
72 iso_pu_bacteria 2894232714 2894233190 324
73 iso_pu_bacteria 2903727486 2903730691 324
74 iso_pu_bacteria 2906602504 2906609360 324
75 iso_pu_bacteria 2909042592 2909044189 324
76 iso_pu_bacteria 8056875544 8056877597 324
77 3300005458 Ga0070681_10342373 Ga0070681_103423731 325
78 3300006028 Ga0070717_10174906 Ga0070717_101749062 325
79 3300035695 Ga0373927_0163962 Ga0373927_0163962_276_1253 325
80 iso_pu_bacteria 2508501123 2509118376 325
81 iso_pu_bacteria 2509276022 2509395826 325
82 iso_pu_bacteria 2510917028 2511186277 325
83 iso_pu_bacteria 2511231027 2511390259 325
84 iso_pu_bacteria 2513237085 2513576163 325
85 iso_pu_bacteria 2513237088 2513599247 325
86 iso_pu_bacteria 2513237090 2513610688 325
87 iso_pu_bacteria 2513237144 2513912092 325
88 iso_pu_bacteria 2513237162 2514019037 325
89 iso_pu_bacteria 2515154113 2515633012 325
90 iso_pu_bacteria 2515154114 2515640228 325
91 iso_pu_bacteria 2515154134 2515742411 325
92 iso_pu_bacteria 2516653085 2517081626 325
93 iso_pu_bacteria 2517287029 2517411239 325
94 iso_pu_bacteria 2519899620 2520381140 325
95 iso_pu_bacteria 2529292951 2530648710 325
96 iso_pu_bacteria 2582581308 2585283768 325
97 iso_pu_bacteria 2582581308 2585283856 325
98 iso_pu_bacteria 2582581316 2585334549 325
99 iso_pu_bacteria 2585427526 2585528702 325
100 iso_pu_bacteria 2585427531 2585562831 325
101 iso_pu_bacteria 2585427608 2585899120 325
102 iso_pu_bacteria 2585427609 2585903248 325
103 iso_pu_bacteria 2585428125 2587978676 325
104 iso_pu_bacteria 2599185301 2599935289 325
105 iso_pu_bacteria 2615840626 2616309775 325
106 iso_pu_bacteria 2615840698 2616550952 325
107 iso_pu_bacteria 2643221558 2643813452 325
108 iso_pu_bacteria 2643221568 2643853836 325
109 iso_pu_bacteria 2643221582 2643922073 325
110 iso_pu_bacteria 2643221623 2644133144 325
111 iso_pu_bacteria 2693429783 2694628004 325
112 iso_pu_bacteria 2693429784 2694641139 325
113 iso_pu_bacteria 2718217927 2719389816 325
114 iso_pu_bacteria 2718217997 2719668959 325
115 iso_pu_bacteria 2718218199 2720489652 325
116 iso_pu_bacteria 2718218232 2720610372 325
117 iso_pu_bacteria 2718218233 2720617791 325
118 iso_pu_bacteria 2718218235 2720628933 325
119 iso_pu_bacteria 2718218269 2720772881 325
120 iso_pu_bacteria 2718218423 2721403459 325
121 iso_pu_bacteria 2721755556 2723030326 325
122 iso_pu_bacteria 2721755684 2723564688 325
123 iso_pu_bacteria 2721755685 2723569626 325
124 iso_pu_bacteria 2721755809 2724035035 325
125 iso_pu_bacteria 2721755819 2724092910 325
126 iso_pu_bacteria 2721755822 2724101173 325
127 iso_pu_bacteria 2721755823 2724113299 325
128 iso_pu_bacteria 2728369352 2730110859 325
129 iso_pu_bacteria 2765235802 2765466428 325
130 iso_pu_bacteria 2767802442 2770197049 325
131 iso_pu_bacteria 2775506902 2776270331 325
132 iso_pu_bacteria 2775506904 2776282321 325
133 iso_pu_bacteria 2791355256 2793297373 325
134 iso_pu_bacteria 2791355259 2793316741 325
135 iso_pu_bacteria 2791355262 2793334122 325
136 iso_pu_bacteria 2791355265 2793354577 325
137 iso_pu_bacteria 2802429605 2805930170 325
138 iso_pu_bacteria 2802429606 2805934805 325
139 iso_pu_bacteria 2838016132 2838016959 325
140 iso_pu_bacteria 2838042994 2838047182 325
141 iso_pu_bacteria 2838048938 2838050173 325
142 iso_pu_bacteria 2838061910 2838062333 325
143 iso_pu_bacteria 2838068647 2838069295 325
144 iso_pu_bacteria 2838668709 2838673113 325
145 iso_pu_bacteria 2838686498 2838688121 325
146 iso_pu_bacteria 2838701080 2838705683 325
147 iso_pu_bacteria 2838729681 2838732299 325
148 iso_pu_bacteria 2838742623 2838745281 325
149 iso_pu_bacteria 2839993093 2839998214 325
150 iso_pu_bacteria 2840764183 2840769052 325
151 iso_pu_bacteria 2841851746 2841851862 325
152 iso_pu_bacteria 2842156927 2842159063 325
153 iso_pu_bacteria 2842163707 2842165959 325
154 iso_pu_bacteria 2842180545 2842182677 325
155 iso_pu_bacteria 2842192696 2842196636 325
156 iso_pu_bacteria 2842205361 2842209222 325
157 iso_pu_bacteria 2842229732 2842233040 325
158 iso_pu_bacteria 2842243621 2842247457 325
159 iso_pu_bacteria 2842250916 2842255363 325
160 iso_pu_bacteria 2842257432 2842261453 325
161 iso_pu_bacteria 2842264693 2842268545 325
162 iso_pu_bacteria 2842271015 2842272929 325
163 iso_pu_bacteria 2842278818 2842282734 325
164 iso_pu_bacteria 2842304105 2842309590 325
165 iso_pu_bacteria 2842311132 2842316209 325
166 iso_pu_bacteria 2842317721 2842320463 325
167 iso_pu_bacteria 2842402390 2842405618 325
168 iso_pu_bacteria 2842409023 2842412202 325
169 iso_pu_bacteria 2842415677 2842418848 325
170 iso_pu_bacteria 2842422224 2842422486 325
171 iso_pu_bacteria 2842428310 2842432517 325
172 iso_pu_bacteria 2842434925 2842438821 325
173 iso_pu_bacteria 2842441272 2842445342 325
174 iso_pu_bacteria 2842447887 2842449647 325
175 iso_pu_bacteria 2842462802 2842466506 325
176 iso_pu_bacteria 2842469257 2842473436 325
177 iso_pu_bacteria 2842489311 2842489423 325
178 iso_pu_bacteria 2842495871 2842497918 325
179 iso_pu_bacteria 2842509118 2842515726 325
180 iso_pu_bacteria 2842871566 2842872226 325
181 iso_pu_bacteria 2844454524 2844461827 325
182 iso_pu_bacteria 2847670302 2847671853 325
183 iso_pu_bacteria 2854896431 2854899780 325
184 iso_pu_bacteria 2854916844 2854920259 325
185 iso_pu_bacteria 2854916844 2854921000 325
186 iso_pu_bacteria 2856314179 2856318417 325
187 iso_pu_bacteria 2856364286 2856370005 325
188 iso_pu_bacteria 2857349434 2857352801 325
189 iso_pu_bacteria 2869285874 2869290812 325
190 iso_pu_bacteria 2871429161 2871433094 325
191 iso_pu_bacteria 2871495908 2871502267 325
192 iso_pu_bacteria 2874123672 2874128237 325
193 iso_pu_bacteria 2874146452 2874153745 325
194 iso_pu_bacteria 2874155637 2874161010 325
195 iso_pu_bacteria 2876369609 2876376026 325
196 iso_pu_bacteria 2876377896 2876382967 325
197 iso_pu_bacteria 2876392853 2876397162 325
198 iso_pu_bacteria 2876413966 2876419050 325
199 iso_pu_bacteria 2878035449 2878037753 325
200 iso_pu_bacteria 2878745973 2878750707 325
201 iso_pu_bacteria 2878760144 2878766158 325
202 iso_pu_bacteria 2878767105 2878773359 325
203 iso_pu_bacteria 2881147464 2881148067 325
204 iso_pu_bacteria 2881161766 2881164858 325
205 iso_pu_bacteria 2885305155 2885306730 325
206 iso_pu_bacteria 2885334103 2885337796 325
207 iso_pu_bacteria 2888350351 2888353033 325
208 iso_pu_bacteria 2889010040 2889014776 325
209 iso_pu_bacteria 2889016732 2889020137 325
210 iso_pu_bacteria 2894652903 2894655655 325
211 iso_pu_bacteria 2903492973 2903496314 325
212 iso_pu_bacteria 2903540706 2903547204 325
213 iso_pu_bacteria 2904578770 2904582186 325
214 iso_pu_bacteria 2904659560 2904663916 325
215 iso_pu_bacteria 2906308376 2906313632 325
216 iso_pu_bacteria 2906321335 2906326341 325
217 iso_pu_bacteria 2906354277 2906360708 325
218 iso_pu_bacteria 2906414383 2906418454 325
219 iso_pu_bacteria 2919119836 2919123034 325
220 iso_pu_bacteria 2919166419 2919168316 325
221 iso_pu_bacteria 2919171160 2919176553 325
222 iso_pu_bacteria 2922130491 2922137559 325
223 iso_pu_bacteria 2922185730 2922193043 325
224 iso_pu_bacteria 2924718760 2924723590 325
225 iso_pu_bacteria 2928521798 2928524155 325
226 iso_pu_bacteria 2933570622 2933576035 325
227 iso_pu_bacteria 2933599457 2933599959 325
228 iso_pu_bacteria 2935901341 2935906398 325
229 iso_pu_bacteria 2937813078 2937820063 325
230 iso_pu_bacteria 2937972304 2937974381 325
231 iso_pu_bacteria 2937994558 2938001067 325
232 iso_pu_bacteria 2938014810 2938016538 325
233 iso_pu_bacteria 2954011201 2954013102 325
234 iso_pu_bacteria 2958064165 2958064758 325
235 iso_pu_bacteria 2958100919 2958101988 325
236 iso_pu_bacteria 2958130278 2958135212 325
237 iso_pu_bacteria 2958165035 2958171333 325
238 iso_pu_bacteria 2958179912 2958184241 325
239 iso_pu_bacteria 2961077736 2961082296 325
240 iso_pu_bacteria 2961114664 2961118944 325
241 iso_pu_bacteria 2961163497 2961169774 325
242 iso_pu_bacteria 2965018300 2965024534 325
243 iso_pu_bacteria 2965119406 2965126022 325
244 iso_pu_bacteria 2968110612 2968115055 325
245 iso_pu_bacteria 2968117919 2968122793 325
246 iso_pu_bacteria 2968171901 2968178166 325
247 iso_pu_bacteria 2970554993 2970561012 325
248 iso_pu_bacteria 2977843712 2977850393 325
249 iso_pu_bacteria 2977864932 2977867308 325
250 iso_pu_bacteria 2977942078 2977943477 325
251 iso_pu_bacteria 2977971508 2977975333 325
252 iso_pu_bacteria 2978969890 2978970937 325
253 iso_pu_bacteria 2979710463 2979711066 325
254 iso_pu_bacteria 2979742915 2979747810 325
255 iso_pu_bacteria 2984587000 2984588045 325
256 iso_pu_bacteria 2987636660 2987641393 325
257 iso_pu_bacteria 2987652177 2987658753 325
258 iso_pu_bacteria 2987659509 2987665998 325
259 iso_pu_bacteria 2996348954 2996355816 325
260 iso_pu_bacteria 2996887358 2996891089 325
261 iso_pu_bacteria 2996893221 2996895598 325
262 iso_pu_bacteria 3002141150 3002145048 325
263 iso_pu_bacteria 3004188549 3004195021 325
264 iso_pu_bacteria 3004203850 3004210203 325
265 iso_pu_bacteria 3004275668 3004282242 325
266 iso_pu_bacteria 3004289098 3004293743 325
267 iso_pu_bacteria 3005452660 3005454423 325
268 iso_pu_bacteria 8004387939 8004393101 325
269 iso_pu_bacteria 8004640170 8004641598 325
270 iso_pu_bacteria 8004714634 8004719888 325
271 iso_pu_bacteria 8005275841 8005275939 325
272 iso_pu_bacteria 8005282627 8005285942 325
273 iso_pu_bacteria 8005289223 8005295380 325
274 iso_pu_bacteria 8005307578 8005311700 325
275 iso_pu_bacteria 8005321885 8005325616 325
276 iso_pu_bacteria 8005382845 8005382903 325
277 iso_pu_bacteria 8005395548 8005398072 325
278 iso_pu_bacteria 8005430974 8005433478 325
279 iso_pu_bacteria 8005497431 8005502101 325
280 iso_pu_bacteria 8005570704 8005576536 325
281 iso_pu_bacteria 8005619151 8005624390 325
282 iso_pu_bacteria 8005626139 8005629652 325
283 iso_pu_bacteria 8005658619 8005662550 325
284 iso_pu_bacteria 8005668836 8005673524 325
285 iso_pu_bacteria 8005695170 8005695476 325
286 iso_pu_bacteria 8018176218 8018180827 325
287 iso_pu_bacteria 8023680758 8023684749 325
288 iso_pu_bacteria 8024501048 8024502950 325
289 iso_pu_bacteria 8055431914 8055433872 325
290 iso_pu_bacteria 8056382006 8056382321 325
291 3300021388 Ga0213875_10001555 Ga0213875_1000155516 326
292 3300037853 Ga0436364_0046669 Ga0436364_0046669_396_1385 326
293 iso_pu_bacteria 2503198000 2503198480 326
294 iso_pu_bacteria 2508501122 2509108085 326
295 iso_pu_bacteria 2508501123 2509114030 326
296 iso_pu_bacteria 2508501127 2509140753 326
297 iso_pu_bacteria 2509276018 2509368548 326
298 iso_pu_bacteria 2509276019 2509376740 326
299 iso_pu_bacteria 2509276021 2509391704 326
300 iso_pu_bacteria 2509276022 2509393533 326
301 iso_pu_bacteria 2509276033 2509447431 326
302 iso_pu_bacteria 2510065019 2510134267 326
303 iso_pu_bacteria 2510065057 2510302688 326
304 iso_pu_bacteria 2510461069 2510842109 326
305 iso_pu_bacteria 2510461069 2510842182 326
306 iso_pu_bacteria 2510461076 2510895706 326
307 iso_pu_bacteria 2510917022 2511131868 326
308 iso_pu_bacteria 2510917026 2511172370 326
309 iso_pu_bacteria 2510917028 2511186077 326
310 iso_pu_bacteria 2510917030 2511199351 326
311 iso_pu_bacteria 2511231027 2511388634 326
312 iso_pu_bacteria 2511231052 2511497738 326
313 iso_pu_bacteria 2512047086 2512528772 326
314 iso_pu_bacteria 2512875016 2512934055 326
315 iso_pu_bacteria 2512875024 2512962344 326
316 iso_pu_bacteria 2512875026 2512969599 326
317 iso_pu_bacteria 2513237084 2513567653 326
318 iso_pu_bacteria 2513237085 2513577940 326
319 iso_pu_bacteria 2513237086 2513584603 326
320 iso_pu_bacteria 2513237088 2513599464 326
321 iso_pu_bacteria 2513237089 2513607185 326
322 iso_pu_bacteria 2513237090 2513610662 326
323 iso_pu_bacteria 2513237091 2513618421 326
324 iso_pu_bacteria 2513237093 2513631912 326
325 iso_pu_bacteria 2513237103 2513707949 326
326 iso_pu_bacteria 2513237138 2513870151 326
327 iso_pu_bacteria 2513237140 2513883851 326
328 iso_pu_bacteria 2513237143 2513902045 326
329 iso_pu_bacteria 2513237144 2513908465 326
330 iso_pu_bacteria 2513237146 2513928171 326
331 iso_pu_bacteria 2513237156 2513988360 326
332 iso_pu_bacteria 2513237159 2513997606 326
333 iso_pu_bacteria 2513237160 2514008950 326
334 iso_pu_bacteria 2513237162 2514017982 326
335 iso_pu_bacteria 2513237164 2514038696 326
336 iso_pu_bacteria 2513237305 2514418241 326
337 iso_pu_bacteria 2515075009 2515113438 326
338 iso_pu_bacteria 2515154107 2515612006 326
339 iso_pu_bacteria 2515154113 2515635152 326
340 iso_pu_bacteria 2515154114 2515645594 326
341 iso_pu_bacteria 2515154116 2515655022 326
342 iso_pu_bacteria 2515154134 2515739800 326
343 iso_pu_bacteria 2516143018 2516206128 326
344 iso_pu_bacteria 2516653046 2516896610 326
345 iso_pu_bacteria 2516653077 2517037045 326
346 iso_pu_bacteria 2516653085 2517077396 326
347 iso_pu_bacteria 2517093000 2517096161 326
348 iso_pu_bacteria 2517287029 2517407777 326
349 iso_pu_bacteria 2517487022 2517565523 326
350 iso_pu_bacteria 2519899620 2520380330 326
351 iso_pu_bacteria 2523231067 2523466447 326
352 iso_pu_bacteria 2524023207 2524452107 326
353 iso_pu_bacteria 2524023209 2524458938 326
354 iso_pu_bacteria 2529292951 2530646471 326
355 iso_pu_bacteria 2534681796 2535517183 326
356 iso_pu_bacteria 2537561587 2537875331 326
357 iso_pu_bacteria 2551306084 2551681469 326
358 iso_pu_bacteria 2551306085 2551684704 326
359 iso_pu_bacteria 2551306086 2551692707 326
360 iso_pu_bacteria 2551306087 2551700303 326
361 iso_pu_bacteria 2551306089 2551713042 326
362 iso_pu_bacteria 2551306090 2551718161 326
363 iso_pu_bacteria 2551306090 2551722862 326
364 iso_pu_bacteria 2551306091 2551731536 326
365 iso_pu_bacteria 2551306092 2551737061 326
366 iso_pu_bacteria 2551306093 2551744381 326
367 iso_pu_bacteria 2554235003 2554244949 326
368 iso_pu_bacteria 2558860100 2558863896 326
369 iso_pu_bacteria 2558860242 2559297218 326
370 iso_pu_bacteria 2582581283 2585167523 326
371 iso_pu_bacteria 2582581294 2585201922 326
372 iso_pu_bacteria 2582581298 2585225316 326
373 iso_pu_bacteria 2582581299 2585228607 326
374 iso_pu_bacteria 2582581304 2585259414 326
375 iso_pu_bacteria 2582581306 2585265749 326
376 iso_pu_bacteria 2582581307 2585271429 326
377 iso_pu_bacteria 2582581308 2585279366 326
378 iso_pu_bacteria 2582581315 2585323028 326
379 iso_pu_bacteria 2582581316 2585331142 326
380 iso_pu_bacteria 2582581865 2585388955 326
381 iso_pu_bacteria 2582581866 2585395140 326
382 iso_pu_bacteria 2582581867 2585401040 326
383 iso_pu_bacteria 2585427526 2585524826 326
384 iso_pu_bacteria 2585427527 2585531149 326
385 iso_pu_bacteria 2585427528 2585538505 326
386 iso_pu_bacteria 2585427529 2585547872 326
387 iso_pu_bacteria 2585427530 2585552927 326
388 iso_pu_bacteria 2585427531 2585559172 326
389 iso_pu_bacteria 2585427590 2585822059 326
390 iso_pu_bacteria 2585427593 2585836458 326
391 iso_pu_bacteria 2585427608 2585898554 326
392 iso_pu_bacteria 2585427609 2585903882 326
393 iso_pu_bacteria 2585427633 2585993742 326
394 iso_pu_bacteria 2585427634 2586004591 326
395 iso_pu_bacteria 2585428125 2587981000 326
396 iso_pu_bacteria 2588253730 2588520195 326
397 iso_pu_bacteria 2599185156 2599332059 326
398 iso_pu_bacteria 2599185170 2599416939 326
399 iso_pu_bacteria 2599185210 2599605163 326
400 iso_pu_bacteria 2599185301 2599935262 326
401 iso_pu_bacteria 2599185352 2600196126 326
402 iso_pu_bacteria 2600255279 2601611677 326
403 iso_pu_bacteria 2600255308 2601748771 326
404 iso_pu_bacteria 2615840624 2616293047 326
405 iso_pu_bacteria 2615840626 2616311109 326
406 iso_pu_bacteria 2615840698 2616554548 326
407 iso_pu_bacteria 2617270742 2617385390 326
408 iso_pu_bacteria 2643221550 2643770647 326
409 iso_pu_bacteria 2643221551 2643777572 326
410 iso_pu_bacteria 2643221555 2643796020 326
411 iso_pu_bacteria 2643221557 2643804328 326
412 iso_pu_bacteria 2643221558 2643810932 326
413 iso_pu_bacteria 2643221564 2643838237 326
414 iso_pu_bacteria 2643221580 2643910115 326
415 iso_pu_bacteria 2643221580 2643912100 326
416 iso_pu_bacteria 2643221582 2643921760 326
417 iso_pu_bacteria 2643221591 2643963930 326
418 iso_pu_bacteria 2643221595 2643983773 326
419 iso_pu_bacteria 2643221599 2644006958 326
420 iso_pu_bacteria 2643221607 2644050155 326
421 iso_pu_bacteria 2643221610 2644065099 326
422 iso_pu_bacteria 2643221618 2644105402 326
423 iso_pu_bacteria 2643221626 2644145736 326
424 iso_pu_bacteria 2643221627 2644155906 326
425 iso_pu_bacteria 2643221634 2644191734 326
426 iso_pu_bacteria 2643221636 2644204786 326
427 iso_pu_bacteria 2643221637 2644208728 326
428 iso_pu_bacteria 2643221643 2644242637 326
429 iso_pu_bacteria 2643221653 2644299419 326
430 iso_pu_bacteria 2643221655 2644311371 326
431 iso_pu_bacteria 2643221659 2644331230 326
432 iso_pu_bacteria 2643221668 2644377508 326
433 iso_pu_bacteria 2643221674 2644410873 326
434 iso_pu_bacteria 2643221675 2644416771 326
435 iso_pu_bacteria 2643221680 2644449811 326
436 iso_pu_bacteria 2643221686 2644483076 326
437 iso_pu_bacteria 2643221688 2644494245 326
438 iso_pu_bacteria 2643221689 2644497722 326
439 iso_pu_bacteria 2643221693 2644519728 326
440 iso_pu_bacteria 2643221698 2644544675 326
441 iso_pu_bacteria 2643221712 2644617045 326
442 iso_pu_bacteria 2643221718 2644652258 326
443 iso_pu_bacteria 2643221719 2644657647 326
444 iso_pu_bacteria 2643221723 2644672832 326
445 iso_pu_bacteria 2643221726 2644689945 326
446 iso_pu_bacteria 2657244999 2657684898 326
447 iso_pu_bacteria 2667528174 2671111135 326
448 iso_pu_bacteria 2687453392 2688595802 326
449 iso_pu_bacteria 2690316117 2692315225 326
450 iso_pu_bacteria 2693429783 2694627978 326
451 iso_pu_bacteria 2693429784 2694636227 326
452 iso_pu_bacteria 2718217882 2719182107 326
453 iso_pu_bacteria 2718217927 2719386733 326
454 iso_pu_bacteria 2718217997 2719666471 326
455 iso_pu_bacteria 2718218009 2719732823 326
456 iso_pu_bacteria 2718218199 2720492891 326
457 iso_pu_bacteria 2718218232 2720614355 326
458 iso_pu_bacteria 2718218233 2720621127 326
459 iso_pu_bacteria 2718218235 2720632456 326
460 iso_pu_bacteria 2718218269 2720776178 326
461 iso_pu_bacteria 2718218363 2721148198 326
462 iso_pu_bacteria 2718218365 2721159651 326
463 iso_pu_bacteria 2718218366 2721165034 326
464 iso_pu_bacteria 2718218423 2721400439 326
465 iso_pu_bacteria 2721755514 2722841204 326
466 iso_pu_bacteria 2721755556 2723027775 326
467 iso_pu_bacteria 2721755684 2723561405 326
468 iso_pu_bacteria 2721755685 2723568028 326
469 iso_pu_bacteria 2721755686 2723573050 326
470 iso_pu_bacteria 2721755809 2724039252 326
471 iso_pu_bacteria 2721755810 2724045579 326
472 iso_pu_bacteria 2721755819 2724090785 326
473 iso_pu_bacteria 2721755822 2724105293 326
474 iso_pu_bacteria 2721755823 2724111120 326
475 iso_pu_bacteria 2724679232 2725950329 326
476 iso_pu_bacteria 2728369352 2730108711 326
477 iso_pu_bacteria 2728369365 2730165342 326
478 iso_pu_bacteria 2728369397 2730299283 326
479 iso_pu_bacteria 2738541293 2738804998 326
480 iso_pu_bacteria 2738541317 2738944699 326
481 iso_pu_bacteria 2738541333 2739033147 326
482 iso_pu_bacteria 2738543024 2739307410 326
483 iso_pu_bacteria 2738543031 2739350584 326
484 iso_pu_bacteria 2751185800 2753358098 326
485 iso_pu_bacteria 2756170246 2756674873 326
486 iso_pu_bacteria 2758568016 2758639124 326
487 iso_pu_bacteria 2765235942 2766066192 326
488 iso_pu_bacteria 2775507049 2776910367 326
489 iso_pu_bacteria 2775507266 2778175725 326
490 iso_pu_bacteria 2791355082 2792580104 326
491 iso_pu_bacteria 2791355082 2792581502 326
492 iso_pu_bacteria 2791355091 2792620525 326
493 iso_pu_bacteria 2791355092 2792625883 326
494 iso_pu_bacteria 2791355094 2792638822 326
495 iso_pu_bacteria 2791355123 2792746990 326
496 iso_pu_bacteria 2791355253 2793280046 326
497 iso_pu_bacteria 2791355256 2793294124 326
498 iso_pu_bacteria 2791355259 2793318120 326
499 iso_pu_bacteria 2791355260 2793319521 326
500 iso_pu_bacteria 2791355261 2793328886 326
501 iso_pu_bacteria 2791355262 2793334883 326
502 iso_pu_bacteria 2791355263 2793343020 326
503 iso_pu_bacteria 2791355264 2793346940 326
504 iso_pu_bacteria 2791355265 2793351527 326
505 iso_pu_bacteria 2791355266 2793362459 326
506 iso_pu_bacteria 2791355267 2793367576 326
507 iso_pu_bacteria 2802428858 2802716029 326
508 iso_pu_bacteria 2802428859 2802722947 326
509 iso_pu_bacteria 2802428860 2802728922 326
510 iso_pu_bacteria 2802428861 2802735288 326
511 iso_pu_bacteria 2802428862 2802742108 326
512 iso_pu_bacteria 2802428863 2802748556 326
513 iso_pu_bacteria 2802429268 2804752974 326
514 iso_pu_bacteria 2802429605 2805926761 326
515 iso_pu_bacteria 2802429606 2805932669 326
516 iso_pu_bacteria 2802429633 2806045286 326
517 iso_pu_bacteria 2802429634 2806049919 326
518 iso_pu_bacteria 2802429635 2806056757 326
519 iso_pu_bacteria 2802429636 2806064139 326
520 iso_pu_bacteria 2802429637 2806071407 326
521 iso_pu_bacteria 2808606387 2808988824 326
522 iso_pu_bacteria 2818991272 2819243992 326
523 iso_pu_bacteria 2818991439 2819561313 326
524 iso_pu_bacteria 2818991448 2819609435 326
525 iso_pu_bacteria 2818991453 2819641254 326
526 iso_pu_bacteria 2838016132 2838020038 326
527 iso_pu_bacteria 2838022645 2838023537 326
528 iso_pu_bacteria 2838029111 2838033300 326
529 iso_pu_bacteria 2838035591 2838041732 326
530 iso_pu_bacteria 2838042994 2838045283 326
531 iso_pu_bacteria 2838048938 2838052848 326
532 iso_pu_bacteria 2838061910 2838065106 326
533 iso_pu_bacteria 2838068647 2838069833 326
534 iso_pu_bacteria 2838074704 2838079725 326
535 iso_pu_bacteria 2838661181 2838661294 326
536 iso_pu_bacteria 2838668709 2838674835 326
537 iso_pu_bacteria 2838675328 2838679538 326
538 iso_pu_bacteria 2838680041 2838683129 326
539 iso_pu_bacteria 2838686498 2838686729 326
540 iso_pu_bacteria 2838694306 2838697927 326
541 iso_pu_bacteria 2838701080 2838707112 326
542 iso_pu_bacteria 2838707686 2838711042 326
543 iso_pu_bacteria 2838714209 2838718895 326
544 iso_pu_bacteria 2838719591 2838723894 326
545 iso_pu_bacteria 2838724970 2838729216 326
546 iso_pu_bacteria 2838729681 2838730313 326
547 iso_pu_bacteria 2838742623 2838742672 326
548 iso_pu_bacteria 2841734538 2841736223 326
549 iso_pu_bacteria 2841846520 2841851014 326
550 iso_pu_bacteria 2841851746 2841854557 326
551 iso_pu_bacteria 2841859092 2841863822 326
552 iso_pu_bacteria 2841864319 2841867281 326
553 iso_pu_bacteria 2842077413 2842079217 326
554 iso_pu_bacteria 2842110456 2842112948 326
555 iso_pu_bacteria 2842118031 2842118272 326
556 iso_pu_bacteria 2842124991 2842129915 326
557 iso_pu_bacteria 2842130223 2842134343 326
558 iso_pu_bacteria 2842146304 2842151756 326
559 iso_pu_bacteria 2842152218 2842156339 326
560 iso_pu_bacteria 2842156927 2842158424 326
561 iso_pu_bacteria 2842163707 2842170201 326
562 iso_pu_bacteria 2842170452 2842175141 326
563 iso_pu_bacteria 2842175837 2842180057 326
564 iso_pu_bacteria 2842180545 2842182039 326
565 iso_pu_bacteria 2842187318 2842191524 326
566 iso_pu_bacteria 2842192696 2842195738 326
567 iso_pu_bacteria 2842198810 2842199051 326
568 iso_pu_bacteria 2842205361 2842209497 326
569 iso_pu_bacteria 2842211629 2842215841 326
570 iso_pu_bacteria 2842217011 2842218276 326
571 iso_pu_bacteria 2842224351 2842228659 326
572 iso_pu_bacteria 2842229732 2842229962 326
573 iso_pu_bacteria 2842237096 2842240186 326
574 iso_pu_bacteria 2842243621 2842243851 326
575 iso_pu_bacteria 2842250916 2842256950 326
576 iso_pu_bacteria 2842257432 2842258064 326
577 iso_pu_bacteria 2842264693 2842267759 326
578 iso_pu_bacteria 2842271015 2842271733 326
579 iso_pu_bacteria 2842278818 2842282951 326
580 iso_pu_bacteria 2842285085 2842285295 326
581 iso_pu_bacteria 2842291075 2842292879 326
582 iso_pu_bacteria 2842298080 2842298290 326
583 iso_pu_bacteria 2842304105 2842305366 326
584 iso_pu_bacteria 2842311132 2842313908 326
585 iso_pu_bacteria 2842317721 2842319856 326
586 iso_pu_bacteria 2842341865 2842347910 326
587 iso_pu_bacteria 2842357229 2842360110 326
588 iso_pu_bacteria 2842363717 2842368415 326
589 iso_pu_bacteria 2842370503 2842373759 326
590 iso_pu_bacteria 2842377471 2842379276 326
591 iso_pu_bacteria 2842384541 2842384783 326
592 iso_pu_bacteria 2842395702 2842400689 326
593 iso_pu_bacteria 2842402390 2842402654 326
594 iso_pu_bacteria 2842409023 2842409974 326
595 iso_pu_bacteria 2842415677 2842416623 326
596 iso_pu_bacteria 2842422224 2842423447 326
597 iso_pu_bacteria 2842428310 2842430403 326
598 iso_pu_bacteria 2842434925 2842436785 326
599 iso_pu_bacteria 2842441272 2842443373 326
600 iso_pu_bacteria 2842447887 2842449243 326
601 iso_pu_bacteria 2842462802 2842466657 326
602 iso_pu_bacteria 2842469257 2842471345 326
603 iso_pu_bacteria 2842475841 2842480035 326
604 iso_pu_bacteria 2842482326 2842483775 326
605 iso_pu_bacteria 2842489311 2842493603 326
606 iso_pu_bacteria 2842495871 2842497754 326
607 iso_pu_bacteria 2842502639 2842505180 326
608 iso_pu_bacteria 2842509118 2842514192 326
609 iso_pu_bacteria 2842515876 2842520604 326
610 iso_pu_bacteria 2842521101 2842522151 326
611 iso_pu_bacteria 2842922631 2842924394 326
612 iso_pu_bacteria 2844002411 2844003650 326
613 iso_pu_bacteria 2844009547 2844010607 326
614 iso_pu_bacteria 2844163670 2844163943 326
615 iso_pu_bacteria 2844454524 2844458026 326
616 iso_pu_bacteria 2847417321 2847419718 326
617 iso_pu_bacteria 2847670302 2847673359 326
618 iso_pu_bacteria 2847686936 2847689869 326
619 iso_pu_bacteria 2848992105 2848994720 326
620 iso_pu_bacteria 2850079185 2850081742 326
621 iso_pu_bacteria 2852387548 2852390575 326
622 iso_pu_bacteria 2854911287 2854916347 326
623 iso_pu_bacteria 2855825444 2855828557 326
624 iso_pu_bacteria 2855839649 2855843682 326
625 iso_pu_bacteria 2855872281 2855877235 326
626 iso_pu_bacteria 2856314179 2856319172 326
627 iso_pu_bacteria 2856320880 2856322229 326
628 iso_pu_bacteria 2856328259 2856332712 326
629 iso_pu_bacteria 2856334872 2856340699 326
630 iso_pu_bacteria 2856342000 2856342843 326
631 iso_pu_bacteria 2856349417 2856355177 326
632 iso_pu_bacteria 2856364286 2856369976 326
633 iso_pu_bacteria 2857349434 2857352829 326
634 iso_pu_bacteria 2857367948 2857369256 326
635 iso_pu_bacteria 2857516855 2857517103 326
636 iso_pu_bacteria 2858800743 2858807072 326
637 iso_pu_bacteria 2869162929 2869165342 326
638 iso_pu_bacteria 2869169390 2869173703 326
639 iso_pu_bacteria 2869242130 2869245191 326
640 iso_pu_bacteria 2869249662 2869255857 326
641 iso_pu_bacteria 2869256925 2869257097 326
642 iso_pu_bacteria 2869264136 2869265112 326
643 iso_pu_bacteria 2869271264 2869277354 326
644 iso_pu_bacteria 2869278585 2869284676 326
645 iso_pu_bacteria 2869285874 2869290783 326
646 iso_pu_bacteria 2871429161 2871433065 326
647 iso_pu_bacteria 2871435913 2871438860 326
648 iso_pu_bacteria 2871451962 2871452184 326
649 iso_pu_bacteria 2871459585 2871465920 326
650 iso_pu_bacteria 2871466892 2871472939 326
651 iso_pu_bacteria 2871474448 2871475651 326
652 iso_pu_bacteria 2871481445 2871484382 326
653 iso_pu_bacteria 2871495908 2871502296 326
654 iso_pu_bacteria 2874102143 2874108445 326
655 iso_pu_bacteria 2874109183 2874109490 326
656 iso_pu_bacteria 2874116593 2874122028 326
657 iso_pu_bacteria 2874123672 2874124233 326
658 iso_pu_bacteria 2874131515 2874138688 326
659 iso_pu_bacteria 2874139085 2874143004 326
660 iso_pu_bacteria 2874146452 2874153774 326
661 iso_pu_bacteria 2874155637 2874161039 326
662 iso_pu_bacteria 2874162495 2874168334 326
663 iso_pu_bacteria 2874168670 2874172213 326
664 iso_pu_bacteria 2876363079 2876363687 326
665 iso_pu_bacteria 2876369609 2876376015 326
666 iso_pu_bacteria 2876377896 2876381382 326
667 iso_pu_bacteria 2876386047 2876386049 326
668 iso_pu_bacteria 2876392853 2876397139 326
669 iso_pu_bacteria 2876399893 2876403786 326
670 iso_pu_bacteria 2876406927 2876407917 326
671 iso_pu_bacteria 2876413966 2876419079 326
672 iso_pu_bacteria 2876420981 2876424492 326
673 iso_pu_bacteria 2878035449 2878039561 326
674 iso_pu_bacteria 2878730984 2878731909 326
675 iso_pu_bacteria 2878738818 2878740927 326
676 iso_pu_bacteria 2878745973 2878750678 326
677 iso_pu_bacteria 2878753008 2878754313 326
678 iso_pu_bacteria 2878760144 2878766187 326
679 iso_pu_bacteria 2878767105 2878773388 326
680 iso_pu_bacteria 2878774303 2878778243 326
681 iso_pu_bacteria 2878781027 2878785543 326
682 iso_pu_bacteria 2881147464 2881148229 326
683 iso_pu_bacteria 2881155292 2881159187 326
684 iso_pu_bacteria 2881161766 2881164883 326
685 iso_pu_bacteria 2881853255 2881856291 326
686 iso_pu_bacteria 2881861095 2881867259 326
687 iso_pu_bacteria 2882632389 2882634584 326
688 iso_pu_bacteria 2882912400 2882913261 326
689 iso_pu_bacteria 2885305155 2885306758 326
690 iso_pu_bacteria 2885312484 2885314315 326
691 iso_pu_bacteria 2885318864 2885323614 326
692 iso_pu_bacteria 2885326080 2885332988 326
693 iso_pu_bacteria 2885334103 2885335734 326
694 iso_pu_bacteria 2885342637 2885344602 326
695 iso_pu_bacteria 2885350715 2885355668 326
696 iso_pu_bacteria 2888337043 2888343446 326
697 iso_pu_bacteria 2888343758 2888344183 326
698 iso_pu_bacteria 2888350351 2888353057 326
699 iso_pu_bacteria 2889010040 2889014803 326
700 iso_pu_bacteria 2889016732 2889020113 326
701 iso_pu_bacteria 2889790730 2889792025 326
702 iso_pu_bacteria 2889914905 2889918346 326
703 iso_pu_bacteria 2891048133 2891051656 326
704 iso_pu_bacteria 2891373044 2891373659 326
705 iso_pu_bacteria 2896384573 2896391162 326
706 iso_pu_bacteria 2898795034 2898796591 326
707 iso_pu_bacteria 2899792073 2899793261 326
708 iso_pu_bacteria 2899803654 2899808422 326
709 iso_pu_bacteria 2899845264 2899850504 326
710 iso_pu_bacteria 2903448605 2903454228 326
711 iso_pu_bacteria 2903492973 2903496285 326
712 iso_pu_bacteria 2903492973 2903497372 326
713 iso_pu_bacteria 2903513507 2903517504 326
714 iso_pu_bacteria 2903521522 2903523252 326
715 iso_pu_bacteria 2903528002 2903529291 326
716 iso_pu_bacteria 2903540706 2903547233 326
717 iso_pu_bacteria 2904659560 2904663893 326
718 iso_pu_bacteria 2906308376 2906313603 326
719 iso_pu_bacteria 2906321335 2906326312 326
720 iso_pu_bacteria 2906328253 2906334269 326
721 iso_pu_bacteria 2906363423 2906369755 326
722 iso_pu_bacteria 2906370794 2906372837 326
723 iso_pu_bacteria 2906378014 2906384940 326
724 iso_pu_bacteria 2906393657 2906394006 326
725 iso_pu_bacteria 2906401398 2906407733 326
726 iso_pu_bacteria 2906408224 2906408501 326
727 iso_pu_bacteria 2906414383 2906419244 326
728 iso_pu_bacteria 2906427513 2906433331 326
729 iso_pu_bacteria 2906626472 2906632611 326
730 iso_pu_bacteria 2913295892 2913296182 326
731 iso_pu_bacteria 2913308742 2913309320 326
732 iso_pu_bacteria 2915650412 2915652760 326
733 iso_pu_bacteria 2915980308 2915983695 326
734 iso_pu_bacteria 2915986958 2915988610 326
735 iso_pu_bacteria 2915993759 2916000230 326
736 iso_pu_bacteria 2916000859 2916007336 326
737 iso_pu_bacteria 2916007675 2916013471 326
738 iso_pu_bacteria 2916014648 2916020746 326
739 iso_pu_bacteria 2916021584 2916028088 326
740 iso_pu_bacteria 2916028427 2916031155 326
741 iso_pu_bacteria 2916035215 2916041553 326
742 iso_pu_bacteria 2916041962 2916043670 326
743 iso_pu_bacteria 2916048683 2916054052 326
744 iso_pu_bacteria 2916055098 2916057791 326
745 iso_pu_bacteria 2916061851 2916068331 326
746 iso_pu_bacteria 2916076590 2916082558 326
747 iso_pu_bacteria 2917554339 2917558630 326
748 iso_pu_bacteria 2919100787 2919105518 326
749 iso_pu_bacteria 2919114240 2919118730 326
750 iso_pu_bacteria 2919171160 2919174038 326
751 iso_pu_bacteria 2919408235 2919410299 326
752 iso_pu_bacteria 2919679072 2919681404 326
753 iso_pu_bacteria 2920760137 2920761244 326
754 iso_pu_bacteria 2920822456 2920825555 326
755 iso_pu_bacteria 2921201388 2921204325 326
756 iso_pu_bacteria 2921208531 2921213252 326
757 iso_pu_bacteria 2921237296 2921243249 326
758 iso_pu_bacteria 2921244191 2921245723 326
759 iso_pu_bacteria 2921250672 2921256934 326
760 iso_pu_bacteria 2921263974 2921266562 326
761 iso_pu_bacteria 2921282425 2921284676 326
762 iso_pu_bacteria 2921289301 2921290719 326
763 iso_pu_bacteria 2921296804 2921302626 326
764 iso_pu_bacteria 2922130491 2922132602 326
765 iso_pu_bacteria 2922151315 2922154956 326
766 iso_pu_bacteria 2922158528 2922159724 326
767 iso_pu_bacteria 2922172374 2922174386 326
768 iso_pu_bacteria 2922178524 2922181927 326
769 iso_pu_bacteria 2922185730 2922193607 326
770 iso_pu_bacteria 2923556063 2923560184 326
771 iso_pu_bacteria 2924144063 2924148108 326
772 iso_pu_bacteria 2924150972 2924158260 326
773 iso_pu_bacteria 2924158325 2924164268 326
774 iso_pu_bacteria 2924165586 2924168450 326
775 iso_pu_bacteria 2924172951 2924174830 326
776 iso_pu_bacteria 2924179722 2924182025 326
777 iso_pu_bacteria 2924186466 2924188901 326
778 iso_pu_bacteria 2924193448 2924195751 326
779 iso_pu_bacteria 2924200457 2924202979 326
780 iso_pu_bacteria 2924207177 2924210013 326
781 iso_pu_bacteria 2924221636 2924222652 326
782 iso_pu_bacteria 2924228884 2924231051 326
783 iso_pu_bacteria 2924710171 2924717161 326
784 iso_pu_bacteria 2924726620 2924728926 326
785 iso_pu_bacteria 2924733363 2924736509 326
786 iso_pu_bacteria 2924741084 2924745487 326
787 iso_pu_bacteria 2924748358 2924748630 326
788 iso_pu_bacteria 2924754689 2924756974 326
789 iso_pu_bacteria 2924762789 2924765602 326
790 iso_pu_bacteria 2924776078 2924778528 326
791 iso_pu_bacteria 2924784321 2924785001 326
792 iso_pu_bacteria 2926754445 2926758249 326
793 iso_pu_bacteria 2926760298 2926764186 326
794 iso_pu_bacteria 2932401849 2932403748 326
795 iso_pu_bacteria 2933006813 2933011113 326
796 iso_pu_bacteria 2933011516 2933016347 326
797 iso_pu_bacteria 2933016740 2933018557 326
798 iso_pu_bacteria 2933570622 2933571173 326
799 iso_pu_bacteria 2933586486 2933588995 326
800 iso_pu_bacteria 2933594066 2933599057 326
801 iso_pu_bacteria 2933599457 2933600639 326
802 iso_pu_bacteria 2935894831 2935896688 326
803 iso_pu_bacteria 2935901341 2935901635 326
804 iso_pu_bacteria 2936367885 2936371724 326
805 iso_pu_bacteria 2936375103 2936379559 326
806 iso_pu_bacteria 2936381700 2936383306 326
807 iso_pu_bacteria 2936996657 2937001561 326
808 iso_pu_bacteria 2937002841 2937005559 326
809 iso_pu_bacteria 2937009748 2937014271 326
810 iso_pu_bacteria 2937016420 2937019195 326
811 iso_pu_bacteria 2937023124 2937026137 326
812 iso_pu_bacteria 2937029754 2937035046 326
813 iso_pu_bacteria 2937042894 2937045771 326
814 iso_pu_bacteria 2937049772 2937054073 326
815 iso_pu_bacteria 2937056579 2937056827 326
816 iso_pu_bacteria 2937063883 2937066111 326
817 iso_pu_bacteria 2937071275 2937077650 326
818 iso_pu_bacteria 2937078374 2937084310 326
819 iso_pu_bacteria 2937084907 2937091748 326
820 iso_pu_bacteria 2937091812 2937093315 326
821 iso_pu_bacteria 2937098957 2937105068 326
822 iso_pu_bacteria 2937106411 2937111493 326
823 iso_pu_bacteria 2937113482 2937118866 326
824 iso_pu_bacteria 2937119839 2937120701 326
825 iso_pu_bacteria 2937126314 2937128962 326
826 iso_pu_bacteria 2937813078 2937820092 326
827 iso_pu_bacteria 2937822353 2937826499 326
828 iso_pu_bacteria 2937836603 2937840593 326
829 iso_pu_bacteria 2937848649 2937849570 326
830 iso_pu_bacteria 2937861824 2937866108 326
831 iso_pu_bacteria 2937868953 2937877294 326
832 iso_pu_bacteria 2937877337 2937878838 326
833 iso_pu_bacteria 2937891427 2937897365 326
834 iso_pu_bacteria 2937980651 2937985214 326
835 iso_pu_bacteria 2937994558 2938001096 326
836 iso_pu_bacteria 2938014810 2938019701 326
837 iso_pu_bacteria 2939669807 2939671713 326
838 iso_pu_bacteria 2941499720 2941504658 326
839 iso_pu_bacteria 2957375807 2957381022 326
840 iso_pu_bacteria 2957382221 2957382976 326
841 iso_pu_bacteria 2957388812 2957391933 326
842 iso_pu_bacteria 2957395598 2957401399 326
843 iso_pu_bacteria 2957402308 2957402972 326
844 iso_pu_bacteria 2957408893 2957411328 326
845 iso_pu_bacteria 2957415311 2957418333 326
846 iso_pu_bacteria 2957422303 2957428029 326
847 iso_pu_bacteria 2957430029 2957436139 326
848 iso_pu_bacteria 2957437181 2957442263 326
849 iso_pu_bacteria 2957443900 2957443908 326
850 iso_pu_bacteria 2957450854 2957454871 326
851 iso_pu_bacteria 2957457609 2957464081 326
852 iso_pu_bacteria 2957464669 2957464864 326
853 iso_pu_bacteria 2957471148 2957477498 326
854 iso_pu_bacteria 2957478035 2957480499 326
855 iso_pu_bacteria 2957484790 2957487067 326
856 iso_pu_bacteria 2957491536 2957491729 326
857 iso_pu_bacteria 2957498199 2957498986 326
858 iso_pu_bacteria 2957505466 2957510113 326
859 iso_pu_bacteria 2958034702 2958041469 326
860 iso_pu_bacteria 2958041894 2958042443 326
861 iso_pu_bacteria 2958064165 2958069535 326
862 iso_pu_bacteria 2958071322 2958077184 326
863 iso_pu_bacteria 2958084443 2958085989 326
864 iso_pu_bacteria 2958092219 2958098952 326
865 iso_pu_bacteria 2958100919 2958101964 326
866 iso_pu_bacteria 2958108152 2958112523 326
867 iso_pu_bacteria 2958115193 2958119250 326
868 iso_pu_bacteria 2958122699 2958123249 326
869 iso_pu_bacteria 2958130278 2958135183 326
870 iso_pu_bacteria 2958137437 2958140070 326
871 iso_pu_bacteria 2958144490 2958147315 326
872 iso_pu_bacteria 2958158011 2958163727 326
873 iso_pu_bacteria 2958165035 2958171362 326
874 iso_pu_bacteria 2958172287 2958174405 326
875 iso_pu_bacteria 2958179912 2958184212 326
876 iso_pu_bacteria 2960584000 2960584638 326
877 iso_pu_bacteria 2960591022 2960596518 326
878 iso_pu_bacteria 2960597568 2960598428 326
879 iso_pu_bacteria 2960603979 2960604969 326
880 iso_pu_bacteria 2960610863 2960613637 326
881 iso_pu_bacteria 2960617483 2960622159 326
882 iso_pu_bacteria 2960624210 2960625738 326
883 iso_pu_bacteria 2960631154 2960634414 326
884 iso_pu_bacteria 2960637947 2960640718 326
885 iso_pu_bacteria 2960645483 2960645680 326
886 iso_pu_bacteria 2960652885 2960658138 326
887 iso_pu_bacteria 2960660292 2960662774 326
888 iso_pu_bacteria 2960667422 2960669735 326
889 iso_pu_bacteria 2960674078 2960680359 326
890 iso_pu_bacteria 2960680706 2960683357 326
891 iso_pu_bacteria 2960687367 2960690846 326
892 iso_pu_bacteria 2960693952 2960695345 326
893 iso_pu_bacteria 2961077736 2961082267 326
894 iso_pu_bacteria 2961114664 2961118967 326
895 iso_pu_bacteria 2961163497 2961169803 326
896 iso_pu_bacteria 2961170736 2961176370 326
897 iso_pu_bacteria 2961183825 2961190669 326
898 iso_pu_bacteria 2963644680 2963645147 326
899 iso_pu_bacteria 2964607997 2964610802 326
900 iso_pu_bacteria 2964615318 2964615983 326
901 iso_pu_bacteria 2964621998 2964624169 326
902 iso_pu_bacteria 2964628898 2964632527 326
903 iso_pu_bacteria 2964636051 2964637320 326
904 iso_pu_bacteria 2964643177 2964644566 326
905 iso_pu_bacteria 2964649959 2964655586 326
906 iso_pu_bacteria 2964656573 2964657557 326
907 iso_pu_bacteria 2964663802 2964666785 326
908 iso_pu_bacteria 2964670856 2964677160 326
909 iso_pu_bacteria 2964678106 2964681971 326
910 iso_pu_bacteria 2964685014 2964685598 326
911 iso_pu_bacteria 2964691889 2964698601 326
912 iso_pu_bacteria 2964698721 2964703258 326
913 iso_pu_bacteria 2964705432 2964711624 326
914 iso_pu_bacteria 2964712639 2964714036 326
915 iso_pu_bacteria 2964719344 2964721110 326
916 iso_pu_bacteria 2965018300 2965024563 326
917 iso_pu_bacteria 2965025482 2965030161 326
918 iso_pu_bacteria 2965032056 2965038630 326
919 iso_pu_bacteria 2965040258 2965044012 326
920 iso_pu_bacteria 2965047637 2965054737 326
921 iso_pu_bacteria 2965062239 2965062395 326
922 iso_pu_bacteria 2965089291 2965096600 326
923 iso_pu_bacteria 2965102966 2965109871 326
924 iso_pu_bacteria 2965119406 2965127211 326
925 iso_pu_bacteria 2967664464 2967669628 326
926 iso_pu_bacteria 2967671571 2967677047 326
927 iso_pu_bacteria 2967678726 2967679171 326
928 iso_pu_bacteria 2967686174 2967692147 326
929 iso_pu_bacteria 2967693043 2967698842 326
930 iso_pu_bacteria 2967699805 2967703787 326
931 iso_pu_bacteria 2967706974 2967708933 326
932 iso_pu_bacteria 2967714385 2967716966 326
933 iso_pu_bacteria 2967721400 2967723533 326
934 iso_pu_bacteria 2967728569 2967728837 326
935 iso_pu_bacteria 2967735183 2967740671 326
936 iso_pu_bacteria 2967742019 2967747842 326
937 iso_pu_bacteria 2967748971 2967750821 326
938 iso_pu_bacteria 2967755722 2967761857 326
939 iso_pu_bacteria 2967762386 2967765081 326
940 iso_pu_bacteria 2967769361 2967772315 326
941 iso_pu_bacteria 2967775926 2967777583 326
942 iso_pu_bacteria 2967996073 2967996715 326
943 iso_pu_bacteria 2968003550 2968004777 326
944 iso_pu_bacteria 2968016561 2968022989 326
945 iso_pu_bacteria 2968083720 2968089954 326
946 iso_pu_bacteria 2968091066 2968093681 326
947 iso_pu_bacteria 2968097103 2968098511 326
948 iso_pu_bacteria 2968110612 2968115032 326
949 iso_pu_bacteria 2968117919 2968122766 326
950 iso_pu_bacteria 2968128360 2968133886 326
951 iso_pu_bacteria 2968138860 2968139294 326
952 iso_pu_bacteria 2968171901 2968178195 326
953 iso_pu_bacteria 2970019648 2970022409 326
954 iso_pu_bacteria 2970026789 2970032735 326
955 iso_pu_bacteria 2970033650 2970039031 326
956 iso_pu_bacteria 2970040964 2970047131 326
957 iso_pu_bacteria 2970047711 2970053746 326
958 iso_pu_bacteria 2970054988 2970058632 326
959 iso_pu_bacteria 2970061556 2970067940 326
960 iso_pu_bacteria 2970068827 2970071270 326
961 iso_pu_bacteria 2970076120 2970078396 326
962 iso_pu_bacteria 2970082768 2970083953 326
963 iso_pu_bacteria 2970088815 2970090182 326
964 iso_pu_bacteria 2970095765 2970097380 326
965 iso_pu_bacteria 2970102677 2970105645 326
966 iso_pu_bacteria 2970109326 2970109793 326
967 iso_pu_bacteria 2970116247 2970121550 326
968 iso_pu_bacteria 2970122695 2970126651 326
969 iso_pu_bacteria 2970129317 2970135049 326
970 iso_pu_bacteria 2970136068 2970143343 326
971 iso_pu_bacteria 2970143518 2970143929 326
972 iso_pu_bacteria 2970149975 2970154141 326
973 iso_pu_bacteria 2970156795 2970162921 326
974 iso_pu_bacteria 2970164137 2970167733 326
975 iso_pu_bacteria 2970170962 2970176659 326
976 iso_pu_bacteria 2970177841 2970179509 326
977 iso_pu_bacteria 2970184632 2970188381 326
978 iso_pu_bacteria 2970191845 2970194646 326
979 iso_pu_bacteria 2970469710 2970475574 326
980 iso_pu_bacteria 2970489779 2970492395 326
981 iso_pu_bacteria 2970503327 2970509041 326
982 iso_pu_bacteria 2970510686 2970510880 326
983 iso_pu_bacteria 2970524798 2970525894 326
984 iso_pu_bacteria 2970540015 2970544445 326
985 iso_pu_bacteria 2970547951 2970550137 326
986 iso_pu_bacteria 2970554993 2970561041 326
987 iso_pu_bacteria 2970593180 2970599287 326
988 iso_pu_bacteria 2970619444 2970623878 326
989 iso_pu_bacteria 2970627176 2970628677 326
990 iso_pu_bacteria 2977516862 2977518893 326
991 iso_pu_bacteria 2977523885 2977524038 326
992 iso_pu_bacteria 2977523885 2977524055 326
993 iso_pu_bacteria 2977530762 2977532688 326
994 iso_pu_bacteria 2977537788 2977540078 326
995 iso_pu_bacteria 2977544691 2977547943 326
996 iso_pu_bacteria 2977551784 2977557363 326
997 iso_pu_bacteria 2977558990 2977559600 326
998 iso_pu_bacteria 2977565890 2977570915 326
999 iso_pu_bacteria 2977572785 2977579252 326
1000 iso_pu_bacteria 2977579622 2977585265 326
1001 iso_pu_bacteria 2977821940 2977823527 326
1002 iso_pu_bacteria 2977828996 2977835404 326
1003 iso_pu_bacteria 2977843712 2977850364 326
1004 iso_pu_bacteria 2977851361 2977855241 326
1005 iso_pu_bacteria 2977864932 2977870237 326
1006 iso_pu_bacteria 2977907340 2977911561 326
1007 iso_pu_bacteria 2977915119 2977919642 326
1008 iso_pu_bacteria 2977922695 2977925724 326
1009 iso_pu_bacteria 2977935797 2977938201 326
1010 iso_pu_bacteria 2977942078 2977943450 326
1011 iso_pu_bacteria 2977950692 2977954488 326
1012 iso_pu_bacteria 2977957713 2977965264 326
1013 iso_pu_bacteria 2977971508 2977977548 326
1014 iso_pu_bacteria 2977986579 2977987137 326
1015 iso_pu_bacteria 2979089926 2979090715 326
1016 iso_pu_bacteria 2979095461 2979096238 326
1017 iso_pu_bacteria 2979100975 2979101764 326
1018 iso_pu_bacteria 2979710463 2979714683 326
1019 iso_pu_bacteria 2979742915 2979746477 326
1020 iso_pu_bacteria 2979764755 2979769026 326
1021 iso_pu_bacteria 2979772303 2979774345 326
1022 iso_pu_bacteria 2979779861 2979781797 326
1023 iso_pu_bacteria 2979793036 2979798627 326
1024 iso_pu_bacteria 2979808191 2979813720 326
1025 iso_pu_bacteria 2984509177 2984510283 326
1026 iso_pu_bacteria 2984518228 2984519012 326
1027 iso_pu_bacteria 2984537506 2984538632 326
1028 iso_pu_bacteria 2984601300 2984605340 326
1029 iso_pu_bacteria 2987636660 2987641421 326
1030 iso_pu_bacteria 2987652177 2987656407 326
1031 iso_pu_bacteria 2987659509 2987666027 326
1032 iso_pu_bacteria 2987666974 2987669347 326
1033 iso_pu_bacteria 2987673487 2987675260 326
1034 iso_pu_bacteria 2989349275 2989350142 326
1035 iso_pu_bacteria 2989771324 2989773280 326
1036 iso_pu_bacteria 2989776772 2989777518 326
1037 iso_pu_bacteria 2989776772 2989780531 326
1038 iso_pu_bacteria 2995392953 2995394713 326
1039 iso_pu_bacteria 2996310559 2996313987 326
1040 iso_pu_bacteria 2996341866 2996342432 326
1041 iso_pu_bacteria 2996386984 2996387511 326
1042 iso_pu_bacteria 2996887358 2996892734 326
1043 iso_pu_bacteria 2996893221 2996897959 326
1044 iso_pu_bacteria 3000135777 3000137170 326
1045 iso_pu_bacteria 3003930520 3003935459 326
1046 iso_pu_bacteria 3004167301 3004173036 326
1047 iso_pu_bacteria 3004188549 3004195050 326
1048 iso_pu_bacteria 3004195979 3004202819 326
1049 iso_pu_bacteria 3004203850 3004210230 326
1050 iso_pu_bacteria 3004211236 3004217262 326
1051 iso_pu_bacteria 3004218560 3004220472 326
1052 iso_pu_bacteria 3004232784 3004233462 326
1053 iso_pu_bacteria 3004239961 3004245835 326
1054 iso_pu_bacteria 3004268573 3004275069 326
1055 iso_pu_bacteria 3004334049 3004337589 326
1056 iso_pu_bacteria 3005409236 3005414254 326
1057 iso_pu_bacteria 3005416602 3005418880 326
1058 iso_pu_bacteria 3005445848 3005448768 326
1059 iso_pu_bacteria 3005452660 3005455000 326
1060 iso_pu_bacteria 637000159 637077205 326
1061 iso_pu_bacteria 639633055 639649498 326
1062 iso_pu_bacteria 643692032 643826614 326
1063 iso_pu_bacteria 648276728 648739884 326
1064 iso_pu_bacteria 649633066 649870369 326
1065 iso_pu_bacteria 650716007 650843646 326
1066 iso_pu_bacteria 8002285264 8002291744 326
1067 iso_pu_bacteria 8003570095 8003574090 326
1068 iso_pu_bacteria 8003992118 8003996243 326
1069 iso_pu_bacteria 8003999396 8004004000 326
1070 iso_pu_bacteria 8004300914 8004304035 326
1071 iso_pu_bacteria 8004312739 8004315498 326
1072 iso_pu_bacteria 8004361976 8004364816 326
1073 iso_pu_bacteria 8004374579 8004375889 326
1074 iso_pu_bacteria 8004387939 8004393072 326
1075 iso_pu_bacteria 8004395343 8004402523 326
1076 iso_pu_bacteria 8004445564 8004452201 326
1077 iso_pu_bacteria 8004633249 8004638402 326
1078 iso_pu_bacteria 8004640170 8004641560 326
1079 iso_pu_bacteria 8004703790 8004706834 326
1080 iso_pu_bacteria 8004714634 8004719859 326
1081 iso_pu_bacteria 8004727605 8004734837 326
1082 iso_pu_bacteria 8005246636 8005250311 326
1083 iso_pu_bacteria 8005258706 8005259499 326
1084 iso_pu_bacteria 8005275841 8005281543 326
1085 iso_pu_bacteria 8005282627 8005284500 326
1086 iso_pu_bacteria 8005289223 8005295830 326
1087 iso_pu_bacteria 8005301065 8005303437 326
1088 iso_pu_bacteria 8005307578 8005313917 326
1089 iso_pu_bacteria 8005314921 8005318228 326
1090 iso_pu_bacteria 8005321885 8005327261 326
1091 iso_pu_bacteria 8005376324 8005381243 326
1092 iso_pu_bacteria 8005382845 8005384743 326
1093 iso_pu_bacteria 8005395548 8005395780 326
1094 iso_pu_bacteria 8005430974 8005435583 326
1095 iso_pu_bacteria 8005460587 8005464124 326
1096 iso_pu_bacteria 8005484373 8005488894 326
1097 iso_pu_bacteria 8005497431 8005501211 326
1098 iso_pu_bacteria 8005542996 8005545999 326
1099 iso_pu_bacteria 8005556819 8005561536 326
1100 iso_pu_bacteria 8005563573 8005568314 326
1101 iso_pu_bacteria 8005570704 8005573148 326
1102 iso_pu_bacteria 8005619151 8005622578 326
1103 iso_pu_bacteria 8005626139 8005630080 326
1104 iso_pu_bacteria 8005645114 8005645978 326
1105 iso_pu_bacteria 8005682033 8005682585 326
1106 iso_pu_bacteria 8005688590 8005691791 326
1107 iso_pu_bacteria 8005695170 8005697733 326
1108 iso_pu_bacteria 8006926726 8006932633 326
1109 iso_pu_bacteria 8018127388 8018127455 326
1110 iso_pu_bacteria 8018150411 8018150970 326
1111 iso_pu_bacteria 8018163183 8018164250 326
1112 iso_pu_bacteria 8018176218 8018179564 326
1113 iso_pu_bacteria 8019648815 8019658859 326
1114 iso_pu_bacteria 8023680758 8023682849 326
1115 iso_pu_bacteria 8024479707 8024486259 326
1116 iso_pu_bacteria 8024486573 8024488346 326
1117 iso_pu_bacteria 8024501048 8024504755 326
1118 iso_pu_bacteria 8046767195 8046770527 326
1119 iso_pu_bacteria 8049293176 8049295583 326
1120 iso_pu_bacteria 8049293176 8049298861 326
1121 iso_pu_bacteria 8054460903 8054465303 326
1122 iso_pu_bacteria 8054558443 8054561942 326
1123 iso_pu_bacteria 8055617313 8055617707 326
1124 iso_pu_bacteria 8056375014 8056377520 326
1125 iso_pu_bacteria 8056382006 8056387228 326
1126 iso_pu_bacteria 8056967851 8056968625 326
1127 iso_pu_bacteria 8057575449 8057576655 326
1128 iso_pu_bacteria 8057874678 8057882025 326
1129 3300003781 Ga0055536_1006866 Ga0055536_10068664 327
1130 3300005354 Ga0070675_100104576 Ga0070675_1001045763 327
1131 3300009094 Ga0111539_10023692 Ga0111539_100236922 327
1132 3300013105 Ga0157369_10330089 Ga0157369_103300892 327
1133 3300025292 Ga0209676_1000300 Ga0209676_100030048 327
1134 3300025298 Ga0209050_1026405 Ga0209050_10264052 327
1135 3300027907 Ga0207428_10253406 Ga0207428_102534062 327
1136 3300037853 Ga0436364_1130693 Ga0436364_1130693_58_1050 327
1137 3300049569 Ga0501032_0064798 Ga0501032_0064798_946_1941 327
1138 3300049570 Ga0501033_0006590 Ga0501033_0006590_4797_5792 327
1139 3300049571 Ga0501034_0052163 Ga0501034_0052163_2181_3176 327
1140 3300049574 Ga0501038_0013672 Ga0501038_0013672_168_1163 327
1141 3300049575 Ga0501039_0015661 Ga0501039_0015661_3336_4331 327
1142 3300049575 Ga0501039_0190371 Ga0501039_0190371_167_1162 327
1143 3300049579 Ga0501043_0234804 Ga0501043_0234804_18_1013 327
1144 3300049580 Ga0501046_0108020 Ga0501046_0108020_1079_2074 327
1145 3300049580 Ga0501046_0233102 Ga0501046_0233102_213_1208 327
1146 3300049581 Ga0501047_0100030 Ga0501047_0100030_337_1332 327
1147 3300049581 Ga0501047_0123583 Ga0501047_0123583_481_1476 327
1148 3300049581 Ga0501047_0230545 Ga0501047_0230545_69_1064 327
1149 3300049582 Ga0501048_0037725 Ga0501048_0037725_1110_2105 327
1150 3300049582 Ga0501048_0072598 Ga0501048_0072598_314_1309 327
1151 3300049582 Ga0501048_0195843 Ga0501048_0195843_209_1204 327
1152 3300049583 Ga0501067_0056370 Ga0501067_0056370_578_1573 327
1153 3300049583 Ga0501067_0120288 Ga0501067_0120288_301_1296 327
1154 3300049584 Ga0501068_0066759 Ga0501068_0066759_353_1348 327
1155 3300049586 Ga0501070_0068526 Ga0501070_0068526_1479_2474 327
1156 3300049586 Ga0501070_0069127 Ga0501070_0069127_325_1320 327
1157 3300049589 Ga0501073_0084925 Ga0501073_0084925_27_1022 327
1158 3300049590 Ga0501074_0031138 Ga0501074_0031138_1971_2966 327
1159 3300049592 Ga0501076_0110323 Ga0501076_0110323_979_1974 327
1160 3300049742 Ga0501080_0014162 Ga0501080_0014162_4538_5533 327
1161 3300049744 Ga0501083_0010520 Ga0501083_0010520_2127_3122 327
1162 3300049822 Ga0501035_0291825 Ga0501035_0291825_219_1214 327
1163 3300049823 Ga0501044_0019083 Ga0501044_0019083_6319_7314 327
1164 3300049823 Ga0501044_0034463 Ga0501044_0034463_204_1199 327
1165 3300049823 Ga0501044_0137519 Ga0501044_0137519_1121_2116 327
1166 3300050511 nmdc:mga08y16_207702_c1 nmdc:mga08y16_207702_c1_224_1207 327
1167 3300054114 Ga0501084_0017035 Ga0501084_0017035_4747_5742 327
1168 3300060353 Ga0501082_0042195 Ga0501082_0042195_1817_2812 327
1169 3300003762 Ga0055542_1009118 Ga0055542_10091182 328
1170 3300005327 Ga0070658_10267132 Ga0070658_102671322 328
1171 3300005459 Ga0068867_100142145 Ga0068867_1001421452 328
1172 3300005564 Ga0070664_100037537 Ga0070664_1000375373 328
1173 3300006038 Ga0075365_10006255 Ga0075365_100062554 328
1174 3300006051 Ga0075364_10005164 Ga0075364_100051645 328
1175 3300006186 Ga0075369_10028100 Ga0075369_100281001 328
1176 3300006353 Ga0075370_10004915 Ga0075370_100049153 328
1177 3300009093 Ga0105240_10114335 Ga0105240_101143353 328
1178 3300009545 Ga0105237_10161699 Ga0105237_101616992 328
1179 3300010375 Ga0105239_10153248 Ga0105239_101532482 328
1180 3300021384 Ga0213876_10043875 Ga0213876_100438751 328
1181 3300025913 Ga0207695_10064942 Ga0207695_100649422 328
1182 3300025933 Ga0207706_10004852 Ga0207706_100048529 328
1183 3300025935 Ga0207709_10070629 Ga0207709_100706292 328
1184 3300025945 Ga0207679_10261820 Ga0207679_102618202 328
1185 3300025986 Ga0207658_10065037 Ga0207658_100650372 328
1186 3300026041 Ga0207639_10201713 Ga0207639_102017131 328
1187 3300026089 Ga0207648_10143703 Ga0207648_101437032 328
1188 3300031456 Ga0307513_10083898 Ga0307513_100838983 328
1189 3300031548 Ga0307408_100022636 Ga0307408_1000226363 328
1190 3300031901 Ga0307406_10106957 Ga0307406_101069572 328
1191 3300031903 Ga0307407_10079643 Ga0307407_100796432 328
1192 3300035398 Ga0316574_0027919 Ga0316574_0027919_231_1229 328
1193 3300038725 Ga0400484_40515 Ga0400484_40515_1120_2133 328
1194 3300038742 Ga0400486_25732 Ga0400486_25732_1305_2318 328
1195 3300039437 Ga0436365_1547706 Ga0436365_1547706_151_1137 328
1196 3300039438 Ga0436360_0960231 Ga0436360_0960231_927_1913 328
1197 3300039447 Ga0436361_0290928 Ga0436361_0290928_1586_2575 328
1198 3300039450 Ga0436363_0280076 Ga0436363_0280076_1226_2215 328
1199 3300044658 Ga0466972_0016192 Ga0466972_0016192_2337_3326 328
1200 3300044842 Ga0466957_0077697 Ga0466957_0077697_50_1042 328
1201 3300046512 Ga0495610_0059015 Ga0495610_0059015_448_1446 328
1202 3300046616 Ga0495668_0032094 Ga0495668_0032094_17_1003 328
1203 3300048923 Ga0496120_0001458 Ga0496120_0001458_3176_4171 328
1204 3300049569 Ga0501032_0006865 Ga0501032_0006865_5474_6475 328
1205 3300049571 Ga0501034_0073266 Ga0501034_0073266_1512_2513 328
1206 3300049571 Ga0501034_0340606 Ga0501034_0340606_288_1286 328
1207 3300049572 Ga0501036_0042543 Ga0501036_0042543_2245_3246 328
1208 3300049574 Ga0501038_0068912 Ga0501038_0068912_1196_2197 328
1209 3300049575 Ga0501039_0015913 Ga0501039_0015913_2316_3317 328
1210 3300049579 Ga0501043_0002095 Ga0501043_0002095_4037_5035 328
1211 3300049581 Ga0501047_0002673 Ga0501047_0002673_3292_4290 328
1212 3300049581 Ga0501047_0059646 Ga0501047_0059646_2574_3572 328
1213 3300049582 Ga0501048_0310847 Ga0501048_0310847_39_1037 328
1214 3300049583 Ga0501067_0028463 Ga0501067_0028463_676_1677 328
1215 3300049585 Ga0501069_0008694 Ga0501069_0008694_3170_4171 328
1216 3300049586 Ga0501070_0000313 Ga0501070_0000313_18092_19090 328
1217 3300049589 Ga0501073_0121049 Ga0501073_0121049_138_1124 328
1218 3300049742 Ga0501080_0000128 Ga0501080_0000128_39242_40240 328
1219 3300049742 Ga0501080_0027719 Ga0501080_0027719_385_1386 328
1220 3300049744 Ga0501083_0087623 Ga0501083_0087623_123_1121 328
1221 3300049823 Ga0501044_0089823 Ga0501044_0089823_505_1506 328
1222 3300049823 Ga0501044_0097372 Ga0501044_0097372_1887_2885 328
1223 3300050491 nmdc:mga00v17_20007_c1 nmdc:mga00v17_20007_c1_1598_2587 328
1224 3300050496 nmdc:mga07m45_5169_c1 nmdc:mga07m45_5169_c1_5354_6343 328
1225 3300053109 Ga0500569_012531 Ga0500569_012531_350_1348 328
1226 3300053177 Ga0500636_0015051 Ga0500636_0015051_593_1591 328
1227 3300054114 Ga0501084_0007726 Ga0501084_0007726_4840_5838 328
1228 3300060353 Ga0501082_0126927 Ga0501082_0126927_701_1702 328
1229 3300002705 JGI25156J39149_1010500 JGI25156J39149_10105002 329
1230 3300002741 JGI25157J39369_1000647 JGI25157J39369_100064711 329
1231 3300003214 JGI25165J46597_1000078 JGI25165J46597_1000078101 329
1232 3300003781 Ga0055536_1009791 Ga0055536_10097913 329
1233 3300003790 Ga0055528_1002280 Ga0055528_10022806 329
1234 3300005367 Ga0070667_100259791 Ga0070667_1002597912 329
1235 3300005468 Ga0070707_100047434 Ga0070707_1000474342 329
1236 3300005539 Ga0068853_100052482 Ga0068853_1000524823 329
1237 3300005548 Ga0070665_100125686 Ga0070665_1001256863 329
1238 3300005577 Ga0068857_100390461 Ga0068857_1003904612 329
1239 3300005617 Ga0068859_100226096 Ga0068859_1002260962 329
1240 3300006048 Ga0075363_100021836 Ga0075363_1000218363 329
1241 3300006177 Ga0075362_10008658 Ga0075362_100086583 329
1242 3300006177 Ga0075362_10080238 Ga0075362_100802382 329
1243 3300006178 Ga0075367_10016682 Ga0075367_100166821 329
1244 3300006195 Ga0075366_10098274 Ga0075366_100982742 329
1245 3300006881 Ga0068865_100124914 Ga0068865_1001249142 329
1246 3300006931 Ga0097620_100226094 Ga0097620_1002260942 329
1247 3300009093 Ga0105240_10010969 Ga0105240_100109695 329
1248 3300009093 Ga0105240_10047959 Ga0105240_100479592 329
1249 3300009093 Ga0105240_10120900 Ga0105240_101209003 329
1250 3300009098 Ga0105245_10133991 Ga0105245_101339912 329
1251 3300009545 Ga0105237_10032245 Ga0105237_100322455 329
1252 3300009545 Ga0105237_10038932 Ga0105237_100389324 329
1253 3300009551 Ga0105238_10015974 Ga0105238_100159743 329
1254 3300009551 Ga0105238_10452502 Ga0105238_104525021 329
1255 3300009766 Ga0123342_1028788 Ga0123342_10287882 329
1256 3300010375 Ga0105239_10000108 Ga0105239_1000010893 329
1257 3300010375 Ga0105239_10122340 Ga0105239_101223403 329
1258 3300010375 Ga0105239_10161994 Ga0105239_101619942 329
1259 3300013105 Ga0157369_10150925 Ga0157369_101509253 329
1260 3300013105 Ga0157369_10336235 Ga0157369_103362352 329
1261 3300013308 Ga0157375_10552081 Ga0157375_105520811 329
1262 3300025250 Ga0209026_1000151 Ga0209026_100015148 329
1263 3300025256 Ga0209759_1000350 Ga0209759_100035054 329
1264 3300025261 Ga0209233_1000150 Ga0209233_100015081 329
1265 3300025273 Ga0209673_1002172 Ga0209673_10021729 329
1266 3300025292 Ga0209676_1006115 Ga0209676_10061156 329
1267 3300025294 Ga0209025_1009032 Ga0209025_10090327 329
1268 3300025295 Ga0209564_1023190 Ga0209564_10231902 329
1269 3300025297 Ga0209758_1000130 Ga0209758_1000130141 329
1270 3300025297 Ga0209758_1003416 Ga0209758_100341611 329
1271 3300025297 Ga0209758_1005604 Ga0209758_10056046 329
1272 3300025297 Ga0209758_1009728 Ga0209758_10097282 329
1273 3300025299 Ga0209256_1003516 Ga0209256_10035166 329
1274 3300025302 Ga0207426_1000511 Ga0207426_100051146 329
1275 3300025304 Ga0209257_1001148 Ga0209257_100114820 329
1276 3300025913 Ga0207695_10011688 Ga0207695_100116885 329
1277 3300025913 Ga0207695_10159132 Ga0207695_101591322 329
1278 3300025922 Ga0207646_10130835 Ga0207646_101308352 329
1279 3300025924 Ga0207694_10017681 Ga0207694_100176815 329
1280 3300025924 Ga0207694_10208538 Ga0207694_102085382 329
1281 3300025938 Ga0207704_10228189 Ga0207704_102281892 329
1282 3300025986 Ga0207658_10218541 Ga0207658_102185412 329
1283 3300026041 Ga0207639_10013742 Ga0207639_100137423 329
1284 3300026078 Ga0207702_10189687 Ga0207702_101896872 329
1285 3300028794 Ga0307515_10000285 Ga0307515_1000028534 329
1286 3300028794 Ga0307515_10111250 Ga0307515_101112502 329
1287 3300031507 Ga0307509_10053450 Ga0307509_100534504 329
1288 3300031616 Ga0307508_10000430 Ga0307508_1000043045 329
1289 3300031616 Ga0307508_10012324 Ga0307508_100123244 329
1290 3300031616 Ga0307508_10068533 Ga0307508_100685332 329
1291 3300035695 Ga0373927_0000245 Ga0373927_0000245_30863_31852 329
1292 3300037068 Ga0373925_0003713 Ga0373925_0003713_3747_4736 329
1293 3300037418 Ga0395900_0029099 Ga0395900_0029099_4194_5186 329
1294 3300037418 Ga0395900_0207837 Ga0395900_0207837_10_1002 329
1295 3300037471 Ga0395905_0007581 Ga0395905_0007581_9361_10389 329
1296 3300037471 Ga0395905_0009048 Ga0395905_0009048_7487_8476 329
1297 3300037471 Ga0395905_0013886 Ga0395905_0013886_6500_7489 329
1298 3300037471 Ga0395905_0020532 Ga0395905_0020532_3872_4864 329
1299 3300037471 Ga0395905_0054804 Ga0395905_0054804_1500_2492 329
1300 3300037471 Ga0395905_0095843 Ga0395905_0095843_742_1734 329
1301 3300038443 Ga0395901_0014960 Ga0395901_0014960_1042_2034 329
1302 3300038443 Ga0395901_0031758 Ga0395901_0031758_1228_2220 329
1303 3300038725 Ga0400484_20998 Ga0400484_20998_987_1976 329
1304 3300038726 Ga0400490_38094 Ga0400490_38094_8503_9492 329
1305 3300038727 Ga0400491_13401 Ga0400491_13401_1196_2185 329
1306 3300039062 Ga0400483_247668 Ga0400483_247668_17040_18029 329
1307 3300039110 Ga0400487_11494 Ga0400487_11494_94_1083 329
1308 3300039110 Ga0400487_13197 Ga0400487_13197_12302_13291 329
1309 3300041404 Ga0439436_0048435 Ga0439436_0048435_19_1011 329
1310 3300041413 Ga0439465_0037731 Ga0439465_0037731_95_1087 329
1311 3300041498 Ga0451841_0340568 Ga0451841_0340568_219_1211 329
1312 3300041507 Ga0451851_1012485 Ga0451851_1012485_324_1316 329
1313 3300041512 Ga0451853_3094484 Ga0451853_3094484_474_1466 329
1314 3300042007 Ga0439449_0009295 Ga0439449_0009295_2369_3361 329
1315 3300046471 Ga0495650_0064423 Ga0495650_0064423_231_1223 329
1316 3300046474 Ga0495605_0015829 Ga0495605_0015829_2200_3192 329
1317 3300046501 Ga0495607_0016552 Ga0495607_0016552_759_1751 329
1318 3300046501 Ga0495607_0023263 Ga0495607_0023263_1145_2137 329
1319 3300046501 Ga0495607_0062768 Ga0495607_0062768_908_1900 329
1320 3300046515 Ga0495620_0012292 Ga0495620_0012292_310_1302 329
1321 3300046518 Ga0495631_0016798 Ga0495631_0016798_2298_3290 329
1322 3300046519 Ga0495632_0016392 Ga0495632_0016392_3071_4063 329
1323 3300046520 Ga0495637_0003753 Ga0495637_0003753_861_1853 329
1324 3300046522 Ga0495643_0001039 Ga0495643_0001039_12165_13157 329
1325 3300046525 Ga0495663_0025419 Ga0495663_0025419_382_1374 329
1326 3300046530 Ga0495654_0017636 Ga0495654_0017636_1328_2320 329
1327 3300046538 Ga0495609_0003026 Ga0495609_0003026_3119_4111 329
1328 3300046538 Ga0495609_0018475 Ga0495609_0018475_429_1421 329
1329 3300046558 Ga0495633_0034951 Ga0495633_0034951_39_1031 329
1330 3300046660 Ga0495625_0004663 Ga0495625_0004663_5785_6777 329
1331 3300046660 Ga0495625_0015174 Ga0495625_0015174_3683_4675 329
1332 3300046674 Ga0495588_0005393 Ga0495588_0005393_4538_5530 329
1333 3300046692 Ga0495671_0154940 Ga0495671_0154940_20_1012 329
1334 3300046694 Ga0495649_0010787 Ga0495649_0010787_583_1575 329
1335 3300047318 Ga0495636_0022191 Ga0495636_0022191_140_1132 329
1336 3300047323 Ga0495683_0142301 Ga0495683_0142301_71_1063 329
1337 3300047443 Ga0495687_003786 Ga0495687_003786_49_1041 329
1338 3300047446 Ga0495679_043826 Ga0495679_043826_166_1158 329
1339 3300047469 Ga0495673_0052838 Ga0495673_0052838_353_1345 329
1340 3300047470 Ga0495681_0002912 Ga0495681_0002912_2080_3072 329
1341 3300047470 Ga0495681_0039636 Ga0495681_0039636_982_1974 329
1342 3300048905 Ga0496102_0002097 Ga0496102_0002097_11969_12961 329
1343 3300048915 Ga0496112_0232458 Ga0496112_0232458_457_1449 329
1344 3300048919 Ga0496116_0000026 Ga0496116_0000026_110497_111489 329
1345 3300048920 Ga0496117_0000674 Ga0496117_0000674_30107_31099 329
1346 3300048920 Ga0496117_0070009 Ga0496117_0070009_655_1647 329
1347 3300048921 Ga0496118_0001442 Ga0496118_0001442_23423_24415 329
1348 3300048922 Ga0496119_0000887 Ga0496119_0000887_16265_17257 329
1349 3300048923 Ga0496120_0000724 Ga0496120_0000724_24855_25847 329
1350 3300048923 Ga0496120_0001956 Ga0496120_0001956_2413_3405 329
1351 3300048924 Ga0496121_0000991 Ga0496121_0000991_26373_27365 329
1352 3300048925 Ga0496122_0009607 Ga0496122_0009607_6226_7218 329
1353 3300048925 Ga0496122_0046010 Ga0496122_0046010_1238_2230 329
1354 3300048926 Ga0496123_0008281 Ga0496123_0008281_5901_6893 329
1355 3300048927 Ga0496124_0069578 Ga0496124_0069578_1394_2386 329
1356 3300048929 Ga0496126_0000069 Ga0496126_0000069_165152_166144 329
1357 3300048929 Ga0496126_0002934 Ga0496126_0002934_8540_9532 329
1358 3300049459 Ga0495678_019335 Ga0495678_019335_436_1428 329
1359 3300049568 Ga0501031_0038885 Ga0501031_0038885_718_1707 329
1360 3300049570 Ga0501033_0109483 Ga0501033_0109483_24_1013 329
1361 3300049571 Ga0501034_0033922 Ga0501034_0033922_2612_3601 329
1362 3300049571 Ga0501034_0064350 Ga0501034_0064350_2250_3239 329
1363 3300049571 Ga0501034_0096713 Ga0501034_0096713_1009_1998 329
1364 3300049572 Ga0501036_0061431 Ga0501036_0061431_1599_2588 329
1365 3300049576 Ga0501040_0190331 Ga0501040_0190331_208_1197 329
1366 3300049578 Ga0501042_0053434 Ga0501042_0053434_1117_2106 329
1367 3300049579 Ga0501043_0044244 Ga0501043_0044244_893_1882 329
1368 3300049580 Ga0501046_0016578 Ga0501046_0016578_2539_3528 329
1369 3300049581 Ga0501047_0024548 Ga0501047_0024548_4330_5319 329
1370 3300049582 Ga0501048_0007377 Ga0501048_0007377_653_1642 329
1371 3300049584 Ga0501068_0045529 Ga0501068_0045529_1563_2552 329
1372 3300049586 Ga0501070_0163989 Ga0501070_0163989_238_1227 329
1373 3300049586 Ga0501070_0194627 Ga0501070_0194627_397_1386 329
1374 3300049587 Ga0501071_0083141 Ga0501071_0083141_923_1912 329
1375 3300049590 Ga0501074_0095861 Ga0501074_0095861_971_1960 329
1376 3300049741 Ga0501079_0055154 Ga0501079_0055154_1731_2720 329
1377 3300049823 Ga0501044_0098444 Ga0501044_0098444_1574_2563 329
1378 3300049824 Ga0501045_0094563 Ga0501045_0094563_392_1381 329
1379 3300050489 nmdc:mga03683_3851_c1 nmdc:mga03683_3851_c1_1580_2572 329
1380 3300050489 nmdc:mga03683_86217_c1 nmdc:mga03683_86217_c1_270_1262 329
1381 3300050490 nmdc:mga03n38_68907_c1 nmdc:mga03n38_68907_c1_124_1116 329
1382 3300050492 nmdc:mga0yw44_9041_c1 nmdc:mga0yw44_9041_c1_307_1299 329
1383 3300053086 Ga0500578_0076274 Ga0500578_0076274_906_1898 329
1384 3300053093 Ga0500651_0162265 Ga0500651_0162265_254_1246 329
1385 3300053107 Ga0500560_001265 Ga0500560_001265_721_1713 329
1386 3300053109 Ga0500569_001415 Ga0500569_001415_2534_3526 329
1387 3300053118 Ga0500594_0004523 Ga0500594_0004523_623_1615 329
1388 3300053122 Ga0500608_029243 Ga0500608_029243_1245_2234 329
1389 3300053125 Ga0500618_006729 Ga0500618_006729_1339_2331 329
1390 3300053134 Ga0500658_0002414 Ga0500658_0002414_5343_6335 329
1391 3300053136 Ga0500559_0012232 Ga0500559_0012232_796_1791 329
1392 3300053139 Ga0500568_0000143 Ga0500568_0000143_60852_61841 329
1393 3300053142 Ga0500577_0046987 Ga0500577_0046987_377_1369 329
1394 3300053156 Ga0500622_0000174 Ga0500622_0000174_62501_63493 329
1395 3300054114 Ga0501084_0077503 Ga0501084_0077503_185_1177 329
1396 3300060353 Ga0501082_0300925 Ga0501082_0300925_246_1247 329
1397 3300001979 JGI24740J21852_10000201 JGI24740J21852_1000020112 330
1398 3300002704 JGI25155J39150_1000014 JGI25155J39150_1000014169 330
1399 3300002705 JGI25156J39149_1000083 JGI25156J39149_100008340 330
1400 3300002737 JGI25162J39368_1000532 JGI25162J39368_100053218 330
1401 3300002738 JGI25154J39366_1000139 JGI25154J39366_100013923 330
1402 3300002741 JGI25157J39369_1000110 JGI25157J39369_100011039 330
1403 3300002773 JGI25152J39213_1001051 JGI25152J39213_10010518 330
1404 3300002773 JGI25152J39213_1004576 JGI25152J39213_10045763 330
1405 3300002773 JGI25152J39213_1007948 JGI25152J39213_10079482 330
1406 3300002773 JGI25152J39213_1009306 JGI25152J39213_10093061 330
1407 3300002773 JGI25152J39213_1016172 JGI25152J39213_10161721 330
1408 3300002774 JGI25150J39212_1000533 JGI25150J39212_10005336 330
1409 3300002987 JGI25159J45721_1000008 JGI25159J45721_1000008166 330
1410 3300002987 JGI25159J45721_1000251 JGI25159J45721_100025113 330
1411 3300003187 JGI25151J46595_10000152 JGI25151J46595_100001525 330
1412 3300003187 JGI25151J46595_10003146 JGI25151J46595_100031465 330
1413 3300003187 JGI25151J46595_10003216 JGI25151J46595_100032162 330
1414 3300003187 JGI25151J46595_10020830 JGI25151J46595_100208302 330
1415 3300003214 JGI25165J46597_1000692 JGI25165J46597_100069216 330
1416 3300003214 JGI25165J46597_1000752 JGI25165J46597_100075224 330
1417 3300003214 JGI25165J46597_1001515 JGI25165J46597_10015155 330
1418 3300003215 JGI25153J46596_10003676 JGI25153J46596_100036766 330
1419 3300003215 JGI25153J46596_10005962 JGI25153J46596_100059621 330
1420 3300003215 JGI25153J46596_10018655 JGI25153J46596_100186552 330
1421 3300003354 JGI25160J50197_1000001 JGI25160J50197_1000001302 330
1422 3300003354 JGI25160J50197_1000033 JGI25160J50197_10000339 330
1423 3300003354 JGI25160J50197_1005675 JGI25160J50197_10056753 330
1424 3300003354 JGI25160J50197_1015468 JGI25160J50197_10154683 330
1425 3300003354 JGI25160J50197_1023193 JGI25160J50197_10231931 330
1426 3300003374 JGI25161J50226_1000001 JGI25161J50226_1000001459 330
1427 3300003374 JGI25161J50226_1000725 JGI25161J50226_10007253 330
1428 3300003374 JGI25161J50226_1001797 JGI25161J50226_10017974 330
1429 3300003374 JGI25161J50226_1007057 JGI25161J50226_10070573 330
1430 3300003762 Ga0055542_1001263 Ga0055542_100126310 330
1431 3300003763 Ga0055529_1005120 Ga0055529_10051202 330
1432 3300003771 Ga0055526_1000440 Ga0055526_100044027 330
1433 3300003771 Ga0055526_1001356 Ga0055526_10013569 330
1434 3300003771 Ga0055526_1008472 Ga0055526_10084724 330
1435 3300003775 Ga0055524_1001932 Ga0055524_10019325 330
1436 3300003775 Ga0055524_1017411 Ga0055524_10174113 330
1437 3300003775 Ga0055524_1021528 Ga0055524_10215282 330
1438 3300003775 Ga0055524_1022564 Ga0055524_10225643 330
1439 3300003781 Ga0055536_1002504 Ga0055536_10025048 330
1440 3300003790 Ga0055528_1000921 Ga0055528_10009215 330
1441 3300003790 Ga0055528_1007362 Ga0055528_10073624 330
1442 3300003790 Ga0055528_1007666 Ga0055528_10076662 330
1443 3300003790 Ga0055528_1013344 Ga0055528_10133442 330
1444 3300003790 Ga0055528_1021283 Ga0055528_10212831 330
1445 3300003790 Ga0055528_1027023 Ga0055528_10270231 330
1446 3300003792 Ga0055540_1000396 Ga0055540_100039629 330
1447 3300003792 Ga0055540_1002497 Ga0055540_10024974 330
1448 3300003792 Ga0055540_1004246 Ga0055540_10042463 330
1449 3300003792 Ga0055540_1005022 Ga0055540_10050226 330
1450 3300003794 Ga0055531_10003672 Ga0055531_100036724 330
1451 3300003794 Ga0055531_10009548 Ga0055531_100095483 330
1452 3300003856 Ga0058692_1000942 Ga0058692_10009429 330
1453 3300003856 Ga0058692_1003656 Ga0058692_10036564 330
1454 3300004625 Ga0055543_1000026 Ga0055543_1000026130 330
1455 3300004625 Ga0055543_1000089 Ga0055543_100008961 330
1456 3300004625 Ga0055543_1000104 Ga0055543_10001043 330
1457 3300004625 Ga0055543_1003556 Ga0055543_10035562 330
1458 3300005262 Ga0065165_1000008 Ga0065165_1000008154 330
1459 3300005262 Ga0065165_1000178 Ga0065165_10001789 330
1460 3300005262 Ga0065165_1003404 Ga0065165_10034048 330
1461 3300005327 Ga0070658_10060723 Ga0070658_100607233 330
1462 3300005331 Ga0070670_100009022 Ga0070670_1000090224 330
1463 3300005334 Ga0068869_100165540 Ga0068869_1001655402 330
1464 3300005338 Ga0068868_100108886 Ga0068868_1001088862 330
1465 3300005344 Ga0070661_100002923 Ga0070661_1000029235 330
1466 3300005347 Ga0070668_100069929 Ga0070668_1000699292 330
1467 3300005355 Ga0070671_100007376 Ga0070671_1000073768 330
1468 3300005366 Ga0070659_100124159 Ga0070659_1001241592 330
1469 3300005367 Ga0070667_100290597 Ga0070667_1002905971 330
1470 3300005455 Ga0070663_100248245 Ga0070663_1002482451 330
1471 3300005535 Ga0070684_100089357 Ga0070684_1000893571 330
1472 3300005539 Ga0068853_100008908 Ga0068853_1000089082 330
1473 3300005539 Ga0068853_100160419 Ga0068853_1001604192 330
1474 3300005548 Ga0070665_100009435 Ga0070665_10000943510 330
1475 3300005548 Ga0070665_100055085 Ga0070665_1000550855 330
1476 3300005563 Ga0068855_100116311 Ga0068855_1001163113 330
1477 3300005563 Ga0068855_100410450 Ga0068855_1004104502 330
1478 3300005564 Ga0070664_100167619 Ga0070664_1001676192 330
1479 3300005578 Ga0068854_100025684 Ga0068854_1000256843 330
1480 3300005578 Ga0068854_100058022 Ga0068854_1000580222 330
1481 3300005578 Ga0068854_100071955 Ga0068854_1000719553 330
1482 3300005614 Ga0068856_100006424 Ga0068856_1000064243 330
1483 3300005614 Ga0068856_100087342 Ga0068856_1000873423 330
1484 3300005614 Ga0068856_100360183 Ga0068856_1003601831 330
1485 3300005616 Ga0068852_100027054 Ga0068852_1000270544 330
1486 3300005616 Ga0068852_100072527 Ga0068852_1000725274 330
1487 3300005616 Ga0068852_100223585 Ga0068852_1002235852 330
1488 3300005617 Ga0068859_100210192 Ga0068859_1002101922 330
1489 3300005618 Ga0068864_100005685 Ga0068864_1000056857 330
1490 3300005834 Ga0068851_10017316 Ga0068851_100173162 330
1491 3300005841 Ga0068863_100089005 Ga0068863_1000890053 330
1492 3300005842 Ga0068858_100249145 Ga0068858_1002491451 330
1493 3300006038 Ga0075365_10000918 Ga0075365_100009187 330
1494 3300006038 Ga0075365_10007236 Ga0075365_100072366 330
1495 3300006042 Ga0075368_10043333 Ga0075368_100433332 330
1496 3300006042 Ga0075368_10049549 Ga0075368_100495492 330
1497 3300006042 Ga0075368_10062261 Ga0075368_100622611 330
1498 3300006042 Ga0075368_10087624 Ga0075368_100876242 330
1499 3300006048 Ga0075363_100102632 Ga0075363_1001026322 330
1500 3300006051 Ga0075364_10136435 Ga0075364_101364352 330
1501 3300006051 Ga0075364_10243653 Ga0075364_102436531 330
1502 3300006177 Ga0075362_10014364 Ga0075362_100143642 330
1503 3300006186 Ga0075369_10016027 Ga0075369_100160273 330
1504 3300006186 Ga0075369_10021994 Ga0075369_100219943 330
1505 3300006195 Ga0075366_10018014 Ga0075366_100180144 330
1506 3300006353 Ga0075370_10047656 Ga0075370_100476562 330
1507 3300006353 Ga0075370_10079099 Ga0075370_100790992 330
1508 3300006353 Ga0075370_10084296 Ga0075370_100842962 330
1509 3300006844 Ga0075428_100005831 Ga0075428_1000058313 330
1510 3300006847 Ga0075431_100223808 Ga0075431_1002238082 330
1511 3300006931 Ga0097620_100210201 Ga0097620_1002102012 330
1512 3300006946 Ga0079104_1002347 Ga0079104_10023472 330
1513 3300006946 Ga0079104_1002740 Ga0079104_10027404 330
1514 3300006948 Ga0099826_10012941 Ga0099826_100129416 330
1515 3300009011 Ga0105251_10019755 Ga0105251_100197553 330
1516 3300009093 Ga0105240_10000014 Ga0105240_10000014219 330
1517 3300009098 Ga0105245_10130450 Ga0105245_101304502 330
1518 3300009148 Ga0105243_10025395 Ga0105243_100253953 330
1519 3300009174 Ga0105241_10076691 Ga0105241_100766914 330
1520 3300009174 Ga0105241_10236086 Ga0105241_102360862 330
1521 3300009177 Ga0105248_10021814 Ga0105248_100218143 330
1522 3300009177 Ga0105248_10172269 Ga0105248_101722693 330
1523 3300009545 Ga0105237_10003649 Ga0105237_1000364912 330
1524 3300009545 Ga0105237_10051914 Ga0105237_100519144 330
1525 3300009545 Ga0105237_10098212 Ga0105237_100982122 330
1526 3300009551 Ga0105238_10001985 Ga0105238_1000198514 330
1527 3300009551 Ga0105238_10078391 Ga0105238_100783911 330
1528 3300009765 Ga0123341_1000035 Ga0123341_10000352 330
1529 3300009766 Ga0123342_1009384 Ga0123342_10093849 330
1530 3300009766 Ga0123342_1026071 Ga0123342_10260713 330
1531 3300010375 Ga0105239_10354527 Ga0105239_103545272 330
1532 3300011119 Ga0105246_10076598 Ga0105246_100765982 330
1533 3300011119 Ga0105246_10091436 Ga0105246_100914362 330
1534 3300011119 Ga0105246_10207784 Ga0105246_102077841 330
1535 3300013102 Ga0157371_10000187 Ga0157371_1000018781 330
1536 3300013104 Ga0157370_10000037 Ga0157370_1000003767 330
1537 3300013104 Ga0157370_10002430 Ga0157370_1000243014 330
1538 3300013104 Ga0157370_10085310 Ga0157370_100853103 330
1539 3300013104 Ga0157370_10114034 Ga0157370_101140342 330
1540 3300013105 Ga0157369_10109741 Ga0157369_101097412 330
1541 3300013105 Ga0157369_10391754 Ga0157369_103917541 330
1542 3300013249 Ga0171463_1007 Ga0171463_1007114 330
1543 3300013306 Ga0163162_10240771 Ga0163162_102407713 330
1544 3300014325 Ga0163163_10270264 Ga0163163_102702641 330
1545 3300014968 Ga0157379_10051127 Ga0157379_100511273 330
1546 3300014968 Ga0157379_10158340 Ga0157379_101583402 330
1547 3300015262 Ga0182007_10002682 Ga0182007_100026826 330
1548 3300015265 Ga0182005_1020059 Ga0182005_10200592 330
1549 3300015265 Ga0182005_1021965 Ga0182005_10219651 330
1550 3300015690 Ga0183363_1061 Ga0183363_106129 330
1551 3300021320 Ga0214544_1000110 Ga0214544_100011015 330
1552 3300021321 Ga0214542_1000032 Ga0214542_100003211 330
1553 3300021327 Ga0214543_1000016 Ga0214543_1000016267 330
1554 3300021327 Ga0214543_1000022 Ga0214543_1000022164 330
1555 3300022740 Ga0228710_1005902 Ga0228710_10059029 330
1556 3300025206 Ga0209435_100027 Ga0209435_100027165 330
1557 3300025228 Ga0209672_104167 Ga0209672_1041674 330
1558 3300025230 Ga0209563_111216 Ga0209563_1112162 330
1559 3300025231 Ga0207427_105205 Ga0207427_1052053 330
1560 3300025233 Ga0209437_100058 Ga0209437_10005811 330
1561 3300025233 Ga0209437_100060 Ga0209437_100060217 330
1562 3300025245 Ga0207425_1000046 Ga0207425_1000046108 330
1563 3300025245 Ga0207425_1004007 Ga0207425_10040073 330
1564 3300025245 Ga0207425_1006686 Ga0207425_10066863 330
1565 3300025245 Ga0207425_1011735 Ga0207425_10117353 330
1566 3300025246 Ga0209646_1000086 Ga0209646_1000086165 330
1567 3300025246 Ga0209646_1004880 Ga0209646_10048804 330
1568 3300025250 Ga0209026_1000082 Ga0209026_1000082165 330
1569 3300025250 Ga0209026_1000151 Ga0209026_100015177 330
1570 3300025253 Ga0209677_100453 Ga0209677_10045321 330
1571 3300025254 Ga0209148_1000032 Ga0209148_1000032489 330
1572 3300025254 Ga0209148_1000213 Ga0209148_100021321 330
1573 3300025256 Ga0209759_1000063 Ga0209759_100006336 330
1574 3300025256 Ga0209759_1000076 Ga0209759_10000767 330
1575 3300025258 Ga0209129_1000170 Ga0209129_10001708 330
1576 3300025258 Ga0209129_1000283 Ga0209129_100028337 330
1577 3300025258 Ga0209129_1000820 Ga0209129_10008203 330
1578 3300025258 Ga0209129_1000868 Ga0209129_10008684 330
1579 3300025258 Ga0209129_1001663 Ga0209129_100166312 330
1580 3300025258 Ga0209129_1006477 Ga0209129_10064772 330
1581 3300025261 Ga0209233_1000149 Ga0209233_1000149172 330
1582 3300025261 Ga0209233_1000150 Ga0209233_100015053 330
1583 3300025261 Ga0209233_1000160 Ga0209233_100016013 330
1584 3300025272 Ga0209455_1000085 Ga0209455_1000085183 330
1585 3300025272 Ga0209455_1001483 Ga0209455_100148311 330
1586 3300025273 Ga0209673_1000010 Ga0209673_1000010586 330
1587 3300025273 Ga0209673_1000025 Ga0209673_1000025122 330
1588 3300025273 Ga0209673_1000112 Ga0209673_1000112100 330
1589 3300025273 Ga0209673_1001637 Ga0209673_10016374 330
1590 3300025273 Ga0209673_1002919 Ga0209673_10029196 330
1591 3300025273 Ga0209673_1005722 Ga0209673_10057223 330
1592 3300025273 Ga0209673_1015525 Ga0209673_10155252 330
1593 3300025284 Ga0209130_1000003 Ga0209130_1000003473 330
1594 3300025284 Ga0209130_1000017 Ga0209130_1000017168 330
1595 3300025284 Ga0209130_1000023 Ga0209130_100002375 330
1596 3300025292 Ga0209676_1001942 Ga0209676_10019429 330
1597 3300025292 Ga0209676_1029563 Ga0209676_10295631 330
1598 3300025294 Ga0209025_1000091 Ga0209025_1000091215 330
1599 3300025294 Ga0209025_1000137 Ga0209025_100013783 330
1600 3300025294 Ga0209025_1000153 Ga0209025_10001538 330
1601 3300025294 Ga0209025_1000545 Ga0209025_100054535 330
1602 3300025294 Ga0209025_1000689 Ga0209025_100068939 330
1603 3300025294 Ga0209025_1001424 Ga0209025_10014244 330
1604 3300025294 Ga0209025_1002940 Ga0209025_10029404 330
1605 3300025294 Ga0209025_1008460 Ga0209025_10084604 330
1606 3300025294 Ga0209025_1018454 Ga0209025_10184542 330
1607 3300025294 Ga0209025_1030110 Ga0209025_10301102 330
1608 3300025294 Ga0209025_1030429 Ga0209025_10304292 330
1609 3300025295 Ga0209564_1000013 Ga0209564_1000013616 330
1610 3300025295 Ga0209564_1000365 Ga0209564_100036571 330
1611 3300025295 Ga0209564_1000564 Ga0209564_100056412 330
1612 3300025295 Ga0209564_1001004 Ga0209564_100100438 330
1613 3300025295 Ga0209564_1005883 Ga0209564_10058832 330
1614 3300025295 Ga0209564_1015988 Ga0209564_10159883 330
1615 3300025297 Ga0209758_1000123 Ga0209758_100012383 330
1616 3300025297 Ga0209758_1001220 Ga0209758_100122015 330
1617 3300025297 Ga0209758_1002966 Ga0209758_10029663 330
1618 3300025297 Ga0209758_1004613 Ga0209758_10046134 330
1619 3300025297 Ga0209758_1006234 Ga0209758_10062347 330
1620 3300025297 Ga0209758_1008951 Ga0209758_10089514 330
1621 3300025297 Ga0209758_1009161 Ga0209758_10091616 330
1622 3300025298 Ga0209050_1004328 Ga0209050_10043283 330
1623 3300025298 Ga0209050_1005211 Ga0209050_10052115 330
1624 3300025298 Ga0209050_1008301 Ga0209050_10083014 330
1625 3300025299 Ga0209256_1000211 Ga0209256_1000211111 330
1626 3300025299 Ga0209256_1000315 Ga0209256_10003154 330
1627 3300025299 Ga0209256_1004669 Ga0209256_10046696 330
1628 3300025299 Ga0209256_1005396 Ga0209256_10053966 330
1629 3300025299 Ga0209256_1010874 Ga0209256_10108744 330
1630 3300025299 Ga0209256_1013599 Ga0209256_10135993 330
1631 3300025299 Ga0209256_1019942 Ga0209256_10199421 330
1632 3300025302 Ga0207426_1000006 Ga0207426_1000006167 330
1633 3300025302 Ga0207426_1000011 Ga0207426_1000011303 330
1634 3300025302 Ga0207426_1000087 Ga0207426_1000087288 330
1635 3300025302 Ga0207426_1000208 Ga0207426_10002084 330
1636 3300025302 Ga0207426_1002922 Ga0207426_10029222 330
1637 3300025303 Ga0209051_1000410 Ga0209051_100041026 330
1638 3300025303 Ga0209051_1001459 Ga0209051_100145911 330
1639 3300025303 Ga0209051_1004728 Ga0209051_10047284 330
1640 3300025303 Ga0209051_1007779 Ga0209051_10077792 330
1641 3300025303 Ga0209051_1038366 Ga0209051_10383662 330
1642 3300025304 Ga0209257_1003036 Ga0209257_10030364 330
1643 3300025315 Ga0207697_10020847 Ga0207697_100208473 330
1644 3300025321 Ga0207656_10019890 Ga0207656_100198903 330
1645 3300025903 Ga0207680_10142919 Ga0207680_101429192 330
1646 3300025907 Ga0207645_10126175 Ga0207645_101261751 330
1647 3300025911 Ga0207654_10032483 Ga0207654_100324833 330
1648 3300025913 Ga0207695_10000037 Ga0207695_10000037220 330
1649 3300025914 Ga0207671_10001017 Ga0207671_1000101718 330
1650 3300025919 Ga0207657_10019972 Ga0207657_100199724 330
1651 3300025925 Ga0207650_10001778 Ga0207650_100017785 330
1652 3300025927 Ga0207687_10013924 Ga0207687_100139243 330
1653 3300025931 Ga0207644_10054517 Ga0207644_100545173 330
1654 3300025935 Ga0207709_10022407 Ga0207709_100224072 330
1655 3300025937 Ga0207669_10039242 Ga0207669_100392422 330
1656 3300025940 Ga0207691_10193477 Ga0207691_101934771 330
1657 3300025949 Ga0207667_10012150 Ga0207667_100121507 330
1658 3300025949 Ga0207667_10569510 Ga0207667_105695101 330
1659 3300025960 Ga0207651_10048219 Ga0207651_100482193 330
1660 3300025972 Ga0207668_10159940 Ga0207668_101599401 330
1661 3300025981 Ga0207640_10027943 Ga0207640_100279433 330
1662 3300025981 Ga0207640_10071336 Ga0207640_100713361 330
1663 3300025986 Ga0207658_10245784 Ga0207658_102457841 330
1664 3300026041 Ga0207639_10039484 Ga0207639_100394842 330
1665 3300026041 Ga0207639_10216235 Ga0207639_102162352 330
1666 3300026067 Ga0207678_10187385 Ga0207678_101873852 330
1667 3300026067 Ga0207678_10189062 Ga0207678_101890622 330
1668 3300026078 Ga0207702_10033194 Ga0207702_100331943 330
1669 3300026078 Ga0207702_10163641 Ga0207702_101636412 330
1670 3300026078 Ga0207702_10178055 Ga0207702_101780552 330
1671 3300026078 Ga0207702_10179524 Ga0207702_101795242 330
1672 3300026078 Ga0207702_10187355 Ga0207702_101873552 330
1673 3300026088 Ga0207641_10035203 Ga0207641_100352033 330
1674 3300026095 Ga0207676_10030998 Ga0207676_100309983 330
1675 3300026116 Ga0207674_10327952 Ga0207674_103279522 330
1676 3300026116 Ga0207674_10467961 Ga0207674_104679612 330
1677 3300026121 Ga0207683_10131269 Ga0207683_101312692 330
1678 3300026121 Ga0207683_10236442 Ga0207683_102364422 330
1679 3300026142 Ga0207698_10029130 Ga0207698_100291303 330
1680 3300027111 Ga0209281_1000375 Ga0209281_100037510 330
1681 3300027111 Ga0209281_1001291 Ga0209281_10012919 330
1682 3300027312 Ga0209371_1000035 Ga0209371_1000035162 330
1683 3300027312 Ga0209371_1000901 Ga0209371_100090111 330
1684 3300027312 Ga0209371_1003138 Ga0209371_10031385 330
1685 3300027666 Ga0209282_1001148 Ga0209282_10011489 330
1686 3300027666 Ga0209282_1001830 Ga0209282_100183013 330
1687 3300027666 Ga0209282_1044420 Ga0209282_10444202 330
1688 3300027866 Ga0209813_10000800 Ga0209813_100008005 330
1689 3300027866 Ga0209813_10032907 Ga0209813_100329072 330
1690 3300028379 Ga0268266_10024005 Ga0268266_100240056 330
1691 3300028379 Ga0268266_10054593 Ga0268266_100545933 330
1692 3300028379 Ga0268266_10070198 Ga0268266_100701984 330
1693 3300028379 Ga0268266_10274954 Ga0268266_102749542 330
1694 3300028577 Ga0265318_10028336 Ga0265318_100283363 330
1695 3300028794 Ga0307515_10000017 Ga0307515_10000017168 330
1696 3300028794 Ga0307515_10021612 Ga0307515_100216123 330
1697 3300028794 Ga0307515_10022262 Ga0307515_100222629 330
1698 3300030500 Ga0268256_1000037 Ga0268256_1000037161 330
1699 3300030500 Ga0268256_1003000 Ga0268256_10030005 330
1700 3300030500 Ga0268256_1003068 Ga0268256_10030686 330
1701 3300030744 Ga0316181_1025508 Ga0316181_10255083 330
1702 3300031235 Ga0265330_10018309 Ga0265330_100183093 330
1703 3300031240 Ga0265320_10036211 Ga0265320_100362112 330
1704 3300031241 Ga0265325_10006250 Ga0265325_100062504 330
1705 3300031241 Ga0265325_10013585 Ga0265325_100135853 330
1706 3300031247 Ga0265340_10028955 Ga0265340_100289553 330
1707 3300031247 Ga0265340_10078080 Ga0265340_100780802 330
1708 3300031247 Ga0265340_10113579 Ga0265340_101135791 330
1709 3300031249 Ga0265339_10002978 Ga0265339_100029784 330
1710 3300031249 Ga0265339_10062419 Ga0265339_100624192 330
1711 3300031250 Ga0265331_10047132 Ga0265331_100471323 330
1712 3300031344 Ga0265316_10013087 Ga0265316_100130876 330
1713 3300031344 Ga0265316_10032893 Ga0265316_100328934 330
1714 3300031344 Ga0265316_10167437 Ga0265316_101674372 330
1715 3300031456 Ga0307513_10005235 Ga0307513_1000523511 330
1716 3300031456 Ga0307513_10080307 Ga0307513_100803074 330
1717 3300031456 Ga0307513_10151987 Ga0307513_101519872 330
1718 3300031548 Ga0307408_100054513 Ga0307408_1000545131 330
1719 3300031595 Ga0265313_10000044 Ga0265313_1000004480 330
1720 3300031595 Ga0265313_10000481 Ga0265313_1000048130 330
1721 3300031595 Ga0265313_10011274 Ga0265313_100112744 330
1722 3300031595 Ga0265313_10072214 Ga0265313_100722142 330
1723 3300031595 Ga0265313_10115121 Ga0265313_101151212 330
1724 3300031711 Ga0265314_10010039 Ga0265314_100100395 330
1725 3300031711 Ga0265314_10025241 Ga0265314_100252414 330
1726 3300031712 Ga0265342_10000926 Ga0265342_1000092623 330
1727 3300031712 Ga0265342_10018725 Ga0265342_100187254 330
1728 3300031712 Ga0265342_10047051 Ga0265342_100470512 330
1729 3300031731 Ga0307405_10000323 Ga0307405_1000032316 330
1730 3300031852 Ga0307410_10338188 Ga0307410_103381881 330
1731 3300031901 Ga0307406_10053211 Ga0307406_100532113 330
1732 3300031911 Ga0307412_10001545 Ga0307412_100015454 330
1733 3300031911 Ga0307412_10169124 Ga0307412_101691241 330
1734 3300031967 Ga0315914_1008120 Ga0315914_10081207 330
1735 3300032004 Ga0307414_10118438 Ga0307414_101184382 330
1736 3300032004 Ga0307414_10124889 Ga0307414_101248892 330
1737 3300032004 Ga0307414_10284487 Ga0307414_102844871 330
1738 3300032004 Ga0307414_10545162 Ga0307414_105451621 330
1739 3300033430 Ga0315913_1006432 Ga0315913_10064329 330
1740 3300033464 Ga0315915_1000007 Ga0315915_1000007234 330
1741 3300037068 Ga0373925_0148449 Ga0373925_0148449_584_1588 330
1742 3300037312 Ga0395899_0000044 Ga0395899_0000044_18459_19469 330
1743 3300037418 Ga0395900_0000042 Ga0395900_0000042_12619_13629 330
1744 3300037466 Ga0395898_0000080 Ga0395898_0000080_12619_13629 330
1745 3300037471 Ga0395905_0000044 Ga0395905_0000044_229288_230298 330
1746 3300037471 Ga0395905_0423218 Ga0395905_0423218_24_1016 330
1747 3300038443 Ga0395901_0000027 Ga0395901_0000027_229254_230264 330
1748 3300039062 Ga0400483_172664 Ga0400483_172664_150_1151 330
1749 3300039062 Ga0400483_246637 Ga0400483_246637_2031_3035 330
1750 3300041413 Ga0439465_0001270 Ga0439465_0001270_643_1635 330
1751 3300041413 Ga0439465_0008472 Ga0439465_0008472_86_1081 330
1752 3300041413 Ga0439465_0008513 Ga0439465_0008513_813_1805 330
1753 3300041452 Ga0451793_1386411 Ga0451793_1386411_22_1014 330
1754 3300041509 Ga0451843_0294688 Ga0451843_0294688_2948_3940 330
1755 3300041999 Ga0439433_0022253 Ga0439433_0022253_126_1121 330
1756 3300042006 Ga0439432_019512 Ga0439432_019512_425_1420 330
1757 3300042145 Ga0450906_002412 Ga0450906_002412_1146_2141 330
1758 3300044684 Ga0466966_0022293 Ga0466966_0022293_41_1033 330
1759 3300044694 Ga0466963_0013253 Ga0466963_0013253_2127_3119 330
1760 3300044735 Ga0466968_0012727 Ga0466968_0012727_151_1146 330
1761 3300044765 Ga0466970_0005599 Ga0466970_0005599_3208_4200 330
1762 3300045051 Ga0451576_0002330 Ga0451576_0002330_4320_5321 330
1763 3300045051 Ga0451576_0036965 Ga0451576_0036965_3743_4747 330
1764 3300045836 Ga0466958_0024660 Ga0466958_0024660_826_1818 330
1765 3300046459 Ga0495629_0004985 Ga0495629_0004985_4881_5885 330
1766 3300046459 Ga0495629_0029471 Ga0495629_0029471_2814_3812 330
1767 3300046460 Ga0495638_0008120 Ga0495638_0008120_3934_4926 330
1768 3300046460 Ga0495638_0019366 Ga0495638_0019366_2397_3389 330
1769 3300046462 Ga0495651_0067244 Ga0495651_0067244_881_1891 330
1770 3300046462 Ga0495651_0098693 Ga0495651_0098693_49_1047 330
1771 3300046462 Ga0495651_0101799 Ga0495651_0101799_1100_2104 330
1772 3300046474 Ga0495605_0020662 Ga0495605_0020662_1831_2823 330
1773 3300046474 Ga0495605_0038126 Ga0495605_0038126_1323_2315 330
1774 3300046476 Ga0495662_0067685 Ga0495662_0067685_24_1022 330
1775 3300046477 Ga0495664_0074572 Ga0495664_0074572_112_1110 330
1776 3300046492 Ga0495585_0037863 Ga0495585_0037863_10_1002 330
1777 3300046492 Ga0495585_0164218 Ga0495585_0164218_41_1033 330
1778 3300046506 Ga0495583_0012467 Ga0495583_0012467_1748_2740 330
1779 3300046507 Ga0495606_0006240 Ga0495606_0006240_8863_9855 330
1780 3300046507 Ga0495606_0133561 Ga0495606_0133561_57_1049 330
1781 3300046512 Ga0495610_0008335 Ga0495610_0008335_2561_3553 330
1782 3300046512 Ga0495610_0036426 Ga0495610_0036426_1223_2215 330
1783 3300046519 Ga0495632_0008302 Ga0495632_0008302_2389_3381 330
1784 3300046520 Ga0495637_0096499 Ga0495637_0096499_59_1054 330
1785 3300046522 Ga0495643_0033843 Ga0495643_0033843_888_1880 330
1786 3300046522 Ga0495643_0075017 Ga0495643_0075017_417_1412 330
1787 3300046533 Ga0495640_0008734 Ga0495640_0008734_4115_5119 330
1788 3300046557 Ga0495622_0031741 Ga0495622_0031741_204_1208 330
1789 3300046559 Ga0495667_0082887 Ga0495667_0082887_423_1433 330
1790 3300046616 Ga0495668_0013586 Ga0495668_0013586_1748_2740 330
1791 3300046660 Ga0495625_0011866 Ga0495625_0011866_2374_3366 330
1792 3300046663 Ga0495635_0017864 Ga0495635_0017864_90_1094 330
1793 3300046674 Ga0495588_0002642 Ga0495588_0002642_3076_4068 330
1794 3300046674 Ga0495588_0071038 Ga0495588_0071038_247_1248 330
1795 3300046674 Ga0495588_0097048 Ga0495588_0097048_10_1008 330
1796 3300046675 Ga0495657_0060563 Ga0495657_0060563_442_1446 330
1797 3300046683 Ga0495658_0030878 Ga0495658_0030878_979_1977 330
1798 3300046689 Ga0495613_0023071 Ga0495613_0023071_2580_3584 330
1799 3300046691 Ga0495670_0090149 Ga0495670_0090149_429_1421 330
1800 3300046809 Ga0495600_0008492 Ga0495600_0008492_3323_4327 330
1801 3300046809 Ga0495600_0033078 Ga0495600_0033078_1920_2918 330
1802 3300046809 Ga0495600_0131177 Ga0495600_0131177_604_1614 330
1803 3300047317 Ga0495604_0041248 Ga0495604_0041248_909_1913 330
1804 3300047321 Ga0495676_0038748 Ga0495676_0038748_2557_3564 330
1805 3300047469 Ga0495673_0058904 Ga0495673_0058904_474_1466 330
1806 3300047470 Ga0495681_0000773 Ga0495681_0000773_4740_5732 330
1807 3300047472 Ga0495686_0009447 Ga0495686_0009447_2879_3871 330
1808 3300047472 Ga0495686_0023819 Ga0495686_0023819_91_1083 330
1809 3300047472 Ga0495686_0026678 Ga0495686_0026678_223_1215 330
1810 3300047472 Ga0495686_0050941 Ga0495686_0050941_84_1076 330
1811 3300048088 Ga0495602_0140246 Ga0495602_0140246_674_1678 330
1812 3300048905 Ga0496102_0240698 Ga0496102_0240698_632_1624 330
1813 3300048907 Ga0496104_0003414 Ga0496104_0003414_5088_6092 330
1814 3300048907 Ga0496104_0044031 Ga0496104_0044031_1049_2041 330
1815 3300048907 Ga0496104_0376879 Ga0496104_0376879_319_1311 330
1816 3300048908 Ga0496105_0000404 Ga0496105_0000404_17568_18572 330
1817 3300048909 Ga0496106_0014285 Ga0496106_0014285_2317_3309 330
1818 3300048916 Ga0496113_0072655 Ga0496113_0072655_1119_2111 330
1819 3300048917 Ga0496114_0127631 Ga0496114_0127631_823_1875 330
1820 3300048918 Ga0496115_0030928 Ga0496115_0030928_1301_2305 330
1821 3300048919 Ga0496116_0012142 Ga0496116_0012142_4135_5127 330
1822 3300048919 Ga0496116_0016325 Ga0496116_0016325_3054_4121 330
1823 3300048919 Ga0496116_0016678 Ga0496116_0016678_1920_2912 330
1824 3300048919 Ga0496116_0063997 Ga0496116_0063997_1211_2203 330
1825 3300048919 Ga0496116_0064545 Ga0496116_0064545_1235_2227 330
1826 3300048919 Ga0496116_0065103 Ga0496116_0065103_1155_2147 330
1827 3300048920 Ga0496117_0000066 Ga0496117_0000066_177316_178308 330
1828 3300048920 Ga0496117_0017065 Ga0496117_0017065_1804_2796 330
1829 3300048920 Ga0496117_0101947 Ga0496117_0101947_432_1436 330
1830 3300048921 Ga0496118_0015274 Ga0496118_0015274_4404_5396 330
1831 3300048921 Ga0496118_0028061 Ga0496118_0028061_471_1463 330
1832 3300048921 Ga0496118_0028682 Ga0496118_0028682_2228_3220 330
1833 3300048921 Ga0496118_0038269 Ga0496118_0038269_666_1658 330
1834 3300048921 Ga0496118_0051085 Ga0496118_0051085_1805_2800 330
1835 3300048921 Ga0496118_0059249 Ga0496118_0059249_94_1098 330
1836 3300048922 Ga0496119_0012012 Ga0496119_0012012_3503_4507 330
1837 3300048922 Ga0496119_0021565 Ga0496119_0021565_2119_3111 330
1838 3300048922 Ga0496119_0028988 Ga0496119_0028988_26_1018 330
1839 3300048922 Ga0496119_0041198 Ga0496119_0041198_1059_2054 330
1840 3300048922 Ga0496119_0050527 Ga0496119_0050527_187_1179 330
1841 3300048923 Ga0496120_0000100 Ga0496120_0000100_74201_75193 330
1842 3300048923 Ga0496120_0005160 Ga0496120_0005160_3234_4226 330
1843 3300048923 Ga0496120_0030888 Ga0496120_0030888_442_1434 330
1844 3300048924 Ga0496121_0017992 Ga0496121_0017992_1906_2898 330
1845 3300048924 Ga0496121_0037009 Ga0496121_0037009_3030_4022 330
1846 3300048925 Ga0496122_0000057 Ga0496122_0000057_74201_75193 330
1847 3300048925 Ga0496122_0000172 Ga0496122_0000172_109350_110345 330
1848 3300048925 Ga0496122_0000414 Ga0496122_0000414_86422_87414 330
1849 3300048925 Ga0496122_0007724 Ga0496122_0007724_7931_8923 330
1850 3300048925 Ga0496122_0008827 Ga0496122_0008827_4187_5179 330
1851 3300048925 Ga0496122_0017434 Ga0496122_0017434_864_1877 330
1852 3300048925 Ga0496122_0077875 Ga0496122_0077875_142_1134 330
1853 3300048926 Ga0496123_0000096 Ga0496123_0000096_98722_99714 330
1854 3300048926 Ga0496123_0000132 Ga0496123_0000132_109398_110393 330
1855 3300048926 Ga0496123_0000839 Ga0496123_0000839_18891_19883 330
1856 3300048926 Ga0496123_0014229 Ga0496123_0014229_3351_4343 330
1857 3300048926 Ga0496123_0015265 Ga0496123_0015265_1679_2671 330
1858 3300048926 Ga0496123_0031285 Ga0496123_0031285_1275_2267 330
1859 3300048927 Ga0496124_0000091 Ga0496124_0000091_8066_9070 330
1860 3300048927 Ga0496124_0008171 Ga0496124_0008171_1855_2847 330
1861 3300048927 Ga0496124_0009055 Ga0496124_0009055_7501_8493 330
1862 3300048927 Ga0496124_0009134 Ga0496124_0009134_1095_2087 330
1863 3300048927 Ga0496124_0020257 Ga0496124_0020257_3359_4426 330
1864 3300048927 Ga0496124_0050863 Ga0496124_0050863_1236_2228 330
1865 3300048927 Ga0496124_0189062 Ga0496124_0189062_446_1483 330
1866 3300048927 Ga0496124_0197883 Ga0496124_0197883_251_1246 330
1867 3300048928 Ga0496125_0002982 Ga0496125_0002982_13635_14627 330
1868 3300048928 Ga0496125_0005688 Ga0496125_0005688_1099_2091 330
1869 3300048928 Ga0496125_0019065 Ga0496125_0019065_2874_3866 330
1870 3300048928 Ga0496125_0024814 Ga0496125_0024814_1589_2581 330
1871 3300048928 Ga0496125_0027777 Ga0496125_0027777_216_1220 330
1872 3300048928 Ga0496125_0063263 Ga0496125_0063263_1552_2565 330
1873 3300048928 Ga0496125_0121785 Ga0496125_0121785_336_1328 330
1874 3300048929 Ga0496126_0000188 Ga0496126_0000188_42282_43274 330
1875 3300048929 Ga0496126_0012848 Ga0496126_0012848_98_1102 330
1876 3300048929 Ga0496126_0327368 Ga0496126_0327368_46_1041 330
1877 3300049568 Ga0501031_0000002 Ga0501031_0000002_171332_172327 330
1878 3300049569 Ga0501032_0000004 Ga0501032_0000004_45296_46291 330
1879 3300049569 Ga0501032_0000774 Ga0501032_0000774_22955_23959 330
1880 3300049570 Ga0501033_0000016 Ga0501033_0000016_171168_172163 330
1881 3300049570 Ga0501033_0000776 Ga0501033_0000776_3959_4951 330
1882 3300049570 Ga0501033_0003501 Ga0501033_0003501_125_1129 330
1883 3300049570 Ga0501033_0071410 Ga0501033_0071410_1023_2027 330
1884 3300049570 Ga0501033_0186557 Ga0501033_0186557_137_1135 330
1885 3300049571 Ga0501034_0000011 Ga0501034_0000011_45296_46291 330
1886 3300049571 Ga0501034_0000012 Ga0501034_0000012_265845_266849 330
1887 3300049571 Ga0501034_0002012 Ga0501034_0002012_3229_4302 330
1888 3300049571 Ga0501034_0031563 Ga0501034_0031563_4299_5303 330
1889 3300049571 Ga0501034_0181817 Ga0501034_0181817_675_1673 330
1890 3300049571 Ga0501034_0266330 Ga0501034_0266330_16_1089 330
1891 3300049572 Ga0501036_0000001 Ga0501036_0000001_45296_46291 330
1892 3300049572 Ga0501036_0209735 Ga0501036_0209735_80_1072 330
1893 3300049573 Ga0501037_0000006 Ga0501037_0000006_171171_172166 330
1894 3300049573 Ga0501037_0000227 Ga0501037_0000227_17199_18203 330
1895 3300049573 Ga0501037_0048724 Ga0501037_0048724_102_1139 330
1896 3300049573 Ga0501037_0073188 Ga0501037_0073188_1229_2233 330
1897 3300049574 Ga0501038_0000003 Ga0501038_0000003_45296_46291 330
1898 3300049574 Ga0501038_0052891 Ga0501038_0052891_661_1653 330
1899 3300049574 Ga0501038_0100886 Ga0501038_0100886_358_1362 330
1900 3300049574 Ga0501038_0132517 Ga0501038_0132517_312_1316 330
1901 3300049574 Ga0501038_0141728 Ga0501038_0141728_796_1800 330
1902 3300049574 Ga0501038_0177975 Ga0501038_0177975_66_1070 330
1903 3300049574 Ga0501038_0274653 Ga0501038_0274653_172_1182 330
1904 3300049575 Ga0501039_0000004 Ga0501039_0000004_45296_46291 330
1905 3300049575 Ga0501039_0082646 Ga0501039_0082646_161_1198 330
1906 3300049575 Ga0501039_0127525 Ga0501039_0127525_502_1506 330
1907 3300049576 Ga0501040_0007583 Ga0501040_0007583_3589_4584 330
1908 3300049576 Ga0501040_0126861 Ga0501040_0126861_546_1553 330
1909 3300049579 Ga0501043_0000396 Ga0501043_0000396_31555_32559 330
1910 3300049579 Ga0501043_0000765 Ga0501043_0000765_15248_16243 330
1911 3300049579 Ga0501043_0192321 Ga0501043_0192321_350_1348 330
1912 3300049579 Ga0501043_0279836 Ga0501043_0279836_256_1260 330
1913 3300049579 Ga0501043_0317325 Ga0501043_0317325_148_1152 330
1914 3300049581 Ga0501047_0007626 Ga0501047_0007626_6806_7801 330
1915 3300049581 Ga0501047_0010616 Ga0501047_0010616_1299_2303 330
1916 3300049581 Ga0501047_0163647 Ga0501047_0163647_123_1115 330
1917 3300049582 Ga0501048_0257784 Ga0501048_0257784_174_1178 330
1918 3300049584 Ga0501068_0032215 Ga0501068_0032215_1405_2409 330
1919 3300049584 Ga0501068_0109845 Ga0501068_0109845_347_1339 330
1920 3300049585 Ga0501069_0000068 Ga0501069_0000068_31116_32120 330
1921 3300049585 Ga0501069_0007152 Ga0501069_0007152_3353_4357 330
1922 3300049586 Ga0501070_0001073 Ga0501070_0001073_7447_8451 330
1923 3300049586 Ga0501070_0003655 Ga0501070_0003655_512_1516 330
1924 3300049586 Ga0501070_0093798 Ga0501070_0093798_817_1827 330
1925 3300049588 Ga0501072_0108870 Ga0501072_0108870_118_1125 330
1926 3300049589 Ga0501073_0039656 Ga0501073_0039656_138_1142 330
1927 3300049589 Ga0501073_0052415 Ga0501073_0052415_1348_2358 330
1928 3300049589 Ga0501073_0055592 Ga0501073_0055592_1745_2749 330
1929 3300049589 Ga0501073_0182092 Ga0501073_0182092_43_1035 330
1930 3300049590 Ga0501074_0000088 Ga0501074_0000088_42608_43612 330
1931 3300049590 Ga0501074_0006992 Ga0501074_0006992_277_1281 330
1932 3300049742 Ga0501080_0030375 Ga0501080_0030375_1640_2632 330
1933 3300049742 Ga0501080_0055629 Ga0501080_0055629_326_1330 330
1934 3300049742 Ga0501080_0124974 Ga0501080_0124974_409_1413 330
1935 3300049744 Ga0501083_0000065 Ga0501083_0000065_16658_17662 330
1936 3300049776 Ga0501280_001626 Ga0501280_001626_1983_2978 330
1937 3300049822 Ga0501035_0000009 Ga0501035_0000009_264537_265532 330
1938 3300049822 Ga0501035_0000185 Ga0501035_0000185_39570_40574 330
1939 3300049822 Ga0501035_0000245 Ga0501035_0000245_2719_3723 330
1940 3300049822 Ga0501035_0000882 Ga0501035_0000882_24657_25649 330
1941 3300049822 Ga0501035_0011959 Ga0501035_0011959_3880_4884 330
1942 3300049822 Ga0501035_0022247 Ga0501035_0022247_1679_2683 330
1943 3300049822 Ga0501035_0037310 Ga0501035_0037310_1330_2334 330
1944 3300049822 Ga0501035_0123885 Ga0501035_0123885_862_1866 330
1945 3300049822 Ga0501035_0134079 Ga0501035_0134079_1002_1994 330
1946 3300049822 Ga0501035_0258123 Ga0501035_0258123_302_1297 330
1947 3300049823 Ga0501044_0000003 Ga0501044_0000003_42610_43614 330
1948 3300049823 Ga0501044_0000005 Ga0501044_0000005_45296_46291 330
1949 3300049823 Ga0501044_0039557 Ga0501044_0039557_1338_2348 330
1950 3300049823 Ga0501044_0073722 Ga0501044_0073722_170_1162 330
1951 3300049823 Ga0501044_0433311 Ga0501044_0433311_147_1151 330
1952 3300049824 Ga0501045_0051974 Ga0501045_0051974_1582_2589 330
1953 3300050489 nmdc:mga03683_53243_c1 nmdc:mga03683_53243_c1_223_1215 330
1954 3300050490 nmdc:mga03n38_64472_c1 nmdc:mga03n38_64472_c1_610_1611 330
1955 3300050491 nmdc:mga00v17_130629_c1 nmdc:mga00v17_130629_c1_91_1083 330
1956 3300050491 nmdc:mga00v17_17_c1 nmdc:mga00v17_17_c1_47840_48832 330
1957 3300050492 nmdc:mga0yw44_101_c1 nmdc:mga0yw44_101_c1_21642_22634 330
1958 3300050492 nmdc:mga0yw44_19418_c1 nmdc:mga0yw44_19418_c1_247_1251 330
1959 3300050493 nmdc:mga0k408_8787_c1 nmdc:mga0k408_8787_c1_487_1479 330
1960 3300050494 nmdc:mga06z11_13972_c1 nmdc:mga06z11_13972_c1_2199_3191 330
1961 3300050516 nmdc:mga0sz30_10915_c1 nmdc:mga0sz30_10915_c1_643_1635 330
1962 3300050516 nmdc:mga0sz30_121_c1 nmdc:mga0sz30_121_c1_11831_12823 330
1963 3300050516 nmdc:mga0sz30_19108_c2 nmdc:mga0sz30_19108_c2_1225_2217 330
1964 3300050516 nmdc:mga0sz30_42061_c1 nmdc:mga0sz30_42061_c1_602_1594 330
1965 3300053085 Ga0495619_0024481 Ga0495619_0024481_1988_2986 330
1966 3300053086 Ga0500578_0132496 Ga0500578_0132496_483_1475 330
1967 3300053118 Ga0500594_0003013 Ga0500594_0003013_190_1182 330
1968 3300053125 Ga0500618_011157 Ga0500618_011157_859_1851 330
1969 3300053134 Ga0500658_0002401 Ga0500658_0002401_3112_4104 330
1970 3300053137 Ga0500561_0006852 Ga0500561_0006852_747_1739 330
1971 3300053139 Ga0500568_0007107 Ga0500568_0007107_2778_3770 330
1972 3300053148 Ga0500590_017641 Ga0500590_017641_2532_3530 330
1973 3300053148 Ga0500590_061267 Ga0500590_061267_360_1364 330
1974 3300053153 Ga0500616_0000771 Ga0500616_0000771_12833_13828 330
1975 3300053153 Ga0500616_0015338 Ga0500616_0015338_1042_2034 330
1976 3300053153 Ga0500616_0017450 Ga0500616_0017450_1994_2986 330
1977 3300053153 Ga0500616_0018766 Ga0500616_0018766_191_1270 330
1978 3300053155 Ga0500620_000347 Ga0500620_000347_7347_8342 330
1979 3300053156 Ga0500622_0005550 Ga0500622_0005550_4573_5565 330
1980 3300053157 Ga0500624_000443 Ga0500624_000443_2632_3624 330
1981 3300053158 Ga0500627_0019857 Ga0500627_0019857_452_1444 330
1982 3300053160 Ga0500633_0001730 Ga0500633_0001730_2041_3033 330
1983 3300053161 Ga0500634_0000019 Ga0500634_0000019_78134_79171 330
1984 3300053177 Ga0500636_0000038 Ga0500636_0000038_68889_69881 330
1985 3300053177 Ga0500636_0003227 Ga0500636_0003227_3061_4053 330
1986 3300053733 Ga0500552_010052 Ga0500552_010052_49_1053 330
1987 3300055283 Ga0500661_014073 Ga0500661_014073_110_1114 330
1988 3300059493 Ga0587077_023705 Ga0587077_023705_48_1043 330
1989 3300059505 Ga0587083_0029198 Ga0587083_0029198_11_1009 330
1990 3300059510 Ga0587090_000202 Ga0587090_000202_3282_4274 330
1991 iso_pu_bacteria 2751185821 2753463398 330

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01408

GFO_IDH_MocA

Oxidoreductase family, NAD-binding Rossmann fold

54

171

0.97

PF22725

GFO_IDH_MocA_C3

GFO/IDH/MocA C-terminal domain

179

300

0.96

PF02894

GFO_IDH_MocA_C

Oxidoreductase family, C-terminal alpha/beta domain

183

380

0.93

PF03807

F420_oxidored

NADP oxidoreductase coenzyme F420-dependent

55

141

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hkt-assembly1.cif.gz_D crystal structure of a putative myo-inositol dehydrogenase from sinorhizobium meliloti 1021 (target psi-012312) 0.985 2 330
4hkt-assembly1.cif.gz_D crystal structure of a putative myo-inositol dehydrogenase from sinorhizobium meliloti 1021 (target psi-012312) 0.9821 2 330
3ezy-assembly1.cif.gz_B crystal structure of probable dehydrogenase tm_0414 from thermotoga maritima 0.9702 3 329
3ezy-assembly1.cif.gz_C crystal structure of probable dehydrogenase tm_0414 from thermotoga maritima 0.9699 3 329
3euw-assembly1.cif.gz_B crystal structure of a myo-inositol dehydrogenase from corynebacterium glutamicum atcc 13032 0.9692 1 330
ID Description Score Start End Superfamily
4hktB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 1.004 2 119 3.40.50.720
4hktB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9956 2 119 3.40.50.720
4hktD02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.9762 121 330 3.30.360.10
3ezyC02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.971 121 329 3.30.360.10
4hktD02 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.967 121 330 3.30.360.10
ID Description Score Start End GO Terms
AF-A0A6M0QYP2-F1-model_v4 Inositol 2-dehydrogenase (EC 1.1.1.18) 0.9879 1 329 GO:0000166
GO:0050112
AF-A0A7C3ZRM2-F1-model_v4 Inositol 2-dehydrogenase (EC 1.1.1.18) 0.9862 1 328 GO:0000166
GO:0050112
AF-A0A6M0QYP2-F1-model_v4 Inositol 2-dehydrogenase (EC 1.1.1.18) 0.982 1 329 GO:0000166
GO:0050112
AF-A0A7C3ZRM2-F1-model_v4 Inositol 2-dehydrogenase (EC 1.1.1.18) 0.9803 1 328 GO:0000166
GO:0050112
AF-A0A6H5JKB6-F1-model_v4 Uncharacterized protein 0.9774 2 329 GO:0000166
GO:0005737
GO:0006740
GO:0016491

Feature Viewer

pLDDT pTM Quality
94.56 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map