F496198

General Info

Members Datasets Scaffolds Average Seq Length
1983 490 1937 281

Family's Representative Sequence

Representative Sequence 3300049743|Ga0501081_0345127|Ga0501081_0345127_138_1067
Length 309
Sequence MTSSDVAEAIAARPHDSGPGVHGSARAATAKRVGARAVLYTTATFFTLFAALPFAWMILTIFKQDEDLYFNVIGSNPLRYNAPPTLDNLRILFQDTSYLTFVRNSFFVGVLTVIITLLLAMPAAYALTRLAGKWGEGLGIAIFLVYLVPPTLLFIPLSRVVSDLGLRNSWWAMVVVYPTFTIPFCTWLLMGFFKSIPRDIEEQAMVDGYSRLGAIWRTVLPVSLPGLLTVVVFSFALTMHEFVYALAFVTSSSEKTISIGVTTELIRGDVYFWQSLMAAAAIVAIPVALLYNLFLDRFIAGFTLGAVKG

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
3 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
4 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
5 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
6 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
7 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
8 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
9 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
10 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
11 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
12 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
13 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
14 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
15 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
16 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
17 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
18 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
19 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
20 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
21 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
22 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
23 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
24 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
25 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
26 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
27 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
28 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
29 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
30 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
31 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
32 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
33 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
34 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
35 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
36 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
37 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
38 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
39 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
40 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
41 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
42 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
43 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
44 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
45 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
46 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
47 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
48 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
49 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
51 3300003349 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM Metagenome Rhizosphere
52 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
53 3300003503 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM Metagenome Rhizosphere
54 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
55 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
56 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
57 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
58 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
59 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
60 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
61 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
62 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
63 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
64 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
65 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
66 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
67 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
68 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
69 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
70 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
71 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
72 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
73 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
74 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
75 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
76 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
77 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
78 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
79 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
80 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
81 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
82 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
83 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
84 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
85 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
86 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
87 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
88 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
89 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
90 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
91 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
92 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
93 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
94 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
95 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
96 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
97 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
98 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
99 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
100 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
101 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
102 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
103 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
104 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
105 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
106 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
107 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
108 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
109 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
110 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
111 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
112 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
113 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
114 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
115 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
116 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
117 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
118 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
119 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
120 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
121 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
122 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
123 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
124 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
125 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
126 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
127 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
128 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
129 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
130 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
131 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
132 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
133 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
134 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
135 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
136 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
137 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
138 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
139 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
140 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
141 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
142 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
143 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
144 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
145 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
146 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
147 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
148 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
149 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
150 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
151 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
152 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
153 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
154 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
155 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
156 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
157 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
158 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
159 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
160 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
161 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
162 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
163 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
164 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
165 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
166 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
167 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
168 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
169 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
170 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
171 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
172 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
173 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
174 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
175 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
176 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
177 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
178 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
179 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
180 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
181 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
182 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
183 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
184 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
185 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
186 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
187 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
188 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
189 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
190 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
191 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
192 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
193 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
194 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
195 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
196 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
197 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
198 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
199 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
200 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
201 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
202 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
203 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
204 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
260 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
261 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
262 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
264 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
265 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
269 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
270 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
271 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
273 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
274 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
275 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
276 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
277 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
278 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
279 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
280 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
281 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
282 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
283 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
284 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
285 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
286 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
287 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
288 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
289 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
290 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
291 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
293 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
294 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
295 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
296 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
297 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
298 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
299 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
300 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
301 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
302 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
303 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
304 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
305 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
306 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
307 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
308 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
309 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
310 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
311 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
312 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
313 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
314 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
315 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
316 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
317 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
318 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
319 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
320 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
321 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
322 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
323 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
324 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
325 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
326 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
327 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
328 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
329 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
330 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
331 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
332 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
333 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
334 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
335 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
336 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
337 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
338 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
339 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
340 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
341 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
342 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
343 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
344 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
345 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
346 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
347 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
348 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
349 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
350 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
351 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
352 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
353 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
354 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
355 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
356 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
357 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
358 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
359 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
360 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
361 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
362 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
363 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
364 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
365 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
366 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
367 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
368 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
369 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
370 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
371 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
372 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
373 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
374 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
375 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
376 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
377 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
378 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
379 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
380 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
381 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
382 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
383 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
384 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
385 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
386 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
387 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
388 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
389 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
390 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
391 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
392 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
393 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
394 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
395 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
396 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
397 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
398 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
399 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
400 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
401 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
402 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
403 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
404 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
405 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
406 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
407 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
408 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
409 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
410 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
411 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
412 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
413 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
414 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
415 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
416 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
417 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
418 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
419 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
420 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
421 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
422 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
423 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
424 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
425 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
426 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
427 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
428 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
429 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
430 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
431 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
432 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
433 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
434 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
435 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
436 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
437 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
438 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
439 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
440 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
441 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
442 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
443 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
444 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
445 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
446 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
447 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
448 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
449 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
450 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
451 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
452 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
453 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
454 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
455 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
456 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
457 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
458 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
459 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
460 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
461 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
462 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
463 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
464 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
465 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
466 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
467 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
468 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
469 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
470 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
471 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
472 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
473 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
474 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
475 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
476 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
477 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
478 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
479 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
480 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
481 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
482 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
483 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
484 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
485 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
486 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
487 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
488 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
489 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
490 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.48
Metatranscriptomes 0.2
Isolates 2.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.96
Nodule 2.27
Rhizoplane 2.67
Rhizosphere 92.74
Stem 0
Stem Tuber 0
Unclassified 1.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_13101341 2162886012 Bacteria 1388
2 JGI24746J21847_1002113 3300001977 Bacteria 3179
3 JGI24737J22298_10027830 3300001990 Bacteria 1780
4 JGI24745J21846_1001654 3300002073 Bacteria 2193
5 JGI24748J21848_1001599 3300002074 Bacteria 2521
6 JGI24749J21850_1002992 3300002076 Bacteria 2360
7 JGI24744J21845_10004588 3300002077 Bacteria 2857
8 JGI24751J29686_10014716 3300002459 Bacteria 1613
9 JGI25406J46586_10008638 3300003203 Bacteria 4600
10 JGI25406J46586_10011476 3300003203 Bacteria 3885
11 JGI25153J46596_10025287 3300003215 Bacteria 2124
12 JGI26129J50193_1000799 3300003349 Bacteria 2039
13 JGI26145J50221_1003223 3300003371 Bacteria 1296
14 JGI26145J50221_1005572 3300003371 Bacteria 1037
15 JGI26141J51220_1000108 3300003503 Bacteria 4000
16 Ga0065704_10159006 3300005289 Bacteria 1369
17 Ga0065712_10094941 3300005290 Bacteria 2231
18 Ga0065712_10108870 3300005290 Bacteria 1866
19 Ga0065712_10152071 3300005290 Bacteria 1362
20 Ga0065715_10093584 3300005293 Bacteria 4632
21 Ga0065715_10179345 3300005293 Bacteria 1488
22 Ga0065707_10018041 3300005295 Bacteria 2288
23 Ga0065707_10216775 3300005295 Bacteria 1241
24 Ga0065707_10259751 3300005295 Bacteria 1100
25 Ga0070658_10001995 3300005327 Bacteria 17158
26 Ga0070658_10012513 3300005327 Bacteria 6807
27 Ga0070658_10041652 3300005327 Bacteria 3705
28 Ga0070658_10057646 3300005327 Bacteria 3160
29 Ga0070676_10000715 3300005328 Bacteria 16250
30 Ga0070676_10008932 3300005328 Bacteria 5419
31 Ga0070676_10027051 3300005328 Bacteria 3251
32 Ga0070676_10401298 3300005328 Bacteria 954
33 Ga0070683_100004179 3300005329 Bacteria 11832
34 Ga0070683_100042902 3300005329 Bacteria 4167
35 Ga0070683_100057597 3300005329 Bacteria 3610
36 Ga0070683_100072455 3300005329 Bacteria 3215
37 Ga0070690_100001179 3300005330 Bacteria 13450
38 Ga0070690_100213148 3300005330 Bacteria 1350
39 Ga0070670_100001169 3300005331 Bacteria 20838
40 Ga0070670_100011897 3300005331 Bacteria 7441
41 Ga0070670_100244401 3300005331 Bacteria 1563
42 Ga0070677_10000244 3300005333 Bacteria 18909
43 Ga0068869_100000046 3300005334 Bacteria 51500
44 Ga0068869_100000625 3300005334 Bacteria 19974
45 Ga0068869_100006020 3300005334 Bacteria 7670
46 Ga0068869_100006478 3300005334 Bacteria 7430
47 Ga0068869_100227602 3300005334 Bacteria 1480
48 Ga0070666_10001439 3300005335 Bacteria 14422
49 Ga0070680_100000543 3300005336 Bacteria 25803
50 Ga0070680_100003007 3300005336 Bacteria 12523
51 Ga0070680_100007253 3300005336 Bacteria 8449
52 Ga0070680_100009795 3300005336 Bacteria 7375
53 Ga0070680_100104954 3300005336 Bacteria 2349
54 Ga0070680_100127592 3300005336 Bacteria 2126
55 Ga0070680_100184409 3300005336 Bacteria 1758
56 Ga0070682_100009292 3300005337 Bacteria 5565
57 Ga0070682_100011525 3300005337 Bacteria 5055
58 Ga0070682_100163673 3300005337 Bacteria 1539
59 Ga0068868_100003952 3300005338 Bacteria 10349
60 Ga0068868_100013550 3300005338 Bacteria 5982
61 Ga0068868_100262593 3300005338 Bacteria 1457
62 Ga0070660_100001141 3300005339 Bacteria 17921
63 Ga0070660_100001288 3300005339 Bacteria 17096
64 Ga0070660_100016470 3300005339 Bacteria 5365
65 Ga0070660_100072741 3300005339 Bacteria 2687
66 Ga0070660_100076723 3300005339 Bacteria 2618
67 Ga0070660_100184912 3300005339 Bacteria 1687
68 Ga0070689_100000277 3300005340 Bacteria 29758
69 Ga0070689_100001932 3300005340 Bacteria 13410
70 Ga0070689_100014350 3300005340 Bacteria 5752
71 Ga0070689_100038125 3300005340 Bacteria 3676
72 Ga0070689_100237991 3300005340 Bacteria 1499
73 Ga0070691_10000467 3300005341 Bacteria 15058
74 Ga0070691_10005169 3300005341 Bacteria 5932
75 Ga0070691_10033523 3300005341 Bacteria 2417
76 Ga0070691_10105965 3300005341 Bacteria 1401
77 Ga0070687_100000259 3300005343 Bacteria 17996
78 Ga0070687_100008454 3300005343 Bacteria 4363
79 Ga0070661_100000498 3300005344 Bacteria 30180
80 Ga0070661_100004888 3300005344 Bacteria 9229
81 Ga0070661_100088296 3300005344 Bacteria 2294
82 Ga0070661_100277128 3300005344 Bacteria 1300
83 Ga0070692_10003634 3300005345 Bacteria 6300
84 Ga0070692_10008524 3300005345 Bacteria 4577
85 Ga0070692_10026874 3300005345 Bacteria 2849
86 Ga0070692_10068699 3300005345 Bacteria 1883
87 Ga0070668_100001237 3300005347 Bacteria 18196
88 Ga0070668_100421951 3300005347 Bacteria 1142
89 Ga0070669_100000701 3300005353 Bacteria 24548
90 Ga0070669_100063120 3300005353 Bacteria 2726
91 Ga0070669_100065774 3300005353 Bacteria 2671
92 Ga0070669_100189907 3300005353 Bacteria 1611
93 Ga0070675_100025068 3300005354 Bacteria 4780
94 Ga0070675_100056373 3300005354 Bacteria 3238
95 Ga0070675_100139943 3300005354 Bacteria 2068
96 Ga0070671_100001652 3300005355 Bacteria 16857
97 Ga0070674_100000159 3300005356 Bacteria 31172
98 Ga0070674_100037139 3300005356 Bacteria 3274
99 Ga0070673_100001576 3300005364 Bacteria 13447
100 Ga0070673_100159290 3300005364 Bacteria 1918
101 Ga0070688_100000788 3300005365 Bacteria 15704
102 Ga0070659_100000694 3300005366 Bacteria 24488
103 Ga0070659_100000770 3300005366 Bacteria 23310
104 Ga0070659_100123817 3300005366 Bacteria 2096
105 Ga0070659_100491081 3300005366 Bacteria 1046
106 Ga0070667_100026212 3300005367 Bacteria 4848
107 Ga0070703_10013200 3300005406 Bacteria 2344
108 Ga0070703_10019167 3300005406 Bacteria 1983
109 Ga0070709_10030238 3300005434 Bacteria 3248
110 Ga0070709_10064058 3300005434 Bacteria 2350
111 Ga0070709_10106418 3300005434 Bacteria 1878
112 Ga0070709_10208912 3300005434 Bacteria 1387
113 Ga0070709_10357042 3300005434 Bacteria 1081
114 Ga0070714_100008731 3300005435 Bacteria 7921
115 Ga0070714_100040195 3300005435 Bacteria 3941
116 Ga0070714_100050181 3300005435 Bacteria 3553
117 Ga0070714_100090311 3300005435 Bacteria 2682
118 Ga0070714_100209059 3300005435 Bacteria 1788
119 Ga0070714_100320855 3300005435 Bacteria 1448
120 Ga0070714_100521185 3300005435 Bacteria 1135
121 Ga0070714_100588191 3300005435 Bacteria 1068
122 Ga0070713_100027640 3300005436 Bacteria 4468
123 Ga0070713_100163252 3300005436 Bacteria 1990
124 Ga0070713_100274847 3300005436 Bacteria 1544
125 Ga0070713_100588451 3300005436 Bacteria 1056
126 Ga0070713_100761681 3300005436 Unclassified 927
127 Ga0070710_10001662 3300005437 Bacteria 10470
128 Ga0070710_10004509 3300005437 Bacteria 6589
129 Ga0070710_10006636 3300005437 Bacteria 5566
130 Ga0070701_10006500 3300005438 Bacteria 4923
131 Ga0070701_10027225 3300005438 Bacteria 2798
132 Ga0070701_10035622 3300005438 Bacteria 2502
133 Ga0070711_100003872 3300005439 Bacteria 8788
134 Ga0070711_100056009 3300005439 Bacteria 2725
135 Ga0070711_100082847 3300005439 Bacteria 2290
136 Ga0070711_100164842 3300005439 Bacteria 1683
137 Ga0070711_100210153 3300005439 Bacteria 1506
138 Ga0070705_100000479 3300005440 Bacteria 23052
139 Ga0070705_100001494 3300005440 Bacteria 12330
140 Ga0070705_100014922 3300005440 Bacteria 4008
141 Ga0070705_100020951 3300005440 Bacteria 3470
142 Ga0070705_100057908 3300005440 Bacteria 2288
143 Ga0070700_100001100 3300005441 Bacteria 13376
144 Ga0070700_100009692 3300005441 Bacteria 5293
145 Ga0070694_100000062 3300005444 Bacteria 51304
146 Ga0070694_100000765 3300005444 Bacteria 17971
147 Ga0070694_100002954 3300005444 Bacteria 10102
148 Ga0070694_100003256 3300005444 Bacteria 9696
149 Ga0070694_100218781 3300005444 Bacteria 1428
150 Ga0070708_100011671 3300005445 Bacteria 7149
151 Ga0070708_100015679 3300005445 Bacteria 6262
152 Ga0070708_100015923 3300005445 Bacteria 6223
153 Ga0070708_100018224 3300005445 Bacteria 5875
154 Ga0070708_100018821 3300005445 Bacteria 5784
155 Ga0070708_100020150 3300005445 Bacteria 5617
156 Ga0070708_100026478 3300005445 Bacteria 4965
157 Ga0070708_100029111 3300005445 Bacteria 4761
158 Ga0070708_100045251 3300005445 Bacteria 3876
159 Ga0070708_100055834 3300005445 Bacteria 3512
160 Ga0070708_100064014 3300005445 Bacteria 3293
161 Ga0070708_100073087 3300005445 Bacteria 3090
162 Ga0070708_100088189 3300005445 Bacteria 2820
163 Ga0070708_100097882 3300005445 Bacteria 2682
164 Ga0070708_100119812 3300005445 Bacteria 2427
165 Ga0070708_100124858 3300005445 Bacteria 2378
166 Ga0070708_100133744 3300005445 Bacteria 2296
167 Ga0070708_100140129 3300005445 Unclassified 2242
168 Ga0070708_100143727 3300005445 Bacteria 2214
169 Ga0070708_100159619 3300005445 Bacteria 2101
170 Ga0070708_100170180 3300005445 Bacteria 2033
171 Ga0070708_100245224 3300005445 Bacteria 1682
172 Ga0070708_100367207 3300005445 Bacteria 1356
173 Ga0070708_100445588 3300005445 Bacteria 1221
174 Ga0070708_100480957 3300005445 Bacteria 1172
175 Ga0070708_100491637 3300005445 Bacteria 1157
176 Ga0070663_100000662 3300005455 Bacteria 18546
177 Ga0070663_100001206 3300005455 Bacteria 14196
178 Ga0070663_100047729 3300005455 Bacteria 3033
179 Ga0070663_100270409 3300005455 Bacteria 1351
180 Ga0070678_100004629 3300005456 Bacteria 7820
181 Ga0070678_100213803 3300005456 Bacteria 1599
182 Ga0070678_100260320 3300005456 Bacteria 1459
183 Ga0070678_100514501 3300005456 Bacteria 1058
184 Ga0070662_100000288 3300005457 Bacteria 29937
185 Ga0070662_100001806 3300005457 Bacteria 13157
186 Ga0070662_100073618 3300005457 Bacteria 2524
187 Ga0070681_10000351 3300005458 Bacteria 37169
188 Ga0070681_10002521 3300005458 Bacteria 16789
189 Ga0070681_10008663 3300005458 Bacteria 9977
190 Ga0070681_10016367 3300005458 Bacteria 7402
191 Ga0070681_10021769 3300005458 Bacteria 6429
192 Ga0070681_10161651 3300005458 Bacteria 2164
193 Ga0070681_10184526 3300005458 Bacteria 2007
194 Ga0070681_10190797 3300005458 Bacteria 1969
195 Ga0070681_10209905 3300005458 Bacteria 1863
196 Ga0070681_10220861 3300005458 Bacteria 1810
197 Ga0070681_10249711 3300005458 Bacteria 1687
198 Ga0068867_100001420 3300005459 Bacteria 16574
199 Ga0068867_100001575 3300005459 Bacteria 15859
200 Ga0068867_100001951 3300005459 Bacteria 14377
201 Ga0068867_100391623 3300005459 Bacteria 1170
202 Ga0070685_10000656 3300005466 Bacteria 18926
203 Ga0070706_100006828 3300005467 Bacteria 10775
204 Ga0070706_100011528 3300005467 Bacteria 8216
205 Ga0070706_100012878 3300005467 Bacteria 7742
206 Ga0070706_100013980 3300005467 Bacteria 7414
207 Ga0070706_100021203 3300005467 Bacteria 5984
208 Ga0070706_100022932 3300005467 Bacteria 5749
209 Ga0070706_100026319 3300005467 Bacteria 5353
210 Ga0070706_100027308 3300005467 Bacteria 5253
211 Ga0070706_100029789 3300005467 Bacteria 5028
212 Ga0070706_100072347 3300005467 Bacteria 3190
213 Ga0070706_100073281 3300005467 Unclassified 3169
214 Ga0070706_100100520 3300005467 Bacteria 2687
215 Ga0070706_100140042 3300005467 Bacteria 2258
216 Ga0070706_100161262 3300005467 Bacteria 2094
217 Ga0070706_100228101 3300005467 Bacteria 1739
218 Ga0070706_100251616 3300005467 Bacteria 1649
219 Ga0070706_100269967 3300005467 Bacteria 1587
220 Ga0070706_100284737 3300005467 Bacteria 1542
221 Ga0070706_100314989 3300005467 Bacteria 1459
222 Ga0070706_100325484 3300005467 Bacteria 1433
223 Ga0070706_100356296 3300005467 Bacteria 1364
224 Ga0070707_100000969 3300005468 Bacteria 28399
225 Ga0070707_100008162 3300005468 Bacteria 9715
226 Ga0070707_100012890 3300005468 Bacteria 7808
227 Ga0070707_100014328 3300005468 Bacteria 7433
228 Ga0070707_100014834 3300005468 Bacteria 7305
229 Ga0070707_100029699 3300005468 Bacteria 5203
230 Ga0070707_100030308 3300005468 Bacteria 5150
231 Ga0070707_100036637 3300005468 Bacteria 4681
232 Ga0070707_100044275 3300005468 Bacteria 4261
233 Ga0070707_100050243 3300005468 Unclassified 3997
234 Ga0070707_100052325 3300005468 Bacteria 3915
235 Ga0070707_100057218 3300005468 Bacteria 3740
236 Ga0070707_100061233 3300005468 Bacteria 3609
237 Ga0070707_100072985 3300005468 Bacteria 3309
238 Ga0070707_100095112 3300005468 Unclassified 2885
239 Ga0070707_100128742 3300005468 Bacteria 2460
240 Ga0070707_100167698 3300005468 Bacteria 2140
241 Ga0070707_100195385 3300005468 Bacteria 1973
242 Ga0070707_100216264 3300005468 Bacteria 1867
243 Ga0070707_100364676 3300005468 Unclassified 1403
244 Ga0070698_100001524 3300005471 Bacteria 25706
245 Ga0070698_100015230 3300005471 Bacteria 8132
246 Ga0070698_100017360 3300005471 Bacteria 7583
247 Ga0070698_100018843 3300005471 Bacteria 7261
248 Ga0070698_100021333 3300005471 Bacteria 6786
249 Ga0070698_100025377 3300005471 Bacteria 6178
250 Ga0070698_100025496 3300005471 Bacteria 6163
251 Ga0070698_100025894 3300005471 Bacteria 6111
252 Ga0070698_100027950 3300005471 Bacteria 5860
253 Ga0070698_100037730 3300005471 Bacteria 4981
254 Ga0070698_100118590 3300005471 Bacteria 2607
255 Ga0070698_100126001 3300005471 Unclassified 2518
256 Ga0070698_100149772 3300005471 Bacteria 2281
257 Ga0070698_100191221 3300005471 Bacteria 1984
258 Ga0070698_100263537 3300005471 Bacteria 1655
259 Ga0070698_100264504 3300005471 Unclassified 1652
260 Ga0070698_100533171 3300005471 Bacteria 1113
261 Ga0070699_100002285 3300005518 Bacteria 17239
262 Ga0070699_100005895 3300005518 Bacteria 10707
263 Ga0070699_100011170 3300005518 Bacteria 7762
264 Ga0070699_100015130 3300005518 Bacteria 6628
265 Ga0070699_100022852 3300005518 Bacteria 5389
266 Ga0070699_100029949 3300005518 Bacteria 4695
267 Ga0070699_100039725 3300005518 Bacteria 4074
268 Ga0070699_100053532 3300005518 Bacteria 3493
269 Ga0070699_100068187 3300005518 Bacteria 3089
270 Ga0070699_100081530 3300005518 Bacteria 2820
271 Ga0070699_100100612 3300005518 Bacteria 2533
272 Ga0070699_100132566 3300005518 Bacteria 2197
273 Ga0070699_100195165 3300005518 Bacteria 1799
274 Ga0070699_100231682 3300005518 Bacteria 1647
275 Ga0070699_100269851 3300005518 Bacteria 1522
276 Ga0070699_100276345 3300005518 Bacteria 1504
277 Ga0070699_100288758 3300005518 Bacteria 1470
278 Ga0070699_100440704 3300005518 Bacteria 1180
279 Ga0070699_100502217 3300005518 Unclassified 1102
280 Ga0070679_100002416 3300005530 Bacteria 16925
281 Ga0070679_100009240 3300005530 Bacteria 9318
282 Ga0070679_100015133 3300005530 Bacteria 7413
283 Ga0070679_100029556 3300005530 Bacteria 5407
284 Ga0070679_100029612 3300005530 Bacteria 5401
285 Ga0070679_100048672 3300005530 Bacteria 4223
286 Ga0070679_100064316 3300005530 Bacteria 3656
287 Ga0070679_100078780 3300005530 Bacteria 3284
288 Ga0070679_100122359 3300005530 Bacteria 2586
289 Ga0070679_100366868 3300005530 Bacteria 1387
290 Ga0070679_100378255 3300005530 Bacteria 1363
291 Ga0070679_100414890 3300005530 Bacteria 1292
292 Ga0070684_100012514 3300005535 Bacteria 6804
293 Ga0070684_100021076 3300005535 Bacteria 5416
294 Ga0070684_100039832 3300005535 Bacteria 4044
295 Ga0070684_100056405 3300005535 Bacteria 3428
296 Ga0070684_100073510 3300005535 Bacteria 3012
297 Ga0070684_100079119 3300005535 Bacteria 2906
298 Ga0070684_100121799 3300005535 Bacteria 2347
299 Ga0070684_100316639 3300005535 Bacteria 1433
300 Ga0070697_100005557 3300005536 Bacteria 9717
301 Ga0070697_100008721 3300005536 Bacteria 7918
302 Ga0070697_100009117 3300005536 Bacteria 7751
303 Ga0070697_100010039 3300005536 Bacteria 7389
304 Ga0070697_100012878 3300005536 Bacteria 6553
305 Ga0070697_100018933 3300005536 Bacteria 5433
306 Ga0070697_100025993 3300005536 Bacteria 4671
307 Ga0070697_100026587 3300005536 Bacteria 4625
308 Ga0070697_100035440 3300005536 Bacteria 4025
309 Ga0070697_100058243 3300005536 Bacteria 3144
310 Ga0070697_100083924 3300005536 Bacteria 2627
311 Ga0070697_100105670 3300005536 Bacteria 2342
312 Ga0070697_100134522 3300005536 Bacteria 2075
313 Ga0070697_100135368 3300005536 Bacteria 2068
314 Ga0070697_100195468 3300005536 Bacteria 1718
315 Ga0070697_100208914 3300005536 Bacteria 1661
316 Ga0070697_100242504 3300005536 Bacteria 1539
317 Ga0070697_100287212 3300005536 Bacteria 1412
318 Ga0068853_100001310 3300005539 Bacteria 17878
319 Ga0068853_100020726 3300005539 Bacteria 5468
320 Ga0068853_100077846 3300005539 Bacteria 2897
321 Ga0068853_100169002 3300005539 Bacteria 1977
322 Ga0068853_100233266 3300005539 Bacteria 1684
323 Ga0068853_100505846 3300005539 Bacteria 1141
324 Ga0070672_100001109 3300005543 Bacteria 16441
325 Ga0070686_100000257 3300005544 Bacteria 36214
326 Ga0070686_100000854 3300005544 Bacteria 17700
327 Ga0070686_100469005 3300005544 Bacteria 971
328 Ga0070695_100000721 3300005545 Bacteria 17637
329 Ga0070695_100001012 3300005545 Bacteria 15322
330 Ga0070695_100001455 3300005545 Bacteria 13134
331 Ga0070695_100001786 3300005545 Bacteria 12111
332 Ga0070695_100002088 3300005545 Bacteria 11428
333 Ga0070695_100006069 3300005545 Bacteria 7141
334 Ga0070695_100014544 3300005545 Bacteria 4745
335 Ga0070695_100021025 3300005545 Bacteria 3989
336 Ga0070695_100118087 3300005545 Bacteria 1811
337 Ga0070695_100121233 3300005545 Bacteria 1789
338 Ga0070695_100261850 3300005545 Bacteria 1263
339 Ga0070695_100328174 3300005545 Bacteria 1140
340 Ga0070696_100000126 3300005546 Bacteria 40723
341 Ga0070696_100001214 3300005546 Bacteria 16731
342 Ga0070696_100009327 3300005546 Bacteria 6570
343 Ga0070696_100019117 3300005546 Bacteria 4638
344 Ga0070696_100023195 3300005546 Bacteria 4217
345 Ga0070696_100092829 3300005546 Bacteria 2152
346 Ga0070696_100311963 3300005546 Bacteria 1208
347 Ga0070693_100000908 3300005547 Bacteria 13184
348 Ga0070693_100001337 3300005547 Bacteria 11093
349 Ga0070693_100021595 3300005547 Bacteria 3411
350 Ga0070693_100049769 3300005547 Bacteria 2392
351 Ga0070693_100066419 3300005547 Bacteria 2111
352 Ga0070665_100018386 3300005548 Bacteria 7005
353 Ga0070665_100024858 3300005548 Bacteria 6036
354 Ga0070665_100034487 3300005548 Bacteria 5089
355 Ga0070704_100000394 3300005549 Bacteria 20035
356 Ga0070704_100001188 3300005549 Bacteria 13624
357 Ga0070704_100045569 3300005549 Bacteria 3052
358 Ga0070704_100055023 3300005549 Bacteria 2819
359 Ga0068855_100000888 3300005563 Bacteria 37101
360 Ga0068855_100001752 3300005563 Bacteria 27089
361 Ga0068855_100013983 3300005563 Bacteria 9676
362 Ga0068855_100020428 3300005563 Bacteria 7942
363 Ga0068855_100034744 3300005563 Bacteria 6008
364 Ga0068855_100041615 3300005563 Bacteria 5446
365 Ga0068855_100055840 3300005563 Bacteria 4636
366 Ga0068855_100066357 3300005563 Bacteria 4207
367 Ga0068855_100088726 3300005563 Bacteria 3572
368 Ga0068855_100228733 3300005563 Bacteria 2083
369 Ga0068855_100308057 3300005563 Bacteria 1753
370 Ga0068855_100635787 3300005563 Bacteria 1148
371 Ga0070664_100001313 3300005564 Bacteria 19838
372 Ga0070664_100020311 3300005564 Bacteria 5468
373 Ga0070664_100035596 3300005564 Bacteria 4180
374 Ga0070664_100201957 3300005564 Bacteria 1774
375 Ga0070664_100328163 3300005564 Bacteria 1388
376 Ga0068857_100001705 3300005577 Bacteria 17672
377 Ga0068857_100010846 3300005577 Bacteria 7932
378 Ga0068857_100011958 3300005577 Bacteria 7548
379 Ga0068857_100173952 3300005577 Bacteria 1958
380 Ga0068857_100192461 3300005577 Bacteria 1858
381 Ga0068857_100623044 3300005577 Bacteria 1021
382 Ga0068854_100001780 3300005578 Bacteria 13116
383 Ga0068854_100004710 3300005578 Bacteria 8597
384 Ga0068854_100087557 3300005578 Bacteria 2311
385 Ga0068854_100191814 3300005578 Bacteria 1601
386 Ga0068854_100298253 3300005578 Bacteria 1303
387 Ga0068856_100000255 3300005614 Bacteria 58233
388 Ga0068856_100001431 3300005614 Bacteria 25031
389 Ga0068856_100010981 3300005614 Bacteria 8793
390 Ga0068856_100021593 3300005614 Bacteria 6256
391 Ga0068856_100088759 3300005614 Bacteria 3074
392 Ga0068856_100089148 3300005614 Bacteria 3067
393 Ga0068856_100102557 3300005614 Bacteria 2855
394 Ga0068856_100134867 3300005614 Bacteria 2474
395 Ga0068856_100216849 3300005614 Bacteria 1929
396 Ga0068856_100304095 3300005614 Bacteria 1613
397 Ga0070702_100000026 3300005615 Bacteria 42816
398 Ga0070702_100083355 3300005615 Bacteria 1920
399 Ga0070702_100152311 3300005615 Bacteria 1486
400 Ga0068852_100000493 3300005616 Bacteria 25813
401 Ga0068852_100002709 3300005616 Bacteria 12239
402 Ga0068852_100006524 3300005616 Bacteria 8437
403 Ga0068852_100008161 3300005616 Bacteria 7690
404 Ga0068852_100012137 3300005616 Bacteria 6525
405 Ga0068852_100125229 3300005616 Bacteria 2358
406 Ga0068852_100177684 3300005616 Bacteria 2000
407 Ga0068852_100211278 3300005616 Bacteria 1841
408 Ga0068859_100000922 3300005617 Bacteria 30115
409 Ga0068859_100003441 3300005617 Bacteria 16089
410 Ga0068859_100003746 3300005617 Bacteria 15499
411 Ga0068859_100080521 3300005617 Bacteria 3298
412 Ga0068864_100011570 3300005618 Bacteria 7285
413 Ga0068864_100038998 3300005618 Bacteria 4059
414 Ga0068864_100084467 3300005618 Bacteria 2789
415 Ga0068864_100292580 3300005618 Bacteria 1523
416 Ga0068864_100422607 3300005618 Bacteria 1270
417 Ga0068866_10000386 3300005718 Bacteria 20693
418 Ga0068866_10046235 3300005718 Bacteria 2188
419 Ga0068866_10118513 3300005718 Bacteria 1488
420 Ga0068866_10204279 3300005718 Bacteria 1182
421 Ga0068861_100000431 3300005719 Bacteria 24398
422 Ga0068861_100187060 3300005719 Bacteria 1728
423 Ga0068851_10000157 3300005834 Bacteria 36145
424 Ga0068851_10011354 3300005834 Bacteria 4175
425 Ga0068870_10004066 3300005840 Bacteria 6255
426 Ga0068870_10007879 3300005840 Bacteria 4764
427 Ga0068870_10011526 3300005840 Bacteria 4102
428 Ga0068863_100003390 3300005841 Bacteria 15728
429 Ga0068863_100056478 3300005841 Bacteria 3716
430 Ga0068858_100013719 3300005842 Bacteria 7649
431 Ga0068858_100025982 3300005842 Bacteria 5445
432 Ga0068858_100067787 3300005842 Bacteria 3306
433 Ga0068860_100008428 3300005843 Bacteria 10268
434 Ga0068860_100028069 3300005843 Bacteria 5419
435 Ga0068860_100067257 3300005843 Bacteria 3405
436 Ga0068860_100070076 3300005843 Bacteria 3333
437 Ga0068860_100076225 3300005843 Bacteria 3189
438 Ga0068860_100139112 3300005843 Bacteria 2332
439 Ga0068860_100352996 3300005843 Bacteria 1447
440 Ga0068860_100500873 3300005843 Bacteria 1212
441 Ga0068862_100002452 3300005844 Bacteria 16445
442 Ga0068862_100013754 3300005844 Bacteria 6707
443 Ga0068862_100054541 3300005844 Bacteria 3422
444 Ga0068862_100108619 3300005844 Bacteria 2433
445 Ga0068862_100450811 3300005844 Bacteria 1213
446 Ga0081455_10000052 3300005937 Bacteria 123035
447 Ga0081455_10000319 3300005937 Bacteria 62852
448 Ga0081455_10017297 3300005937 Bacteria 6919
449 Ga0081455_10071492 3300005937 Bacteria 2876
450 Ga0081455_10110025 3300005937 Bacteria 2191
451 Ga0081538_10009576 3300005981 Bacteria 8063
452 Ga0081538_10018669 3300005981 Bacteria 5194
453 Ga0081538_10021003 3300005981 Bacteria 4786
454 Ga0081538_10043856 3300005981 Bacteria 2800
455 Ga0081540_1005976 3300005983 Bacteria 8964
456 Ga0081540_1023538 3300005983 Bacteria 3598
457 Ga0081540_1031176 3300005983 Bacteria 2937
458 Ga0081539_10000009 3300005985 Bacteria 509286
459 Ga0081539_10000050 3300005985 Bacteria 269342
460 Ga0070717_10069535 3300006028 Bacteria 2932
461 Ga0070717_10072367 3300006028 Bacteria 2878
462 Ga0070717_10119917 3300006028 Bacteria 2252
463 Ga0075368_10006549 3300006042 Bacteria 4075
464 Ga0075363_100004637 3300006048 Bacteria 6041
465 Ga0075363_100120458 3300006048 Bacteria 1465
466 Ga0075432_10010802 3300006058 Bacteria 3102
467 Ga0075432_10029808 3300006058 Bacteria 1885
468 Ga0070715_10024198 3300006163 Bacteria 2389
469 Ga0070715_10044874 3300006163 Bacteria 1871
470 Ga0070715_10094892 3300006163 Bacteria 1380
471 Ga0070715_10140422 3300006163 Bacteria 1173
472 Ga0070716_100052718 3300006173 Bacteria 2317
473 Ga0070716_100127377 3300006173 Bacteria 1604
474 Ga0070716_100261377 3300006173 Bacteria 1184
475 Ga0070712_100002056 3300006175 Bacteria 12321
476 Ga0070712_100128812 3300006175 Bacteria 1915
477 Ga0075367_10002833 3300006178 Bacteria 8059
478 Ga0075367_10013912 3300006178 Bacteria 4342
479 Ga0075369_10019008 3300006186 Bacteria 2802
480 Ga0075366_10047800 3300006195 Bacteria 2536
481 Ga0097621_100000759 3300006237 Bacteria 22639
482 Ga0097621_100001085 3300006237 Bacteria 19020
483 Ga0097621_100042950 3300006237 Bacteria 3643
484 Ga0097621_100221503 3300006237 Bacteria 1649
485 Ga0075370_10003433 3300006353 Bacteria 7542
486 Ga0068871_100007090 3300006358 Bacteria 7988
487 Ga0068871_100086031 3300006358 Bacteria 2612
488 Ga0068871_100098256 3300006358 Bacteria 2449
489 Ga0075428_100000408 3300006844 Bacteria 42716
490 Ga0075428_100000845 3300006844 Bacteria 32138
491 Ga0075428_100001296 3300006844 Bacteria 26545
492 Ga0075428_100004737 3300006844 Bacteria 15068
493 Ga0075428_100024251 3300006844 Bacteria 6710
494 Ga0075428_100024996 3300006844 Bacteria 6608
495 Ga0075428_100042770 3300006844 Bacteria 4981
496 Ga0075428_100054078 3300006844 Bacteria 4399
497 Ga0075428_100074468 3300006844 Bacteria 3709
498 Ga0075428_100206429 3300006844 Bacteria 2123
499 Ga0075428_100206857 3300006844 Bacteria 2121
500 Ga0075428_100633212 3300006844 Bacteria 1141
501 Ga0075430_100000171 3300006846 Bacteria 42893
502 Ga0075430_100003321 3300006846 Bacteria 13481
503 Ga0075430_100013359 3300006846 Bacteria 6997
504 Ga0075430_100169460 3300006846 Unclassified 1816
505 Ga0075431_100004259 3300006847 Bacteria 14009
506 Ga0075431_100004533 3300006847 Bacteria 13639
507 Ga0075431_100006819 3300006847 Bacteria 11344
508 Ga0075431_100006845 3300006847 Bacteria 11323
509 Ga0075431_100027525 3300006847 Bacteria 5834
510 Ga0075431_100030460 3300006847 Bacteria 5558
511 Ga0075431_100043253 3300006847 Bacteria 4649
512 Ga0075431_100055122 3300006847 Bacteria 4100
513 Ga0075431_100136819 3300006847 Bacteria 2526
514 Ga0075431_100147474 3300006847 Bacteria 2424
515 Ga0075431_100296011 3300006847 Bacteria 1636
516 Ga0075431_100364087 3300006847 Bacteria 1452
517 Ga0075431_100386405 3300006847 Bacteria 1403
518 Ga0075431_100708872 3300006847 Bacteria 984
519 Ga0075433_10000463 3300006852 Bacteria 26380
520 Ga0075433_10001063 3300006852 Bacteria 19706
521 Ga0075433_10001343 3300006852 Bacteria 18014
522 Ga0075433_10002784 3300006852 Bacteria 13381
523 Ga0075433_10002853 3300006852 Bacteria 13240
524 Ga0075433_10007848 3300006852 Bacteria 8485
525 Ga0075433_10018059 3300006852 Bacteria 5855
526 Ga0075433_10020023 3300006852 Bacteria 5588
527 Ga0075433_10023475 3300006852 Bacteria 5192
528 Ga0075433_10034370 3300006852 Bacteria 4354
529 Ga0075433_10045911 3300006852 Bacteria 3799
530 Ga0075433_10065710 3300006852 Bacteria 3182
531 Ga0075433_10077665 3300006852 Bacteria 2924
532 Ga0075433_10106776 3300006852 Bacteria 2482
533 Ga0075433_10117157 3300006852 Bacteria 2363
534 Ga0075433_10122901 3300006852 Bacteria 2306
535 Ga0075433_10133924 3300006852 Bacteria 2202
536 Ga0075433_10335445 3300006852 Bacteria 1337
537 Ga0075433_10338480 3300006852 Bacteria 1330
538 Ga0075434_100000108 3300006871 Bacteria 47506
539 Ga0075434_100000254 3300006871 Bacteria 37644
540 Ga0075434_100000334 3300006871 Bacteria 33993
541 Ga0075434_100002157 3300006871 Bacteria 17135
542 Ga0075434_100008015 3300006871 Bacteria 9789
543 Ga0075434_100008287 3300006871 Bacteria 9654
544 Ga0075434_100018304 3300006871 Bacteria 6765
545 Ga0075434_100025321 3300006871 Bacteria 5805
546 Ga0075434_100056363 3300006871 Bacteria 3905
547 Ga0075434_100141207 3300006871 Unclassified 2428
548 Ga0075434_100142079 3300006871 Unclassified 2420
549 Ga0075434_100175523 3300006871 Bacteria 2162
550 Ga0075434_100208171 3300006871 Bacteria 1977
551 Ga0075434_100242980 3300006871 Bacteria 1820
552 Ga0075434_100259437 3300006871 Bacteria 1757
553 Ga0075434_100289132 3300006871 Bacteria 1659
554 Ga0075434_100394164 3300006871 Bacteria 1405
555 Ga0075434_100437123 3300006871 Bacteria 1330
556 Ga0075434_100492240 3300006871 Unclassified 1247
557 Ga0075429_100000225 3300006880 Bacteria 38302
558 Ga0075429_100000346 3300006880 Bacteria 33783
559 Ga0075429_100001131 3300006880 Bacteria 21511
560 Ga0075429_100007371 3300006880 Bacteria 9549
561 Ga0075429_100015108 3300006880 Bacteria 6692
562 Ga0075429_100021836 3300006880 Bacteria 5549
563 Ga0075429_100021963 3300006880 Bacteria 5533
564 Ga0075429_100027333 3300006880 Bacteria 4951
565 Ga0075429_100098284 3300006880 Bacteria 2554
566 Ga0075429_100100282 3300006880 Bacteria 2527
567 Ga0075429_100110012 3300006880 Bacteria 2409
568 Ga0075429_100323789 3300006880 Bacteria 1349
569 Ga0075429_100396352 3300006880 Bacteria 1209
570 Ga0075429_100539719 3300006880 Bacteria 1022
571 Ga0068865_100000559 3300006881 Bacteria 20688
572 Ga0068865_100000930 3300006881 Bacteria 16602
573 Ga0075436_100002541 3300006914 Bacteria 12559
574 Ga0075436_100004283 3300006914 Bacteria 9801
575 Ga0075436_100010957 3300006914 Bacteria 6224
576 Ga0075436_100031053 3300006914 Bacteria 3677
577 Ga0075436_100066997 3300006914 Bacteria 2482
578 Ga0075436_100102698 3300006914 Bacteria 1992
579 Ga0075436_100139638 3300006914 Bacteria 1702
580 Ga0097620_100000922 3300006931 Bacteria 30115
581 Ga0097620_100003441 3300006931 Bacteria 16089
582 Ga0097620_100003746 3300006931 Bacteria 15499
583 Ga0097620_100080520 3300006931 Bacteria 3298
584 Ga0099825_1020622 3300006941 Bacteria 4645
585 Ga0099824_1023517 3300006942 Bacteria 3803
586 Ga0099823_1000128 3300006944 Bacteria 38804
587 Ga0099823_1058804 3300006944 Bacteria 2067
588 Ga0075435_100000853 3300007076 Bacteria 19069
589 Ga0075435_100001299 3300007076 Bacteria 16064
590 Ga0075435_100004427 3300007076 Bacteria 9645
591 Ga0075435_100007437 3300007076 Bacteria 7802
592 Ga0075435_100009431 3300007076 Bacteria 7066
593 Ga0075435_100015104 3300007076 Bacteria 5796
594 Ga0075435_100046588 3300007076 Bacteria 3478
595 Ga0075435_100047859 3300007076 Bacteria 3434
596 Ga0075435_100053225 3300007076 Bacteria 3264
597 Ga0075435_100057985 3300007076 Bacteria 3134
598 Ga0075435_100102358 3300007076 Bacteria 2374
599 Ga0075435_100113919 3300007076 Bacteria 2251
600 Ga0075435_100126440 3300007076 Bacteria 2137
601 Ga0075435_100141648 3300007076 Bacteria 2017
602 Ga0075435_100155698 3300007076 Bacteria 1922
603 Ga0075435_100164909 3300007076 Bacteria 1868
604 Ga0075435_100168835 3300007076 Bacteria 1845
605 Ga0075435_100376780 3300007076 Bacteria 1219
606 Ga0099794_10001793 3300007265 Bacteria 7664
607 Ga0099794_10008570 3300007265 Bacteria 4255
608 Ga0099794_10114268 3300007265 Bacteria 1355
609 Ga0099795_10016540 3300007788 Bacteria 2334
610 Ga0105251_10165515 3300009011 Bacteria 997
611 Ga0105250_10066318 3300009092 Bacteria 1455
612 Ga0105250_10094965 3300009092 Bacteria 1215
613 Ga0105240_10006885 3300009093 Bacteria 16614
614 Ga0105240_10015833 3300009093 Bacteria 10230
615 Ga0105240_10016614 3300009093 Bacteria 9954
616 Ga0105240_10034365 3300009093 Bacteria 6539
617 Ga0105240_10041691 3300009093 Bacteria 5855
618 Ga0105240_10076166 3300009093 Bacteria 4136
619 Ga0105240_10122811 3300009093 Bacteria 3125
620 Ga0105240_10138896 3300009093 Bacteria 2907
621 Ga0105240_10571891 3300009093 Bacteria 1248
622 Ga0105240_10762969 3300009093 Bacteria 1051
623 Ga0111539_10001057 3300009094 Bacteria 36241
624 Ga0111539_10001170 3300009094 Bacteria 34759
625 Ga0111539_10004319 3300009094 Bacteria 18605
626 Ga0111539_10024524 3300009094 Bacteria 7398
627 Ga0111539_10027825 3300009094 Bacteria 6904
628 Ga0111539_10051679 3300009094 Bacteria 4894
629 Ga0111539_10169149 3300009094 Bacteria 2554
630 Ga0105245_10006295 3300009098 Bacteria 10449
631 Ga0105245_10034774 3300009098 Bacteria 4470
632 Ga0105245_10070145 3300009098 Bacteria 3180
633 Ga0105247_10000624 3300009101 Bacteria 28468
634 Ga0105247_10052380 3300009101 Bacteria 2516
635 Ga0114129_10000078 3300009147 Bacteria 89074
636 Ga0114129_10000647 3300009147 Bacteria 43515
637 Ga0114129_10003138 3300009147 Bacteria 23195
638 Ga0114129_10005151 3300009147 Bacteria 18403
639 Ga0114129_10011047 3300009147 Bacteria 12862
640 Ga0114129_10011177 3300009147 Bacteria 12799
641 Ga0114129_10023163 3300009147 Bacteria 8808
642 Ga0114129_10028852 3300009147 Bacteria 7862
643 Ga0114129_10031475 3300009147 Bacteria 7499
644 Ga0114129_10035540 3300009147 Bacteria 7039
645 Ga0114129_10041394 3300009147 Bacteria 6492
646 Ga0114129_10046047 3300009147 Bacteria 6131
647 Ga0114129_10050508 3300009147 Bacteria 5841
648 Ga0114129_10051683 3300009147 Bacteria 5769
649 Ga0114129_10061146 3300009147 Bacteria 5264
650 Ga0114129_10074005 3300009147 Bacteria 4745
651 Ga0114129_10082125 3300009147 Bacteria 4478
652 Ga0114129_10141082 3300009147 Unclassified 3303
653 Ga0114129_10159383 3300009147 Bacteria 3084
654 Ga0114129_10165753 3300009147 Bacteria 3015
655 Ga0114129_10191107 3300009147 Bacteria 2780
656 Ga0114129_10236233 3300009147 Bacteria 2459
657 Ga0114129_10267453 3300009147 Bacteria 2288
658 Ga0114129_10288043 3300009147 Bacteria 2192
659 Ga0114129_10378543 3300009147 Bacteria 1870
660 Ga0114129_10380358 3300009147 Bacteria 1865
661 Ga0114129_10466017 3300009147 Bacteria 1655
662 Ga0114129_10672716 3300009147 Bacteria 1334
663 Ga0114129_10776426 3300009147 Bacteria 1224
664 Ga0114129_11063869 3300009147 Bacteria 1015
665 Ga0105243_10019362 3300009148 Bacteria 5161
666 Ga0105243_10148238 3300009148 Bacteria 2010
667 Ga0105243_10242548 3300009148 Bacteria 1604
668 Ga0105243_10256811 3300009148 Bacteria 1563
669 Ga0105241_10002193 3300009174 Bacteria 14692
670 Ga0105241_10008159 3300009174 Bacteria 7712
671 Ga0105241_10036676 3300009174 Bacteria 3690
672 Ga0105241_10040391 3300009174 Bacteria 3522
673 Ga0105241_10211180 3300009174 Bacteria 1626
674 Ga0105241_10547217 3300009174 Bacteria 1039
675 Ga0105242_10003732 3300009176 Bacteria 11834
676 Ga0105242_10018910 3300009176 Bacteria 5395
677 Ga0105242_10338281 3300009176 Bacteria 1386
678 Ga0105242_10537723 3300009176 Unclassified 1118
679 Ga0105248_10005783 3300009177 Bacteria 13592
680 Ga0105248_10018623 3300009177 Bacteria 7676
681 Ga0105248_10161216 3300009177 Bacteria 2529
682 Ga0105248_10335375 3300009177 Bacteria 1703
683 Ga0105248_10860817 3300009177 Bacteria 1023
684 Ga0105248_10999824 3300009177 Bacteria 945
685 Ga0105237_10004564 3300009545 Bacteria 15987
686 Ga0105237_10005302 3300009545 Bacteria 14581
687 Ga0105237_10010552 3300009545 Bacteria 9816
688 Ga0105237_10384842 3300009545 Bacteria 1408
689 Ga0105238_10001448 3300009551 Bacteria 23857
690 Ga0105238_10005185 3300009551 Bacteria 12878
691 Ga0105238_10021802 3300009551 Bacteria 6525
692 Ga0105238_10032523 3300009551 Bacteria 5308
693 Ga0105238_10066801 3300009551 Bacteria 3597
694 Ga0105238_10071906 3300009551 Bacteria 3456
695 Ga0105238_10091688 3300009551 Bacteria 3026
696 Ga0105238_10144966 3300009551 Bacteria 2351
697 Ga0105238_10188537 3300009551 Bacteria 2038
698 Ga0105238_10340837 3300009551 Bacteria 1487
699 Ga0105238_10487216 3300009551 Bacteria 1233
700 Ga0105249_10000377 3300009553 Bacteria 44267
701 Ga0105249_10069822 3300009553 Bacteria 3243
702 Ga0105249_10138943 3300009553 Bacteria 2327
703 Ga0105249_10315842 3300009553 Bacteria 1572
704 Ga0105239_10001843 3300010375 Bacteria 27745
705 Ga0105239_10004343 3300010375 Bacteria 16985
706 Ga0105239_10009890 3300010375 Bacteria 10713
707 Ga0105239_10024954 3300010375 Bacteria 6585
708 Ga0105239_10042764 3300010375 Bacteria 4964
709 Ga0105239_10408794 3300010375 Bacteria 1536
710 Ga0105239_10622201 3300010375 Bacteria 1232
711 Ga0105239_10842581 3300010375 Bacteria 1051
712 Ga0105246_10013792 3300011119 Bacteria 5072
713 Ga0105246_10078125 3300011119 Bacteria 2350
714 Ga0105246_10109617 3300011119 Bacteria 2026
715 Ga0157373_10000570 3300013100 Bacteria 28793
716 Ga0157373_10004632 3300013100 Bacteria 10348
717 Ga0157373_10077955 3300013100 Bacteria 2337
718 Ga0157373_10249385 3300013100 Bacteria 1255
719 Ga0157371_10011116 3300013102 Bacteria 6967
720 Ga0157371_10079804 3300013102 Bacteria 2317
721 Ga0157371_10087262 3300013102 Bacteria 2209
722 Ga0157370_10008438 3300013104 Bacteria 11112
723 Ga0157370_10017355 3300013104 Bacteria 7264
724 Ga0157370_10028283 3300013104 Bacteria 5517
725 Ga0157370_10034757 3300013104 Bacteria 4904
726 Ga0157370_10107650 3300013104 Bacteria 2607
727 Ga0157370_10168490 3300013104 Bacteria 2036
728 Ga0157370_10185705 3300013104 Bacteria 1930
729 Ga0157370_10595088 3300013104 Bacteria 1013
730 Ga0157369_10004244 3300013105 Bacteria 16973
731 Ga0157369_10006108 3300013105 Bacteria 13978
732 Ga0157369_10027133 3300013105 Bacteria 6350
733 Ga0157369_10060657 3300013105 Bacteria 4079
734 Ga0157369_10063202 3300013105 Bacteria 3989
735 Ga0157369_10154247 3300013105 Bacteria 2427
736 Ga0157369_10369585 3300013105 Bacteria 1489
737 Ga0171462_1010 3300013250 Bacteria 310590
738 Ga0157374_10002036 3300013296 Bacteria 16983
739 Ga0157374_10106764 3300013296 Bacteria 2690
740 Ga0157374_10248243 3300013296 Bacteria 1751
741 Ga0157374_10568598 3300013296 Bacteria 1142
742 Ga0157378_10001955 3300013297 Bacteria 18469
743 Ga0157378_10115507 3300013297 Bacteria 2466
744 Ga0157378_10145455 3300013297 Unclassified 2204
745 Ga0157378_10169432 3300013297 Bacteria 2047
746 Ga0157378_10186437 3300013297 Bacteria 1954
747 Ga0157378_10479410 3300013297 Bacteria 1239
748 Ga0157378_10521378 3300013297 Bacteria 1190
749 Ga0157378_10612377 3300013297 Bacteria 1101
750 Ga0163162_10002791 3300013306 Bacteria 16602
751 Ga0163162_10121379 3300013306 Bacteria 2718
752 Ga0163162_10230539 3300013306 Bacteria 1982
753 Ga0157372_10000301 3300013307 Bacteria 54965
754 Ga0157372_10012527 3300013307 Bacteria 9031
755 Ga0157372_10034066 3300013307 Bacteria 5596
756 Ga0157372_10046229 3300013307 Bacteria 4832
757 Ga0157372_10082146 3300013307 Bacteria 3648
758 Ga0157372_10181770 3300013307 Bacteria 2435
759 Ga0157372_10193795 3300013307 Bacteria 2354
760 Ga0157372_10234839 3300013307 Bacteria 2127
761 Ga0157372_10236084 3300013307 Bacteria 2121
762 Ga0157372_10316620 3300013307 Bacteria 1817
763 Ga0157372_10381984 3300013307 Bacteria 1641
764 Ga0157375_10011397 3300013308 Bacteria 7848
765 Ga0157375_10106572 3300013308 Bacteria 2895
766 Ga0157375_10262058 3300013308 Bacteria 1890
767 Ga0157375_10288873 3300013308 Bacteria 1803
768 Ga0157375_10455684 3300013308 Bacteria 1444
769 Ga0157375_10608223 3300013308 Bacteria 1252
770 Ga0163163_10005187 3300014325 Bacteria 11237
771 Ga0163163_10057253 3300014325 Bacteria 3853
772 Ga0163163_10549775 3300014325 Bacteria 1217
773 Ga0157380_10045262 3300014326 Bacteria 3452
774 Ga0157380_10061096 3300014326 Bacteria 3014
775 Ga0182008_10058318 3300014497 Bacteria 1906
776 Ga0157377_10000487 3300014745 Bacteria 17027
777 Ga0157379_10001956 3300014968 Bacteria 17045
778 Ga0157379_10232011 3300014968 Bacteria 1673
779 Ga0157379_10296756 3300014968 Bacteria 1472
780 Ga0157376_10023541 3300014969 Bacteria 4821
781 Ga0157376_10059239 3300014969 Bacteria 3211
782 Ga0157376_10359748 3300014969 Bacteria 1395
783 Ga0183362_10002 3300015683 Bacteria 1432711
784 Ga0163161_10531976 3300017792 Bacteria 961
785 Ga0206350_11519533 3300020080 Bacteria 1809
786 Ga0213876_10060995 3300021384 Bacteria 1990
787 Ga0213875_10000138 3300021388 Bacteria 79866
788 Ga0224712_10001625 3300022467 Bacteria 5277
789 Ga0209758_1003658 3300025297 Bacteria 13702
790 Ga0207697_10000586 3300025315 Bacteria 20751
791 Ga0207656_10001746 3300025321 Bacteria 7230
792 Ga0207696_1040276 3300025711 Bacteria 1369
793 Ga0207653_10005965 3300025885 Bacteria 3800
794 Ga0207653_10015367 3300025885 Bacteria 2402
795 Ga0207653_10064520 3300025885 Bacteria 1242
796 Ga0207682_10000732 3300025893 Bacteria 15240
797 Ga0207692_10006422 3300025898 Bacteria 4764
798 Ga0207692_10011005 3300025898 Bacteria 3830
799 Ga0207692_10114809 3300025898 Bacteria 1499
800 Ga0207692_10211044 3300025898 Bacteria 1146
801 Ga0207642_10000359 3300025899 Bacteria 13680
802 Ga0207642_10182080 3300025899 Bacteria 1146
803 Ga0207710_10002087 3300025900 Bacteria 9456
804 Ga0207710_10184402 3300025900 Bacteria 1025
805 Ga0207688_10000079 3300025901 Bacteria 36923
806 Ga0207688_10007444 3300025901 Bacteria 5955
807 Ga0207688_10015832 3300025901 Bacteria 4091
808 Ga0207688_10183245 3300025901 Bacteria 1249
809 Ga0207680_10001014 3300025903 Bacteria 13234
810 Ga0207647_10010432 3300025904 Bacteria 6563
811 Ga0207647_10042222 3300025904 Bacteria 2862
812 Ga0207647_10073786 3300025904 Bacteria 2056
813 Ga0207685_10018781 3300025905 Bacteria 2265
814 Ga0207685_10021799 3300025905 Bacteria 2153
815 Ga0207699_10271853 3300025906 Bacteria 1175
816 Ga0207699_10378025 3300025906 Bacteria 1005
817 Ga0207645_10000016 3300025907 Bacteria 114058
818 Ga0207645_10001153 3300025907 Bacteria 21836
819 Ga0207645_10150527 3300025907 Bacteria 1519
820 Ga0207643_10000010 3300025908 Bacteria 159218
821 Ga0207643_10000223 3300025908 Bacteria 39814
822 Ga0207643_10036559 3300025908 Bacteria 2754
823 Ga0207705_10013498 3300025909 Bacteria 5893
824 Ga0207705_10044608 3300025909 Bacteria 3186
825 Ga0207705_10069252 3300025909 Bacteria 2555
826 Ga0207705_10093956 3300025909 Bacteria 2199
827 Ga0207684_10000045 3300025910 Bacteria 253128
828 Ga0207684_10000410 3300025910 Bacteria 57371
829 Ga0207684_10000470 3300025910 Bacteria 52370
830 Ga0207684_10003453 3300025910 Bacteria 15416
831 Ga0207684_10006083 3300025910 Bacteria 11039
832 Ga0207684_10008090 3300025910 Bacteria 9376
833 Ga0207684_10010224 3300025910 Bacteria 8260
834 Ga0207684_10010712 3300025910 Bacteria 8054
835 Ga0207684_10012128 3300025910 Bacteria 7502
836 Ga0207684_10016995 3300025910 Bacteria 6250
837 Ga0207684_10020217 3300025910 Bacteria 5687
838 Ga0207684_10025353 3300025910 Bacteria 5052
839 Ga0207684_10034918 3300025910 Bacteria 4271
840 Ga0207684_10039731 3300025910 Bacteria 3989
841 Ga0207684_10045817 3300025910 Bacteria 3709
842 Ga0207684_10052864 3300025910 Bacteria 3448
843 Ga0207684_10052883 3300025910 Bacteria 3448
844 Ga0207684_10067076 3300025910 Bacteria 3048
845 Ga0207684_10124086 3300025910 Bacteria 2215
846 Ga0207684_10162524 3300025910 Bacteria 1923
847 Ga0207684_10185803 3300025910 Bacteria 1792
848 Ga0207684_10188241 3300025910 Bacteria 1780
849 Ga0207684_10248042 3300025910 Bacteria 1536
850 Ga0207684_10354812 3300025910 Bacteria 1262
851 Ga0207684_10414983 3300025910 Bacteria 1157
852 Ga0207654_10001320 3300025911 Bacteria 13217
853 Ga0207654_10002865 3300025911 Bacteria 8748
854 Ga0207654_10005966 3300025911 Bacteria 6129
855 Ga0207707_10000256 3300025912 Bacteria 58159
856 Ga0207707_10000597 3300025912 Bacteria 36412
857 Ga0207707_10001468 3300025912 Bacteria 21818
858 Ga0207707_10004819 3300025912 Bacteria 11832
859 Ga0207707_10020291 3300025912 Bacteria 5801
860 Ga0207707_10039738 3300025912 Bacteria 4112
861 Ga0207707_10073926 3300025912 Bacteria 2973
862 Ga0207707_10096678 3300025912 Bacteria 2581
863 Ga0207707_10110316 3300025912 Bacteria 2404
864 Ga0207707_10111165 3300025912 Bacteria 2395
865 Ga0207707_10113428 3300025912 Bacteria 2369
866 Ga0207707_10177441 3300025912 Bacteria 1861
867 Ga0207707_10230402 3300025912 Bacteria 1612
868 Ga0207707_10246670 3300025912 Bacteria 1552
869 Ga0207707_10259908 3300025912 Bacteria 1507
870 Ga0207707_10512760 3300025912 Bacteria 1022
871 Ga0207695_10010900 3300025913 Bacteria 11062
872 Ga0207695_10016676 3300025913 Bacteria 8584
873 Ga0207695_10042569 3300025913 Bacteria 4849
874 Ga0207695_10157997 3300025913 Bacteria 2201
875 Ga0207695_10175264 3300025913 Bacteria 2067
876 Ga0207695_10226032 3300025913 Bacteria 1778
877 Ga0207671_10011341 3300025914 Bacteria 7260
878 Ga0207671_10027706 3300025914 Bacteria 4235
879 Ga0207671_10035256 3300025914 Bacteria 3714
880 Ga0207671_10043101 3300025914 Bacteria 3337
881 Ga0207671_10085250 3300025914 Bacteria 2373
882 Ga0207671_10107174 3300025914 Bacteria 2122
883 Ga0207671_10424550 3300025914 Bacteria 1058
884 Ga0207693_10008258 3300025915 Bacteria 8526
885 Ga0207693_10032378 3300025915 Bacteria 4127
886 Ga0207693_10053937 3300025915 Bacteria 3154
887 Ga0207693_10079514 3300025915 Bacteria 2566
888 Ga0207693_10296711 3300025915 Bacteria 1266
889 Ga0207693_10320436 3300025915 Bacteria 1213
890 Ga0207663_10023184 3300025916 Bacteria 3558
891 Ga0207663_10031629 3300025916 Bacteria 3134
892 Ga0207663_10104392 3300025916 Bacteria 1911
893 Ga0207663_10199570 3300025916 Bacteria 1442
894 Ga0207663_10351950 3300025916 Bacteria 1115
895 Ga0207660_10000031 3300025917 Bacteria 66315
896 Ga0207660_10000053 3300025917 Bacteria 59218
897 Ga0207660_10022563 3300025917 Bacteria 4242
898 Ga0207660_10026280 3300025917 Bacteria 3963
899 Ga0207660_10055327 3300025917 Bacteria 2835
900 Ga0207660_10088122 3300025917 Bacteria 2294
901 Ga0207660_10093117 3300025917 Bacteria 2238
902 Ga0207660_10103372 3300025917 Bacteria 2131
903 Ga0207660_10163796 3300025917 Bacteria 1718
904 Ga0207660_10247654 3300025917 Bacteria 1406
905 Ga0207662_10000127 3300025918 Bacteria 36567
906 Ga0207662_10000131 3300025918 Bacteria 35953
907 Ga0207662_10163303 3300025918 Unclassified 1424
908 Ga0207662_10240524 3300025918 Bacteria 1185
909 Ga0207657_10000060 3300025919 Bacteria 101953
910 Ga0207657_10000591 3300025919 Bacteria 38405
911 Ga0207657_10000939 3300025919 Bacteria 30838
912 Ga0207657_10022238 3300025919 Bacteria 5943
913 Ga0207657_10090609 3300025919 Bacteria 2552
914 Ga0207657_10119039 3300025919 Bacteria 2174
915 Ga0207657_10237207 3300025919 Bacteria 1457
916 Ga0207657_10285908 3300025919 Bacteria 1308
917 Ga0207657_10403484 3300025919 Bacteria 1075
918 Ga0207649_10003363 3300025920 Bacteria 8750
919 Ga0207649_10335541 3300025920 Bacteria 1115
920 Ga0207652_10004397 3300025921 Bacteria 11480
921 Ga0207652_10007393 3300025921 Bacteria 8856
922 Ga0207652_10012252 3300025921 Bacteria 6927
923 Ga0207652_10015642 3300025921 Bacteria 6176
924 Ga0207652_10020524 3300025921 Bacteria 5442
925 Ga0207652_10020672 3300025921 Bacteria 5425
926 Ga0207652_10023164 3300025921 Bacteria 5142
927 Ga0207652_10074122 3300025921 Bacteria 2963
928 Ga0207652_10107569 3300025921 Bacteria 2470
929 Ga0207652_10206760 3300025921 Bacteria 1767
930 Ga0207652_10221738 3300025921 Bacteria 1704
931 Ga0207652_10223843 3300025921 Bacteria 1695
932 Ga0207646_10000188 3300025922 Bacteria 84349
933 Ga0207646_10001491 3300025922 Bacteria 28771
934 Ga0207646_10003035 3300025922 Bacteria 19317
935 Ga0207646_10007481 3300025922 Bacteria 11088
936 Ga0207646_10017237 3300025922 Bacteria 6765
937 Ga0207646_10017777 3300025922 Bacteria 6643
938 Ga0207646_10020895 3300025922 Bacteria 6057
939 Ga0207646_10021045 3300025922 Bacteria 6032
940 Ga0207646_10027508 3300025922 Bacteria 5187
941 Ga0207646_10044097 3300025922 Bacteria 4003
942 Ga0207646_10046854 3300025922 Bacteria 3879
943 Ga0207646_10061789 3300025922 Bacteria 3343
944 Ga0207646_10061921 3300025922 Unclassified 3340
945 Ga0207646_10076856 3300025922 Bacteria 2984
946 Ga0207646_10135886 3300025922 Bacteria 2214
947 Ga0207646_10149658 3300025922 Bacteria 2105
948 Ga0207646_10151724 3300025922 Bacteria 2090
949 Ga0207646_10316057 3300025922 Unclassified 1411
950 Ga0207646_10373305 3300025922 Bacteria 1288
951 Ga0207646_10723365 3300025922 Bacteria 889
952 Ga0207681_10012767 3300025923 Bacteria 5189
953 Ga0207681_10015677 3300025923 Bacteria 4730
954 Ga0207694_10004715 3300025924 Bacteria 10606
955 Ga0207694_10041843 3300025924 Bacteria 3532
956 Ga0207694_10050844 3300025924 Bacteria 3212
957 Ga0207694_10138929 3300025924 Bacteria 1953
958 Ga0207694_10140257 3300025924 Bacteria 1943
959 Ga0207650_10000179 3300025925 Bacteria 74527
960 Ga0207650_10003354 3300025925 Bacteria 11015
961 Ga0207659_10000928 3300025926 Bacteria 17477
962 Ga0207659_10158621 3300025926 Bacteria 1774
963 Ga0207659_10161170 3300025926 Bacteria 1761
964 Ga0207687_10003702 3300025927 Bacteria 10287
965 Ga0207687_10003864 3300025927 Bacteria 10056
966 Ga0207687_10037708 3300025927 Bacteria 3299
967 Ga0207700_10049700 3300025928 Bacteria 3121
968 Ga0207700_10061770 3300025928 Bacteria 2843
969 Ga0207700_10080767 3300025928 Bacteria 2537
970 Ga0207700_10082049 3300025928 Bacteria 2520
971 Ga0207664_10149108 3300025929 Bacteria 1986
972 Ga0207664_10154601 3300025929 Bacteria 1952
973 Ga0207664_10176071 3300025929 Bacteria 1834
974 Ga0207664_10232178 3300025929 Bacteria 1604
975 Ga0207644_10000932 3300025931 Bacteria 18591
976 Ga0207690_10001609 3300025932 Bacteria 14062
977 Ga0207690_10008839 3300025932 Bacteria 5977
978 Ga0207690_10065440 3300025932 Bacteria 2486
979 Ga0207706_10000132 3300025933 Bacteria 81128
980 Ga0207706_10001694 3300025933 Bacteria 21743
981 Ga0207706_10017386 3300025933 Bacteria 6478
982 Ga0207706_10099532 3300025933 Bacteria 2558
983 Ga0207686_10004545 3300025934 Bacteria 7437
984 Ga0207686_10015082 3300025934 Bacteria 4315
985 Ga0207709_10033746 3300025935 Bacteria 3009
986 Ga0207709_10151495 3300025935 Bacteria 1607
987 Ga0207709_10257475 3300025935 Bacteria 1278
988 Ga0207670_10000085 3300025936 Bacteria 64040
989 Ga0207670_10003537 3300025936 Bacteria 8289
990 Ga0207669_10002824 3300025937 Bacteria 7444
991 Ga0207669_10030551 3300025937 Bacteria 2995
992 Ga0207704_10000778 3300025938 Bacteria 14038
993 Ga0207665_10001562 3300025939 Bacteria 15439
994 Ga0207665_10106369 3300025939 Bacteria 1966
995 Ga0207665_10130960 3300025939 Bacteria 1781
996 Ga0207665_10254221 3300025939 Bacteria 1299
997 Ga0207691_10000011 3300025940 Bacteria 147984
998 Ga0207711_10000230 3300025941 Bacteria 59916
999 Ga0207711_10082750 3300025941 Bacteria 2806
1000 Ga0207689_10000011 3300025942 Bacteria 123627
1001 Ga0207689_10000101 3300025942 Bacteria 69326
1002 Ga0207689_10002025 3300025942 Bacteria 19154
1003 Ga0207689_10007129 3300025942 Bacteria 9830
1004 Ga0207689_10009309 3300025942 Bacteria 8494
1005 Ga0207661_10005278 3300025944 Bacteria 9096
1006 Ga0207661_10014442 3300025944 Bacteria 5789
1007 Ga0207661_10029121 3300025944 Bacteria 4237
1008 Ga0207661_10037002 3300025944 Bacteria 3814
1009 Ga0207661_10632494 3300025944 Bacteria 983
1010 Ga0207679_10000657 3300025945 Bacteria 23160
1011 Ga0207679_10002689 3300025945 Bacteria 10980
1012 Ga0207679_10056913 3300025945 Bacteria 2890
1013 Ga0207679_10305688 3300025945 Bacteria 1372
1014 Ga0207667_10002318 3300025949 Bacteria 23847
1015 Ga0207667_10003375 3300025949 Bacteria 19706
1016 Ga0207667_10007621 3300025949 Bacteria 12970
1017 Ga0207667_10055567 3300025949 Bacteria 4161
1018 Ga0207667_10057159 3300025949 Bacteria 4096
1019 Ga0207667_10129620 3300025949 Bacteria 2598
1020 Ga0207667_10359265 3300025949 Bacteria 1485
1021 Ga0207667_10570502 3300025949 Bacteria 1143
1022 Ga0207651_10000153 3300025960 Bacteria 30072
1023 Ga0207651_10017085 3300025960 Bacteria 4275
1024 Ga0207712_10001891 3300025961 Bacteria 13765
1025 Ga0207712_10013685 3300025961 Bacteria 5202
1026 Ga0207712_10056122 3300025961 Bacteria 2774
1027 Ga0207712_10079422 3300025961 Bacteria 2383
1028 Ga0207712_10324783 3300025961 Bacteria 1271
1029 Ga0207668_10001052 3300025972 Bacteria 16458
1030 Ga0207668_10014099 3300025972 Bacteria 4942
1031 Ga0207640_10001312 3300025981 Bacteria 13481
1032 Ga0207640_10021723 3300025981 Bacteria 3829
1033 Ga0207640_10045142 3300025981 Bacteria 2828
1034 Ga0207640_10055541 3300025981 Bacteria 2594
1035 Ga0207640_10109691 3300025981 Bacteria 1953
1036 Ga0207640_10468238 3300025981 Bacteria 1042
1037 Ga0207658_10000879 3300025986 Bacteria 25016
1038 Ga0207677_10000827 3300026023 Bacteria 17714
1039 Ga0207677_10010080 3300026023 Bacteria 5334
1040 Ga0207703_10000850 3300026035 Bacteria 29911
1041 Ga0207703_10021851 3300026035 Bacteria 5010
1042 Ga0207703_10149455 3300026035 Bacteria 2035
1043 Ga0207703_10281580 3300026035 Bacteria 1510
1044 Ga0207703_10563541 3300026035 Bacteria 1075
1045 Ga0207639_10000440 3300026041 Bacteria 28739
1046 Ga0207639_10000807 3300026041 Bacteria 21296
1047 Ga0207639_10106494 3300026041 Bacteria 2276
1048 Ga0207639_10173180 3300026041 Bacteria 1830
1049 Ga0207639_10197678 3300026041 Bacteria 1722
1050 Ga0207639_10236098 3300026041 Bacteria 1587
1051 Ga0207639_10359250 3300026041 Bacteria 1303
1052 Ga0207639_10649786 3300026041 Bacteria 976
1053 Ga0207678_10000667 3300026067 Bacteria 31484
1054 Ga0207678_10018491 3300026067 Bacteria 6120
1055 Ga0207678_10096951 3300026067 Bacteria 2520
1056 Ga0207678_10174905 3300026067 Bacteria 1833
1057 Ga0207678_10274447 3300026067 Bacteria 1446
1058 Ga0207708_10000183 3300026075 Bacteria 49256
1059 Ga0207708_10007415 3300026075 Bacteria 8105
1060 Ga0207708_10423420 3300026075 Bacteria 1104
1061 Ga0207702_10000390 3300026078 Bacteria 50020
1062 Ga0207702_10002958 3300026078 Bacteria 15850
1063 Ga0207702_10005017 3300026078 Bacteria 11630
1064 Ga0207702_10093233 3300026078 Bacteria 2641
1065 Ga0207702_10184688 3300026078 Bacteria 1922
1066 Ga0207702_10264033 3300026078 Bacteria 1622
1067 Ga0207702_10597960 3300026078 Bacteria 1082
1068 Ga0207702_10806026 3300026078 Bacteria 928
1069 Ga0207641_10001606 3300026088 Bacteria 22063
1070 Ga0207641_10028847 3300026088 Bacteria 4587
1071 Ga0207641_10158136 3300026088 Bacteria 2058
1072 Ga0207641_10785855 3300026088 Bacteria 941
1073 Ga0207648_10000258 3300026089 Bacteria 57424
1074 Ga0207648_10001400 3300026089 Bacteria 26519
1075 Ga0207648_10006238 3300026089 Bacteria 11871
1076 Ga0207648_10257595 3300026089 Unclassified 1556
1077 Ga0207648_10311727 3300026089 Bacteria 1412
1078 Ga0207648_10414174 3300026089 Bacteria 1223
1079 Ga0207676_10001725 3300026095 Bacteria 16107
1080 Ga0207676_10071587 3300026095 Bacteria 2784
1081 Ga0207674_10000921 3300026116 Bacteria 38304
1082 Ga0207674_10001878 3300026116 Bacteria 26750
1083 Ga0207674_10015960 3300026116 Bacteria 8228
1084 Ga0207674_10058994 3300026116 Bacteria 3885
1085 Ga0207674_10080518 3300026116 Bacteria 3260
1086 Ga0207674_10293433 3300026116 Bacteria 1574
1087 Ga0207674_10326622 3300026116 Bacteria 1484
1088 Ga0207674_10538390 3300026116 Bacteria 1128
1089 Ga0207675_100000164 3300026118 Bacteria 58951
1090 Ga0207675_100000987 3300026118 Bacteria 28194
1091 Ga0207675_100015565 3300026118 Bacteria 7094
1092 Ga0207675_100415266 3300026118 Bacteria 1328
1093 Ga0207683_10000384 3300026121 Bacteria 40812
1094 Ga0207683_10390451 3300026121 Bacteria 1280
1095 Ga0207683_10471191 3300026121 Bacteria 1158
1096 Ga0207698_10004492 3300026142 Bacteria 8513
1097 Ga0207698_10005122 3300026142 Bacteria 8056
1098 Ga0207698_10032840 3300026142 Bacteria 3765
1099 Ga0207698_10058473 3300026142 Bacteria 2988
1100 Ga0207698_10072393 3300026142 Bacteria 2740
1101 Ga0207698_10339815 3300026142 Bacteria 1414
1102 Ga0207698_10489164 3300026142 Bacteria 1195
1103 Ga0209389_1000009 3300027296 Bacteria 226873
1104 Ga0209389_1000223 3300027296 Bacteria 38812
1105 Ga0209489_100050 3300027361 Bacteria 154669
1106 Ga0209489_102324 3300027361 Bacteria 38812
1107 Ga0209700_100016 3300027363 Bacteria 252567
1108 Ga0209700_102324 3300027363 Bacteria 38812
1109 Ga0209984_1000425 3300027424 Bacteria 4594
1110 Ga0210000_1004956 3300027462 Bacteria 1928
1111 Ga0209995_1001020 3300027471 Bacteria 4307
1112 Ga0209179_1011376 3300027512 Bacteria 1575
1113 Ga0209968_1013459 3300027526 Bacteria 1284
1114 Ga0209982_1009091 3300027552 Bacteria 1464
1115 Ga0209970_1000283 3300027614 Bacteria 8406
1116 Ga0209970_1000473 3300027614 Bacteria 6869
1117 Ga0210002_1001740 3300027617 Bacteria 3108
1118 Ga0209983_1001943 3300027665 Bacteria 4582
1119 Ga0209983_1008900 3300027665 Bacteria 2051
1120 Ga0209588_1005030 3300027671 Bacteria 3765
1121 Ga0209588_1036620 3300027671 Bacteria 1579
1122 Ga0209971_1000022 3300027682 Bacteria 56932
1123 Ga0209971_1000156 3300027682 Bacteria 20200
1124 Ga0209966_1000165 3300027695 Bacteria 27721
1125 Ga0209966_1000218 3300027695 Bacteria 22793
1126 Ga0209966_1013850 3300027695 Bacteria 1499
1127 Ga0209998_10000457 3300027717 Bacteria 11345
1128 Ga0209998_10001306 3300027717 Bacteria 6094
1129 Ga0209998_10016265 3300027717 Bacteria 1565
1130 Ga0209974_10001842 3300027876 Bacteria 7737
1131 Ga0209974_10003147 3300027876 Bacteria 5975
1132 Ga0209974_10030644 3300027876 Bacteria 1782
1133 Ga0207428_10000029 3300027907 Bacteria 241338
1134 Ga0207428_10000138 3300027907 Bacteria 98359
1135 Ga0207428_10008713 3300027907 Bacteria 9154
1136 Ga0207428_10293342 3300027907 Bacteria 1204
1137 Ga0268266_10000550 3300028379 Bacteria 52292
1138 Ga0268266_10006468 3300028379 Bacteria 10723
1139 Ga0268266_10017659 3300028379 Bacteria 6083
1140 Ga0268265_10000749 3300028380 Bacteria 31597
1141 Ga0268265_10087156 3300028380 Bacteria 2483
1142 Ga0268265_10155279 3300028380 Bacteria 1935
1143 Ga0268265_10177159 3300028380 Bacteria 1828
1144 Ga0268264_10000825 3300028381 Bacteria 33267
1145 Ga0268264_10006152 3300028381 Bacteria 10136
1146 Ga0268264_10017806 3300028381 Bacteria 5816
1147 Ga0268264_10095232 3300028381 Bacteria 2576
1148 Ga0268264_10139012 3300028381 Unclassified 2163
1149 Ga0268264_10400777 3300028381 Bacteria 1318
1150 Ga0268264_10488412 3300028381 Bacteria 1199
1151 Ga0268264_10639075 3300028381 Bacteria 1052
1152 Ga0265338_10209956 3300028800 Bacteria 1462
1153 Ga0265325_10025301 3300031241 Bacteria 3223
1154 Ga0265339_10000286 3300031249 Bacteria 40859
1155 Ga0265339_10007870 3300031249 Bacteria 6838
1156 Ga0307408_100027799 3300031548 Bacteria 3902
1157 Ga0307408_100038804 3300031548 Bacteria 3362
1158 Ga0307408_100045999 3300031548 Bacteria 3120
1159 Ga0265313_10000345 3300031595 Bacteria 50388
1160 Ga0265313_10000450 3300031595 Bacteria 43434
1161 Ga0265313_10105469 3300031595 Bacteria 1245
1162 Ga0265342_10000546 3300031712 Bacteria 39732
1163 Ga0307410_10277840 3300031852 Bacteria 1313
1164 Ga0307406_10151690 3300031901 Unclassified 1654
1165 Ga0307409_100111716 3300031995 Bacteria 2293
1166 Ga0307416_100051000 3300032002 Bacteria 3302
1167 Ga0307416_100516559 3300032002 Bacteria 1262
1168 Ga0307416_100693117 3300032002 Unclassified 1107
1169 Ga0316583_10001948 3300032133 Bacteria 7050
1170 Ga0316583_10010260 3300032133 Bacteria 3376
1171 Ga0373930_0009973 3300034816 Bacteria 1688
1172 Ga0373948_0014646 3300034817 Bacteria 1431
1173 Ga0373958_0009862 3300034819 Bacteria 1581
1174 Ga0373958_0025874 3300034819 Bacteria 1120
1175 Ga0373928_0023141 3300035084 Bacteria 1323
1176 Ga0373934_0012355 3300035086 Bacteria 3224
1177 Ga0373940_0000985 3300035088 Bacteria 4861
1178 Ga0373940_0009571 3300035088 Bacteria 2256
1179 Ga0373944_0016127 3300035089 Bacteria 2102
1180 Ga0373949_0022601 3300035090 Bacteria 1451
1181 Ga0373949_0071148 3300035090 Bacteria 911
1182 Ga0373923_0003541 3300035111 Bacteria 5023
1183 Ga0373932_0003321 3300035112 Bacteria 3884
1184 Ga0373932_0013728 3300035112 Bacteria 2022
1185 Ga0373932_0041685 3300035112 Bacteria 1327
1186 Ga0373932_0049821 3300035112 Bacteria 1239
1187 Ga0373941_0003908 3300035115 Bacteria 3414
1188 Ga0373941_0055670 3300035115 Bacteria 1272
1189 Ga0373945_0012198 3300035116 Bacteria 2850
1190 Ga0373945_0023915 3300035116 Bacteria 2113
1191 Ga0373953_0022228 3300035117 Bacteria 2389
1192 Ga0373953_0168672 3300035117 Unclassified 942
1193 Ga0373954_0000032 3300035118 Bacteria 54647
1194 Ga0373954_0002280 3300035118 Bacteria 7990
1195 Ga0373954_0201446 3300035118 Bacteria 978
1196 Ga0373956_0001446 3300035119 Bacteria 9798
1197 Ga0373956_0021068 3300035119 Bacteria 2778
1198 Ga0373957_0023558 3300035120 Bacteria 2203
1199 Ga0373943_0040452 3300035170 Bacteria 2251
1200 Ga0373946_0000511 3300035171 Bacteria 12863
1201 Ga0373946_0109408 3300035171 Bacteria 1249
1202 Ga0373955_0001825 3300035172 Bacteria 9164
1203 Ga0373955_0007037 3300035172 Bacteria 5152
1204 Ga0373955_0012817 3300035172 Bacteria 4040
1205 Ga0373961_0003301 3300035241 Bacteria 4012
1206 Ga0373961_0006257 3300035241 Bacteria 2861
1207 Ga0373961_0008481 3300035241 Bacteria 2499
1208 Ga0373961_0043340 3300035241 Bacteria 1308
1209 Ga0373962_0018805 3300035242 Bacteria 1802
1210 Ga0373962_0055271 3300035242 Bacteria 1153
1211 Ga0316574_0003067 3300035398 Bacteria 8526
1212 Ga0316574_0119479 3300035398 Bacteria 1692
1213 Ga0373924_0024827 3300035410 Bacteria 2365
1214 Ga0373924_0042527 3300035410 Bacteria 1864
1215 Ga0373924_0107133 3300035410 Bacteria 1205
1216 Ga0373924_0142997 3300035410 Bacteria 1044
1217 Ga0373931_0001516 3300035691 Bacteria 9995
1218 Ga0373931_0031620 3300035691 Bacteria 2733
1219 Ga0373931_0041456 3300035691 Bacteria 2418
1220 Ga0373931_0057270 3300035691 Bacteria 2090
1221 Ga0373931_0064854 3300035691 Bacteria 1978
1222 Ga0373935_0006419 3300035692 Bacteria 7019
1223 Ga0373935_0013223 3300035692 Bacteria 4977
1224 Ga0373935_0041323 3300035692 Bacteria 2896
1225 Ga0373935_0059316 3300035692 Bacteria 2446
1226 Ga0373927_0018631 3300035695 Bacteria 4558
1227 Ga0373927_0030462 3300035695 Bacteria 3520
1228 Ga0373927_0043502 3300035695 Bacteria 2907
1229 Ga0373927_0291723 3300035695 Bacteria 1073
1230 Ga0373927_0325739 3300035695 Bacteria 1012
1231 Ga0373933_0004902 3300035724 Bacteria 7304
1232 Ga0373933_0009419 3300035724 Bacteria 5335
1233 Ga0373933_0012697 3300035724 Bacteria 4655
1234 Ga0373933_0053912 3300035724 Bacteria 2408
1235 Ga0373933_0092548 3300035724 Bacteria 1867
1236 Ga0373947_0013306 3300035725 Bacteria 4713
1237 Ga0373947_0022267 3300035725 Bacteria 3673
1238 Ga0373947_0032647 3300035725 Bacteria 3069
1239 Ga0373947_0159257 3300035725 Bacteria 1459
1240 Ga0373947_0255502 3300035725 Bacteria 1160
1241 Ga0373937_0000461 3300036401 Bacteria 37578
1242 Ga0373937_0000633 3300036401 Bacteria 30781
1243 Ga0373937_0020828 3300036401 Bacteria 5882
1244 Ga0316582_0351515 3300036647 Bacteria 1014
1245 Ga0373925_0006276 3300037068 Bacteria 8760
1246 Ga0373925_0309450 3300037068 Bacteria 1277
1247 Ga0395899_0001099 3300037312 Bacteria 24243
1248 Ga0395899_0002343 3300037312 Bacteria 15425
1249 Ga0395899_0009066 3300037312 Bacteria 7648
1250 Ga0395899_0047868 3300037312 Bacteria 3182
1251 Ga0395899_0352018 3300037312 Bacteria 985
1252 Ga0395900_0002185 3300037418 Bacteria 21860
1253 Ga0395900_0003191 3300037418 Bacteria 17763
1254 Ga0395900_0006261 3300037418 Bacteria 12415
1255 Ga0395900_0008468 3300037418 Bacteria 10577
1256 Ga0395900_0018450 3300037418 Bacteria 7115
1257 Ga0395900_0033735 3300037418 Bacteria 5268
1258 Ga0395900_0037846 3300037418 Bacteria 4973
1259 Ga0395900_0088746 3300037418 Bacteria 3179
1260 Ga0395900_0116794 3300037418 Bacteria 2738
1261 Ga0395900_0151163 3300037418 Bacteria 2372
1262 Ga0395900_0153623 3300037418 Bacteria 2351
1263 Ga0395900_0200253 3300037418 Bacteria 2021
1264 Ga0395900_0500974 3300037418 Bacteria 1165
1265 Ga0395900_0625926 3300037418 Bacteria 1015
1266 Ga0395898_0003639 3300037466 Bacteria 17131
1267 Ga0395898_0010493 3300037466 Bacteria 9684
1268 Ga0395898_0014161 3300037466 Bacteria 8201
1269 Ga0395898_0014967 3300037466 Bacteria 7965
1270 Ga0395898_0017778 3300037466 Bacteria 7255
1271 Ga0395898_0022282 3300037466 Bacteria 6416
1272 Ga0395898_0024709 3300037466 Bacteria 6059
1273 Ga0395898_0030714 3300037466 Bacteria 5374
1274 Ga0395898_0132384 3300037466 Unclassified 2388
1275 Ga0395898_0171837 3300037466 Bacteria 2072
1276 Ga0395898_0214676 3300037466 Bacteria 1835
1277 Ga0395898_0227997 3300037466 Bacteria 1777
1278 Ga0395898_0255158 3300037466 Bacteria 1672
1279 Ga0395898_0279063 3300037466 Bacteria 1594
1280 Ga0395898_0287406 3300037466 Bacteria 1569
1281 Ga0395898_0409104 3300037466 Bacteria 1293
1282 Ga0395905_0003015 3300037471 Bacteria 18245
1283 Ga0395905_0054456 3300037471 Bacteria 3744
1284 Ga0395905_0091388 3300037471 Bacteria 2854
1285 Ga0395905_0132149 3300037471 Bacteria 2348
1286 Ga0395905_0478083 3300037471 Bacteria 1145
1287 Ga0436364_0048041 3300037853 Bacteria 30704
1288 Ga0436364_0814945 3300037853 Bacteria 1094
1289 Ga0395901_0000399 3300038443 Bacteria 51867
1290 Ga0395901_0000583 3300038443 Bacteria 42413
1291 Ga0395901_0001301 3300038443 Bacteria 26316
1292 Ga0395901_0002644 3300038443 Bacteria 18103
1293 Ga0395901_0009709 3300038443 Bacteria 9759
1294 Ga0395901_0012627 3300038443 Bacteria 8570
1295 Ga0395901_0029444 3300038443 Bacteria 5655
1296 Ga0395901_0039236 3300038443 Bacteria 4900
1297 Ga0395901_0111868 3300038443 Bacteria 2868
1298 Ga0395901_0130006 3300038443 Bacteria 2646
1299 Ga0395901_0133862 3300038443 Bacteria 2605
1300 Ga0395901_0135802 3300038443 Bacteria 2585
1301 Ga0395901_0162421 3300038443 Bacteria 2346
1302 Ga0395901_0301391 3300038443 Bacteria 1661
1303 Ga0395901_0362126 3300038443 Bacteria 1495
1304 Ga0395901_0377699 3300038443 Bacteria 1459
1305 Ga0395901_0667339 3300038443 Bacteria 1041
1306 Ga0436365_0314347 3300039437 Bacteria 6450
1307 Ga0436365_0432013 3300039437 Bacteria 8065
1308 Ga0436365_0947829 3300039437 Bacteria 1004
1309 Ga0436365_1652708 3300039437 Bacteria 22501
1310 Ga0436361_0678106 3300039447 Bacteria 1350
1311 Ga0436361_0704417 3300039447 Bacteria 2714
1312 Ga0436363_1301926 3300039450 Bacteria 1659
1313 Ga0436363_1344844 3300039450 Bacteria 1329
1314 Ga0436363_1709801 3300039450 Bacteria 1085
1315 Ga0436363_1717667 3300039450 Bacteria 3567
1316 Ga0436362_0031537 3300039453 Bacteria 2307
1317 Ga0436362_0553573 3300039453 Bacteria 1013
1318 Ga0451797_0823541 3300041453 Bacteria 1019
1319 Ga0439448_0000596 3300042005 Bacteria 8507
1320 Ga0439459_0000371 3300042438 Bacteria 5581
1321 Ga0439464_0052949 3300042439 Bacteria 1176
1322 Ga0439460_0002299 3300042461 Bacteria 4598
1323 Ga0451577_0000102 3300042876 Bacteria 188094
1324 Ga0451577_0000239 3300042876 Bacteria 108628
1325 Ga0451577_0000321 3300042876 Bacteria 90051
1326 Ga0451577_0002745 3300042876 Bacteria 20403
1327 Ga0451577_0038586 3300042876 Bacteria 4296
1328 Ga0451577_0039257 3300042876 Bacteria 4254
1329 Ga0451577_0246499 3300042876 Bacteria 1617
1330 Ga0451577_0373041 3300042876 Bacteria 1294
1331 Ga0451577_0391498 3300042876 Bacteria 1261
1332 Ga0451577_0395646 3300042876 Bacteria 1254
1333 Ga0466972_0001055 3300044658 Bacteria 13225
1334 Ga0453683_0004838 3300044673 Bacteria 9474
1335 Ga0453683_0007096 3300044673 Bacteria 7632
1336 Ga0453683_0023341 3300044673 Bacteria 3943
1337 Ga0453683_0030193 3300044673 Bacteria 3428
1338 Ga0453683_0035213 3300044673 Bacteria 3155
1339 Ga0453683_0035755 3300044673 Bacteria 3129
1340 Ga0453683_0036758 3300044673 Bacteria 3082
1341 Ga0453683_0055946 3300044673 Bacteria 2469
1342 Ga0453683_0267363 3300044673 Bacteria 1091
1343 Ga0453683_0368609 3300044673 Bacteria 924
1344 Ga0466963_0107399 3300044694 Bacteria 1914
1345 Ga0466963_0212335 3300044694 Bacteria 1354
1346 Ga0466963_0287433 3300044694 Bacteria 1156
1347 Ga0466964_0005544 3300044706 Bacteria 4687
1348 Ga0453684_0000249 3300044712 Bacteria 232232
1349 Ga0453684_0002288 3300044712 Bacteria 47092
1350 Ga0453684_0003712 3300044712 Bacteria 33813
1351 Ga0453684_0011384 3300044712 Bacteria 14936
1352 Ga0453684_0035640 3300044712 Bacteria 6875
1353 Ga0453684_0048015 3300044712 Bacteria 5652
1354 Ga0453684_0149917 3300044712 Bacteria 2773
1355 Ga0453684_0307475 3300044712 Bacteria 1800
1356 Ga0453684_0678606 3300044712 Bacteria 1122
1357 Ga0466968_0075391 3300044735 Bacteria 1475
1358 Ga0466957_0010951 3300044842 Bacteria 5216
1359 Ga0451576_0002131 3300045051 Bacteria 30698
1360 Ga0451576_0008459 3300045051 Bacteria 12082
1361 Ga0451576_0008839 3300045051 Bacteria 11765
1362 Ga0451576_0014274 3300045051 Bacteria 8847
1363 Ga0451576_0034790 3300045051 Bacteria 5349
1364 Ga0451576_0042134 3300045051 Bacteria 4821
1365 Ga0451576_0058725 3300045051 Bacteria 4018
1366 Ga0451576_0065900 3300045051 Bacteria 3770
1367 Ga0451576_0135899 3300045051 Bacteria 2564
1368 Ga0451576_0289654 3300045051 Bacteria 1712
1369 Ga0451576_0324937 3300045051 Bacteria 1610
1370 Ga0451576_0909607 3300045051 Bacteria 923
1371 Ga0466967_0046414 3300045976 Bacteria 3782
1372 Ga0466967_0089271 3300045976 Bacteria 2798
1373 Ga0466967_0123088 3300045976 Bacteria 2399
1374 Ga0466967_0244517 3300045976 Bacteria 1712
1375 Ga0466967_0311930 3300045976 Bacteria 1515
1376 Ga0466967_0427221 3300045976 Bacteria 1292
1377 Ga0495592_0002269 3300046454 Bacteria 13557
1378 Ga0495592_0071183 3300046454 Bacteria 2531
1379 Ga0495603_0069541 3300046455 Bacteria 2071
1380 Ga0495603_0261328 3300046455 Bacteria 996
1381 Ga0495629_0000622 3300046459 Bacteria 28827
1382 Ga0495629_0001032 3300046459 Bacteria 22313
1383 Ga0495629_0020139 3300046459 Bacteria 4762
1384 Ga0495651_0001609 3300046462 Bacteria 17488
1385 Ga0495651_0002105 3300046462 Bacteria 15367
1386 Ga0495651_0045972 3300046462 Bacteria 3380
1387 Ga0495651_0075283 3300046462 Bacteria 2560
1388 Ga0495651_0152320 3300046462 Bacteria 1665
1389 Ga0495653_0000810 3300046463 Bacteria 24043
1390 Ga0495653_0004115 3300046463 Bacteria 11765
1391 Ga0495653_0020376 3300046463 Bacteria 5377
1392 Ga0495580_0027197 3300046472 Bacteria 4162
1393 Ga0495580_0034874 3300046472 Bacteria 3620
1394 Ga0495580_0151186 3300046472 Bacteria 1608
1395 Ga0495582_0003798 3300046473 Bacteria 8505
1396 Ga0495582_0045249 3300046473 Bacteria 2424
1397 Ga0495605_0166049 3300046474 Bacteria 978
1398 Ga0495639_0003746 3300046475 Bacteria 6541
1399 Ga0495662_0086811 3300046476 Bacteria 1524
1400 Ga0495664_0001322 3300046477 Bacteria 13014
1401 Ga0495664_0037563 3300046477 Bacteria 2859
1402 Ga0495664_0066041 3300046477 Bacteria 2157
1403 Ga0495664_0109613 3300046477 Bacteria 1666
1404 Ga0495608_0000334 3300046511 Bacteria 33101
1405 Ga0495608_0000663 3300046511 Bacteria 23759
1406 Ga0495618_0006834 3300046514 Bacteria 6910
1407 Ga0495618_0035037 3300046514 Bacteria 3149
1408 Ga0495628_0085151 3300046516 Bacteria 2452
1409 Ga0495628_0196576 3300046516 Bacteria 1521
1410 Ga0495628_0198725 3300046516 Bacteria 1511
1411 Ga0495630_0007085 3300046517 Bacteria 7985
1412 Ga0495630_0010224 3300046517 Bacteria 6770
1413 Ga0495630_0066157 3300046517 Bacteria 2716
1414 Ga0495648_0005015 3300046524 Bacteria 11123
1415 Ga0495648_0114898 3300046524 Bacteria 1457
1416 Ga0495666_0007789 3300046526 Bacteria 5363
1417 Ga0495666_0007796 3300046526 Bacteria 5361
1418 Ga0495642_0035593 3300046528 Bacteria 2009
1419 Ga0495652_0002927 3300046529 Bacteria 17184
1420 Ga0495652_0010713 3300046529 Bacteria 8307
1421 Ga0495652_0053242 3300046529 Bacteria 3450
1422 Ga0495665_0011685 3300046531 Bacteria 4757
1423 Ga0495640_0009245 3300046533 Bacteria 7687
1424 Ga0495640_0013614 3300046533 Bacteria 6182
1425 Ga0495586_0006148 3300046535 Bacteria 6417
1426 Ga0495586_0047396 3300046535 Bacteria 2320
1427 Ga0495587_0001520 3300046536 Bacteria 15413
1428 Ga0495587_0002243 3300046536 Bacteria 12921
1429 Ga0495587_0122402 3300046536 Bacteria 1490
1430 Ga0495645_0019129 3300046543 Bacteria 4930
1431 Ga0495645_0041185 3300046543 Bacteria 3368
1432 Ga0495667_0000346 3300046559 Bacteria 29307
1433 Ga0495667_0002608 3300046559 Bacteria 12034
1434 Ga0495667_0050806 3300046559 Bacteria 2736
1435 Ga0495667_0074984 3300046559 Bacteria 2202
1436 Ga0495634_0014918 3300046642 Bacteria 5586
1437 Ga0495635_0002624 3300046663 Bacteria 12304
1438 Ga0495635_0003614 3300046663 Bacteria 10712
1439 Ga0495635_0006472 3300046663 Bacteria 8167
1440 Ga0495635_0075210 3300046663 Bacteria 2314
1441 Ga0495635_0164202 3300046663 Bacteria 1511
1442 Ga0495588_0042495 3300046674 Bacteria 2324
1443 Ga0495588_0085697 3300046674 Bacteria 1647
1444 Ga0495657_0005870 3300046675 Bacteria 9653
1445 Ga0495657_0022326 3300046675 Bacteria 4535
1446 Ga0495599_0001516 3300046678 Bacteria 13366
1447 Ga0495599_0011917 3300046678 Bacteria 5348
1448 Ga0495599_0113860 3300046678 Bacteria 1683
1449 Ga0495599_0354994 3300046678 Bacteria 878
1450 Ga0495623_0004310 3300046679 Bacteria 9365
1451 Ga0495623_0035431 3300046679 Bacteria 3198
1452 Ga0495646_0003704 3300046680 Bacteria 9543
1453 Ga0495646_0060254 3300046680 Bacteria 2264
1454 Ga0495647_0002281 3300046681 Bacteria 6017
1455 Ga0495647_0015064 3300046681 Bacteria 2703
1456 Ga0495658_0003807 3300046683 Bacteria 7472
1457 Ga0495658_0007272 3300046683 Bacteria 5472
1458 Ga0495658_0013224 3300046683 Bacteria 4200
1459 Ga0495658_0086139 3300046683 Bacteria 1853
1460 Ga0495669_0103187 3300046684 Unclassified 1326
1461 Ga0495613_0006304 3300046689 Bacteria 8871
1462 Ga0495613_0012107 3300046689 Bacteria 6411
1463 Ga0495613_0106879 3300046689 Bacteria 2019
1464 Ga0495624_0050665 3300046690 Bacteria 2630
1465 Ga0495624_0112036 3300046690 Bacteria 1677
1466 Ga0495624_0139882 3300046690 Bacteria 1483
1467 Ga0495670_0057989 3300046691 Bacteria 1944
1468 Ga0495600_0003904 3300046809 Bacteria 8854
1469 Ga0495600_0004169 3300046809 Bacteria 8620
1470 Ga0495600_0005188 3300046809 Bacteria 7831
1471 Ga0495600_0037970 3300046809 Bacteria 3133
1472 Ga0495600_0206979 3300046809 Bacteria 1258
1473 Ga0495581_0006833 3300047315 Bacteria 6618
1474 Ga0495581_0018030 3300047315 Bacteria 4101
1475 Ga0495581_0029337 3300047315 Bacteria 3189
1476 Ga0495581_0075227 3300047315 Bacteria 1954
1477 Ga0495604_0001894 3300047317 Bacteria 16994
1478 Ga0495604_0023170 3300047317 Bacteria 4955
1479 Ga0495604_0059441 3300047317 Bacteria 2929
1480 Ga0495674_0002440 3300047319 Bacteria 18166
1481 Ga0495674_0003607 3300047319 Bacteria 15057
1482 Ga0495674_0015609 3300047319 Bacteria 7091
1483 Ga0495674_0043145 3300047319 Bacteria 4016
1484 Ga0495674_0060842 3300047319 Bacteria 3294
1485 Ga0495676_0015175 3300047321 Bacteria 6871
1486 Ga0495676_0346470 3300047321 Bacteria 994
1487 Ga0495680_0000535 3300047322 Bacteria 42742
1488 Ga0495680_0013510 3300047322 Bacteria 7121
1489 Ga0495680_0018701 3300047322 Bacteria 5872
1490 Ga0495680_0082648 3300047322 Bacteria 2423
1491 Ga0495675_0001560 3300047444 Bacteria 13834
1492 Ga0495675_0002705 3300047444 Bacteria 10625
1493 Ga0495675_0091696 3300047444 Bacteria 1907
1494 Ga0495684_0000340 3300047471 Bacteria 37592
1495 Ga0495684_0001336 3300047471 Bacteria 19848
1496 Ga0495684_0076918 3300047471 Bacteria 2534
1497 Ga0495593_0010908 3300047673 Bacteria 5236
1498 Ga0495593_0024194 3300047673 Bacteria 3368
1499 Ga0495593_0227924 3300047673 Bacteria 934
1500 Ga0495602_0003813 3300048088 Bacteria 15682
1501 Ga0495602_0027138 3300048088 Bacteria 5511
1502 Ga0495602_0031957 3300048088 Bacteria 4964
1503 Ga0495614_0027253 3300048089 Bacteria 2464
1504 Ga0496100_0056076 3300048903 Bacteria 2577
1505 Ga0496100_0123449 3300048903 Bacteria 1815
1506 Ga0496101_0048809 3300048904 Bacteria 3043
1507 Ga0496102_0023729 3300048905 Bacteria 5450
1508 Ga0496102_0084240 3300048905 Bacteria 2934
1509 Ga0496102_0109425 3300048905 Bacteria 2575
1510 Ga0496102_0178824 3300048905 Bacteria 1998
1511 Ga0496102_0192636 3300048905 Bacteria 1921
1512 Ga0496102_0278872 3300048905 Bacteria 1576
1513 Ga0496102_0361501 3300048905 Bacteria 1367
1514 Ga0496103_0080990 3300048906 Bacteria 2042
1515 Ga0496104_0012999 3300048907 Bacteria 7494
1516 Ga0496104_0094319 3300048907 Bacteria 2863
1517 Ga0496104_0504316 3300048907 Bacteria 1121
1518 Ga0496105_0002276 3300048908 Bacteria 13932
1519 Ga0496105_0403266 3300048908 Bacteria 1085
1520 Ga0496106_0021785 3300048909 Bacteria 4759
1521 Ga0496106_0035735 3300048909 Bacteria 3716
1522 Ga0496106_0049337 3300048909 Bacteria 3171
1523 Ga0496106_0078840 3300048909 Bacteria 2528
1524 Ga0496106_0108608 3300048909 Bacteria 2158
1525 Ga0496106_0643797 3300048909 Bacteria 847
1526 Ga0496107_0020445 3300048910 Bacteria 4676
1527 Ga0496107_0027285 3300048910 Bacteria 4054
1528 Ga0496107_0040527 3300048910 Bacteria 3343
1529 Ga0496107_0397408 3300048910 Bacteria 1025
1530 Ga0496108_0065006 3300048911 Bacteria 3074
1531 Ga0496108_0271978 3300048911 Bacteria 1475
1532 Ga0496108_0328923 3300048911 Bacteria 1332
1533 Ga0496109_0007256 3300048912 Bacteria 9373
1534 Ga0496109_0037259 3300048912 Bacteria 4394
1535 Ga0496109_0387755 3300048912 Bacteria 1320
1536 Ga0496109_0603318 3300048912 Bacteria 1034
1537 Ga0496110_0032168 3300048913 Bacteria 4528
1538 Ga0496110_0138228 3300048913 Bacteria 2202
1539 Ga0496110_0199904 3300048913 Bacteria 1816
1540 Ga0496110_0641676 3300048913 Bacteria 961
1541 Ga0496111_0042323 3300048914 Bacteria 3270
1542 Ga0496111_0178652 3300048914 Bacteria 1578
1543 Ga0496111_0205310 3300048914 Bacteria 1464
1544 Ga0496112_0002248 3300048915 Bacteria 15425
1545 Ga0496112_0054491 3300048915 Bacteria 3929
1546 Ga0496112_0059384 3300048915 Bacteria 3768
1547 Ga0496112_0083512 3300048915 Bacteria 3159
1548 Ga0496112_0163278 3300048915 Bacteria 2194
1549 Ga0496112_0199680 3300048915 Bacteria 1960
1550 Ga0496113_0005812 3300048916 Bacteria 7741
1551 Ga0496113_0077378 3300048916 Bacteria 2543
1552 Ga0496114_0005322 3300048917 Bacteria 10055
1553 Ga0496114_0336689 3300048917 Bacteria 1334
1554 Ga0496115_0027807 3300048918 Bacteria 4427
1555 Ga0496115_0033216 3300048918 Bacteria 4072
1556 Ga0496116_0003061 3300048919 Bacteria 16892
1557 Ga0496121_0032351 3300048924 Bacteria 4756
1558 Ga0496121_0144315 3300048924 Bacteria 1761
1559 Ga0496125_0073415 3300048928 Bacteria 2660
1560 Ga0496126_0030458 3300048929 Bacteria 5111
1561 Ga0496126_0425740 3300048929 Bacteria 1072
1562 Ga0501031_0003990 3300049568 Bacteria 9517
1563 Ga0501031_0112189 3300049568 Bacteria 1780
1564 Ga0501032_0000073 3300049569 Bacteria 85584
1565 Ga0501032_0049061 3300049569 Bacteria 2849
1566 Ga0501032_0109725 3300049569 Bacteria 1826
1567 Ga0501032_0137788 3300049569 Bacteria 1608
1568 Ga0501032_0296492 3300049569 Bacteria 1045
1569 Ga0501033_0000136 3300049570 Bacteria 70952
1570 Ga0501033_0018838 3300049570 Bacteria 5220
1571 Ga0501033_0025306 3300049570 Bacteria 4470
1572 Ga0501033_0033321 3300049570 Bacteria 3867
1573 Ga0501033_0119379 3300049570 Bacteria 1914
1574 Ga0501034_0000251 3300049571 Bacteria 99406
1575 Ga0501034_0001131 3300049571 Bacteria 37119
1576 Ga0501034_0006465 3300049571 Bacteria 12621
1577 Ga0501034_0016230 3300049571 Bacteria 7642
1578 Ga0501034_0018585 3300049571 Bacteria 7125
1579 Ga0501034_0038227 3300049571 Bacteria 4860
1580 Ga0501034_0059388 3300049571 Bacteria 3841
1581 Ga0501034_0066647 3300049571 Bacteria 3613
1582 Ga0501034_0066672 3300049571 Bacteria 3613
1583 Ga0501034_0449044 3300049571 Bacteria 1207
1584 Ga0501036_0000036 3300049572 Bacteria 87244
1585 Ga0501036_0006000 3300049572 Bacteria 9849
1586 Ga0501036_0007555 3300049572 Bacteria 8868
1587 Ga0501036_0012743 3300049572 Bacteria 6975
1588 Ga0501036_0057434 3300049572 Bacteria 3296
1589 Ga0501036_0154501 3300049572 Bacteria 1935
1590 Ga0501036_0275557 3300049572 Bacteria 1408
1591 Ga0501036_0290126 3300049572 Bacteria 1369
1592 Ga0501037_0000040 3300049573 Bacteria 119364
1593 Ga0501037_0003198 3300049573 Bacteria 11877
1594 Ga0501037_0019500 3300049573 Bacteria 5003
1595 Ga0501037_0066917 3300049573 Bacteria 2616
1596 Ga0501037_0157916 3300049573 Bacteria 1617
1597 Ga0501037_0264320 3300049573 Bacteria 1202
1598 Ga0501037_0334638 3300049573 Bacteria 1046
1599 Ga0501038_0000150 3300049574 Bacteria 59508
1600 Ga0501038_0008633 3300049574 Bacteria 9354
1601 Ga0501038_0088301 3300049574 Bacteria 2602
1602 Ga0501038_0092061 3300049574 Bacteria 2539
1603 Ga0501039_0002067 3300049575 Bacteria 14878
1604 Ga0501039_0053506 3300049575 Bacteria 3124
1605 Ga0501039_0129101 3300049575 Bacteria 1983
1606 Ga0501039_0157515 3300049575 Bacteria 1784
1607 Ga0501039_0207592 3300049575 Bacteria 1540
1608 Ga0501039_0238559 3300049575 Bacteria 1430
1609 Ga0501040_0002645 3300049576 Bacteria 11552
1610 Ga0501040_0002919 3300049576 Bacteria 11055
1611 Ga0501040_0014155 3300049576 Bacteria 5251
1612 Ga0501040_0131804 3300049576 Bacteria 1758
1613 Ga0501040_0287031 3300049576 Bacteria 1176
1614 Ga0501041_0019694 3300049577 Bacteria 4031
1615 Ga0501041_0078455 3300049577 Bacteria 2032
1616 Ga0501042_0022622 3300049578 Bacteria 4392
1617 Ga0501042_0086564 3300049578 Bacteria 2247
1618 Ga0501042_0169376 3300049578 Bacteria 1576
1619 Ga0501043_0000464 3300049579 Bacteria 36232
1620 Ga0501043_0000736 3300049579 Bacteria 29004
1621 Ga0501043_0005551 3300049579 Bacteria 10170
1622 Ga0501043_0021777 3300049579 Bacteria 5026
1623 Ga0501043_0040268 3300049579 Bacteria 3672
1624 Ga0501043_0091006 3300049579 Bacteria 2398
1625 Ga0501043_0160795 3300049579 Bacteria 1755
1626 Ga0501046_0000296 3300049580 Bacteria 50413
1627 Ga0501046_0000398 3300049580 Bacteria 43497
1628 Ga0501046_0004847 3300049580 Bacteria 12122
1629 Ga0501046_0009011 3300049580 Bacteria 8656
1630 Ga0501046_0016765 3300049580 Bacteria 6125
1631 Ga0501046_0065820 3300049580 Bacteria 2826
1632 Ga0501046_0177882 3300049580 Bacteria 1593
1633 Ga0501047_0000124 3300049581 Bacteria 94721
1634 Ga0501047_0000656 3300049581 Bacteria 36126
1635 Ga0501047_0020358 3300049581 Bacteria 6371
1636 Ga0501047_0024140 3300049581 Bacteria 5840
1637 Ga0501047_0026604 3300049581 Bacteria 5567
1638 Ga0501047_0031540 3300049581 Bacteria 5111
1639 Ga0501047_0054383 3300049581 Bacteria 3872
1640 Ga0501047_0091221 3300049581 Bacteria 2924
1641 Ga0501047_0094301 3300049581 Bacteria 2872
1642 Ga0501047_0302544 3300049581 Bacteria 1441
1643 Ga0501047_0389463 3300049581 Bacteria 1227
1644 Ga0501048_0000566 3300049582 Bacteria 26246
1645 Ga0501048_0000906 3300049582 Bacteria 21866
1646 Ga0501048_0005609 3300049582 Bacteria 9546
1647 Ga0501048_0005778 3300049582 Bacteria 9404
1648 Ga0501048_0034386 3300049582 Bacteria 3657
1649 Ga0501048_0070007 3300049582 Bacteria 2478
1650 Ga0501048_0096261 3300049582 Bacteria 2088
1651 Ga0501067_0000192 3300049583 Bacteria 34520
1652 Ga0501067_0056911 3300049583 Bacteria 2166
1653 Ga0501068_0011008 3300049584 Bacteria 5090
1654 Ga0501068_0028358 3300049584 Bacteria 3310
1655 Ga0501068_0131351 3300049584 Bacteria 1566
1656 Ga0501069_0019343 3300049585 Bacteria 3681
1657 Ga0501069_0023829 3300049585 Bacteria 3337
1658 Ga0501069_0035563 3300049585 Bacteria 2745
1659 Ga0501069_0051159 3300049585 Bacteria 2298
1660 Ga0501069_0082293 3300049585 Bacteria 1814
1661 Ga0501070_0001240 3300049586 Bacteria 22856
1662 Ga0501070_0001465 3300049586 Bacteria 21138
1663 Ga0501070_0001698 3300049586 Bacteria 19502
1664 Ga0501070_0038630 3300049586 Bacteria 3983
1665 Ga0501070_0042958 3300049586 Bacteria 3763
1666 Ga0501070_0063418 3300049586 Bacteria 3061
1667 Ga0501070_0137359 3300049586 Bacteria 2018
1668 Ga0501070_0184366 3300049586 Bacteria 1717
1669 Ga0501070_0376513 3300049586 Bacteria 1150
1670 Ga0501070_0686547 3300049586 Bacteria 810
1671 Ga0501071_0022863 3300049587 Bacteria 4362
1672 Ga0501071_0030813 3300049587 Bacteria 3796
1673 Ga0501071_0055656 3300049587 Bacteria 2856
1674 Ga0501072_0002128 3300049588 Bacteria 14764
1675 Ga0501072_0047053 3300049588 Bacteria 3397
1676 Ga0501072_0056622 3300049588 Bacteria 3089
1677 Ga0501072_0193912 3300049588 Bacteria 1620
1678 Ga0501072_0276553 3300049588 Bacteria 1336
1679 Ga0501073_0000037 3300049589 Bacteria 87345
1680 Ga0501073_0019463 3300049589 Bacteria 4901
1681 Ga0501073_0039238 3300049589 Bacteria 3355
1682 Ga0501073_0042645 3300049589 Bacteria 3201
1683 Ga0501073_0090680 3300049589 Bacteria 2124
1684 Ga0501074_0000133 3300049590 Bacteria 38342
1685 Ga0501074_0003133 3300049590 Bacteria 11665
1686 Ga0501074_0004836 3300049590 Bacteria 9654
1687 Ga0501074_0023972 3300049590 Bacteria 4434
1688 Ga0501074_0075543 3300049590 Bacteria 2419
1689 Ga0501074_0283265 3300049590 Bacteria 1178
1690 Ga0501074_0319275 3300049590 Bacteria 1103
1691 Ga0501075_0008265 3300049591 Bacteria 7252
1692 Ga0501075_0062043 3300049591 Bacteria 2818
1693 Ga0501075_0229253 3300049591 Bacteria 1416
1694 Ga0501075_0268007 3300049591 Bacteria 1301
1695 Ga0501075_0269405 3300049591 Bacteria 1298
1696 Ga0501075_0424072 3300049591 Bacteria 1014
1697 Ga0501075_0449015 3300049591 Bacteria 983
1698 Ga0501075_0654452 3300049591 Bacteria 801
1699 Ga0501076_0012712 3300049592 Bacteria 6301
1700 Ga0501076_0049392 3300049592 Bacteria 3327
1701 Ga0501076_0081709 3300049592 Bacteria 2594
1702 Ga0501076_0190747 3300049592 Bacteria 1672
1703 Ga0501077_0001105 3300049593 Bacteria 16273
1704 Ga0501077_0074950 3300049593 Bacteria 2143
1705 Ga0501077_0075690 3300049593 Bacteria 2132
1706 Ga0501077_0122182 3300049593 Bacteria 1651
1707 Ga0501077_0125573 3300049593 Bacteria 1626
1708 Ga0501077_0181527 3300049593 Bacteria 1337
1709 Ga0501077_0230564 3300049593 Bacteria 1177
1710 Ga0501079_0003047 3300049741 Bacteria 12264
1711 Ga0501079_0003540 3300049741 Bacteria 11482
1712 Ga0501079_0010872 3300049741 Bacteria 6931
1713 Ga0501079_0017460 3300049741 Bacteria 5479
1714 Ga0501079_0054968 3300049741 Bacteria 3071
1715 Ga0501079_0111803 3300049741 Bacteria 2123
1716 Ga0501079_0141515 3300049741 Bacteria 1874
1717 Ga0501079_0173530 3300049741 Bacteria 1681
1718 Ga0501079_0464028 3300049741 Bacteria 995
1719 Ga0501080_0000054 3300049742 Bacteria 74316
1720 Ga0501080_0000130 3300049742 Bacteria 53465
1721 Ga0501080_0010473 3300049742 Bacteria 8489
1722 Ga0501080_0036304 3300049742 Bacteria 4601
1723 Ga0501080_0037417 3300049742 Bacteria 4533
1724 Ga0501080_0139654 3300049742 Bacteria 2240
1725 Ga0501080_0238183 3300049742 Bacteria 1661
1726 Ga0501080_0388524 3300049742 Bacteria 1256
1727 Ga0501080_0456340 3300049742 Bacteria 1145
1728 Ga0501081_0001014 3300049743 Bacteria 16751
1729 Ga0501081_0039299 3300049743 Bacteria 3237
1730 Ga0501081_0147927 3300049743 Bacteria 1686
1731 Ga0501081_0225834 3300049743 Bacteria 1363
1732 Ga0501081_0345127 3300049743 Bacteria 1097
1733 Ga0501081_0359343 3300049743 Bacteria 1074
1734 Ga0501081_0408574 3300049743 Bacteria 1006
1735 Ga0501083_0000480 3300049744 Bacteria 25565
1736 Ga0501083_0007166 3300049744 Bacteria 7915
1737 Ga0501083_0010078 3300049744 Bacteria 6662
1738 Ga0501083_0040827 3300049744 Bacteria 3149
1739 Ga0501083_0065245 3300049744 Bacteria 2425
1740 Ga0501083_0104125 3300049744 Bacteria 1870
1741 Ga0501035_0000142 3300049822 Bacteria 87561
1742 Ga0501035_0006352 3300049822 Bacteria 11114
1743 Ga0501035_0013436 3300049822 Bacteria 7558
1744 Ga0501035_0119926 3300049822 Bacteria 2300
1745 Ga0501035_0410742 3300049822 Bacteria 1125
1746 Ga0501044_0010830 3300049823 Bacteria 9894
1747 Ga0501044_0021003 3300049823 Bacteria 6971
1748 Ga0501044_0041223 3300049823 Bacteria 4806
1749 Ga0501044_0067532 3300049823 Bacteria 3643
1750 Ga0501044_0093846 3300049823 Bacteria 3025
1751 Ga0501044_0249399 3300049823 Bacteria 1717
1752 Ga0501044_0385704 3300049823 Bacteria 1315
1753 Ga0501044_0540074 3300049823 Bacteria 1064
1754 Ga0501045_0010760 3300049824 Bacteria 6410
1755 Ga0501045_0025006 3300049824 Bacteria 4290
1756 Ga0501045_0177424 3300049824 Bacteria 1587
1757 Ga0501045_0203204 3300049824 Bacteria 1476
1758 nmdc:mga03n38_70030_c1 3300050490 Bacteria 1621
1759 nmdc:mga0k408_90722_c1 3300050493 Bacteria 1795
1760 nmdc:mga06z11_18302_c1 3300050494 Bacteria 3198
1761 nmdc:mga06z11_194_c1 3300050494 Bacteria 24394
1762 nmdc:mga06z11_2647_c1 3300050494 Bacteria 6862
1763 nmdc:mga04h51_1935_c1 3300050495 Bacteria 4829
1764 nmdc:mga05p37_11330_c1 3300050507 Bacteria 10608
1765 nmdc:mga05p37_128134_c1 3300050507 Bacteria 3116
1766 nmdc:mga05p37_13057_c1 3300050507 Bacteria 9940
1767 nmdc:mga05p37_134968_c1 3300050507 Bacteria 3027
1768 nmdc:mga05p37_15330_c1 3300050507 Bacteria 9207
1769 nmdc:mga05p37_17550_c1 3300050507 Bacteria 8640
1770 nmdc:mga05p37_20977_c1 3300050507 Bacteria 7909
1771 nmdc:mga05p37_217882_c1 3300050507 Bacteria 2305
1772 nmdc:mga05p37_219934_c1 3300050507 Bacteria 2292
1773 nmdc:mga05p37_223129_c1 3300050507 Bacteria 2274
1774 nmdc:mga05p37_234794_c1 3300050507 Bacteria 2208
1775 nmdc:mga05p37_24438_c1 3300050507 Bacteria 7344
1776 nmdc:mga05p37_326019_c1 3300050507 Bacteria 1816
1777 nmdc:mga05p37_388450_c1 3300050507 Bacteria 1633
1778 nmdc:mga05p37_38_c1 3300050507 Bacteria 109166
1779 nmdc:mga05p37_43900_c1 3300050507 Bacteria 5500
1780 nmdc:mga05p37_440482_c1 3300050507 Bacteria 1511
1781 nmdc:mga05p37_56012_c1 3300050507 Bacteria 4854
1782 nmdc:mga05p37_6261_c1 3300050507 Bacteria 14015
1783 nmdc:mga05p37_663061_c1 3300050507 Bacteria 1166
1784 nmdc:mga05p37_66846_c1 3300050507 Bacteria 4422
1785 nmdc:mga05p37_694897_c1 3300050507 Bacteria 1131
1786 nmdc:mga05p37_71040_c1 3300050507 Bacteria 4282
1787 nmdc:mga05p37_74990_c1 3300050507 Bacteria 4164
1788 nmdc:mga05p37_801295_c1 3300050507 Bacteria 1031
1789 nmdc:mga05p37_80661_c1 3300050507 Bacteria 4008
1790 nmdc:mga05p37_84537_c1 3300050507 Bacteria 3910
1791 nmdc:mga05p37_888_c1 3300050507 Bacteria 33726
1792 nmdc:mga09592_11651_c1 3300050508 Bacteria 7153
1793 nmdc:mga09592_172363_c1 3300050508 Bacteria 1871
1794 nmdc:mga09592_23317_c1 3300050508 Bacteria 5112
1795 nmdc:mga09592_28720_c1 3300050508 Bacteria 4623
1796 nmdc:mga09592_35560_c1 3300050508 Bacteria 4171
1797 nmdc:mga09592_387189_c1 3300050508 Unclassified 1209
1798 nmdc:mga09592_4013_c1 3300050508 Bacteria 11873
1799 nmdc:mga09592_43862_c1 3300050508 Bacteria 3763
1800 nmdc:mga09592_5319_c1 3300050508 Bacteria 10464
1801 nmdc:mga09592_542_c1 3300050508 Bacteria 28621
1802 nmdc:mga09592_94110_c1 3300050508 Bacteria 2562
1803 nmdc:mga0qj67_11505_c1 3300050509 Bacteria 6632
1804 nmdc:mga0qj67_16343_c1 3300050509 Bacteria 5626
1805 nmdc:mga0qj67_17904_c1 3300050509 Bacteria 5393
1806 nmdc:mga0qj67_3904_c1 3300050509 Bacteria 10774
1807 nmdc:mga0qj67_7208_c1 3300050509 Bacteria 8209
1808 nmdc:mga0qj67_97939_c1 3300050509 Bacteria 2362
1809 nmdc:mga06r32_11770_c1 3300050510 Bacteria 7879
1810 nmdc:mga06r32_122019_c1 3300050510 Bacteria 2571
1811 nmdc:mga06r32_299_c1 3300050510 Bacteria 41034
1812 nmdc:mga06r32_315696_c1 3300050510 Bacteria 1548
1813 nmdc:mga06r32_368381_c1 3300050510 Bacteria 1420
1814 nmdc:mga06r32_3979_c1 3300050510 Bacteria 13240
1815 nmdc:mga06r32_41309_c1 3300050510 Bacteria 4382
1816 nmdc:mga06r32_552412_c1 3300050510 Bacteria 1125
1817 nmdc:mga06r32_56979_c1 3300050510 Bacteria 3753
1818 nmdc:mga06r32_756483_c1 3300050510 Unclassified 934
1819 nmdc:mga06r32_86175_c1 3300050510 Bacteria 3063
1820 nmdc:mga08y16_101694_c1 3300050511 Bacteria 2992
1821 nmdc:mga08y16_20211_c1 3300050511 Bacteria 7029
1822 nmdc:mga08y16_2178_c1 3300050511 Bacteria 20091
1823 nmdc:mga08y16_25433_c1 3300050511 Bacteria 6244
1824 nmdc:mga08y16_348752_c1 3300050511 Bacteria 1521
1825 nmdc:mga08y16_6776_c1 3300050511 Bacteria 12020
1826 nmdc:mga08y16_7974_c1 3300050511 Bacteria 11083
1827 nmdc:mga0n895_10572_c1 3300050512 Bacteria 8166
1828 nmdc:mga0n895_120593_c1 3300050512 Bacteria 2644
1829 nmdc:mga0n895_137479_c1 3300050512 Bacteria 2471
1830 nmdc:mga0n895_13810_c1 3300050512 Bacteria 7305
1831 nmdc:mga0n895_16412_c1 3300050512 Bacteria 6794
1832 nmdc:mga0n895_17520_c1 3300050512 Bacteria 6604
1833 nmdc:mga0n895_184246_c1 3300050512 Bacteria 2119
1834 nmdc:mga0n895_207618_c1 3300050512 Bacteria 1989
1835 nmdc:mga0n895_267330_c1 3300050512 Bacteria 1735
1836 nmdc:mga0n895_28197_c1 3300050512 Bacteria 5341
1837 nmdc:mga0n895_298179_c1 3300050512 Bacteria 1634
1838 nmdc:mga0n895_38126_c1 3300050512 Bacteria 4655
1839 nmdc:mga0n895_384170_c1 3300050512 Bacteria 1421
1840 nmdc:mga0n895_44151_c1 3300050512 Bacteria 4347
1841 nmdc:mga0n895_452_c1 3300050512 Bacteria 27503
1842 nmdc:mga0n895_5287_c1 3300050512 Bacteria 10752
1843 nmdc:mga0n895_53004_c1 3300050512 Bacteria 3983
1844 nmdc:mga0n895_603272_c1 3300050512 Bacteria 1100
1845 nmdc:mga0n895_8052_c1 3300050512 Bacteria 9095
1846 nmdc:mga0n895_92725_c1 3300050512 Bacteria 3024
1847 nmdc:mga0n895_93891_c1 3300050512 Unclassified 3004
1848 nmdc:mga0rr50_100363_c1 3300050513 Bacteria 2273
1849 nmdc:mga0rr50_1220_c1 3300050513 Bacteria 13973
1850 nmdc:mga0rr50_129713_c1 3300050513 Bacteria 2017
1851 nmdc:mga0rr50_132101_c1 3300050513 Bacteria 2000
1852 nmdc:mga0rr50_133531_c1 3300050513 Bacteria 1990
1853 nmdc:mga0rr50_157141_c1 3300050513 Unclassified 1843
1854 nmdc:mga0rr50_168072_c1 3300050513 Unclassified 1785
1855 nmdc:mga0rr50_1781_c1 3300050513 Bacteria 11900
1856 nmdc:mga0rr50_181199_c1 3300050513 Bacteria 1722
1857 nmdc:mga0rr50_18651_c1 3300050513 Bacteria 4665
1858 nmdc:mga0rr50_197_c1 3300050513 Bacteria 32712
1859 nmdc:mga0rr50_204960_c1 3300050513 Bacteria 1623
1860 nmdc:mga0rr50_2540_c1 3300050513 Bacteria 10336
1861 nmdc:mga0rr50_25807_c1 3300050513 Bacteria 4091
1862 nmdc:mga0rr50_284560_c1 3300050513 Bacteria 1380
1863 nmdc:mga0rr50_294246_c1 3300050513 Bacteria 1357
1864 nmdc:mga0rr50_338757_c1 3300050513 Bacteria 1263
1865 nmdc:mga0rr50_35065_c1 3300050513 Bacteria 3600
1866 nmdc:mga0rr50_3780_c1 3300050513 Bacteria 8784
1867 nmdc:mga0rr50_4988_c1 3300050513 Bacteria 7861
1868 nmdc:mga0rr50_6473_c1 3300050513 Bacteria 7133
1869 nmdc:mga0rr50_84426_c1 3300050513 Bacteria 2459
1870 nmdc:mga08x19_100626_c1 3300050514 Bacteria 1917
1871 nmdc:mga08x19_129979_c1 3300050514 Bacteria 1693
1872 nmdc:mga08x19_22602_c1 3300050514 Bacteria 3896
1873 nmdc:mga08x19_2564_c1 3300050514 Bacteria 11044
1874 nmdc:mga08x19_45394_c1 3300050514 Bacteria 2808
1875 nmdc:mga08x19_56286_c1 3300050514 Unclassified 2538
1876 nmdc:mga08x19_73900_c1 3300050514 Bacteria 2227
1877 nmdc:mga08x19_76710_c1 3300050514 Bacteria 2187
1878 nmdc:mga08x19_80334_c1 3300050514 Bacteria 2140
1879 nmdc:mga0a205_131530_c1 3300050515 Bacteria 2403
1880 nmdc:mga0a205_140_c1 3300050515 Bacteria 45904
1881 nmdc:mga0a205_20885_c1 3300050515 Bacteria 6189
1882 nmdc:mga0a205_231059_c1 3300050515 Bacteria 1733
1883 nmdc:mga0a205_309761_c1 3300050515 Bacteria 1451
1884 nmdc:mga0a205_36144_c1 3300050515 Bacteria 4746
1885 nmdc:mga0a205_426_c1 3300050515 Bacteria 32418
1886 nmdc:mga0a205_44577_c1 3300050515 Bacteria 4276
1887 nmdc:mga0a205_47008_c1 3300050515 Bacteria 4163
1888 nmdc:mga0a205_47030_c1 3300050515 Bacteria 4162
1889 nmdc:mga0a205_51055_c1 3300050515 Bacteria 3992
1890 nmdc:mga0a205_5124_c1 3300050515 Bacteria 11783
1891 nmdc:mga0a205_6159_c1 3300050515 Bacteria 10823
1892 nmdc:mga0a205_82747_c1 3300050515 Bacteria 3100
1893 nmdc:mga0a205_882_c1 3300050515 Bacteria 24578
1894 nmdc:mga0sz30_4146_c1 3300050516 Bacteria 5222
1895 nmdc:mga0sz30_9309_c1 3300050516 Bacteria 3732
1896 Ga0495601_0001061 3300053077 Bacteria 15053
1897 Ga0495601_0005515 3300053077 Bacteria 7381
1898 Ga0495601_0008840 3300053077 Bacteria 5944
1899 Ga0495601_0033223 3300053077 Unclassified 3214
1900 Ga0495601_0092584 3300053077 Bacteria 1947
1901 Ga0495612_0006604 3300053078 Bacteria 4761
1902 Ga0495612_0007969 3300053078 Bacteria 4319
1903 Ga0495595_0000705 3300053084 Bacteria 12726
1904 Ga0495595_0006414 3300053084 Bacteria 4797
1905 Ga0495595_0045480 3300053084 Bacteria 2019
1906 Ga0495595_0056149 3300053084 Bacteria 1834
1907 Ga0495619_0000163 3300053085 Bacteria 48724
1908 Ga0495619_0000275 3300053085 Bacteria 37064
1909 Ga0495619_0004676 3300053085 Bacteria 8722
1910 Ga0495619_0006250 3300053085 Bacteria 7555
1911 Ga0495619_0007801 3300053085 Bacteria 6774
1912 Ga0495619_0034828 3300053085 Bacteria 3273
1913 Ga0500643_064094 3300053087 Bacteria 1028
1914 Ga0501084_0009170 3300054114 Bacteria 8184
1915 Ga0501084_0010017 3300054114 Bacteria 7831
1916 Ga0501084_0011104 3300054114 Bacteria 7460
1917 Ga0501084_0055248 3300054114 Bacteria 3322
1918 Ga0501084_0338980 3300054114 Bacteria 1270
1919 Ga0587073_0045526 3300059492 Bacteria 974
1920 Ga0587083_0032049 3300059505 Bacteria 1052
1921 Ga0501082_0000057 3300060353 Bacteria 79254
1922 Ga0501082_0000058 3300060353 Bacteria 78173
1923 Ga0501082_0005405 3300060353 Bacteria 11083
1924 Ga0501082_0008075 3300060353 Bacteria 9080
1925 Ga0501082_0088479 3300060353 Bacteria 2672
1926 Ga0501082_0094375 3300060353 Bacteria 2585
1927 Ga0501082_0176857 3300060353 Bacteria 1856
1928 Ga0501082_0234479 3300060353 Bacteria 1597
1929 Ga0501082_0467972 3300060353 Bacteria 1102
1930 Ga0501082_0832266 3300060353 Bacteria 807
1931 Ga0466962_0086282 3300061719 Bacteria 1503
1932 Ga0530510_0019854 3300061734 Bacteria 4775
1933 Ga0530510_0058978 3300061734 Bacteria 2776
1934 Ga0530510_0147853 3300061734 Bacteria 1734
1935 Ga0530510_0160361 3300061734 Bacteria 1663
1936 Ga0530510_0304259 3300061734 Bacteria 1193
1937 Ga0530510_0311761 3300061734 Bacteria 1178

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037466 Ga0395898_0227997 Ga0395898_0227997_17_709 230
2 3300035242 Ga0373962_0055271 Ga0373962_0055271_430_1140 236
3 3300046684 Ga0495669_0103187 Ga0495669_0103187_592_1302 236
4 3300049591 Ga0501075_0654452 Ga0501075_0654452_79_789 236
5 3300037466 Ga0395898_0409104 Ga0395898_0409104_563_1282 239
6 3300060353 Ga0501082_0832266 Ga0501082_0832266_22_741 239
7 3300041453 Ga0451797_0823541 Ga0451797_0823541_186_953 242
8 3300020080 Ga0206350_11519533 Ga0206350_115195332 244
9 3300006880 Ga0075429_100100282 Ga0075429_1001002822 249
10 3300009147 Ga0114129_10288043 Ga0114129_102880432 249
11 3300050507 nmdc:mga05p37_234794_c1 nmdc:mga05p37_234794_c1_811_1638 249
12 3300050508 nmdc:mga09592_94110_c1 nmdc:mga09592_94110_c1_832_1659 249
13 3300005445 Ga0070708_100015679 Ga0070708_1000156795 250
14 3300005471 Ga0070698_100149772 Ga0070698_1001497722 250
15 3300005614 Ga0068856_100102557 Ga0068856_1001025571 250
16 3300006871 Ga0075434_100394164 Ga0075434_1003941641 250
17 3300007076 Ga0075435_100155698 Ga0075435_1001556982 250
18 3300035090 Ga0373949_0071148 Ga0373949_0071148_11_775 250
19 3300035410 Ga0373924_0142997 Ga0373924_0142997_250_1002 250
20 3300037471 Ga0395905_0003015 Ga0395905_0003015_16059_16811 250
21 3300039437 Ga0436365_0432013 Ga0436365_0432013_11_763 250
22 3300044673 Ga0453683_0004838 Ga0453683_0004838_4296_5048 250
23 3300044673 Ga0453683_0368609 Ga0453683_0368609_17_769 250
24 3300045051 Ga0451576_0042134 Ga0451576_0042134_1091_1843 250
25 3300045051 Ga0451576_0289654 Ga0451576_0289654_852_1604 250
26 3300047673 Ga0495593_0227924 Ga0495593_0227924_139_891 250
27 3300048089 Ga0495614_0027253 Ga0495614_0027253_41_793 250
28 3300048905 Ga0496102_0361501 Ga0496102_0361501_32_784 250
29 3300048909 Ga0496106_0643797 Ga0496106_0643797_19_771 250
30 3300048910 Ga0496107_0397408 Ga0496107_0397408_10_762 250
31 3300048912 Ga0496109_0603318 Ga0496109_0603318_67_819 250
32 3300048913 Ga0496110_0641676 Ga0496110_0641676_18_770 250
33 3300049573 Ga0501037_0334638 Ga0501037_0334638_280_1035 250
34 3300049576 Ga0501040_0287031 Ga0501040_0287031_24_776 250
35 3300049580 Ga0501046_0000296 Ga0501046_0000296_49646_50398 250
36 3300049586 Ga0501070_0686547 Ga0501070_0686547_31_783 250
37 3300049588 Ga0501072_0276553 Ga0501072_0276553_546_1298 250
38 3300049743 Ga0501081_0408574 Ga0501081_0408574_232_984 250
39 3300050513 nmdc:mga0rr50_284560_c1 nmdc:mga0rr50_284560_c1_613_1365 250
40 3300050514 nmdc:mga08x19_45394_c1 nmdc:mga08x19_45394_c1_710_1462 250
41 3300050515 nmdc:mga0a205_82747_c1 nmdc:mga0a205_82747_c1_508_1263 250
42 3300060353 Ga0501082_0094375 Ga0501082_0094375_23_775 250
43 3300061734 Ga0530510_0058978 Ga0530510_0058978_2003_2764 250
44 3300061734 Ga0530510_0304259 Ga0530510_0304259_22_774 250
45 3300039437 Ga0436365_0947829 Ga0436365_0947829_224_979 251
46 3300045051 Ga0451576_0324937 Ga0451576_0324937_839_1594 251
47 3300049575 Ga0501039_0157515 Ga0501039_0157515_1010_1765 251
48 3300005467 Ga0070706_100026319 Ga0070706_1000263192 253
49 3300005471 Ga0070698_100191221 Ga0070698_1001912211 253
50 3300005518 Ga0070699_100039725 Ga0070699_1000397254 253
51 3300005536 Ga0070697_100025993 Ga0070697_1000259933 253
52 3300006852 Ga0075433_10122901 Ga0075433_101229011 253
53 3300007076 Ga0075435_100053225 Ga0075435_1000532252 253
54 3300009147 Ga0114129_10041394 Ga0114129_100413949 253
55 3300025910 Ga0207684_10010712 Ga0207684_100107128 253
56 3300050507 nmdc:mga05p37_217882_c1 nmdc:mga05p37_217882_c1_1067_1948 253
57 3300050513 nmdc:mga0rr50_132101_c1 nmdc:mga0rr50_132101_c1_84_965 253
58 3300050515 nmdc:mga0a205_131530_c1 nmdc:mga0a205_131530_c1_1198_2079 253
59 3300005435 Ga0070714_100050181 Ga0070714_1000501813 255
60 3300005563 Ga0068855_100041615 Ga0068855_1000416157 255
61 3300005616 Ga0068852_100008161 Ga0068852_1000081614 255
62 3300006844 Ga0075428_100024996 Ga0075428_1000249968 255
63 3300006847 Ga0075431_100006845 Ga0075431_10000684511 255
64 3300009147 Ga0114129_10023163 Ga0114129_100231636 255
65 3300025915 Ga0207693_10079514 Ga0207693_100795142 255
66 3300050510 nmdc:mga06r32_86175_c1 nmdc:mga06r32_86175_c1_1959_2822 255
67 3300005467 Ga0070706_100027308 Ga0070706_1000273084 256
68 3300005518 Ga0070699_100440704 Ga0070699_1004407042 256
69 3300006880 Ga0075429_100396352 Ga0075429_1003963522 256
70 3300025910 Ga0207684_10016995 Ga0207684_100169953 256
71 3300049593 Ga0501077_0181527 Ga0501077_0181527_181_1032 257
72 3300005563 Ga0068855_100013983 Ga0068855_1000139835 258
73 3300005616 Ga0068852_100012137 Ga0068852_1000121373 258
74 3300009551 Ga0105238_10021802 Ga0105238_100218027 258
75 3300025949 Ga0207667_10007621 Ga0207667_100076219 258
76 3300026116 Ga0207674_10058994 Ga0207674_100589944 258
77 3300026142 Ga0207698_10004492 Ga0207698_100044923 258
78 3300049572 Ga0501036_0290126 Ga0501036_0290126_451_1302 258
79 3300049587 Ga0501071_0030813 Ga0501071_0030813_919_1770 258
80 3300049591 Ga0501075_0268007 Ga0501075_0268007_385_1236 258
81 3300049592 Ga0501076_0012712 Ga0501076_0012712_5031_5882 258
82 3300049741 Ga0501079_0054968 Ga0501079_0054968_1227_2078 258
83 3300049824 Ga0501045_0177424 Ga0501045_0177424_318_1169 258
84 3300054114 Ga0501084_0055248 Ga0501084_0055248_733_1584 258
85 3300061734 Ga0530510_0160361 Ga0530510_0160361_631_1482 258
86 3300005445 Ga0070708_100491637 Ga0070708_1004916371 259
87 3300005468 Ga0070707_100128742 Ga0070707_1001287422 259
88 3300025922 Ga0207646_10046854 Ga0207646_100468542 259
89 3300050507 nmdc:mga05p37_801295_c1 nmdc:mga05p37_801295_c1_10_789 259
90 3300005445 Ga0070708_100055834 Ga0070708_1000558343 260
91 3300005445 Ga0070708_100159619 Ga0070708_1001596192 260
92 3300032002 Ga0307416_100051000 Ga0307416_1000510002 260
93 3300037471 Ga0395905_0054456 Ga0395905_0054456_2351_3196 260
94 3300050513 nmdc:mga0rr50_100363_c1 nmdc:mga0rr50_100363_c1_764_1546 260
95 3300009147 Ga0114129_11063869 Ga0114129_110638691 261
96 3300009551 Ga0105238_10066801 Ga0105238_100668014 261
97 3300046690 Ga0495624_0139882 Ga0495624_0139882_608_1456 261
98 3300050507 nmdc:mga05p37_694897_c1 nmdc:mga05p37_694897_c1_22_807 261
99 3300049571 Ga0501034_0059388 Ga0501034_0059388_2083_2931 262
100 3300049823 Ga0501044_0067532 Ga0501044_0067532_1356_2204 262
101 3300005458 Ga0070681_10000351 Ga0070681_100003513 263
102 3300005530 Ga0070679_100122359 Ga0070679_1001223592 263
103 3300009093 Ga0105240_10016614 Ga0105240_100166143 263
104 3300025912 Ga0207707_10001468 Ga0207707_100014683 263
105 3300025913 Ga0207695_10175264 Ga0207695_101752642 263
106 3300025921 Ga0207652_10012252 Ga0207652_100122521 263
107 3300005467 Ga0070706_100100520 Ga0070706_1001005203 265
108 3300006880 Ga0075429_100539719 Ga0075429_1005397191 266
109 3300049569 Ga0501032_0296492 Ga0501032_0296492_184_1032 266
110 3300049570 Ga0501033_0033321 Ga0501033_0033321_1654_2502 266
111 3300049572 Ga0501036_0154501 Ga0501036_0154501_450_1298 266
112 3300049579 Ga0501043_0091006 Ga0501043_0091006_875_1723 266
113 3300049580 Ga0501046_0065820 Ga0501046_0065820_480_1328 266
114 3300049585 Ga0501069_0051159 Ga0501069_0051159_994_1842 266
115 3300049592 Ga0501076_0049392 Ga0501076_0049392_2126_2974 266
116 3300050490 nmdc:mga03n38_70030_c1 nmdc:mga03n38_70030_c1_694_1539 266
117 3300050494 nmdc:mga06z11_194_c1 nmdc:mga06z11_194_c1_1632_2477 266
118 3300050495 nmdc:mga04h51_1935_c1 nmdc:mga04h51_1935_c1_1745_2590 266
119 3300003349 JGI26129J50193_1000799 JGI26129J50193_10007991 267
120 3300003371 JGI26145J50221_1005572 JGI26145J50221_10055721 267
121 3300005545 Ga0070695_100001012 Ga0070695_1000010124 267
122 3300005616 Ga0068852_100002709 Ga0068852_1000027094 267
123 3300013102 Ga0157371_10087262 Ga0157371_100872623 267
124 3300013307 Ga0157372_10181770 Ga0157372_101817702 267
125 3300013307 Ga0157372_10236084 Ga0157372_102360843 267
126 3300025910 Ga0207684_10008090 Ga0207684_100080904 267
127 3300027614 Ga0209970_1000283 Ga0209970_10002836 267
128 3300027682 Ga0209971_1000156 Ga0209971_100015612 267
129 3300027695 Ga0209966_1000165 Ga0209966_10001652 267
130 3300027717 Ga0209998_10000457 Ga0209998_100004573 267
131 3300027876 Ga0209974_10003147 Ga0209974_100031472 267
132 3300035112 Ga0373932_0049821 Ga0373932_0049821_12_821 267
133 3300042876 Ga0451577_0391498 Ga0451577_0391498_171_1010 267
134 3300045051 Ga0451576_0909607 Ga0451576_0909607_59_898 267
135 3300050507 nmdc:mga05p37_440482_c1 nmdc:mga05p37_440482_c1_695_1501 267
136 3300050512 nmdc:mga0n895_298179_c1 nmdc:mga0n895_298179_c1_207_1019 267
137 3300006941 Ga0099825_1020622 Ga0099825_10206224 268
138 3300006944 Ga0099823_1058804 Ga0099823_10588043 268
139 3300027296 Ga0209389_1000009 Ga0209389_100000947 268
140 3300027361 Ga0209489_100050 Ga0209489_10005079 268
141 3300027363 Ga0209700_100016 Ga0209700_100016187 268
142 3300035117 Ga0373953_0168672 Ga0373953_0168672_80_919 268
143 3300005327 Ga0070658_10012513 Ga0070658_100125134 269
144 3300005328 Ga0070676_10027051 Ga0070676_100270513 269
145 3300005334 Ga0068869_100006478 Ga0068869_1000064783 269
146 3300005339 Ga0070660_100016470 Ga0070660_1000164702 269
147 3300005345 Ga0070692_10026874 Ga0070692_100268743 269
148 3300005445 Ga0070708_100088189 Ga0070708_1000881892 269
149 3300005458 Ga0070681_10021769 Ga0070681_100217694 269
150 3300005467 Ga0070706_100284737 Ga0070706_1002847372 269
151 3300005468 Ga0070707_100036637 Ga0070707_1000366375 269
152 3300005468 Ga0070707_100072985 Ga0070707_1000729852 269
153 3300005471 Ga0070698_100118590 Ga0070698_1001185903 269
154 3300005518 Ga0070699_100081530 Ga0070699_1000815303 269
155 3300005530 Ga0070679_100002416 Ga0070679_1000024164 269
156 3300005536 Ga0070697_100083924 Ga0070697_1000839242 269
157 3300005545 Ga0070695_100001455 Ga0070695_1000014559 269
158 3300005546 Ga0070696_100009327 Ga0070696_1000093272 269
159 3300005546 Ga0070696_100019117 Ga0070696_1000191174 269
160 3300005577 Ga0068857_100173952 Ga0068857_1001739522 269
161 3300005616 Ga0068852_100125229 Ga0068852_1001252292 269
162 3300005718 Ga0068866_10204279 Ga0068866_102042792 269
163 3300005843 Ga0068860_100070076 Ga0068860_1000700762 269
164 3300005844 Ga0068862_100013754 Ga0068862_1000137542 269
165 3300006844 Ga0075428_100206857 Ga0075428_1002068571 269
166 3300006847 Ga0075431_100296011 Ga0075431_1002960112 269
167 3300006880 Ga0075429_100110012 Ga0075429_1001100122 269
168 3300009098 Ga0105245_10070145 Ga0105245_100701453 269
169 3300009553 Ga0105249_10138943 Ga0105249_101389433 269
170 3300013307 Ga0157372_10381984 Ga0157372_103819841 269
171 3300025885 Ga0207653_10064520 Ga0207653_100645202 269
172 3300025909 Ga0207705_10044608 Ga0207705_100446082 269
173 3300025912 Ga0207707_10096678 Ga0207707_100966781 269
174 3300025919 Ga0207657_10022238 Ga0207657_100222384 269
175 3300025921 Ga0207652_10020672 Ga0207652_100206722 269
176 3300025922 Ga0207646_10061789 Ga0207646_100617892 269
177 3300025942 Ga0207689_10009309 Ga0207689_100093097 269
178 3300025961 Ga0207712_10079422 Ga0207712_100794223 269
179 3300026075 Ga0207708_10423420 Ga0207708_104234202 269
180 3300026142 Ga0207698_10058473 Ga0207698_100584733 269
181 3300028381 Ga0268264_10095232 Ga0268264_100952323 269
182 3300031595 Ga0265313_10105469 Ga0265313_101054692 269
183 3300031712 Ga0265342_10000546 Ga0265342_1000054626 269
184 3300044673 Ga0453683_0036758 Ga0453683_0036758_599_1441 269
185 3300044673 Ga0453683_0055946 Ga0453683_0055946_421_1245 269
186 3300049570 Ga0501033_0018838 Ga0501033_0018838_1055_1882 269
187 3300049571 Ga0501034_0449044 Ga0501034_0449044_226_1080 269
188 3300049573 Ga0501037_0157916 Ga0501037_0157916_403_1230 269
189 3300049573 Ga0501037_0264320 Ga0501037_0264320_29_883 269
190 3300049575 Ga0501039_0238559 Ga0501039_0238559_197_1051 269
191 3300049576 Ga0501040_0014155 Ga0501040_0014155_2537_3364 269
192 3300049577 Ga0501041_0078455 Ga0501041_0078455_51_878 269
193 3300049581 Ga0501047_0024140 Ga0501047_0024140_1362_2210 269
194 3300049581 Ga0501047_0054383 Ga0501047_0054383_2560_3414 269
195 3300049586 Ga0501070_0184366 Ga0501070_0184366_533_1387 269
196 3300049588 Ga0501072_0056622 Ga0501072_0056622_1084_1911 269
197 3300049590 Ga0501074_0283265 Ga0501074_0283265_72_899 269
198 3300049591 Ga0501075_0008265 Ga0501075_0008265_3046_3873 269
199 3300049593 Ga0501077_0001105 Ga0501077_0001105_5037_5864 269
200 3300049741 Ga0501079_0003047 Ga0501079_0003047_3260_4087 269
201 3300049742 Ga0501080_0037417 Ga0501080_0037417_2533_3360 269
202 3300049822 Ga0501035_0410742 Ga0501035_0410742_189_1016 269
203 3300049823 Ga0501044_0385704 Ga0501044_0385704_251_1105 269
204 3300049824 Ga0501045_0203204 Ga0501045_0203204_50_877 269
205 3300050508 nmdc:mga09592_172363_c1 nmdc:mga09592_172363_c1_667_1497 269
206 3300050510 nmdc:mga06r32_315696_c1 nmdc:mga06r32_315696_c1_154_984 269
207 3300050513 nmdc:mga0rr50_133531_c1 nmdc:mga0rr50_133531_c1_564_1406 269
208 3300060353 Ga0501082_0088479 Ga0501082_0088479_248_1075 269
209 3300006844 Ga0075428_100004737 Ga0075428_1000047375 270
210 3300006846 Ga0075430_100169460 Ga0075430_1001694602 270
211 3300006847 Ga0075431_100030460 Ga0075431_1000304606 270
212 3300009147 Ga0114129_10000078 Ga0114129_1000007856 270
213 3300035398 Ga0316574_0003067 Ga0316574_0003067_895_1710 270
214 3300050507 nmdc:mga05p37_84537_c1 nmdc:mga05p37_84537_c1_169_1050 270
215 3300050508 nmdc:mga09592_387189_c1 nmdc:mga09592_387189_c1_300_1181 270
216 3300050509 nmdc:mga0qj67_16343_c1 nmdc:mga0qj67_16343_c1_1819_2700 270
217 3300050510 nmdc:mga06r32_3979_c1 nmdc:mga06r32_3979_c1_629_1510 270
218 3300060353 Ga0501082_0234479 Ga0501082_0234479_385_1239 270
219 3300005337 Ga0070682_100163673 Ga0070682_1001636732 271
220 3300005456 Ga0070678_100213803 Ga0070678_1002138032 271
221 3300005458 Ga0070681_10184526 Ga0070681_101845261 271
222 3300005549 Ga0070704_100045569 Ga0070704_1000455694 271
223 3300005577 Ga0068857_100623044 Ga0068857_1006230441 271
224 3300006852 Ga0075433_10000463 Ga0075433_1000046310 271
225 3300025912 Ga0207707_10246670 Ga0207707_102466701 271
226 3300025917 Ga0207660_10163796 Ga0207660_101637962 271
227 3300025919 Ga0207657_10285908 Ga0207657_102859082 271
228 3300025944 Ga0207661_10037002 Ga0207661_100370023 271
229 3300026116 Ga0207674_10326622 Ga0207674_103266222 271
230 3300048905 Ga0496102_0084240 Ga0496102_0084240_355_1251 271
231 3300048913 Ga0496110_0138228 Ga0496110_0138228_421_1317 271
232 3300005295 Ga0065707_10018041 Ga0065707_100180412 272
233 3300005440 Ga0070705_100020951 Ga0070705_1000209513 272
234 3300005445 Ga0070708_100015923 Ga0070708_1000159236 272
235 3300005445 Ga0070708_100064014 Ga0070708_1000640146 272
236 3300005445 Ga0070708_100445588 Ga0070708_1004455882 272
237 3300005445 Ga0070708_100480957 Ga0070708_1004809572 272
238 3300005467 Ga0070706_100072347 Ga0070706_1000723472 272
239 3300005467 Ga0070706_100140042 Ga0070706_1001400423 272
240 3300005467 Ga0070706_100228101 Ga0070706_1002281012 272
241 3300005467 Ga0070706_100314989 Ga0070706_1003149892 272
242 3300005468 Ga0070707_100014328 Ga0070707_1000143284 272
243 3300005468 Ga0070707_100052325 Ga0070707_1000523253 272
244 3300005471 Ga0070698_100015230 Ga0070698_1000152303 272
245 3300005518 Ga0070699_100029949 Ga0070699_1000299492 272
246 3300005518 Ga0070699_100068187 Ga0070699_1000681874 272
247 3300005518 Ga0070699_100231682 Ga0070699_1002316822 272
248 3300005536 Ga0070697_100135368 Ga0070697_1001353682 272
249 3300005545 Ga0070695_100261850 Ga0070695_1002618501 272
250 3300005546 Ga0070696_100023195 Ga0070696_1000231956 272
251 3300005578 Ga0068854_100191814 Ga0068854_1001918142 272
252 3300005981 Ga0081538_10009576 Ga0081538_100095765 272
253 3300006058 Ga0075432_10029808 Ga0075432_100298082 272
254 3300006163 Ga0070715_10094892 Ga0070715_100948922 272
255 3300006844 Ga0075428_100000408 Ga0075428_1000004089 272
256 3300006846 Ga0075430_100000171 Ga0075430_10000017127 272
257 3300006846 Ga0075430_100013359 Ga0075430_1000133592 272
258 3300006847 Ga0075431_100004259 Ga0075431_1000042594 272
259 3300006847 Ga0075431_100147474 Ga0075431_1001474742 272
260 3300006852 Ga0075433_10001343 Ga0075433_1000134312 272
261 3300006852 Ga0075433_10065710 Ga0075433_100657103 272
262 3300006871 Ga0075434_100002157 Ga0075434_1000021572 272
263 3300006871 Ga0075434_100008287 Ga0075434_1000082872 272
264 3300006871 Ga0075434_100437123 Ga0075434_1004371232 272
265 3300006871 Ga0075434_100492240 Ga0075434_1004922401 272
266 3300006880 Ga0075429_100000225 Ga0075429_1000002259 272
267 3300006880 Ga0075429_100098284 Ga0075429_1000982842 272
268 3300006914 Ga0075436_100031053 Ga0075436_1000310532 272
269 3300007076 Ga0075435_100007437 Ga0075435_1000074375 272
270 3300007076 Ga0075435_100102358 Ga0075435_1001023582 272
271 3300007076 Ga0075435_100113919 Ga0075435_1001139193 272
272 3300007076 Ga0075435_100164909 Ga0075435_1001649092 272
273 3300007076 Ga0075435_100376780 Ga0075435_1003767802 272
274 3300009094 Ga0111539_10001057 Ga0111539_1000105714 272
275 3300009147 Ga0114129_10005151 Ga0114129_100051516 272
276 3300009147 Ga0114129_10011047 Ga0114129_100110475 272
277 3300009147 Ga0114129_10074005 Ga0114129_100740053 272
278 3300009147 Ga0114129_10141082 Ga0114129_101410824 272
279 3300009147 Ga0114129_10236233 Ga0114129_102362332 272
280 3300013297 Ga0157378_10479410 Ga0157378_104794101 272
281 3300013297 Ga0157378_10612377 Ga0157378_106123771 272
282 3300025910 Ga0207684_10006083 Ga0207684_100060837 272
283 3300025910 Ga0207684_10039731 Ga0207684_100397313 272
284 3300025910 Ga0207684_10248042 Ga0207684_102480422 272
285 3300025922 Ga0207646_10027508 Ga0207646_100275084 272
286 3300025922 Ga0207646_10135886 Ga0207646_101358862 272
287 3300025935 Ga0207709_10257475 Ga0207709_102574752 272
288 3300025981 Ga0207640_10109691 Ga0207640_101096912 272
289 3300027907 Ga0207428_10000029 Ga0207428_10000029139 272
290 3300035088 Ga0373940_0009571 Ga0373940_0009571_1167_2015 272
291 3300035112 Ga0373932_0041685 Ga0373932_0041685_35_883 272
292 3300049570 Ga0501033_0025306 Ga0501033_0025306_1476_2327 272
293 3300049574 Ga0501038_0092061 Ga0501038_0092061_1058_1909 272
294 3300049575 Ga0501039_0053506 Ga0501039_0053506_2027_2878 272
295 3300049576 Ga0501040_0002645 Ga0501040_0002645_6246_7097 272
296 3300049577 Ga0501041_0019694 Ga0501041_0019694_1892_2743 272
297 3300049578 Ga0501042_0022622 Ga0501042_0022622_1327_2178 272
298 3300049580 Ga0501046_0004847 Ga0501046_0004847_3240_4091 272
299 3300049582 Ga0501048_0005609 Ga0501048_0005609_2747_3598 272
300 3300049587 Ga0501071_0055656 Ga0501071_0055656_1213_2064 272
301 3300049590 Ga0501074_0003133 Ga0501074_0003133_9157_10008 272
302 3300049591 Ga0501075_0424072 Ga0501075_0424072_21_872 272
303 3300049593 Ga0501077_0075690 Ga0501077_0075690_1066_1917 272
304 3300049741 Ga0501079_0003540 Ga0501079_0003540_8032_8883 272
305 3300049742 Ga0501080_0456340 Ga0501080_0456340_18_869 272
306 3300049743 Ga0501081_0001014 Ga0501081_0001014_11794_12645 272
307 3300049824 Ga0501045_0025006 Ga0501045_0025006_152_1003 272
308 3300050507 nmdc:mga05p37_134968_c1 nmdc:mga05p37_134968_c1_1941_2792 272
309 3300050507 nmdc:mga05p37_17550_c1 nmdc:mga05p37_17550_c1_3980_4828 272
310 3300050507 nmdc:mga05p37_20977_c1 nmdc:mga05p37_20977_c1_2834_3682 272
311 3300050507 nmdc:mga05p37_219934_c1 nmdc:mga05p37_219934_c1_1232_2080 272
312 3300050508 nmdc:mga09592_28720_c1 nmdc:mga09592_28720_c1_3648_4496 272
313 3300050508 nmdc:mga09592_43862_c1 nmdc:mga09592_43862_c1_315_1163 272
314 3300050508 nmdc:mga09592_542_c1 nmdc:mga09592_542_c1_5417_6265 272
315 3300050509 nmdc:mga0qj67_11505_c1 nmdc:mga0qj67_11505_c1_5530_6378 272
316 3300050510 nmdc:mga06r32_11770_c1 nmdc:mga06r32_11770_c1_2221_3069 272
317 3300050511 nmdc:mga08y16_2178_c1 nmdc:mga08y16_2178_c1_10910_11758 272
318 3300050512 nmdc:mga0n895_137479_c1 nmdc:mga0n895_137479_c1_367_1215 272
319 3300050512 nmdc:mga0n895_53004_c1 nmdc:mga0n895_53004_c1_2663_3517 272
320 3300050512 nmdc:mga0n895_8052_c1 nmdc:mga0n895_8052_c1_2686_3534 272
321 3300050513 nmdc:mga0rr50_129713_c1 nmdc:mga0rr50_129713_c1_593_1447 272
322 3300050513 nmdc:mga0rr50_168072_c1 nmdc:mga0rr50_168072_c1_739_1593 272
323 3300050513 nmdc:mga0rr50_18651_c1 nmdc:mga0rr50_18651_c1_1231_2079 272
324 3300050513 nmdc:mga0rr50_4988_c1 nmdc:mga0rr50_4988_c1_5508_6356 272
325 3300050515 nmdc:mga0a205_231059_c1 nmdc:mga0a205_231059_c1_776_1624 272
326 3300050515 nmdc:mga0a205_47030_c1 nmdc:mga0a205_47030_c1_170_1018 272
327 3300054114 Ga0501084_0009170 Ga0501084_0009170_3137_3988 272
328 3300060353 Ga0501082_0008075 Ga0501082_0008075_5757_6608 272
329 3300061734 Ga0530510_0019854 Ga0530510_0019854_2996_3847 272
330 3300003203 JGI25406J46586_10008638 JGI25406J46586_100086381 273
331 3300005289 Ga0065704_10159006 Ga0065704_101590061 273
332 3300005295 Ga0065707_10216775 Ga0065707_102167751 273
333 3300005295 Ga0065707_10259751 Ga0065707_102597511 273
334 3300005330 Ga0070690_100213148 Ga0070690_1002131482 273
335 3300005341 Ga0070691_10033523 Ga0070691_100335233 273
336 3300005353 Ga0070669_100065774 Ga0070669_1000657742 273
337 3300005353 Ga0070669_100189907 Ga0070669_1001899072 273
338 3300005436 Ga0070713_100588451 Ga0070713_1005884511 273
339 3300005438 Ga0070701_10035622 Ga0070701_100356223 273
340 3300005440 Ga0070705_100014922 Ga0070705_1000149225 273
341 3300005444 Ga0070694_100003256 Ga0070694_1000032567 273
342 3300005445 Ga0070708_100018224 Ga0070708_1000182245 273
343 3300005445 Ga0070708_100026478 Ga0070708_1000264783 273
344 3300005445 Ga0070708_100029111 Ga0070708_1000291112 273
345 3300005445 Ga0070708_100097882 Ga0070708_1000978823 273
346 3300005445 Ga0070708_100124858 Ga0070708_1001248583 273
347 3300005445 Ga0070708_100140129 Ga0070708_1001401292 273
348 3300005445 Ga0070708_100245224 Ga0070708_1002452242 273
349 3300005445 Ga0070708_100367207 Ga0070708_1003672071 273
350 3300005459 Ga0068867_100391623 Ga0068867_1003916231 273
351 3300005467 Ga0070706_100006828 Ga0070706_1000068289 273
352 3300005467 Ga0070706_100012878 Ga0070706_1000128786 273
353 3300005467 Ga0070706_100013980 Ga0070706_1000139807 273
354 3300005467 Ga0070706_100022932 Ga0070706_1000229324 273
355 3300005467 Ga0070706_100029789 Ga0070706_1000297892 273
356 3300005467 Ga0070706_100073281 Ga0070706_1000732812 273
357 3300005467 Ga0070706_100325484 Ga0070706_1003254842 273
358 3300005468 Ga0070707_100000969 Ga0070707_10000096911 273
359 3300005468 Ga0070707_100012890 Ga0070707_1000128906 273
360 3300005468 Ga0070707_100030308 Ga0070707_1000303082 273
361 3300005468 Ga0070707_100044275 Ga0070707_1000442755 273
362 3300005468 Ga0070707_100050243 Ga0070707_1000502432 273
363 3300005468 Ga0070707_100095112 Ga0070707_1000951123 273
364 3300005468 Ga0070707_100364676 Ga0070707_1003646762 273
365 3300005471 Ga0070698_100001524 Ga0070698_10000152417 273
366 3300005471 Ga0070698_100017360 Ga0070698_1000173603 273
367 3300005471 Ga0070698_100018843 Ga0070698_1000188434 273
368 3300005471 Ga0070698_100025894 Ga0070698_1000258946 273
369 3300005471 Ga0070698_100037730 Ga0070698_1000377302 273
370 3300005471 Ga0070698_100126001 Ga0070698_1001260013 273
371 3300005471 Ga0070698_100264504 Ga0070698_1002645042 273
372 3300005518 Ga0070699_100005895 Ga0070699_10000589510 273
373 3300005518 Ga0070699_100011170 Ga0070699_1000111703 273
374 3300005518 Ga0070699_100015130 Ga0070699_1000151307 273
375 3300005518 Ga0070699_100022852 Ga0070699_1000228522 273
376 3300005518 Ga0070699_100195165 Ga0070699_1001951652 273
377 3300005518 Ga0070699_100269851 Ga0070699_1002698512 273
378 3300005518 Ga0070699_100502217 Ga0070699_1005022171 273
379 3300005536 Ga0070697_100005557 Ga0070697_1000055577 273
380 3300005536 Ga0070697_100008721 Ga0070697_1000087213 273
381 3300005536 Ga0070697_100009117 Ga0070697_1000091177 273
382 3300005536 Ga0070697_100035440 Ga0070697_1000354402 273
383 3300005544 Ga0070686_100469005 Ga0070686_1004690051 273
384 3300005545 Ga0070695_100006069 Ga0070695_1000060694 273
385 3300005545 Ga0070695_100328174 Ga0070695_1003281741 273
386 3300005549 Ga0070704_100055023 Ga0070704_1000550232 273
387 3300005577 Ga0068857_100192461 Ga0068857_1001924612 273
388 3300005618 Ga0068864_100292580 Ga0068864_1002925802 273
389 3300005618 Ga0068864_100422607 Ga0068864_1004226072 273
390 3300005843 Ga0068860_100076225 Ga0068860_1000762253 273
391 3300005843 Ga0068860_100352996 Ga0068860_1003529962 273
392 3300005843 Ga0068860_100500873 Ga0068860_1005008732 273
393 3300005844 Ga0068862_100054541 Ga0068862_1000545412 273
394 3300005844 Ga0068862_100450811 Ga0068862_1004508111 273
395 3300005937 Ga0081455_10000319 Ga0081455_1000031968 273
396 3300005983 Ga0081540_1005976 Ga0081540_10059763 273
397 3300005983 Ga0081540_1023538 Ga0081540_10235383 273
398 3300005985 Ga0081539_10000009 Ga0081539_10000009108 273
399 3300006058 Ga0075432_10010802 Ga0075432_100108023 273
400 3300006175 Ga0070712_100002056 Ga0070712_10000205610 273
401 3300006844 Ga0075428_100000845 Ga0075428_10000084512 273
402 3300006844 Ga0075428_100001296 Ga0075428_1000012962 273
403 3300006844 Ga0075428_100024251 Ga0075428_1000242513 273
404 3300006844 Ga0075428_100054078 Ga0075428_1000540783 273
405 3300006844 Ga0075428_100206429 Ga0075428_1002064291 273
406 3300006846 Ga0075430_100003321 Ga0075430_10000332113 273
407 3300006847 Ga0075431_100004533 Ga0075431_1000045333 273
408 3300006847 Ga0075431_100006819 Ga0075431_1000068192 273
409 3300006847 Ga0075431_100136819 Ga0075431_1001368193 273
410 3300006847 Ga0075431_100708872 Ga0075431_1007088722 273
411 3300006852 Ga0075433_10002784 Ga0075433_1000278411 273
412 3300006852 Ga0075433_10002853 Ga0075433_1000285310 273
413 3300006852 Ga0075433_10018059 Ga0075433_100180594 273
414 3300006852 Ga0075433_10020023 Ga0075433_100200234 273
415 3300006852 Ga0075433_10023475 Ga0075433_100234756 273
416 3300006852 Ga0075433_10077665 Ga0075433_100776653 273
417 3300006852 Ga0075433_10133924 Ga0075433_101339242 273
418 3300006852 Ga0075433_10335445 Ga0075433_103354452 273
419 3300006852 Ga0075433_10338480 Ga0075433_103384802 273
420 3300006871 Ga0075434_100000334 Ga0075434_1000003348 273
421 3300006871 Ga0075434_100008015 Ga0075434_1000080154 273
422 3300006871 Ga0075434_100018304 Ga0075434_1000183047 273
423 3300006871 Ga0075434_100025321 Ga0075434_1000253214 273
424 3300006871 Ga0075434_100056363 Ga0075434_1000563634 273
425 3300006871 Ga0075434_100141207 Ga0075434_1001412072 273
426 3300006871 Ga0075434_100142079 Ga0075434_1001420792 273
427 3300006871 Ga0075434_100175523 Ga0075434_1001755231 273
428 3300006871 Ga0075434_100242980 Ga0075434_1002429802 273
429 3300006871 Ga0075434_100259437 Ga0075434_1002594372 273
430 3300006880 Ga0075429_100000346 Ga0075429_1000003469 273
431 3300006880 Ga0075429_100007371 Ga0075429_1000073714 273
432 3300006880 Ga0075429_100015108 Ga0075429_1000151085 273
433 3300006880 Ga0075429_100021836 Ga0075429_1000218366 273
434 3300006880 Ga0075429_100021963 Ga0075429_1000219638 273
435 3300006880 Ga0075429_100027333 Ga0075429_1000273331 273
436 3300006880 Ga0075429_100323789 Ga0075429_1003237892 273
437 3300006914 Ga0075436_100004283 Ga0075436_1000042838 273
438 3300006914 Ga0075436_100010957 Ga0075436_1000109575 273
439 3300007076 Ga0075435_100004427 Ga0075435_1000044277 273
440 3300007076 Ga0075435_100015104 Ga0075435_1000151044 273
441 3300007076 Ga0075435_100046588 Ga0075435_1000465882 273
442 3300007076 Ga0075435_100141648 Ga0075435_1001416482 273
443 3300007076 Ga0075435_100168835 Ga0075435_1001688352 273
444 3300007265 Ga0099794_10001793 Ga0099794_100017932 273
445 3300007265 Ga0099794_10008570 Ga0099794_100085704 273
446 3300007265 Ga0099794_10114268 Ga0099794_101142682 273
447 3300009092 Ga0105250_10094965 Ga0105250_100949651 273
448 3300009094 Ga0111539_10001170 Ga0111539_1000117037 273
449 3300009094 Ga0111539_10024524 Ga0111539_100245243 273
450 3300009094 Ga0111539_10169149 Ga0111539_101691492 273
451 3300009147 Ga0114129_10000647 Ga0114129_1000064747 273
452 3300009147 Ga0114129_10003138 Ga0114129_100031386 273
453 3300009147 Ga0114129_10028852 Ga0114129_100288527 273
454 3300009147 Ga0114129_10031475 Ga0114129_100314754 273
455 3300009147 Ga0114129_10046047 Ga0114129_100460473 273
456 3300009147 Ga0114129_10050508 Ga0114129_100505082 273
457 3300009147 Ga0114129_10061146 Ga0114129_100611463 273
458 3300009147 Ga0114129_10082125 Ga0114129_100821252 273
459 3300009147 Ga0114129_10159383 Ga0114129_101593832 273
460 3300009147 Ga0114129_10267453 Ga0114129_102674532 273
461 3300009147 Ga0114129_10378543 Ga0114129_103785431 273
462 3300009147 Ga0114129_10380358 Ga0114129_103803582 273
463 3300009147 Ga0114129_10466017 Ga0114129_104660172 273
464 3300009147 Ga0114129_10672716 Ga0114129_106727162 273
465 3300009148 Ga0105243_10148238 Ga0105243_101482382 273
466 3300009176 Ga0105242_10537723 Ga0105242_105377232 273
467 3300013297 Ga0157378_10145455 Ga0157378_101454552 273
468 3300013308 Ga0157375_10288873 Ga0157375_102888732 273
469 3300013308 Ga0157375_10455684 Ga0157375_104556842 273
470 3300014326 Ga0157380_10045262 Ga0157380_100452623 273
471 3300014968 Ga0157379_10296756 Ga0157379_102967562 273
472 3300025899 Ga0207642_10182080 Ga0207642_101820802 273
473 3300025910 Ga0207684_10000410 Ga0207684_100004108 273
474 3300025910 Ga0207684_10003453 Ga0207684_100034532 273
475 3300025910 Ga0207684_10010224 Ga0207684_100102243 273
476 3300025910 Ga0207684_10012128 Ga0207684_100121286 273
477 3300025910 Ga0207684_10034918 Ga0207684_100349183 273
478 3300025910 Ga0207684_10045817 Ga0207684_100458171 273
479 3300025910 Ga0207684_10124086 Ga0207684_101240862 273
480 3300025910 Ga0207684_10188241 Ga0207684_101882412 273
481 3300025915 Ga0207693_10008258 Ga0207693_100082586 273
482 3300025916 Ga0207663_10104392 Ga0207663_101043922 273
483 3300025918 Ga0207662_10163303 Ga0207662_101633031 273
484 3300025922 Ga0207646_10000188 Ga0207646_1000018821 273
485 3300025922 Ga0207646_10017237 Ga0207646_100172376 273
486 3300025922 Ga0207646_10017777 Ga0207646_100177774 273
487 3300025922 Ga0207646_10020895 Ga0207646_100208954 273
488 3300025922 Ga0207646_10151724 Ga0207646_101517242 273
489 3300025922 Ga0207646_10316057 Ga0207646_103160572 273
490 3300025939 Ga0207665_10001562 Ga0207665_1000156212 273
491 3300025939 Ga0207665_10106369 Ga0207665_101063692 273
492 3300025961 Ga0207712_10013685 Ga0207712_100136853 273
493 3300026041 Ga0207639_10197678 Ga0207639_101976782 273
494 3300026088 Ga0207641_10785855 Ga0207641_107858551 273
495 3300026089 Ga0207648_10257595 Ga0207648_102575952 273
496 3300026116 Ga0207674_10080518 Ga0207674_100805181 273
497 3300026118 Ga0207675_100415266 Ga0207675_1004152661 273
498 3300027665 Ga0209983_1001943 Ga0209983_10019432 273
499 3300027671 Ga0209588_1036620 Ga0209588_10366202 273
500 3300027876 Ga0209974_10030644 Ga0209974_100306441 273
501 3300027907 Ga0207428_10000138 Ga0207428_1000013866 273
502 3300028380 Ga0268265_10177159 Ga0268265_101771592 273
503 3300028381 Ga0268264_10139012 Ga0268264_101390121 273
504 3300028381 Ga0268264_10488412 Ga0268264_104884122 273
505 3300031548 Ga0307408_100038804 Ga0307408_1000388044 273
506 3300031852 Ga0307410_10277840 Ga0307410_102778402 273
507 3300034819 Ga0373958_0009862 Ga0373958_0009862_502_1374 273
508 3300035088 Ga0373940_0000985 Ga0373940_0000985_2216_3088 273
509 3300035090 Ga0373949_0022601 Ga0373949_0022601_364_1236 273
510 3300035241 Ga0373961_0006257 Ga0373961_0006257_168_1040 273
511 3300035691 Ga0373931_0057270 Ga0373931_0057270_556_1428 273
512 3300037312 Ga0395899_0009066 Ga0395899_0009066_5895_6764 273
513 3300037418 Ga0395900_0006261 Ga0395900_0006261_7171_8034 273
514 3300037418 Ga0395900_0018450 Ga0395900_0018450_2231_3064 273
515 3300037418 Ga0395900_0037846 Ga0395900_0037846_959_1828 273
516 3300037466 Ga0395898_0014161 Ga0395898_0014161_2895_3764 273
517 3300037466 Ga0395898_0022282 Ga0395898_0022282_81_944 273
518 3300037466 Ga0395898_0030714 Ga0395898_0030714_962_1795 273
519 3300037466 Ga0395898_0132384 Ga0395898_0132384_46_903 273
520 3300037853 Ga0436364_0814945 Ga0436364_0814945_14_850 273
521 3300038443 Ga0395901_0000399 Ga0395901_0000399_34643_35512 273
522 3300038443 Ga0395901_0012627 Ga0395901_0012627_1258_2091 273
523 3300039437 Ga0436365_0314347 Ga0436365_0314347_1760_2596 273
524 3300039453 Ga0436362_0031537 Ga0436362_0031537_1222_2058 273
525 3300042439 Ga0439464_0052949 Ga0439464_0052949_265_1140 273
526 3300042461 Ga0439460_0002299 Ga0439460_0002299_1750_2625 273
527 3300042876 Ga0451577_0395646 Ga0451577_0395646_287_1159 273
528 3300044673 Ga0453683_0007096 Ga0453683_0007096_3982_4839 273
529 3300044673 Ga0453683_0035213 Ga0453683_0035213_296_1153 273
530 3300044673 Ga0453683_0035755 Ga0453683_0035755_1991_2863 273
531 3300044712 Ga0453684_0678606 Ga0453684_0678606_76_948 273
532 3300045051 Ga0451576_0008459 Ga0451576_0008459_9922_10794 273
533 3300045051 Ga0451576_0058725 Ga0451576_0058725_1831_2703 273
534 3300045051 Ga0451576_0065900 Ga0451576_0065900_1569_2429 273
535 3300046472 Ga0495580_0027197 Ga0495580_0027197_2405_3265 273
536 3300046528 Ga0495642_0035593 Ga0495642_0035593_358_1218 273
537 3300046678 Ga0495599_0354994 Ga0495599_0354994_31_852 273
538 3300048915 Ga0496112_0059384 Ga0496112_0059384_54_932 273
539 3300049576 Ga0501040_0002919 Ga0501040_0002919_758_1633 273
540 3300049579 Ga0501043_0160795 Ga0501043_0160795_644_1519 273
541 3300049581 Ga0501047_0389463 Ga0501047_0389463_181_1029 273
542 3300049582 Ga0501048_0005778 Ga0501048_0005778_71_943 273
543 3300049585 Ga0501069_0023829 Ga0501069_0023829_1690_2562 273
544 3300049588 Ga0501072_0193912 Ga0501072_0193912_266_1087 273
545 3300049590 Ga0501074_0004836 Ga0501074_0004836_983_1858 273
546 3300049591 Ga0501075_0229253 Ga0501075_0229253_10_882 273
547 3300049591 Ga0501075_0449015 Ga0501075_0449015_69_926 273
548 3300049592 Ga0501076_0081709 Ga0501076_0081709_23_844 273
549 3300049592 Ga0501076_0190747 Ga0501076_0190747_517_1389 273
550 3300049593 Ga0501077_0230564 Ga0501077_0230564_150_1025 273
551 3300049743 Ga0501081_0039299 Ga0501081_0039299_1705_2526 273
552 3300049743 Ga0501081_0345127 Ga0501081_0345127_138_1067 273
553 3300049744 Ga0501083_0007166 Ga0501083_0007166_965_1840 273
554 3300049824 Ga0501045_0010760 Ga0501045_0010760_5327_6202 273
555 3300050507 nmdc:mga05p37_11330_c1 nmdc:mga05p37_11330_c1_4014_4898 273
556 3300050507 nmdc:mga05p37_13057_c1 nmdc:mga05p37_13057_c1_4772_5629 273
557 3300050507 nmdc:mga05p37_223129_c1 nmdc:mga05p37_223129_c1_1031_1900 273
558 3300050507 nmdc:mga05p37_38_c1 nmdc:mga05p37_38_c1_62782_63666 273
559 3300050507 nmdc:mga05p37_43900_c1 nmdc:mga05p37_43900_c1_1173_2066 273
560 3300050507 nmdc:mga05p37_56012_c1 nmdc:mga05p37_56012_c1_2659_3519 273
561 3300050507 nmdc:mga05p37_6261_c1 nmdc:mga05p37_6261_c1_949_1809 273
562 3300050507 nmdc:mga05p37_663061_c1 nmdc:mga05p37_663061_c1_133_1017 273
563 3300050507 nmdc:mga05p37_66846_c1 nmdc:mga05p37_66846_c1_363_1235 273
564 3300050507 nmdc:mga05p37_71040_c1 nmdc:mga05p37_71040_c1_11_871 273
565 3300050507 nmdc:mga05p37_74990_c1 nmdc:mga05p37_74990_c1_2749_3621 273
566 3300050507 nmdc:mga05p37_888_c1 nmdc:mga05p37_888_c1_19168_20052 273
567 3300050508 nmdc:mga09592_11651_c1 nmdc:mga09592_11651_c1_118_1002 273
568 3300050508 nmdc:mga09592_23317_c1 nmdc:mga09592_23317_c1_1336_2196 273
569 3300050508 nmdc:mga09592_35560_c1 nmdc:mga09592_35560_c1_2106_2999 273
570 3300050508 nmdc:mga09592_5319_c1 nmdc:mga09592_5319_c1_3271_4143 273
571 3300050509 nmdc:mga0qj67_3904_c1 nmdc:mga0qj67_3904_c1_8135_9004 273
572 3300050509 nmdc:mga0qj67_7208_c1 nmdc:mga0qj67_7208_c1_2284_3156 273
573 3300050510 nmdc:mga06r32_122019_c1 nmdc:mga06r32_122019_c1_1089_1973 273
574 3300050510 nmdc:mga06r32_299_c1 nmdc:mga06r32_299_c1_24597_25481 273
575 3300050510 nmdc:mga06r32_41309_c1 nmdc:mga06r32_41309_c1_784_1653 273
576 3300050510 nmdc:mga06r32_552412_c1 nmdc:mga06r32_552412_c1_119_979 273
577 3300050511 nmdc:mga08y16_20211_c1 nmdc:mga08y16_20211_c1_5090_5983 273
578 3300050511 nmdc:mga08y16_25433_c1 nmdc:mga08y16_25433_c1_1121_1993 273
579 3300050512 nmdc:mga0n895_10572_c1 nmdc:mga0n895_10572_c1_6012_6896 273
580 3300050512 nmdc:mga0n895_120593_c1 nmdc:mga0n895_120593_c1_639_1499 273
581 3300050512 nmdc:mga0n895_17520_c1 nmdc:mga0n895_17520_c1_2130_3002 273
582 3300050512 nmdc:mga0n895_207618_c1 nmdc:mga0n895_207618_c1_370_1227 273
583 3300050512 nmdc:mga0n895_267330_c1 nmdc:mga0n895_267330_c1_499_1383 273
584 3300050512 nmdc:mga0n895_38126_c1 nmdc:mga0n895_38126_c1_1496_2356 273
585 3300050512 nmdc:mga0n895_44151_c1 nmdc:mga0n895_44151_c1_1982_2839 273
586 3300050512 nmdc:mga0n895_5287_c1 nmdc:mga0n895_5287_c1_8299_9156 273
587 3300050512 nmdc:mga0n895_92725_c1 nmdc:mga0n895_92725_c1_439_1308 273
588 3300050512 nmdc:mga0n895_93891_c1 nmdc:mga0n895_93891_c1_822_1682 273
589 3300050513 nmdc:mga0rr50_157141_c1 nmdc:mga0rr50_157141_c1_503_1357 273
590 3300050513 nmdc:mga0rr50_1781_c1 nmdc:mga0rr50_1781_c1_7829_8689 273
591 3300050513 nmdc:mga0rr50_197_c1 nmdc:mga0rr50_197_c1_9576_10460 273
592 3300050513 nmdc:mga0rr50_204960_c1 nmdc:mga0rr50_204960_c1_344_1216 273
593 3300050513 nmdc:mga0rr50_2540_c1 nmdc:mga0rr50_2540_c1_4179_5039 273
594 3300050513 nmdc:mga0rr50_35065_c1 nmdc:mga0rr50_35065_c1_2233_3096 273
595 3300050513 nmdc:mga0rr50_3780_c1 nmdc:mga0rr50_3780_c1_5069_5926 273
596 3300050513 nmdc:mga0rr50_84426_c1 nmdc:mga0rr50_84426_c1_1226_2083 273
597 3300050514 nmdc:mga08x19_22602_c1 nmdc:mga08x19_22602_c1_2398_3255 273
598 3300050514 nmdc:mga08x19_2564_c1 nmdc:mga08x19_2564_c1_3521_4405 273
599 3300050514 nmdc:mga08x19_56286_c1 nmdc:mga08x19_56286_c1_1159_2013 273
600 3300050515 nmdc:mga0a205_140_c1 nmdc:mga0a205_140_c1_30251_31135 273
601 3300050515 nmdc:mga0a205_20885_c1 nmdc:mga0a205_20885_c1_4312_5172 273
602 3300050515 nmdc:mga0a205_309761_c1 nmdc:mga0a205_309761_c1_223_1092 273
603 3300050515 nmdc:mga0a205_36144_c1 nmdc:mga0a205_36144_c1_2325_3182 273
604 3300050515 nmdc:mga0a205_426_c1 nmdc:mga0a205_426_c1_7925_8797 273
605 3300050515 nmdc:mga0a205_47008_c1 nmdc:mga0a205_47008_c1_273_1166 273
606 3300054114 Ga0501084_0010017 Ga0501084_0010017_5990_6865 273
607 3300060353 Ga0501082_0000058 Ga0501082_0000058_14220_15095 273
608 3300060353 Ga0501082_0467972 Ga0501082_0467972_204_1061 273
609 3300061734 Ga0530510_0147853 Ga0530510_0147853_344_1165 273
610 iso_pu_bacteria 2508501128 2509149194 273
611 iso_pu_bacteria 2513237098 2513679288 273
612 iso_pu_bacteria 2728368998 2728754506 273
613 iso_pu_bacteria 2842038055 2842038452 273
614 iso_pu_bacteria 2842045827 2842048603 273
615 iso_pu_bacteria 2847930680 2847938023 273
616 iso_pu_bacteria 2847930680 2847938919 273
617 iso_pu_bacteria 2874590934 2874596514 273
618 iso_pu_bacteria 2874645413 2874653252 273
619 iso_pu_bacteria 2876761206 2876762670 273
620 iso_pu_bacteria 2876761206 2876764177 273
621 iso_pu_bacteria 2876771140 2876777190 273
622 iso_pu_bacteria 2876818435 2876825060 273
623 iso_pu_bacteria 2879074833 2879081327 273
624 iso_pu_bacteria 2879083081 2879084430 273
625 iso_pu_bacteria 2879127579 2879129772 273
626 iso_pu_bacteria 2879142872 2879147720 273
627 iso_pu_bacteria 2881665667 2881670827 273
628 iso_pu_bacteria 2885374607 2885375629 273
629 iso_pu_bacteria 2885409591 2885412904 273
630 iso_pu_bacteria 2906643746 2906647080 273
631 iso_pu_bacteria 2922361189 2922362725 273
632 iso_pu_bacteria 2935769743 2935774490 273
633 iso_pu_bacteria 2935785616 2935789494 273
634 iso_pu_bacteria 2935793552 2935797463 273
635 iso_pu_bacteria 2941531003 2941533954 273
636 iso_pu_bacteria 8016622563 8016629757 273
637 iso_pu_bacteria 8019538911 8019541576 273
638 iso_pu_bacteria 8019648815 8019656731 273
639 3300005518 Ga0070699_100132566 Ga0070699_1001325662 274
640 3300007076 Ga0075435_100126440 Ga0075435_1001264402 274
641 3300035112 Ga0373932_0013728 Ga0373932_0013728_542_1378 274
642 iso_pu_bacteria 2887375801 2887379190 274
643 3300005329 Ga0070683_100072455 Ga0070683_1000724553 275
644 3300005336 Ga0070680_100127592 Ga0070680_1001275922 275
645 3300005337 Ga0070682_100009292 Ga0070682_1000092924 275
646 3300005366 Ga0070659_100491081 Ga0070659_1004910811 275
647 3300005458 Ga0070681_10016367 Ga0070681_100163675 275
648 3300005458 Ga0070681_10249711 Ga0070681_102497113 275
649 3300005530 Ga0070679_100029556 Ga0070679_1000295564 275
650 3300005535 Ga0070684_100056405 Ga0070684_1000564053 275
651 3300005547 Ga0070693_100066419 Ga0070693_1000664193 275
652 3300005578 Ga0068854_100298253 Ga0068854_1002982532 275
653 3300005614 Ga0068856_100000255 Ga0068856_10000025530 275
654 3300005614 Ga0068856_100304095 Ga0068856_1003040952 275
655 3300009093 Ga0105240_10076166 Ga0105240_100761663 275
656 3300009174 Ga0105241_10040391 Ga0105241_100403914 275
657 3300009551 Ga0105238_10144966 Ga0105238_101449663 275
658 3300010375 Ga0105239_10842581 Ga0105239_108425812 275
659 3300013307 Ga0157372_10234839 Ga0157372_102348392 275
660 3300025912 Ga0207707_10000597 Ga0207707_1000059723 275
661 3300025912 Ga0207707_10039738 Ga0207707_100397384 275
662 3300025912 Ga0207707_10113428 Ga0207707_101134283 275
663 3300025912 Ga0207707_10230402 Ga0207707_102304023 275
664 3300025917 Ga0207660_10055327 Ga0207660_100553272 275
665 3300025917 Ga0207660_10088122 Ga0207660_100881223 275
666 3300025921 Ga0207652_10020524 Ga0207652_100205244 275
667 3300025944 Ga0207661_10005278 Ga0207661_100052782 275
668 3300025981 Ga0207640_10045142 Ga0207640_100451422 275
669 3300026041 Ga0207639_10649786 Ga0207639_106497861 275
670 3300026078 Ga0207702_10000390 Ga0207702_1000039028 275
671 3300045976 Ga0466967_0046414 Ga0466967_0046414_1712_2554 275
672 3300046477 Ga0495664_0037563 Ga0495664_0037563_1223_2065 275
673 3300046543 Ga0495645_0019129 Ga0495645_0019129_3882_4724 275
674 3300046678 Ga0495599_0113860 Ga0495599_0113860_564_1406 275
675 3300053077 Ga0495601_0005515 Ga0495601_0005515_6079_6921 275
676 3300001990 JGI24737J22298_10027830 JGI24737J22298_100278302 276
677 3300003203 JGI25406J46586_10011476 JGI25406J46586_100114764 276
678 3300005290 Ga0065712_10108870 Ga0065712_101088701 276
679 3300005293 Ga0065715_10093584 Ga0065715_100935843 276
680 3300005327 Ga0070658_10057646 Ga0070658_100576463 276
681 3300005328 Ga0070676_10000715 Ga0070676_1000071514 276
682 3300005329 Ga0070683_100042902 Ga0070683_1000429024 276
683 3300005329 Ga0070683_100057597 Ga0070683_1000575973 276
684 3300005331 Ga0070670_100001169 Ga0070670_10000116914 276
685 3300005334 Ga0068869_100000046 Ga0068869_10000004622 276
686 3300005334 Ga0068869_100000625 Ga0068869_1000006259 276
687 3300005336 Ga0070680_100000543 Ga0070680_10000054312 276
688 3300005336 Ga0070680_100003007 Ga0070680_1000030072 276
689 3300005336 Ga0070680_100009795 Ga0070680_1000097956 276
690 3300005336 Ga0070680_100184409 Ga0070680_1001844092 276
691 3300005338 Ga0068868_100003952 Ga0068868_10000395214 276
692 3300005339 Ga0070660_100001288 Ga0070660_1000012887 276
693 3300005339 Ga0070660_100072741 Ga0070660_1000727413 276
694 3300005340 Ga0070689_100000277 Ga0070689_1000002771 276
695 3300005340 Ga0070689_100014350 Ga0070689_1000143502 276
696 3300005340 Ga0070689_100038125 Ga0070689_1000381252 276
697 3300005341 Ga0070691_10000467 Ga0070691_100004672 276
698 3300005341 Ga0070691_10005169 Ga0070691_100051693 276
699 3300005343 Ga0070687_100000259 Ga0070687_1000002592 276
700 3300005344 Ga0070661_100000498 Ga0070661_10000049814 276
701 3300005344 Ga0070661_100088296 Ga0070661_1000882961 276
702 3300005345 Ga0070692_10003634 Ga0070692_100036347 276
703 3300005345 Ga0070692_10068699 Ga0070692_100686992 276
704 3300005353 Ga0070669_100063120 Ga0070669_1000631203 276
705 3300005354 Ga0070675_100139943 Ga0070675_1001399432 276
706 3300005366 Ga0070659_100000770 Ga0070659_10000077016 276
707 3300005406 Ga0070703_10019167 Ga0070703_100191673 276
708 3300005434 Ga0070709_10357042 Ga0070709_103570421 276
709 3300005436 Ga0070713_100027640 Ga0070713_1000276401 276
710 3300005436 Ga0070713_100163252 Ga0070713_1001632522 276
711 3300005438 Ga0070701_10027225 Ga0070701_100272253 276
712 3300005440 Ga0070705_100000479 Ga0070705_10000047923 276
713 3300005440 Ga0070705_100001494 Ga0070705_1000014942 276
714 3300005440 Ga0070705_100057908 Ga0070705_1000579083 276
715 3300005441 Ga0070700_100001100 Ga0070700_1000011009 276
716 3300005444 Ga0070694_100000062 Ga0070694_10000006221 276
717 3300005444 Ga0070694_100000765 Ga0070694_1000007657 276
718 3300005444 Ga0070694_100218781 Ga0070694_1002187812 276
719 3300005445 Ga0070708_100018821 Ga0070708_1000188216 276
720 3300005445 Ga0070708_100073087 Ga0070708_1000730872 276
721 3300005455 Ga0070663_100001206 Ga0070663_1000012063 276
722 3300005457 Ga0070662_100001806 Ga0070662_1000018067 276
723 3300005458 Ga0070681_10002521 Ga0070681_1000252114 276
724 3300005458 Ga0070681_10209905 Ga0070681_102099051 276
725 3300005458 Ga0070681_10220861 Ga0070681_102208612 276
726 3300005459 Ga0068867_100001575 Ga0068867_1000015759 276
727 3300005459 Ga0068867_100001951 Ga0068867_1000019513 276
728 3300005467 Ga0070706_100021203 Ga0070706_1000212034 276
729 3300005468 Ga0070707_100014834 Ga0070707_1000148344 276
730 3300005468 Ga0070707_100029699 Ga0070707_1000296991 276
731 3300005468 Ga0070707_100216264 Ga0070707_1002162641 276
732 3300005471 Ga0070698_100025496 Ga0070698_1000254965 276
733 3300005518 Ga0070699_100002285 Ga0070699_1000022858 276
734 3300005530 Ga0070679_100009240 Ga0070679_1000092403 276
735 3300005530 Ga0070679_100015133 Ga0070679_1000151337 276
736 3300005530 Ga0070679_100078780 Ga0070679_1000787803 276
737 3300005530 Ga0070679_100378255 Ga0070679_1003782551 276
738 3300005535 Ga0070684_100012514 Ga0070684_1000125144 276
739 3300005535 Ga0070684_100021076 Ga0070684_1000210767 276
740 3300005536 Ga0070697_100018933 Ga0070697_1000189331 276
741 3300005536 Ga0070697_100208914 Ga0070697_1002089142 276
742 3300005539 Ga0068853_100001310 Ga0068853_1000013107 276
743 3300005539 Ga0068853_100077846 Ga0068853_1000778461 276
744 3300005544 Ga0070686_100000257 Ga0070686_1000002572 276
745 3300005545 Ga0070695_100000721 Ga0070695_1000007212 276
746 3300005545 Ga0070695_100001786 Ga0070695_1000017862 276
747 3300005546 Ga0070696_100000126 Ga0070696_10000012623 276
748 3300005546 Ga0070696_100001214 Ga0070696_10000121412 276
749 3300005547 Ga0070693_100000908 Ga0070693_1000009087 276
750 3300005547 Ga0070693_100001337 Ga0070693_10000133715 276
751 3300005549 Ga0070704_100000394 Ga0070704_10000039419 276
752 3300005549 Ga0070704_100001188 Ga0070704_10000118810 276
753 3300005563 Ga0068855_100000888 Ga0068855_10000088820 276
754 3300005563 Ga0068855_100001752 Ga0068855_1000017522 276
755 3300005564 Ga0070664_100001313 Ga0070664_1000013138 276
756 3300005564 Ga0070664_100201957 Ga0070664_1002019572 276
757 3300005577 Ga0068857_100001705 Ga0068857_10000170522 276
758 3300005577 Ga0068857_100011958 Ga0068857_1000119587 276
759 3300005578 Ga0068854_100004710 Ga0068854_1000047103 276
760 3300005578 Ga0068854_100087557 Ga0068854_1000875572 276
761 3300005614 Ga0068856_100001431 Ga0068856_10000143110 276
762 3300005614 Ga0068856_100021593 Ga0068856_1000215938 276
763 3300005614 Ga0068856_100088759 Ga0068856_1000887592 276
764 3300005615 Ga0070702_100000026 Ga0070702_10000002613 276
765 3300005615 Ga0070702_100152311 Ga0070702_1001523111 276
766 3300005617 Ga0068859_100000922 Ga0068859_10000092214 276
767 3300005617 Ga0068859_100003441 Ga0068859_10000344120 276
768 3300005618 Ga0068864_100038998 Ga0068864_1000389984 276
769 3300005718 Ga0068866_10046235 Ga0068866_100462352 276
770 3300005719 Ga0068861_100187060 Ga0068861_1001870602 276
771 3300005834 Ga0068851_10011354 Ga0068851_100113544 276
772 3300005840 Ga0068870_10004066 Ga0068870_100040665 276
773 3300005841 Ga0068863_100003390 Ga0068863_1000033906 276
774 3300005842 Ga0068858_100067787 Ga0068858_1000677873 276
775 3300005843 Ga0068860_100008428 Ga0068860_1000084288 276
776 3300005843 Ga0068860_100139112 Ga0068860_1001391123 276
777 3300005844 Ga0068862_100108619 Ga0068862_1001086192 276
778 3300005937 Ga0081455_10000052 Ga0081455_1000005225 276
779 3300005985 Ga0081539_10000050 Ga0081539_10000050231 276
780 3300006028 Ga0070717_10119917 Ga0070717_101199173 276
781 3300006173 Ga0070716_100127377 Ga0070716_1001273771 276
782 3300006237 Ga0097621_100000759 Ga0097621_10000075912 276
783 3300006358 Ga0068871_100086031 Ga0068871_1000860312 276
784 3300006844 Ga0075428_100074468 Ga0075428_1000744682 276
785 3300006844 Ga0075428_100633212 Ga0075428_1006332122 276
786 3300006847 Ga0075431_100027525 Ga0075431_1000275255 276
787 3300006847 Ga0075431_100055122 Ga0075431_1000551224 276
788 3300006847 Ga0075431_100386405 Ga0075431_1003864051 276
789 3300006852 Ga0075433_10007848 Ga0075433_100078489 276
790 3300006852 Ga0075433_10034370 Ga0075433_100343702 276
791 3300006852 Ga0075433_10045911 Ga0075433_100459114 276
792 3300006852 Ga0075433_10106776 Ga0075433_101067762 276
793 3300006852 Ga0075433_10117157 Ga0075433_101171572 276
794 3300006871 Ga0075434_100000108 Ga0075434_10000010836 276
795 3300006871 Ga0075434_100000254 Ga0075434_10000025426 276
796 3300006871 Ga0075434_100208171 Ga0075434_1002081712 276
797 3300006880 Ga0075429_100001131 Ga0075429_10000113111 276
798 3300006881 Ga0068865_100000559 Ga0068865_1000005592 276
799 3300006914 Ga0075436_100002541 Ga0075436_1000025414 276
800 3300006914 Ga0075436_100066997 Ga0075436_1000669972 276
801 3300006914 Ga0075436_100139638 Ga0075436_1001396382 276
802 3300006931 Ga0097620_100000922 Ga0097620_10000092214 276
803 3300006931 Ga0097620_100003441 Ga0097620_1000034412 276
804 3300007076 Ga0075435_100000853 Ga0075435_10000085316 276
805 3300007076 Ga0075435_100001299 Ga0075435_10000129921 276
806 3300007076 Ga0075435_100047859 Ga0075435_1000478593 276
807 3300007076 Ga0075435_100057985 Ga0075435_1000579853 276
808 3300009093 Ga0105240_10006885 Ga0105240_100068853 276
809 3300009094 Ga0111539_10004319 Ga0111539_1000431911 276
810 3300009094 Ga0111539_10027825 Ga0111539_100278253 276
811 3300009094 Ga0111539_10051679 Ga0111539_100516793 276
812 3300009098 Ga0105245_10034774 Ga0105245_100347747 276
813 3300009147 Ga0114129_10011177 Ga0114129_100111779 276
814 3300009147 Ga0114129_10051683 Ga0114129_100516832 276
815 3300009147 Ga0114129_10165753 Ga0114129_101657533 276
816 3300009147 Ga0114129_10191107 Ga0114129_101911073 276
817 3300009147 Ga0114129_10776426 Ga0114129_107764261 276
818 3300009148 Ga0105243_10242548 Ga0105243_102425481 276
819 3300009148 Ga0105243_10256811 Ga0105243_102568112 276
820 3300009174 Ga0105241_10008159 Ga0105241_100081593 276
821 3300009174 Ga0105241_10036676 Ga0105241_100366766 276
822 3300009176 Ga0105242_10338281 Ga0105242_103382812 276
823 3300009177 Ga0105248_10161216 Ga0105248_101612162 276
824 3300009177 Ga0105248_10335375 Ga0105248_103353752 276
825 3300009545 Ga0105237_10005302 Ga0105237_1000530213 276
826 3300009545 Ga0105237_10384842 Ga0105237_103848422 276
827 3300009551 Ga0105238_10001448 Ga0105238_100014488 276
828 3300010375 Ga0105239_10001843 Ga0105239_1000184311 276
829 3300011119 Ga0105246_10013792 Ga0105246_100137924 276
830 3300013100 Ga0157373_10000570 Ga0157373_1000057015 276
831 3300013104 Ga0157370_10017355 Ga0157370_100173553 276
832 3300013104 Ga0157370_10034757 Ga0157370_100347575 276
833 3300013104 Ga0157370_10595088 Ga0157370_105950882 276
834 3300013105 Ga0157369_10006108 Ga0157369_100061085 276
835 3300013105 Ga0157369_10027133 Ga0157369_100271332 276
836 3300013297 Ga0157378_10115507 Ga0157378_101155072 276
837 3300013297 Ga0157378_10169432 Ga0157378_101694322 276
838 3300013306 Ga0163162_10230539 Ga0163162_102305392 276
839 3300013307 Ga0157372_10000301 Ga0157372_1000030114 276
840 3300013307 Ga0157372_10034066 Ga0157372_100340663 276
841 3300013308 Ga0157375_10262058 Ga0157375_102620583 276
842 3300014497 Ga0182008_10058318 Ga0182008_100583182 276
843 3300014968 Ga0157379_10232011 Ga0157379_102320111 276
844 3300021384 Ga0213876_10060995 Ga0213876_100609952 276
845 3300025885 Ga0207653_10005965 Ga0207653_100059651 276
846 3300025885 Ga0207653_10015367 Ga0207653_100153673 276
847 3300025901 Ga0207688_10007444 Ga0207688_100074443 276
848 3300025901 Ga0207688_10015832 Ga0207688_100158322 276
849 3300025904 Ga0207647_10042222 Ga0207647_100422222 276
850 3300025904 Ga0207647_10073786 Ga0207647_100737863 276
851 3300025907 Ga0207645_10001153 Ga0207645_1000115314 276
852 3300025908 Ga0207643_10000223 Ga0207643_100002235 276
853 3300025909 Ga0207705_10093956 Ga0207705_100939561 276
854 3300025910 Ga0207684_10000470 Ga0207684_1000047030 276
855 3300025910 Ga0207684_10052864 Ga0207684_100528643 276
856 3300025910 Ga0207684_10414983 Ga0207684_104149831 276
857 3300025911 Ga0207654_10002865 Ga0207654_100028653 276
858 3300025912 Ga0207707_10000256 Ga0207707_1000025612 276
859 3300025912 Ga0207707_10020291 Ga0207707_100202913 276
860 3300025912 Ga0207707_10073926 Ga0207707_100739263 276
861 3300025912 Ga0207707_10177441 Ga0207707_101774412 276
862 3300025913 Ga0207695_10016676 Ga0207695_100166761 276
863 3300025914 Ga0207671_10424550 Ga0207671_104245501 276
864 3300025916 Ga0207663_10031629 Ga0207663_100316292 276
865 3300025917 Ga0207660_10000031 Ga0207660_1000003135 276
866 3300025917 Ga0207660_10000053 Ga0207660_1000005341 276
867 3300025917 Ga0207660_10103372 Ga0207660_101033723 276
868 3300025918 Ga0207662_10000131 Ga0207662_100001312 276
869 3300025919 Ga0207657_10000591 Ga0207657_1000059123 276
870 3300025919 Ga0207657_10000939 Ga0207657_1000093914 276
871 3300025921 Ga0207652_10004397 Ga0207652_1000439710 276
872 3300025921 Ga0207652_10007393 Ga0207652_100073938 276
873 3300025921 Ga0207652_10023164 Ga0207652_100231643 276
874 3300025921 Ga0207652_10223843 Ga0207652_102238431 276
875 3300025922 Ga0207646_10003035 Ga0207646_1000303516 276
876 3300025922 Ga0207646_10007481 Ga0207646_100074815 276
877 3300025922 Ga0207646_10021045 Ga0207646_100210452 276
878 3300025923 Ga0207681_10015677 Ga0207681_100156775 276
879 3300025924 Ga0207694_10041843 Ga0207694_100418432 276
880 3300025925 Ga0207650_10003354 Ga0207650_1000335412 276
881 3300025926 Ga0207659_10158621 Ga0207659_101586212 276
882 3300025927 Ga0207687_10003702 Ga0207687_100037022 276
883 3300025929 Ga0207664_10176071 Ga0207664_101760712 276
884 3300025932 Ga0207690_10008839 Ga0207690_100088391 276
885 3300025933 Ga0207706_10001694 Ga0207706_100016948 276
886 3300025933 Ga0207706_10017386 Ga0207706_100173866 276
887 3300025935 Ga0207709_10151495 Ga0207709_101514952 276
888 3300025936 Ga0207670_10003537 Ga0207670_1000353712 276
889 3300025939 Ga0207665_10254221 Ga0207665_102542211 276
890 3300025942 Ga0207689_10000101 Ga0207689_1000010157 276
891 3300025942 Ga0207689_10002025 Ga0207689_100020252 276
892 3300025945 Ga0207679_10002689 Ga0207679_100026899 276
893 3300025945 Ga0207679_10305688 Ga0207679_103056882 276
894 3300025949 Ga0207667_10003375 Ga0207667_100033758 276
895 3300025949 Ga0207667_10055567 Ga0207667_100555673 276
896 3300025949 Ga0207667_10359265 Ga0207667_103592652 276
897 3300025960 Ga0207651_10017085 Ga0207651_100170854 276
898 3300025961 Ga0207712_10056122 Ga0207712_100561222 276
899 3300025981 Ga0207640_10055541 Ga0207640_100555412 276
900 3300026023 Ga0207677_10010080 Ga0207677_100100802 276
901 3300026035 Ga0207703_10281580 Ga0207703_102815802 276
902 3300026041 Ga0207639_10000440 Ga0207639_100004409 276
903 3300026041 Ga0207639_10359250 Ga0207639_103592501 276
904 3300026067 Ga0207678_10018491 Ga0207678_100184914 276
905 3300026075 Ga0207708_10000183 Ga0207708_1000018325 276
906 3300026078 Ga0207702_10002958 Ga0207702_100029589 276
907 3300026088 Ga0207641_10028847 Ga0207641_100288475 276
908 3300026088 Ga0207641_10158136 Ga0207641_101581362 276
909 3300026089 Ga0207648_10001400 Ga0207648_100014003 276
910 3300026089 Ga0207648_10006238 Ga0207648_100062388 276
911 3300026089 Ga0207648_10311727 Ga0207648_103117272 276
912 3300026116 Ga0207674_10000921 Ga0207674_1000092123 276
913 3300026116 Ga0207674_10015960 Ga0207674_100159604 276
914 3300026118 Ga0207675_100000987 Ga0207675_1000009873 276
915 3300026118 Ga0207675_100015565 Ga0207675_1000155657 276
916 3300026142 Ga0207698_10339815 Ga0207698_103398152 276
917 3300027695 Ga0209966_1013850 Ga0209966_10138501 276
918 3300027717 Ga0209998_10016265 Ga0209998_100162652 276
919 3300027907 Ga0207428_10008713 Ga0207428_100087134 276
920 3300027907 Ga0207428_10293342 Ga0207428_102933422 276
921 3300028380 Ga0268265_10087156 Ga0268265_100871562 276
922 3300028380 Ga0268265_10155279 Ga0268265_101552793 276
923 3300028381 Ga0268264_10006152 Ga0268264_100061523 276
924 3300028381 Ga0268264_10400777 Ga0268264_104007772 276
925 3300031249 Ga0265339_10007870 Ga0265339_100078704 276
926 3300031548 Ga0307408_100027799 Ga0307408_1000277994 276
927 3300031548 Ga0307408_100045999 Ga0307408_1000459994 276
928 3300031995 Ga0307409_100111716 Ga0307409_1001117162 276
929 3300032002 Ga0307416_100516559 Ga0307416_1005165592 276
930 3300032133 Ga0316583_10010260 Ga0316583_100102604 276
931 3300034817 Ga0373948_0014646 Ga0373948_0014646_80_940 276
932 3300034819 Ga0373958_0025874 Ga0373958_0025874_179_1039 276
933 3300035084 Ga0373928_0023141 Ga0373928_0023141_121_981 276
934 3300035086 Ga0373934_0012355 Ga0373934_0012355_2087_2932 276
935 3300035089 Ga0373944_0016127 Ga0373944_0016127_473_1309 276
936 3300035115 Ga0373941_0055670 Ga0373941_0055670_160_993 276
937 3300035116 Ga0373945_0023915 Ga0373945_0023915_50_886 276
938 3300035117 Ga0373953_0022228 Ga0373953_0022228_1072_1917 276
939 3300035118 Ga0373954_0000032 Ga0373954_0000032_32784_33629 276
940 3300035118 Ga0373954_0002280 Ga0373954_0002280_1220_2065 276
941 3300035119 Ga0373956_0001446 Ga0373956_0001446_4169_5014 276
942 3300035171 Ga0373946_0000511 Ga0373946_0000511_11422_12258 276
943 3300035172 Ga0373955_0012817 Ga0373955_0012817_2203_3048 276
944 3300035241 Ga0373961_0003301 Ga0373961_0003301_628_1488 276
945 3300035241 Ga0373961_0008481 Ga0373961_0008481_964_1806 276
946 3300035241 Ga0373961_0043340 Ga0373961_0043340_182_1015 276
947 3300035410 Ga0373924_0042527 Ga0373924_0042527_494_1339 276
948 3300035691 Ga0373931_0031620 Ga0373931_0031620_955_1818 276
949 3300035691 Ga0373931_0041456 Ga0373931_0041456_732_1565 276
950 3300035691 Ga0373931_0064854 Ga0373931_0064854_20_880 276
951 3300035692 Ga0373935_0013223 Ga0373935_0013223_390_1226 276
952 3300035695 Ga0373927_0043502 Ga0373927_0043502_554_1390 276
953 3300035724 Ga0373933_0012697 Ga0373933_0012697_1072_1917 276
954 3300035724 Ga0373933_0092548 Ga0373933_0092548_190_1035 276
955 3300035725 Ga0373947_0032647 Ga0373947_0032647_1676_2512 276
956 3300036401 Ga0373937_0000461 Ga0373937_0000461_10059_10904 276
957 3300036401 Ga0373937_0000633 Ga0373937_0000633_7397_8242 276
958 3300037312 Ga0395899_0352018 Ga0395899_0352018_54_920 276
959 3300037418 Ga0395900_0002185 Ga0395900_0002185_3974_4819 276
960 3300037418 Ga0395900_0116794 Ga0395900_0116794_500_1345 276
961 3300037418 Ga0395900_0200253 Ga0395900_0200253_783_1628 276
962 3300037466 Ga0395898_0003639 Ga0395898_0003639_2620_3465 276
963 3300037466 Ga0395898_0017778 Ga0395898_0017778_5573_6418 276
964 3300037466 Ga0395898_0171837 Ga0395898_0171837_410_1276 276
965 3300037466 Ga0395898_0214676 Ga0395898_0214676_917_1762 276
966 3300037471 Ga0395905_0091388 Ga0395905_0091388_617_1483 276
967 3300038443 Ga0395901_0029444 Ga0395901_0029444_3854_4699 276
968 3300038443 Ga0395901_0039236 Ga0395901_0039236_1989_2855 276
969 3300038443 Ga0395901_0667339 Ga0395901_0667339_125_970 276
970 3300039450 Ga0436363_1301926 Ga0436363_1301926_397_1242 276
971 3300039450 Ga0436363_1717667 Ga0436363_1717667_1973_2818 276
972 3300039453 Ga0436362_0553573 Ga0436362_0553573_80_925 276
973 3300042005 Ga0439448_0000596 Ga0439448_0000596_7575_8435 276
974 3300042438 Ga0439459_0000371 Ga0439459_0000371_3744_4604 276
975 3300042876 Ga0451577_0002745 Ga0451577_0002745_7207_8067 276
976 3300042876 Ga0451577_0038586 Ga0451577_0038586_1126_1965 276
977 3300042876 Ga0451577_0039257 Ga0451577_0039257_750_1610 276
978 3300042876 Ga0451577_0246499 Ga0451577_0246499_407_1270 276
979 3300044673 Ga0453683_0023341 Ga0453683_0023341_2155_3015 276
980 3300044694 Ga0466963_0287433 Ga0466963_0287433_64_909 276
981 3300044712 Ga0453684_0003712 Ga0453684_0003712_10220_11080 276
982 3300044712 Ga0453684_0035640 Ga0453684_0035640_1073_1933 276
983 3300044735 Ga0466968_0075391 Ga0466968_0075391_604_1449 276
984 3300045051 Ga0451576_0002131 Ga0451576_0002131_20404_21243 276
985 3300045051 Ga0451576_0008839 Ga0451576_0008839_6972_7832 276
986 3300045051 Ga0451576_0014274 Ga0451576_0014274_5368_6228 276
987 3300045051 Ga0451576_0034790 Ga0451576_0034790_2855_3688 276
988 3300045976 Ga0466967_0244517 Ga0466967_0244517_804_1649 276
989 3300045976 Ga0466967_0311930 Ga0466967_0311930_346_1191 276
990 3300046454 Ga0495592_0002269 Ga0495592_0002269_5912_6757 276
991 3300046459 Ga0495629_0001032 Ga0495629_0001032_12764_13609 276
992 3300046462 Ga0495651_0001609 Ga0495651_0001609_10054_10899 276
993 3300046463 Ga0495653_0000810 Ga0495653_0000810_794_1639 276
994 3300046511 Ga0495608_0000663 Ga0495608_0000663_21311_22156 276
995 3300046516 Ga0495628_0198725 Ga0495628_0198725_65_910 276
996 3300046526 Ga0495666_0007796 Ga0495666_0007796_2524_3360 276
997 3300046529 Ga0495652_0002927 Ga0495652_0002927_13202_14047 276
998 3300046535 Ga0495586_0006148 Ga0495586_0006148_2468_3304 276
999 3300046536 Ga0495587_0001520 Ga0495587_0001520_10458_11303 276
1000 3300046559 Ga0495667_0000346 Ga0495667_0000346_6664_7509 276
1001 3300046663 Ga0495635_0006472 Ga0495635_0006472_451_1296 276
1002 3300046663 Ga0495635_0075210 Ga0495635_0075210_608_1444 276
1003 3300046674 Ga0495588_0085697 Ga0495588_0085697_748_1584 276
1004 3300046675 Ga0495657_0005870 Ga0495657_0005870_4171_5016 276
1005 3300046678 Ga0495599_0001516 Ga0495599_0001516_3920_4765 276
1006 3300046679 Ga0495623_0035431 Ga0495623_0035431_1584_2429 276
1007 3300046680 Ga0495646_0060254 Ga0495646_0060254_882_1727 276
1008 3300046681 Ga0495647_0002281 Ga0495647_0002281_2514_3350 276
1009 3300046689 Ga0495613_0106879 Ga0495613_0106879_838_1683 276
1010 3300046809 Ga0495600_0004169 Ga0495600_0004169_4638_5483 276
1011 3300047315 Ga0495581_0075227 Ga0495581_0075227_19_855 276
1012 3300047317 Ga0495604_0001894 Ga0495604_0001894_6793_7638 276
1013 3300047319 Ga0495674_0043145 Ga0495674_0043145_2651_3496 276
1014 3300047319 Ga0495674_0060842 Ga0495674_0060842_173_1009 276
1015 3300047322 Ga0495680_0000535 Ga0495680_0000535_26696_27541 276
1016 3300047444 Ga0495675_0001560 Ga0495675_0001560_3017_3862 276
1017 3300047471 Ga0495684_0000340 Ga0495684_0000340_7342_8187 276
1018 3300047673 Ga0495593_0010908 Ga0495593_0010908_3550_4395 276
1019 3300048088 Ga0495602_0003813 Ga0495602_0003813_1073_1918 276
1020 3300048905 Ga0496102_0109425 Ga0496102_0109425_659_1546 276
1021 3300048905 Ga0496102_0192636 Ga0496102_0192636_589_1449 276
1022 3300048909 Ga0496106_0035735 Ga0496106_0035735_1539_2399 276
1023 3300048909 Ga0496106_0049337 Ga0496106_0049337_628_1491 276
1024 3300048911 Ga0496108_0271978 Ga0496108_0271978_603_1463 276
1025 3300048912 Ga0496109_0387755 Ga0496109_0387755_195_1040 276
1026 3300048915 Ga0496112_0083512 Ga0496112_0083512_340_1185 276
1027 3300048915 Ga0496112_0199680 Ga0496112_0199680_264_1124 276
1028 3300048919 Ga0496116_0003061 Ga0496116_0003061_11349_12236 276
1029 3300049584 Ga0501068_0131351 Ga0501068_0131351_539_1402 276
1030 3300049585 Ga0501069_0082293 Ga0501069_0082293_673_1536 276
1031 3300049593 Ga0501077_0074950 Ga0501077_0074950_676_1539 276
1032 3300049741 Ga0501079_0111803 Ga0501079_0111803_922_1785 276
1033 3300049743 Ga0501081_0147927 Ga0501081_0147927_642_1505 276
1034 3300049743 Ga0501081_0225834 Ga0501081_0225834_269_1114 276
1035 3300050507 nmdc:mga05p37_128134_c1 nmdc:mga05p37_128134_c1_1163_2011 276
1036 3300050507 nmdc:mga05p37_15330_c1 nmdc:mga05p37_15330_c1_3279_4142 276
1037 3300050507 nmdc:mga05p37_326019_c1 nmdc:mga05p37_326019_c1_409_1272 276
1038 3300050507 nmdc:mga05p37_80661_c1 nmdc:mga05p37_80661_c1_373_1236 276
1039 3300050508 nmdc:mga09592_4013_c1 nmdc:mga09592_4013_c1_5483_6346 276
1040 3300050509 nmdc:mga0qj67_97939_c1 nmdc:mga0qj67_97939_c1_15_878 276
1041 3300050510 nmdc:mga06r32_368381_c1 nmdc:mga06r32_368381_c1_96_959 276
1042 3300050510 nmdc:mga06r32_56979_c1 nmdc:mga06r32_56979_c1_2226_3089 276
1043 3300050511 nmdc:mga08y16_101694_c1 nmdc:mga08y16_101694_c1_1106_1969 276
1044 3300050511 nmdc:mga08y16_348752_c1 nmdc:mga08y16_348752_c1_134_976 276
1045 3300050511 nmdc:mga08y16_6776_c1 nmdc:mga08y16_6776_c1_8482_9342 276
1046 3300050511 nmdc:mga08y16_7974_c1 nmdc:mga08y16_7974_c1_1219_2055 276
1047 3300050512 nmdc:mga0n895_13810_c1 nmdc:mga0n895_13810_c1_5391_6254 276
1048 3300050512 nmdc:mga0n895_16412_c1 nmdc:mga0n895_16412_c1_714_1577 276
1049 3300050512 nmdc:mga0n895_28197_c1 nmdc:mga0n895_28197_c1_1010_1855 276
1050 3300050512 nmdc:mga0n895_384170_c1 nmdc:mga0n895_384170_c1_68_928 276
1051 3300050512 nmdc:mga0n895_452_c1 nmdc:mga0n895_452_c1_21544_22380 276
1052 3300050512 nmdc:mga0n895_603272_c1 nmdc:mga0n895_603272_c1_214_1062 276
1053 3300050513 nmdc:mga0rr50_1220_c1 nmdc:mga0rr50_1220_c1_2681_3517 276
1054 3300050513 nmdc:mga0rr50_181199_c1 nmdc:mga0rr50_181199_c1_828_1673 276
1055 3300050513 nmdc:mga0rr50_6473_c1 nmdc:mga0rr50_6473_c1_666_1502 276
1056 3300050514 nmdc:mga08x19_100626_c1 nmdc:mga08x19_100626_c1_502_1362 276
1057 3300050514 nmdc:mga08x19_129979_c1 nmdc:mga08x19_129979_c1_146_994 276
1058 3300050514 nmdc:mga08x19_76710_c1 nmdc:mga08x19_76710_c1_99_944 276
1059 3300050514 nmdc:mga08x19_80334_c1 nmdc:mga08x19_80334_c1_318_1163 276
1060 3300050515 nmdc:mga0a205_44577_c1 nmdc:mga0a205_44577_c1_1463_2326 276
1061 3300050515 nmdc:mga0a205_51055_c1 nmdc:mga0a205_51055_c1_1814_2662 276
1062 3300050515 nmdc:mga0a205_5124_c1 nmdc:mga0a205_5124_c1_7353_8189 276
1063 3300050515 nmdc:mga0a205_6159_c1 nmdc:mga0a205_6159_c1_8010_8870 276
1064 3300050515 nmdc:mga0a205_882_c1 nmdc:mga0a205_882_c1_7176_8036 276
1065 3300053077 Ga0495601_0092584 Ga0495601_0092584_230_1075 276
1066 3300053084 Ga0495595_0056149 Ga0495595_0056149_279_1124 276
1067 3300053085 Ga0495619_0000163 Ga0495619_0000163_27498_28343 276
1068 iso_pu_bacteria 2513237101 2513697316 276
1069 iso_pu_bacteria 2721755755 2723848619 276
1070 iso_pu_bacteria 2901300506 2901310669 276
1071 iso_pu_bacteria 2917699015 2917700294 276
1072 iso_pu_bacteria 2935675223 2935680234 276
1073 iso_pu_bacteria 2935684952 2935693727 276
1074 iso_pu_bacteria 2935694250 2935700787 276
1075 iso_pu_bacteria 2935713505 2935722424 276
1076 iso_pu_bacteria 2935722832 2935731733 276
1077 iso_pu_bacteria 2935732158 2935740942 276
1078 iso_pu_bacteria 2935741537 2935750355 276
1079 iso_pu_bacteria 2935750917 2935759912 276
1080 iso_pu_bacteria 2935760218 2935768723 276
1081 iso_pu_bacteria 2940556831 2940565817 276
1082 iso_pu_bacteria 8019648815 8019654659 276
1083 3300003215 JGI25153J46596_10025287 JGI25153J46596_100252872 277
1084 3300005290 Ga0065712_10152071 Ga0065712_101520712 277
1085 3300005328 Ga0070676_10401298 Ga0070676_104012981 277
1086 3300005331 Ga0070670_100244401 Ga0070670_1002444011 277
1087 3300005334 Ga0068869_100227602 Ga0068869_1002276021 277
1088 3300005336 Ga0070680_100007253 Ga0070680_1000072533 277
1089 3300005338 Ga0068868_100262593 Ga0068868_1002625932 277
1090 3300005339 Ga0070660_100076723 Ga0070660_1000767232 277
1091 3300005339 Ga0070660_100184912 Ga0070660_1001849122 277
1092 3300005340 Ga0070689_100237991 Ga0070689_1002379911 277
1093 3300005343 Ga0070687_100008454 Ga0070687_1000084541 277
1094 3300005347 Ga0070668_100421951 Ga0070668_1004219511 277
1095 3300005354 Ga0070675_100056373 Ga0070675_1000563733 277
1096 3300005356 Ga0070674_100037139 Ga0070674_1000371392 277
1097 3300005364 Ga0070673_100159290 Ga0070673_1001592902 277
1098 3300005366 Ga0070659_100123817 Ga0070659_1001238172 277
1099 3300005434 Ga0070709_10064058 Ga0070709_100640582 277
1100 3300005434 Ga0070709_10106418 Ga0070709_101064181 277
1101 3300005434 Ga0070709_10208912 Ga0070709_102089121 277
1102 3300005435 Ga0070714_100040195 Ga0070714_1000401953 277
1103 3300005435 Ga0070714_100090311 Ga0070714_1000903112 277
1104 3300005435 Ga0070714_100209059 Ga0070714_1002090591 277
1105 3300005435 Ga0070714_100320855 Ga0070714_1003208552 277
1106 3300005435 Ga0070714_100521185 Ga0070714_1005211851 277
1107 3300005436 Ga0070713_100274847 Ga0070713_1002748471 277
1108 3300005436 Ga0070713_100761681 Ga0070713_1007616811 277
1109 3300005437 Ga0070710_10004509 Ga0070710_100045094 277
1110 3300005439 Ga0070711_100082847 Ga0070711_1000828473 277
1111 3300005439 Ga0070711_100210153 Ga0070711_1002101533 277
1112 3300005445 Ga0070708_100133744 Ga0070708_1001337442 277
1113 3300005455 Ga0070663_100270409 Ga0070663_1002704091 277
1114 3300005456 Ga0070678_100260320 Ga0070678_1002603202 277
1115 3300005456 Ga0070678_100514501 Ga0070678_1005145011 277
1116 3300005457 Ga0070662_100073618 Ga0070662_1000736183 277
1117 3300005458 Ga0070681_10161651 Ga0070681_101616512 277
1118 3300005458 Ga0070681_10190797 Ga0070681_101907972 277
1119 3300005471 Ga0070698_100533171 Ga0070698_1005331711 277
1120 3300005530 Ga0070679_100064316 Ga0070679_1000643163 277
1121 3300005530 Ga0070679_100366868 Ga0070679_1003668682 277
1122 3300005535 Ga0070684_100073510 Ga0070684_1000735102 277
1123 3300005535 Ga0070684_100079119 Ga0070684_1000791192 277
1124 3300005535 Ga0070684_100121799 Ga0070684_1001217992 277
1125 3300005535 Ga0070684_100316639 Ga0070684_1003166391 277
1126 3300005536 Ga0070697_100010039 Ga0070697_1000100397 277
1127 3300005539 Ga0068853_100169002 Ga0068853_1001690024 277
1128 3300005539 Ga0068853_100505846 Ga0068853_1005058462 277
1129 3300005545 Ga0070695_100118087 Ga0070695_1001180872 277
1130 3300005545 Ga0070695_100121233 Ga0070695_1001212332 277
1131 3300005547 Ga0070693_100021595 Ga0070693_1000215952 277
1132 3300005548 Ga0070665_100018386 Ga0070665_1000183867 277
1133 3300005548 Ga0070665_100024858 Ga0070665_1000248585 277
1134 3300005563 Ga0068855_100034744 Ga0068855_1000347444 277
1135 3300005563 Ga0068855_100055840 Ga0068855_1000558403 277
1136 3300005563 Ga0068855_100066357 Ga0068855_1000663573 277
1137 3300005563 Ga0068855_100308057 Ga0068855_1003080572 277
1138 3300005564 Ga0070664_100328163 Ga0070664_1003281632 277
1139 3300005616 Ga0068852_100006524 Ga0068852_1000065245 277
1140 3300005616 Ga0068852_100177684 Ga0068852_1001776842 277
1141 3300005617 Ga0068859_100080521 Ga0068859_1000805213 277
1142 3300005618 Ga0068864_100084467 Ga0068864_1000844672 277
1143 3300005718 Ga0068866_10118513 Ga0068866_101185132 277
1144 3300005840 Ga0068870_10011526 Ga0068870_100115264 277
1145 3300005842 Ga0068858_100025982 Ga0068858_1000259824 277
1146 3300005843 Ga0068860_100067257 Ga0068860_1000672574 277
1147 3300005937 Ga0081455_10071492 Ga0081455_100714921 277
1148 3300005937 Ga0081455_10110025 Ga0081455_101100252 277
1149 3300005983 Ga0081540_1031176 Ga0081540_10311763 277
1150 3300006028 Ga0070717_10069535 Ga0070717_100695353 277
1151 3300006042 Ga0075368_10006549 Ga0075368_100065491 277
1152 3300006048 Ga0075363_100004637 Ga0075363_1000046377 277
1153 3300006048 Ga0075363_100120458 Ga0075363_1001204581 277
1154 3300006163 Ga0070715_10024198 Ga0070715_100241983 277
1155 3300006163 Ga0070715_10044874 Ga0070715_100448742 277
1156 3300006163 Ga0070715_10140422 Ga0070715_101404222 277
1157 3300006173 Ga0070716_100052718 Ga0070716_1000527181 277
1158 3300006173 Ga0070716_100261377 Ga0070716_1002613772 277
1159 3300006175 Ga0070712_100128812 Ga0070712_1001288122 277
1160 3300006178 Ga0075367_10002833 Ga0075367_100028337 277
1161 3300006178 Ga0075367_10013912 Ga0075367_100139122 277
1162 3300006186 Ga0075369_10019008 Ga0075369_100190082 277
1163 3300006195 Ga0075366_10047800 Ga0075366_100478002 277
1164 3300006237 Ga0097621_100221503 Ga0097621_1002215031 277
1165 3300006353 Ga0075370_10003433 Ga0075370_100034338 277
1166 3300006358 Ga0068871_100098256 Ga0068871_1000982561 277
1167 3300006871 Ga0075434_100289132 Ga0075434_1002891322 277
1168 3300006914 Ga0075436_100102698 Ga0075436_1001026982 277
1169 3300006931 Ga0097620_100080520 Ga0097620_1000805203 277
1170 3300006942 Ga0099824_1023517 Ga0099824_10235171 277
1171 3300006944 Ga0099823_1000128 Ga0099823_100012831 277
1172 3300007788 Ga0099795_10016540 Ga0099795_100165402 277
1173 3300009093 Ga0105240_10041691 Ga0105240_100416912 277
1174 3300009093 Ga0105240_10122811 Ga0105240_101228112 277
1175 3300009093 Ga0105240_10571891 Ga0105240_105718912 277
1176 3300009093 Ga0105240_10762969 Ga0105240_107629692 277
1177 3300009101 Ga0105247_10052380 Ga0105247_100523803 277
1178 3300009174 Ga0105241_10211180 Ga0105241_102111802 277
1179 3300009174 Ga0105241_10547217 Ga0105241_105472171 277
1180 3300009176 Ga0105242_10018910 Ga0105242_100189105 277
1181 3300009177 Ga0105248_10018623 Ga0105248_100186232 277
1182 3300009177 Ga0105248_10860817 Ga0105248_108608171 277
1183 3300009177 Ga0105248_10999824 Ga0105248_109998241 277
1184 3300009545 Ga0105237_10010552 Ga0105237_100105524 277
1185 3300009551 Ga0105238_10005185 Ga0105238_100051853 277
1186 3300009551 Ga0105238_10091688 Ga0105238_100916883 277
1187 3300009551 Ga0105238_10340837 Ga0105238_103408372 277
1188 3300009551 Ga0105238_10487216 Ga0105238_104872161 277
1189 3300009553 Ga0105249_10069822 Ga0105249_100698222 277
1190 3300009553 Ga0105249_10315842 Ga0105249_103158422 277
1191 3300010375 Ga0105239_10009890 Ga0105239_100098906 277
1192 3300010375 Ga0105239_10024954 Ga0105239_100249542 277
1193 3300010375 Ga0105239_10042764 Ga0105239_100427642 277
1194 3300010375 Ga0105239_10408794 Ga0105239_104087941 277
1195 3300010375 Ga0105239_10622201 Ga0105239_106222012 277
1196 3300011119 Ga0105246_10078125 Ga0105246_100781253 277
1197 3300011119 Ga0105246_10109617 Ga0105246_101096173 277
1198 3300013100 Ga0157373_10077955 Ga0157373_100779551 277
1199 3300013102 Ga0157371_10079804 Ga0157371_100798042 277
1200 3300013104 Ga0157370_10107650 Ga0157370_101076503 277
1201 3300013104 Ga0157370_10168490 Ga0157370_101684902 277
1202 3300013104 Ga0157370_10185705 Ga0157370_101857052 277
1203 3300013105 Ga0157369_10154247 Ga0157369_101542473 277
1204 3300013105 Ga0157369_10369585 Ga0157369_103695852 277
1205 3300013296 Ga0157374_10106764 Ga0157374_101067643 277
1206 3300013296 Ga0157374_10248243 Ga0157374_102482433 277
1207 3300013297 Ga0157378_10186437 Ga0157378_101864372 277
1208 3300013297 Ga0157378_10521378 Ga0157378_105213781 277
1209 3300013306 Ga0163162_10121379 Ga0163162_101213793 277
1210 3300013307 Ga0157372_10082146 Ga0157372_100821462 277
1211 3300013307 Ga0157372_10193795 Ga0157372_101937951 277
1212 3300013308 Ga0157375_10106572 Ga0157375_101065722 277
1213 3300013308 Ga0157375_10608223 Ga0157375_106082232 277
1214 3300014325 Ga0163163_10057253 Ga0163163_100572532 277
1215 3300014325 Ga0163163_10549775 Ga0163163_105497752 277
1216 3300014969 Ga0157376_10059239 Ga0157376_100592393 277
1217 3300014969 Ga0157376_10359748 Ga0157376_103597482 277
1218 3300017792 Ga0163161_10531976 Ga0163161_105319761 277
1219 3300021388 Ga0213875_10000138 Ga0213875_1000013825 277
1220 3300025297 Ga0209758_1003658 Ga0209758_10036582 277
1221 3300025898 Ga0207692_10011005 Ga0207692_100110054 277
1222 3300025898 Ga0207692_10211044 Ga0207692_102110441 277
1223 3300025900 Ga0207710_10184402 Ga0207710_101844021 277
1224 3300025901 Ga0207688_10183245 Ga0207688_101832452 277
1225 3300025905 Ga0207685_10018781 Ga0207685_100187811 277
1226 3300025905 Ga0207685_10021799 Ga0207685_100217992 277
1227 3300025906 Ga0207699_10271853 Ga0207699_102718532 277
1228 3300025906 Ga0207699_10378025 Ga0207699_103780252 277
1229 3300025907 Ga0207645_10150527 Ga0207645_101505272 277
1230 3300025908 Ga0207643_10036559 Ga0207643_100365593 277
1231 3300025909 Ga0207705_10069252 Ga0207705_100692523 277
1232 3300025910 Ga0207684_10025353 Ga0207684_100253532 277
1233 3300025911 Ga0207654_10005966 Ga0207654_100059662 277
1234 3300025912 Ga0207707_10110316 Ga0207707_101103162 277
1235 3300025912 Ga0207707_10111165 Ga0207707_101111653 277
1236 3300025912 Ga0207707_10259908 Ga0207707_102599082 277
1237 3300025913 Ga0207695_10157997 Ga0207695_101579973 277
1238 3300025914 Ga0207671_10027706 Ga0207671_100277064 277
1239 3300025914 Ga0207671_10035256 Ga0207671_100352562 277
1240 3300025914 Ga0207671_10043101 Ga0207671_100431013 277
1241 3300025914 Ga0207671_10085250 Ga0207671_100852502 277
1242 3300025914 Ga0207671_10107174 Ga0207671_101071742 277
1243 3300025915 Ga0207693_10032378 Ga0207693_100323784 277
1244 3300025915 Ga0207693_10053937 Ga0207693_100539373 277
1245 3300025915 Ga0207693_10296711 Ga0207693_102967112 277
1246 3300025915 Ga0207693_10320436 Ga0207693_103204363 277
1247 3300025916 Ga0207663_10023184 Ga0207663_100231843 277
1248 3300025916 Ga0207663_10199570 Ga0207663_101995702 277
1249 3300025917 Ga0207660_10026280 Ga0207660_100262804 277
1250 3300025917 Ga0207660_10093117 Ga0207660_100931171 277
1251 3300025917 Ga0207660_10247654 Ga0207660_102476541 277
1252 3300025918 Ga0207662_10240524 Ga0207662_102405241 277
1253 3300025919 Ga0207657_10090609 Ga0207657_100906093 277
1254 3300025919 Ga0207657_10119039 Ga0207657_101190393 277
1255 3300025919 Ga0207657_10403484 Ga0207657_104034842 277
1256 3300025921 Ga0207652_10107569 Ga0207652_101075691 277
1257 3300025921 Ga0207652_10206760 Ga0207652_102067602 277
1258 3300025922 Ga0207646_10373305 Ga0207646_103733051 277
1259 3300025924 Ga0207694_10050844 Ga0207694_100508443 277
1260 3300025924 Ga0207694_10138929 Ga0207694_101389293 277
1261 3300025924 Ga0207694_10140257 Ga0207694_101402572 277
1262 3300025926 Ga0207659_10161170 Ga0207659_101611701 277
1263 3300025927 Ga0207687_10037708 Ga0207687_100377083 277
1264 3300025928 Ga0207700_10080767 Ga0207700_100807671 277
1265 3300025928 Ga0207700_10082049 Ga0207700_100820491 277
1266 3300025929 Ga0207664_10149108 Ga0207664_101491083 277
1267 3300025929 Ga0207664_10154601 Ga0207664_101546012 277
1268 3300025929 Ga0207664_10232178 Ga0207664_102321781 277
1269 3300025932 Ga0207690_10065440 Ga0207690_100654403 277
1270 3300025933 Ga0207706_10099532 Ga0207706_100995323 277
1271 3300025934 Ga0207686_10015082 Ga0207686_100150822 277
1272 3300025937 Ga0207669_10030551 Ga0207669_100305511 277
1273 3300025939 Ga0207665_10130960 Ga0207665_101309601 277
1274 3300025941 Ga0207711_10082750 Ga0207711_100827503 277
1275 3300025942 Ga0207689_10007129 Ga0207689_100071293 277
1276 3300025944 Ga0207661_10029121 Ga0207661_100291213 277
1277 3300025944 Ga0207661_10632494 Ga0207661_106324942 277
1278 3300025949 Ga0207667_10057159 Ga0207667_100571593 277
1279 3300025961 Ga0207712_10324783 Ga0207712_103247832 277
1280 3300025972 Ga0207668_10014099 Ga0207668_100140995 277
1281 3300025981 Ga0207640_10468238 Ga0207640_104682381 277
1282 3300026035 Ga0207703_10021851 Ga0207703_100218514 277
1283 3300026035 Ga0207703_10149455 Ga0207703_101494553 277
1284 3300026035 Ga0207703_10563541 Ga0207703_105635411 277
1285 3300026041 Ga0207639_10106494 Ga0207639_101064942 277
1286 3300026041 Ga0207639_10173180 Ga0207639_101731804 277
1287 3300026041 Ga0207639_10236098 Ga0207639_102360982 277
1288 3300026067 Ga0207678_10096951 Ga0207678_100969513 277
1289 3300026067 Ga0207678_10174905 Ga0207678_101749052 277
1290 3300026067 Ga0207678_10274447 Ga0207678_102744471 277
1291 3300026078 Ga0207702_10597960 Ga0207702_105979602 277
1292 3300026078 Ga0207702_10806026 Ga0207702_108060261 277
1293 3300026095 Ga0207676_10071587 Ga0207676_100715873 277
1294 3300026116 Ga0207674_10293433 Ga0207674_102934332 277
1295 3300026116 Ga0207674_10538390 Ga0207674_105383901 277
1296 3300026121 Ga0207683_10390451 Ga0207683_103904512 277
1297 3300026121 Ga0207683_10471191 Ga0207683_104711912 277
1298 3300026142 Ga0207698_10072393 Ga0207698_100723933 277
1299 3300026142 Ga0207698_10489164 Ga0207698_104891642 277
1300 3300027296 Ga0209389_1000223 Ga0209389_100022328 277
1301 3300027361 Ga0209489_102324 Ga0209489_1023247 277
1302 3300027363 Ga0209700_102324 Ga0209700_1023247 277
1303 3300027512 Ga0209179_1011376 Ga0209179_10113761 277
1304 3300027671 Ga0209588_1005030 Ga0209588_10050301 277
1305 3300028379 Ga0268266_10006468 Ga0268266_100064685 277
1306 3300028379 Ga0268266_10017659 Ga0268266_100176594 277
1307 3300028381 Ga0268264_10017806 Ga0268264_100178063 277
1308 3300028381 Ga0268264_10639075 Ga0268264_106390752 277
1309 3300028800 Ga0265338_10209956 Ga0265338_102099561 277
1310 3300031241 Ga0265325_10025301 Ga0265325_100253013 277
1311 3300031249 Ga0265339_10000286 Ga0265339_1000028621 277
1312 3300031595 Ga0265313_10000345 Ga0265313_100003458 277
1313 3300031595 Ga0265313_10000450 Ga0265313_1000045018 277
1314 3300032133 Ga0316583_10001948 Ga0316583_100019483 277
1315 3300034816 Ga0373930_0009973 Ga0373930_0009973_632_1477 277
1316 3300035111 Ga0373923_0003541 Ga0373923_0003541_1613_2458 277
1317 3300035112 Ga0373932_0003321 Ga0373932_0003321_76_921 277
1318 3300035115 Ga0373941_0003908 Ga0373941_0003908_1011_1856 277
1319 3300035116 Ga0373945_0012198 Ga0373945_0012198_396_1244 277
1320 3300035118 Ga0373954_0201446 Ga0373954_0201446_62_910 277
1321 3300035119 Ga0373956_0021068 Ga0373956_0021068_1347_2195 277
1322 3300035120 Ga0373957_0023558 Ga0373957_0023558_61_909 277
1323 3300035170 Ga0373943_0040452 Ga0373943_0040452_519_1364 277
1324 3300035171 Ga0373946_0109408 Ga0373946_0109408_39_884 277
1325 3300035172 Ga0373955_0001825 Ga0373955_0001825_7917_8765 277
1326 3300035172 Ga0373955_0007037 Ga0373955_0007037_3941_4789 277
1327 3300035242 Ga0373962_0018805 Ga0373962_0018805_603_1448 277
1328 3300035410 Ga0373924_0024827 Ga0373924_0024827_887_1735 277
1329 3300035410 Ga0373924_0107133 Ga0373924_0107133_249_1097 277
1330 3300035691 Ga0373931_0001516 Ga0373931_0001516_235_1080 277
1331 3300035692 Ga0373935_0006419 Ga0373935_0006419_5311_6159 277
1332 3300035692 Ga0373935_0041323 Ga0373935_0041323_1460_2305 277
1333 3300035692 Ga0373935_0059316 Ga0373935_0059316_729_1574 277
1334 3300035695 Ga0373927_0018631 Ga0373927_0018631_1339_2184 277
1335 3300035695 Ga0373927_0030462 Ga0373927_0030462_832_1680 277
1336 3300035695 Ga0373927_0291723 Ga0373927_0291723_171_1016 277
1337 3300035724 Ga0373933_0004902 Ga0373933_0004902_6271_7119 277
1338 3300035724 Ga0373933_0009419 Ga0373933_0009419_3682_4530 277
1339 3300035724 Ga0373933_0053912 Ga0373933_0053912_1294_2139 277
1340 3300035725 Ga0373947_0013306 Ga0373947_0013306_990_1838 277
1341 3300035725 Ga0373947_0022267 Ga0373947_0022267_1607_2452 277
1342 3300035725 Ga0373947_0255502 Ga0373947_0255502_288_1133 277
1343 3300036401 Ga0373937_0020828 Ga0373937_0020828_4095_4943 277
1344 3300037068 Ga0373925_0006276 Ga0373925_0006276_7819_8667 277
1345 3300037068 Ga0373925_0309450 Ga0373925_0309450_250_1095 277
1346 3300037312 Ga0395899_0047868 Ga0395899_0047868_321_1169 277
1347 3300037418 Ga0395900_0003191 Ga0395900_0003191_13238_14083 277
1348 3300037418 Ga0395900_0088746 Ga0395900_0088746_715_1563 277
1349 3300037418 Ga0395900_0151163 Ga0395900_0151163_1128_1973 277
1350 3300037418 Ga0395900_0153623 Ga0395900_0153623_1223_2071 277
1351 3300037466 Ga0395898_0010493 Ga0395898_0010493_5172_6020 277
1352 3300037466 Ga0395898_0014967 Ga0395898_0014967_5894_6742 277
1353 3300037466 Ga0395898_0255158 Ga0395898_0255158_339_1187 277
1354 3300037466 Ga0395898_0279063 Ga0395898_0279063_465_1310 277
1355 3300037466 Ga0395898_0287406 Ga0395898_0287406_368_1213 277
1356 3300037471 Ga0395905_0132149 Ga0395905_0132149_888_1733 277
1357 3300037853 Ga0436364_0048041 Ga0436364_0048041_24640_25485 277
1358 3300038443 Ga0395901_0001301 Ga0395901_0001301_18708_19553 277
1359 3300038443 Ga0395901_0009709 Ga0395901_0009709_2133_2981 277
1360 3300038443 Ga0395901_0111868 Ga0395901_0111868_1565_2413 277
1361 3300038443 Ga0395901_0135802 Ga0395901_0135802_1224_2072 277
1362 3300038443 Ga0395901_0162421 Ga0395901_0162421_1223_2068 277
1363 3300038443 Ga0395901_0301391 Ga0395901_0301391_629_1477 277
1364 3300038443 Ga0395901_0362126 Ga0395901_0362126_390_1235 277
1365 3300039447 Ga0436361_0678106 Ga0436361_0678106_257_1102 277
1366 3300039447 Ga0436361_0704417 Ga0436361_0704417_469_1314 277
1367 3300039450 Ga0436363_1344844 Ga0436363_1344844_57_902 277
1368 3300042876 Ga0451577_0000239 Ga0451577_0000239_45051_45908 277
1369 3300044658 Ga0466972_0001055 Ga0466972_0001055_522_1367 277
1370 3300044694 Ga0466963_0212335 Ga0466963_0212335_279_1127 277
1371 3300044706 Ga0466964_0005544 Ga0466964_0005544_95_940 277
1372 3300044842 Ga0466957_0010951 Ga0466957_0010951_4242_5090 277
1373 3300045976 Ga0466967_0089271 Ga0466967_0089271_300_1148 277
1374 3300045976 Ga0466967_0427221 Ga0466967_0427221_322_1167 277
1375 3300046454 Ga0495592_0071183 Ga0495592_0071183_1548_2396 277
1376 3300046455 Ga0495603_0069541 Ga0495603_0069541_1208_2053 277
1377 3300046455 Ga0495603_0261328 Ga0495603_0261328_56_904 277
1378 3300046459 Ga0495629_0000622 Ga0495629_0000622_4520_5368 277
1379 3300046459 Ga0495629_0020139 Ga0495629_0020139_3186_4034 277
1380 3300046462 Ga0495651_0002105 Ga0495651_0002105_243_1091 277
1381 3300046462 Ga0495651_0045972 Ga0495651_0045972_253_1101 277
1382 3300046462 Ga0495651_0075283 Ga0495651_0075283_773_1621 277
1383 3300046462 Ga0495651_0152320 Ga0495651_0152320_782_1627 277
1384 3300046463 Ga0495653_0004115 Ga0495653_0004115_4073_4921 277
1385 3300046463 Ga0495653_0020376 Ga0495653_0020376_2461_3309 277
1386 3300046472 Ga0495580_0034874 Ga0495580_0034874_1165_2013 277
1387 3300046473 Ga0495582_0003798 Ga0495582_0003798_1141_1989 277
1388 3300046473 Ga0495582_0045249 Ga0495582_0045249_274_1119 277
1389 3300046474 Ga0495605_0166049 Ga0495605_0166049_123_968 277
1390 3300046475 Ga0495639_0003746 Ga0495639_0003746_4689_5537 277
1391 3300046476 Ga0495662_0086811 Ga0495662_0086811_583_1431 277
1392 3300046477 Ga0495664_0001322 Ga0495664_0001322_11971_12819 277
1393 3300046477 Ga0495664_0066041 Ga0495664_0066041_155_1003 277
1394 3300046511 Ga0495608_0000334 Ga0495608_0000334_32094_32942 277
1395 3300046514 Ga0495618_0006834 Ga0495618_0006834_6042_6890 277
1396 3300046514 Ga0495618_0035037 Ga0495618_0035037_188_1036 277
1397 3300046516 Ga0495628_0085151 Ga0495628_0085151_185_1033 277
1398 3300046516 Ga0495628_0196576 Ga0495628_0196576_612_1460 277
1399 3300046517 Ga0495630_0007085 Ga0495630_0007085_1326_2174 277
1400 3300046517 Ga0495630_0010224 Ga0495630_0010224_3172_4020 277
1401 3300046517 Ga0495630_0066157 Ga0495630_0066157_1363_2208 277
1402 3300046526 Ga0495666_0007789 Ga0495666_0007789_209_1057 277
1403 3300046529 Ga0495652_0010713 Ga0495652_0010713_7269_8117 277
1404 3300046529 Ga0495652_0053242 Ga0495652_0053242_2148_2996 277
1405 3300046531 Ga0495665_0011685 Ga0495665_0011685_2026_2874 277
1406 3300046533 Ga0495640_0009245 Ga0495640_0009245_4666_5514 277
1407 3300046533 Ga0495640_0013614 Ga0495640_0013614_4474_5322 277
1408 3300046535 Ga0495586_0047396 Ga0495586_0047396_996_1844 277
1409 3300046536 Ga0495587_0002243 Ga0495587_0002243_146_994 277
1410 3300046536 Ga0495587_0122402 Ga0495587_0122402_370_1215 277
1411 3300046543 Ga0495645_0041185 Ga0495645_0041185_2450_3298 277
1412 3300046559 Ga0495667_0002608 Ga0495667_0002608_1318_2166 277
1413 3300046559 Ga0495667_0050806 Ga0495667_0050806_1353_2201 277
1414 3300046559 Ga0495667_0074984 Ga0495667_0074984_1020_1868 277
1415 3300046642 Ga0495634_0014918 Ga0495634_0014918_1921_2769 277
1416 3300046663 Ga0495635_0002624 Ga0495635_0002624_1511_2359 277
1417 3300046663 Ga0495635_0003614 Ga0495635_0003614_2667_3515 277
1418 3300046663 Ga0495635_0164202 Ga0495635_0164202_82_930 277
1419 3300046674 Ga0495588_0042495 Ga0495588_0042495_983_1831 277
1420 3300046675 Ga0495657_0022326 Ga0495657_0022326_1472_2320 277
1421 3300046678 Ga0495599_0011917 Ga0495599_0011917_784_1632 277
1422 3300046679 Ga0495623_0004310 Ga0495623_0004310_1377_2225 277
1423 3300046680 Ga0495646_0003704 Ga0495646_0003704_639_1487 277
1424 3300046681 Ga0495647_0015064 Ga0495647_0015064_322_1170 277
1425 3300046683 Ga0495658_0003807 Ga0495658_0003807_5219_6067 277
1426 3300046683 Ga0495658_0007272 Ga0495658_0007272_853_1701 277
1427 3300046683 Ga0495658_0086139 Ga0495658_0086139_242_1087 277
1428 3300046689 Ga0495613_0006304 Ga0495613_0006304_3610_4458 277
1429 3300046689 Ga0495613_0012107 Ga0495613_0012107_2597_3445 277
1430 3300046690 Ga0495624_0050665 Ga0495624_0050665_1579_2427 277
1431 3300046690 Ga0495624_0112036 Ga0495624_0112036_766_1611 277
1432 3300046691 Ga0495670_0057989 Ga0495670_0057989_882_1727 277
1433 3300046809 Ga0495600_0003904 Ga0495600_0003904_6030_6878 277
1434 3300046809 Ga0495600_0005188 Ga0495600_0005188_6514_7362 277
1435 3300046809 Ga0495600_0037970 Ga0495600_0037970_327_1175 277
1436 3300046809 Ga0495600_0206979 Ga0495600_0206979_354_1199 277
1437 3300047315 Ga0495581_0006833 Ga0495581_0006833_1797_2645 277
1438 3300047315 Ga0495581_0018030 Ga0495581_0018030_2967_3812 277
1439 3300047315 Ga0495581_0029337 Ga0495581_0029337_1775_2623 277
1440 3300047317 Ga0495604_0023170 Ga0495604_0023170_4037_4885 277
1441 3300047317 Ga0495604_0059441 Ga0495604_0059441_334_1182 277
1442 3300047319 Ga0495674_0002440 Ga0495674_0002440_4590_5435 277
1443 3300047319 Ga0495674_0003607 Ga0495674_0003607_2213_3061 277
1444 3300047319 Ga0495674_0015609 Ga0495674_0015609_1012_1860 277
1445 3300047321 Ga0495676_0015175 Ga0495676_0015175_855_1703 277
1446 3300047321 Ga0495676_0346470 Ga0495676_0346470_107_952 277
1447 3300047322 Ga0495680_0013510 Ga0495680_0013510_4921_5769 277
1448 3300047322 Ga0495680_0018701 Ga0495680_0018701_792_1637 277
1449 3300047322 Ga0495680_0082648 Ga0495680_0082648_160_1008 277
1450 3300047444 Ga0495675_0002705 Ga0495675_0002705_230_1078 277
1451 3300047444 Ga0495675_0091696 Ga0495675_0091696_27_872 277
1452 3300047471 Ga0495684_0001336 Ga0495684_0001336_11728_12576 277
1453 3300047471 Ga0495684_0076918 Ga0495684_0076918_101_946 277
1454 3300047673 Ga0495593_0024194 Ga0495593_0024194_2235_3080 277
1455 3300048088 Ga0495602_0027138 Ga0495602_0027138_1942_2790 277
1456 3300048088 Ga0495602_0031957 Ga0495602_0031957_635_1483 277
1457 3300048903 Ga0496100_0056076 Ga0496100_0056076_1543_2388 277
1458 3300048903 Ga0496100_0123449 Ga0496100_0123449_440_1285 277
1459 3300048904 Ga0496101_0048809 Ga0496101_0048809_2016_2861 277
1460 3300048905 Ga0496102_0178824 Ga0496102_0178824_311_1156 277
1461 3300048905 Ga0496102_0278872 Ga0496102_0278872_536_1381 277
1462 3300048906 Ga0496103_0080990 Ga0496103_0080990_494_1339 277
1463 3300048907 Ga0496104_0012999 Ga0496104_0012999_4907_5752 277
1464 3300048907 Ga0496104_0094319 Ga0496104_0094319_1415_2263 277
1465 3300048907 Ga0496104_0504316 Ga0496104_0504316_95_940 277
1466 3300048908 Ga0496105_0002276 Ga0496105_0002276_952_1797 277
1467 3300048909 Ga0496106_0078840 Ga0496106_0078840_1629_2474 277
1468 3300048909 Ga0496106_0108608 Ga0496106_0108608_65_910 277
1469 3300048910 Ga0496107_0027285 Ga0496107_0027285_2975_3820 277
1470 3300048910 Ga0496107_0040527 Ga0496107_0040527_2375_3223 277
1471 3300048911 Ga0496108_0328923 Ga0496108_0328923_325_1170 277
1472 3300048912 Ga0496109_0037259 Ga0496109_0037259_3454_4299 277
1473 3300048913 Ga0496110_0032168 Ga0496110_0032168_2732_3577 277
1474 3300048914 Ga0496111_0042323 Ga0496111_0042323_2084_2929 277
1475 3300048914 Ga0496111_0178652 Ga0496111_0178652_553_1398 277
1476 3300048915 Ga0496112_0054491 Ga0496112_0054491_2133_2978 277
1477 3300048915 Ga0496112_0163278 Ga0496112_0163278_1247_2092 277
1478 3300048916 Ga0496113_0005812 Ga0496113_0005812_2787_3632 277
1479 3300048917 Ga0496114_0005322 Ga0496114_0005322_4426_5271 277
1480 3300048917 Ga0496114_0336689 Ga0496114_0336689_193_1038 277
1481 3300048918 Ga0496115_0027807 Ga0496115_0027807_2518_3363 277
1482 3300048924 Ga0496121_0032351 Ga0496121_0032351_3819_4661 277
1483 3300048924 Ga0496121_0144315 Ga0496121_0144315_276_1121 277
1484 3300048928 Ga0496125_0073415 Ga0496125_0073415_778_1623 277
1485 3300048929 Ga0496126_0030458 Ga0496126_0030458_4158_5000 277
1486 3300048929 Ga0496126_0425740 Ga0496126_0425740_162_1007 277
1487 3300049568 Ga0501031_0003990 Ga0501031_0003990_2232_3077 277
1488 3300049568 Ga0501031_0112189 Ga0501031_0112189_465_1313 277
1489 3300049569 Ga0501032_0000073 Ga0501032_0000073_54064_54909 277
1490 3300049569 Ga0501032_0109725 Ga0501032_0109725_513_1361 277
1491 3300049570 Ga0501033_0000136 Ga0501033_0000136_16089_16934 277
1492 3300049570 Ga0501033_0119379 Ga0501033_0119379_338_1186 277
1493 3300049571 Ga0501034_0000251 Ga0501034_0000251_34640_35485 277
1494 3300049571 Ga0501034_0001131 Ga0501034_0001131_11699_12544 277
1495 3300049571 Ga0501034_0016230 Ga0501034_0016230_6034_6879 277
1496 3300049571 Ga0501034_0038227 Ga0501034_0038227_1663_2511 277
1497 3300049571 Ga0501034_0066647 Ga0501034_0066647_224_1069 277
1498 3300049571 Ga0501034_0066672 Ga0501034_0066672_1979_2824 277
1499 3300049572 Ga0501036_0000036 Ga0501036_0000036_54029_54874 277
1500 3300049572 Ga0501036_0012743 Ga0501036_0012743_1473_2318 277
1501 3300049572 Ga0501036_0057434 Ga0501036_0057434_2038_2886 277
1502 3300049573 Ga0501037_0000040 Ga0501037_0000040_18513_19358 277
1503 3300049573 Ga0501037_0066917 Ga0501037_0066917_1482_2327 277
1504 3300049574 Ga0501038_0000150 Ga0501038_0000150_40801_41646 277
1505 3300049574 Ga0501038_0088301 Ga0501038_0088301_1677_2522 277
1506 3300049575 Ga0501039_0002067 Ga0501039_0002067_11902_12747 277
1507 3300049575 Ga0501039_0129101 Ga0501039_0129101_485_1330 277
1508 3300049576 Ga0501040_0131804 Ga0501040_0131804_641_1489 277
1509 3300049578 Ga0501042_0086564 Ga0501042_0086564_1074_1922 277
1510 3300049578 Ga0501042_0169376 Ga0501042_0169376_453_1298 277
1511 3300049579 Ga0501043_0000464 Ga0501043_0000464_8405_9250 277
1512 3300049579 Ga0501043_0021777 Ga0501043_0021777_3761_4606 277
1513 3300049579 Ga0501043_0040268 Ga0501043_0040268_2487_3335 277
1514 3300049580 Ga0501046_0000398 Ga0501046_0000398_34174_35019 277
1515 3300049580 Ga0501046_0009011 Ga0501046_0009011_2104_2952 277
1516 3300049581 Ga0501047_0000656 Ga0501047_0000656_34410_35255 277
1517 3300049581 Ga0501047_0020358 Ga0501047_0020358_338_1186 277
1518 3300049581 Ga0501047_0031540 Ga0501047_0031540_3739_4584 277
1519 3300049581 Ga0501047_0094301 Ga0501047_0094301_1886_2731 277
1520 3300049582 Ga0501048_0000906 Ga0501048_0000906_4805_5650 277
1521 3300049582 Ga0501048_0034386 Ga0501048_0034386_404_1252 277
1522 3300049582 Ga0501048_0070007 Ga0501048_0070007_899_1744 277
1523 3300049583 Ga0501067_0000192 Ga0501067_0000192_26255_27100 277
1524 3300049583 Ga0501067_0056911 Ga0501067_0056911_1197_2042 277
1525 3300049584 Ga0501068_0011008 Ga0501068_0011008_3791_4636 277
1526 3300049584 Ga0501068_0028358 Ga0501068_0028358_368_1213 277
1527 3300049585 Ga0501069_0019343 Ga0501069_0019343_2063_2908 277
1528 3300049586 Ga0501070_0001465 Ga0501070_0001465_4882_5727 277
1529 3300049586 Ga0501070_0042958 Ga0501070_0042958_2325_3173 277
1530 3300049586 Ga0501070_0376513 Ga0501070_0376513_186_1031 277
1531 3300049587 Ga0501071_0022863 Ga0501071_0022863_1628_2473 277
1532 3300049588 Ga0501072_0002128 Ga0501072_0002128_4041_4886 277
1533 3300049588 Ga0501072_0047053 Ga0501072_0047053_1725_2570 277
1534 3300049589 Ga0501073_0000037 Ga0501073_0000037_32399_33244 277
1535 3300049589 Ga0501073_0019463 Ga0501073_0019463_2058_2906 277
1536 3300049589 Ga0501073_0039238 Ga0501073_0039238_1869_2714 277
1537 3300049589 Ga0501073_0042645 Ga0501073_0042645_620_1465 277
1538 3300049590 Ga0501074_0000133 Ga0501074_0000133_30587_31432 277
1539 3300049590 Ga0501074_0023972 Ga0501074_0023972_1519_2364 277
1540 3300049741 Ga0501079_0010872 Ga0501079_0010872_1640_2485 277
1541 3300049741 Ga0501079_0017460 Ga0501079_0017460_3617_4462 277
1542 3300049741 Ga0501079_0141515 Ga0501079_0141515_623_1471 277
1543 3300049742 Ga0501080_0000054 Ga0501080_0000054_27504_28349 277
1544 3300049742 Ga0501080_0036304 Ga0501080_0036304_1262_2110 277
1545 3300049742 Ga0501080_0139654 Ga0501080_0139654_1340_2185 277
1546 3300049742 Ga0501080_0388524 Ga0501080_0388524_250_1095 277
1547 3300049743 Ga0501081_0359343 Ga0501081_0359343_34_879 277
1548 3300049744 Ga0501083_0010078 Ga0501083_0010078_3394_4239 277
1549 3300049744 Ga0501083_0040827 Ga0501083_0040827_2114_2959 277
1550 3300049744 Ga0501083_0065245 Ga0501083_0065245_652_1497 277
1551 3300049822 Ga0501035_0000142 Ga0501035_0000142_52077_52922 277
1552 3300049822 Ga0501035_0013436 Ga0501035_0013436_3690_4535 277
1553 3300049823 Ga0501044_0093846 Ga0501044_0093846_682_1527 277
1554 3300049823 Ga0501044_0540074 Ga0501044_0540074_87_932 277
1555 3300050493 nmdc:mga0k408_90722_c1 nmdc:mga0k408_90722_c1_74_919 277
1556 3300050494 nmdc:mga06z11_18302_c1 nmdc:mga06z11_18302_c1_1002_1847 277
1557 3300050494 nmdc:mga06z11_2647_c1 nmdc:mga06z11_2647_c1_5742_6587 277
1558 3300050510 nmdc:mga06r32_756483_c1 nmdc:mga06r32_756483_c1_69_914 277
1559 3300050512 nmdc:mga0n895_184246_c1 nmdc:mga0n895_184246_c1_644_1489 277
1560 3300050513 nmdc:mga0rr50_294246_c1 nmdc:mga0rr50_294246_c1_441_1286 277
1561 3300050513 nmdc:mga0rr50_338757_c1 nmdc:mga0rr50_338757_c1_226_1074 277
1562 3300050514 nmdc:mga08x19_73900_c1 nmdc:mga08x19_73900_c1_678_1526 277
1563 3300050516 nmdc:mga0sz30_4146_c1 nmdc:mga0sz30_4146_c1_4192_5037 277
1564 3300053077 Ga0495601_0001061 Ga0495601_0001061_11995_12843 277
1565 3300053077 Ga0495601_0008840 Ga0495601_0008840_861_1709 277
1566 3300053078 Ga0495612_0006604 Ga0495612_0006604_3631_4479 277
1567 3300053078 Ga0495612_0007969 Ga0495612_0007969_1788_2636 277
1568 3300053084 Ga0495595_0000705 Ga0495595_0000705_5170_6018 277
1569 3300053084 Ga0495595_0006414 Ga0495595_0006414_3845_4693 277
1570 3300053084 Ga0495595_0045480 Ga0495595_0045480_548_1396 277
1571 3300053085 Ga0495619_0000275 Ga0495619_0000275_23374_24222 277
1572 3300053085 Ga0495619_0004676 Ga0495619_0004676_3674_4522 277
1573 3300053085 Ga0495619_0006250 Ga0495619_0006250_2984_3829 277
1574 3300053085 Ga0495619_0007801 Ga0495619_0007801_1691_2539 277
1575 3300053085 Ga0495619_0034828 Ga0495619_0034828_241_1089 277
1576 3300053087 Ga0500643_064094 Ga0500643_064094_92_937 277
1577 3300054114 Ga0501084_0011104 Ga0501084_0011104_5021_5866 277
1578 3300054114 Ga0501084_0338980 Ga0501084_0338980_172_1020 277
1579 3300060353 Ga0501082_0000057 Ga0501082_0000057_32679_33524 277
1580 3300060353 Ga0501082_0005405 Ga0501082_0005405_7482_8327 277
1581 3300005327 Ga0070658_10041652 Ga0070658_100416521 278
1582 3300005434 Ga0070709_10030238 Ga0070709_100302382 278
1583 3300005437 Ga0070710_10001662 Ga0070710_100016626 278
1584 3300005439 Ga0070711_100003872 Ga0070711_1000038724 278
1585 3300005455 Ga0070663_100047729 Ga0070663_1000477292 278
1586 3300005467 Ga0070706_100251616 Ga0070706_1002516162 278
1587 3300005530 Ga0070679_100414890 Ga0070679_1004148901 278
1588 3300005563 Ga0068855_100228733 Ga0068855_1002287333 278
1589 3300005614 Ga0068856_100216849 Ga0068856_1002168492 278
1590 3300005616 Ga0068852_100211278 Ga0068852_1002112782 278
1591 3300009093 Ga0105240_10034365 Ga0105240_100343655 278
1592 3300009551 Ga0105238_10071906 Ga0105238_100719064 278
1593 3300013105 Ga0157369_10060657 Ga0157369_100606572 278
1594 3300013307 Ga0157372_10316620 Ga0157372_103166202 278
1595 3300022467 Ga0224712_10001625 Ga0224712_100016253 278
1596 3300025898 Ga0207692_10006422 Ga0207692_100064229 278
1597 3300025912 Ga0207707_10512760 Ga0207707_105127601 278
1598 3300025913 Ga0207695_10042569 Ga0207695_100425691 278
1599 3300025921 Ga0207652_10221738 Ga0207652_102217381 278
1600 3300025928 Ga0207700_10049700 Ga0207700_100497002 278
1601 3300026078 Ga0207702_10264033 Ga0207702_102640332 278
1602 3300026142 Ga0207698_10032840 Ga0207698_100328404 278
1603 3300037418 Ga0395900_0625926 Ga0395900_0625926_103_957 278
1604 3300044694 Ga0466963_0107399 Ga0466963_0107399_567_1421 278
1605 3300044712 Ga0453684_0011384 Ga0453684_0011384_1740_2594 278
1606 3300045976 Ga0466967_0123088 Ga0466967_0123088_252_1106 278
1607 3300049569 Ga0501032_0049061 Ga0501032_0049061_543_1391 278
1608 3300049569 Ga0501032_0137788 Ga0501032_0137788_554_1402 278
1609 3300049571 Ga0501034_0006465 Ga0501034_0006465_834_1682 278
1610 3300049571 Ga0501034_0018585 Ga0501034_0018585_5002_5850 278
1611 3300049572 Ga0501036_0006000 Ga0501036_0006000_732_1580 278
1612 3300049572 Ga0501036_0007555 Ga0501036_0007555_6541_7389 278
1613 3300049572 Ga0501036_0275557 Ga0501036_0275557_349_1197 278
1614 3300049573 Ga0501037_0003198 Ga0501037_0003198_5720_6568 278
1615 3300049573 Ga0501037_0019500 Ga0501037_0019500_177_1025 278
1616 3300049574 Ga0501038_0008633 Ga0501038_0008633_2669_3517 278
1617 3300049575 Ga0501039_0207592 Ga0501039_0207592_317_1165 278
1618 3300049579 Ga0501043_0000736 Ga0501043_0000736_6416_7264 278
1619 3300049579 Ga0501043_0005551 Ga0501043_0005551_7561_8409 278
1620 3300049580 Ga0501046_0016765 Ga0501046_0016765_246_1094 278
1621 3300049580 Ga0501046_0177882 Ga0501046_0177882_593_1447 278
1622 3300049581 Ga0501047_0000124 Ga0501047_0000124_19891_20739 278
1623 3300049581 Ga0501047_0026604 Ga0501047_0026604_4029_4883 278
1624 3300049581 Ga0501047_0091221 Ga0501047_0091221_607_1455 278
1625 3300049581 Ga0501047_0302544 Ga0501047_0302544_451_1299 278
1626 3300049582 Ga0501048_0000566 Ga0501048_0000566_10492_11340 278
1627 3300049582 Ga0501048_0096261 Ga0501048_0096261_439_1287 278
1628 3300049585 Ga0501069_0035563 Ga0501069_0035563_1004_1852 278
1629 3300049586 Ga0501070_0001240 Ga0501070_0001240_13811_14659 278
1630 3300049586 Ga0501070_0001698 Ga0501070_0001698_15268_16116 278
1631 3300049586 Ga0501070_0038630 Ga0501070_0038630_1456_2310 278
1632 3300049586 Ga0501070_0063418 Ga0501070_0063418_739_1587 278
1633 3300049589 Ga0501073_0090680 Ga0501073_0090680_1209_2057 278
1634 3300049590 Ga0501074_0075543 Ga0501074_0075543_975_1829 278
1635 3300049590 Ga0501074_0319275 Ga0501074_0319275_158_1006 278
1636 3300049742 Ga0501080_0000130 Ga0501080_0000130_5757_6605 278
1637 3300049742 Ga0501080_0010473 Ga0501080_0010473_3374_4228 278
1638 3300049742 Ga0501080_0238183 Ga0501080_0238183_585_1433 278
1639 3300049744 Ga0501083_0000480 Ga0501083_0000480_24058_24906 278
1640 3300049744 Ga0501083_0104125 Ga0501083_0104125_612_1460 278
1641 3300049822 Ga0501035_0006352 Ga0501035_0006352_4443_5291 278
1642 3300049822 Ga0501035_0119926 Ga0501035_0119926_674_1522 278
1643 3300049823 Ga0501044_0010830 Ga0501044_0010830_4422_5276 278
1644 3300049823 Ga0501044_0021003 Ga0501044_0021003_5428_6276 278
1645 3300049823 Ga0501044_0041223 Ga0501044_0041223_396_1244 278
1646 3300059492 Ga0587073_0045526 Ga0587073_0045526_89_943 278
1647 3300059505 Ga0587083_0032049 Ga0587083_0032049_120_974 278
1648 3300061719 Ga0466962_0086282 Ga0466962_0086282_540_1394 278
1649 3300005445 Ga0070708_100119812 Ga0070708_1001198122 279
1650 3300005445 Ga0070708_100170180 Ga0070708_1001701803 279
1651 3300005467 Ga0070706_100269967 Ga0070706_1002699672 279
1652 3300005471 Ga0070698_100021333 Ga0070698_1000213334 279
1653 3300005518 Ga0070699_100276345 Ga0070699_1002763451 279
1654 3300005536 Ga0070697_100026587 Ga0070697_1000265872 279
1655 3300005536 Ga0070697_100058243 Ga0070697_1000582433 279
1656 3300005536 Ga0070697_100195468 Ga0070697_1001954682 279
1657 3300005981 Ga0081538_10018669 Ga0081538_100186691 279
1658 3300006844 Ga0075428_100042770 Ga0075428_1000427705 279
1659 3300006847 Ga0075431_100043253 Ga0075431_1000432534 279
1660 3300009093 Ga0105240_10138896 Ga0105240_101388962 279
1661 3300009147 Ga0114129_10035540 Ga0114129_100355402 279
1662 3300013250 Ga0171462_1010 Ga0171462_101064 279
1663 3300025910 Ga0207684_10052883 Ga0207684_100528832 279
1664 3300025922 Ga0207646_10723365 Ga0207646_107233651 279
1665 3300037312 Ga0395899_0001099 Ga0395899_0001099_8839_9693 279
1666 3300037312 Ga0395899_0002343 Ga0395899_0002343_10558_11412 279
1667 3300037418 Ga0395900_0008468 Ga0395900_0008468_9657_10511 279
1668 3300037418 Ga0395900_0033735 Ga0395900_0033735_2300_3154 279
1669 3300037418 Ga0395900_0500974 Ga0395900_0500974_140_994 279
1670 3300037466 Ga0395898_0024709 Ga0395898_0024709_60_914 279
1671 3300037471 Ga0395905_0478083 Ga0395905_0478083_80_934 279
1672 3300038443 Ga0395901_0000583 Ga0395901_0000583_31086_31940 279
1673 3300038443 Ga0395901_0002644 Ga0395901_0002644_3638_4492 279
1674 3300038443 Ga0395901_0130006 Ga0395901_0130006_284_1138 279
1675 3300038443 Ga0395901_0133862 Ga0395901_0133862_1563_2417 279
1676 3300038443 Ga0395901_0377699 Ga0395901_0377699_471_1325 279
1677 3300044673 Ga0453683_0030193 Ga0453683_0030193_404_1255 279
1678 3300046477 Ga0495664_0109613 Ga0495664_0109613_545_1399 279
1679 3300046524 Ga0495648_0005015 Ga0495648_0005015_9792_10646 279
1680 3300046524 Ga0495648_0114898 Ga0495648_0114898_478_1332 279
1681 3300049591 Ga0501075_0062043 Ga0501075_0062043_298_1152 279
1682 3300049591 Ga0501075_0269405 Ga0501075_0269405_308_1162 279
1683 3300049593 Ga0501077_0122182 Ga0501077_0122182_486_1340 279
1684 3300049741 Ga0501079_0173530 Ga0501079_0173530_537_1391 279
1685 3300049741 Ga0501079_0464028 Ga0501079_0464028_53_907 279
1686 3300049823 Ga0501044_0249399 Ga0501044_0249399_13_867 279
1687 3300050507 nmdc:mga05p37_24438_c1 nmdc:mga05p37_24438_c1_1573_2427 279
1688 3300050516 nmdc:mga0sz30_9309_c1 nmdc:mga0sz30_9309_c1_2174_3028 279
1689 3300053077 Ga0495601_0033223 Ga0495601_0033223_1168_2022 279
1690 3300060353 Ga0501082_0176857 Ga0501082_0176857_389_1243 279
1691 3300061734 Ga0530510_0311761 Ga0530510_0311761_265_1119 279
1692 3300003371 JGI26145J50221_1003223 JGI26145J50221_10032232 280
1693 3300003503 JGI26141J51220_1000108 JGI26141J51220_10001081 280
1694 3300005336 Ga0070680_100104954 Ga0070680_1001049543 280
1695 3300005344 Ga0070661_100277128 Ga0070661_1002771281 280
1696 3300005406 Ga0070703_10013200 Ga0070703_100132003 280
1697 3300005435 Ga0070714_100008731 Ga0070714_1000087313 280
1698 3300005435 Ga0070714_100588191 Ga0070714_1005881911 280
1699 3300005437 Ga0070710_10006636 Ga0070710_100066362 280
1700 3300005439 Ga0070711_100164842 Ga0070711_1001648423 280
1701 3300005444 Ga0070694_100002954 Ga0070694_1000029543 280
1702 3300005445 Ga0070708_100011671 Ga0070708_1000116713 280
1703 3300005445 Ga0070708_100020150 Ga0070708_1000201505 280
1704 3300005445 Ga0070708_100045251 Ga0070708_1000452513 280
1705 3300005445 Ga0070708_100143727 Ga0070708_1001437271 280
1706 3300005458 Ga0070681_10008663 Ga0070681_100086639 280
1707 3300005467 Ga0070706_100011528 Ga0070706_1000115284 280
1708 3300005467 Ga0070706_100161262 Ga0070706_1001612622 280
1709 3300005467 Ga0070706_100356296 Ga0070706_1003562962 280
1710 3300005468 Ga0070707_100057218 Ga0070707_1000572183 280
1711 3300005468 Ga0070707_100061233 Ga0070707_1000612333 280
1712 3300005468 Ga0070707_100167698 Ga0070707_1001676982 280
1713 3300005468 Ga0070707_100195385 Ga0070707_1001953852 280
1714 3300005471 Ga0070698_100025377 Ga0070698_1000253775 280
1715 3300005471 Ga0070698_100027950 Ga0070698_1000279502 280
1716 3300005471 Ga0070698_100263537 Ga0070698_1002635371 280
1717 3300005518 Ga0070699_100053532 Ga0070699_1000535323 280
1718 3300005518 Ga0070699_100100612 Ga0070699_1001006122 280
1719 3300005530 Ga0070679_100048672 Ga0070679_1000486723 280
1720 3300005536 Ga0070697_100105670 Ga0070697_1001056703 280
1721 3300005536 Ga0070697_100134522 Ga0070697_1001345221 280
1722 3300005536 Ga0070697_100242504 Ga0070697_1002425042 280
1723 3300005536 Ga0070697_100287212 Ga0070697_1002872122 280
1724 3300005539 Ga0068853_100233266 Ga0068853_1002332662 280
1725 3300005545 Ga0070695_100002088 Ga0070695_10000208810 280
1726 3300005545 Ga0070695_100021025 Ga0070695_1000210252 280
1727 3300005546 Ga0070696_100311963 Ga0070696_1003119631 280
1728 3300005563 Ga0068855_100088726 Ga0068855_1000887264 280
1729 3300005563 Ga0068855_100635787 Ga0068855_1006357872 280
1730 3300005564 Ga0070664_100035596 Ga0070664_1000355963 280
1731 3300005614 Ga0068856_100010981 Ga0068856_1000109818 280
1732 3300005614 Ga0068856_100134867 Ga0068856_1001348672 280
1733 3300005937 Ga0081455_10017297 Ga0081455_100172972 280
1734 3300005981 Ga0081538_10021003 Ga0081538_100210035 280
1735 3300005981 Ga0081538_10043856 Ga0081538_100438564 280
1736 3300006028 Ga0070717_10072367 Ga0070717_100723672 280
1737 3300006847 Ga0075431_100364087 Ga0075431_1003640872 280
1738 3300006852 Ga0075433_10001063 Ga0075433_1000106318 280
1739 3300007076 Ga0075435_100009431 Ga0075435_1000094317 280
1740 3300009551 Ga0105238_10188537 Ga0105238_101885372 280
1741 3300013100 Ga0157373_10249385 Ga0157373_102493851 280
1742 3300013104 Ga0157370_10008438 Ga0157370_100084385 280
1743 3300013104 Ga0157370_10028283 Ga0157370_100282834 280
1744 3300013105 Ga0157369_10063202 Ga0157369_100632023 280
1745 3300013296 Ga0157374_10568598 Ga0157374_105685982 280
1746 3300013307 Ga0157372_10012527 Ga0157372_100125273 280
1747 3300015683 Ga0183362_10002 Ga0183362_10002686 280
1748 3300025898 Ga0207692_10114809 Ga0207692_101148092 280
1749 3300025910 Ga0207684_10020217 Ga0207684_100202173 280
1750 3300025910 Ga0207684_10067076 Ga0207684_100670763 280
1751 3300025910 Ga0207684_10162524 Ga0207684_101625242 280
1752 3300025910 Ga0207684_10185803 Ga0207684_101858032 280
1753 3300025910 Ga0207684_10354812 Ga0207684_103548122 280
1754 3300025912 Ga0207707_10004819 Ga0207707_100048194 280
1755 3300025913 Ga0207695_10226032 Ga0207695_102260322 280
1756 3300025916 Ga0207663_10351950 Ga0207663_103519501 280
1757 3300025917 Ga0207660_10022563 Ga0207660_100225635 280
1758 3300025919 Ga0207657_10237207 Ga0207657_102372072 280
1759 3300025920 Ga0207649_10335541 Ga0207649_103355412 280
1760 3300025921 Ga0207652_10015642 Ga0207652_100156423 280
1761 3300025922 Ga0207646_10001491 Ga0207646_1000149113 280
1762 3300025922 Ga0207646_10044097 Ga0207646_100440972 280
1763 3300025922 Ga0207646_10061921 Ga0207646_100619213 280
1764 3300025922 Ga0207646_10076856 Ga0207646_100768562 280
1765 3300025928 Ga0207700_10061770 Ga0207700_100617702 280
1766 3300025945 Ga0207679_10056913 Ga0207679_100569133 280
1767 3300025949 Ga0207667_10129620 Ga0207667_101296202 280
1768 3300025949 Ga0207667_10570502 Ga0207667_105705022 280
1769 3300025981 Ga0207640_10021723 Ga0207640_100217237 280
1770 3300026078 Ga0207702_10093233 Ga0207702_100932332 280
1771 3300026078 Ga0207702_10184688 Ga0207702_101846881 280
1772 3300026089 Ga0207648_10414174 Ga0207648_104141741 280
1773 3300027424 Ga0209984_1000425 Ga0209984_10004254 280
1774 3300027462 Ga0210000_1004956 Ga0210000_10049562 280
1775 3300027526 Ga0209968_1013459 Ga0209968_10134592 280
1776 3300027552 Ga0209982_1009091 Ga0209982_10090912 280
1777 3300027614 Ga0209970_1000473 Ga0209970_10004735 280
1778 3300027617 Ga0210002_1001740 Ga0210002_10017402 280
1779 3300027665 Ga0209983_1008900 Ga0209983_10089001 280
1780 3300027682 Ga0209971_1000022 Ga0209971_100002233 280
1781 3300027695 Ga0209966_1000218 Ga0209966_10002189 280
1782 3300027717 Ga0209998_10001306 Ga0209998_100013064 280
1783 3300027876 Ga0209974_10001842 Ga0209974_100018428 280
1784 3300031901 Ga0307406_10151690 Ga0307406_101516902 280
1785 3300032002 Ga0307416_100693117 Ga0307416_1006931172 280
1786 3300035398 Ga0316574_0119479 Ga0316574_0119479_131_973 280
1787 3300036647 Ga0316582_0351515 Ga0316582_0351515_135_977 280
1788 3300039437 Ga0436365_1652708 Ga0436365_1652708_18854_19741 280
1789 3300042876 Ga0451577_0000102 Ga0451577_0000102_65599_66441 280
1790 3300042876 Ga0451577_0000321 Ga0451577_0000321_20872_21714 280
1791 3300042876 Ga0451577_0373041 Ga0451577_0373041_436_1284 280
1792 3300044673 Ga0453683_0267363 Ga0453683_0267363_211_1065 280
1793 3300044712 Ga0453684_0000249 Ga0453684_0000249_165715_166557 280
1794 3300044712 Ga0453684_0002288 Ga0453684_0002288_37275_38117 280
1795 3300044712 Ga0453684_0048015 Ga0453684_0048015_2981_3823 280
1796 3300044712 Ga0453684_0149917 Ga0453684_0149917_966_1817 280
1797 3300044712 Ga0453684_0307475 Ga0453684_0307475_540_1388 280
1798 3300045051 Ga0451576_0135899 Ga0451576_0135899_782_1630 280
1799 3300049586 Ga0501070_0137359 Ga0501070_0137359_594_1448 280
1800 3300049593 Ga0501077_0125573 Ga0501077_0125573_459_1310 280
1801 3300050507 nmdc:mga05p37_388450_c1 nmdc:mga05p37_388450_c1_133_1026 280
1802 3300050509 nmdc:mga0qj67_17904_c1 nmdc:mga0qj67_17904_c1_1244_2104 280
1803 3300050513 nmdc:mga0rr50_25807_c1 nmdc:mga0rr50_25807_c1_365_1258 280
1804 iso_pu_bacteria 2791355137 2792832770 280
1805 2162886012 MBSR1b_contig_13101341 MBSR1b_0875.00003770 281
1806 3300001977 JGI24746J21847_1002113 JGI24746J21847_10021132 281
1807 3300002073 JGI24745J21846_1001654 JGI24745J21846_10016543 281
1808 3300002074 JGI24748J21848_1001599 JGI24748J21848_10015993 281
1809 3300002076 JGI24749J21850_1002992 JGI24749J21850_10029922 281
1810 3300002077 JGI24744J21845_10004588 JGI24744J21845_100045882 281
1811 3300002459 JGI24751J29686_10014716 JGI24751J29686_100147162 281
1812 3300005290 Ga0065712_10094941 Ga0065712_100949412 281
1813 3300005293 Ga0065715_10179345 Ga0065715_101793452 281
1814 3300005327 Ga0070658_10001995 Ga0070658_1000199515 281
1815 3300005328 Ga0070676_10008932 Ga0070676_100089324 281
1816 3300005329 Ga0070683_100004179 Ga0070683_1000041797 281
1817 3300005330 Ga0070690_100001179 Ga0070690_10000117911 281
1818 3300005331 Ga0070670_100011897 Ga0070670_1000118975 281
1819 3300005333 Ga0070677_10000244 Ga0070677_1000024416 281
1820 3300005334 Ga0068869_100006020 Ga0068869_1000060205 281
1821 3300005335 Ga0070666_10001439 Ga0070666_100014399 281
1822 3300005337 Ga0070682_100011525 Ga0070682_1000115252 281
1823 3300005338 Ga0068868_100013550 Ga0068868_1000135505 281
1824 3300005339 Ga0070660_100001141 Ga0070660_1000011414 281
1825 3300005340 Ga0070689_100001932 Ga0070689_10000193211 281
1826 3300005341 Ga0070691_10105965 Ga0070691_101059652 281
1827 3300005344 Ga0070661_100004888 Ga0070661_1000048888 281
1828 3300005345 Ga0070692_10008524 Ga0070692_100085243 281
1829 3300005347 Ga0070668_100001237 Ga0070668_10000123715 281
1830 3300005353 Ga0070669_100000701 Ga0070669_1000007019 281
1831 3300005354 Ga0070675_100025068 Ga0070675_1000250684 281
1832 3300005355 Ga0070671_100001652 Ga0070671_10000165215 281
1833 3300005356 Ga0070674_100000159 Ga0070674_10000015910 281
1834 3300005364 Ga0070673_100001576 Ga0070673_10000157611 281
1835 3300005365 Ga0070688_100000788 Ga0070688_1000007883 281
1836 3300005366 Ga0070659_100000694 Ga0070659_1000006944 281
1837 3300005367 Ga0070667_100026212 Ga0070667_1000262124 281
1838 3300005438 Ga0070701_10006500 Ga0070701_100065002 281
1839 3300005439 Ga0070711_100056009 Ga0070711_1000560092 281
1840 3300005441 Ga0070700_100009692 Ga0070700_1000096924 281
1841 3300005455 Ga0070663_100000662 Ga0070663_1000006627 281
1842 3300005456 Ga0070678_100004629 Ga0070678_1000046295 281
1843 3300005457 Ga0070662_100000288 Ga0070662_1000002889 281
1844 3300005459 Ga0068867_100001420 Ga0068867_10000142014 281
1845 3300005466 Ga0070685_10000656 Ga0070685_100006564 281
1846 3300005468 Ga0070707_100008162 Ga0070707_1000081626 281
1847 3300005518 Ga0070699_100288758 Ga0070699_1002887582 281
1848 3300005530 Ga0070679_100029612 Ga0070679_1000296127 281
1849 3300005535 Ga0070684_100039832 Ga0070684_1000398322 281
1850 3300005536 Ga0070697_100012878 Ga0070697_1000128784 281
1851 3300005539 Ga0068853_100020726 Ga0068853_1000207264 281
1852 3300005543 Ga0070672_100001109 Ga0070672_10000110914 281
1853 3300005544 Ga0070686_100000854 Ga0070686_10000085415 281
1854 3300005545 Ga0070695_100014544 Ga0070695_1000145442 281
1855 3300005546 Ga0070696_100092829 Ga0070696_1000928292 281
1856 3300005547 Ga0070693_100049769 Ga0070693_1000497692 281
1857 3300005548 Ga0070665_100034487 Ga0070665_1000344874 281
1858 3300005563 Ga0068855_100020428 Ga0068855_1000204285 281
1859 3300005564 Ga0070664_100020311 Ga0070664_1000203114 281
1860 3300005577 Ga0068857_100010846 Ga0068857_1000108465 281
1861 3300005578 Ga0068854_100001780 Ga0068854_10000178011 281
1862 3300005614 Ga0068856_100089148 Ga0068856_1000891482 281
1863 3300005615 Ga0070702_100083355 Ga0070702_1000833552 281
1864 3300005616 Ga0068852_100000493 Ga0068852_10000049311 281
1865 3300005617 Ga0068859_100003746 Ga0068859_1000037466 281
1866 3300005618 Ga0068864_100011570 Ga0068864_1000115704 281
1867 3300005718 Ga0068866_10000386 Ga0068866_100003864 281
1868 3300005719 Ga0068861_100000431 Ga0068861_10000043112 281
1869 3300005834 Ga0068851_10000157 Ga0068851_100001575 281
1870 3300005840 Ga0068870_10007879 Ga0068870_100078794 281
1871 3300005841 Ga0068863_100056478 Ga0068863_1000564782 281
1872 3300005842 Ga0068858_100013719 Ga0068858_1000137195 281
1873 3300005843 Ga0068860_100028069 Ga0068860_1000280692 281
1874 3300005844 Ga0068862_100002452 Ga0068862_10000245214 281
1875 3300006237 Ga0097621_100001085 Ga0097621_10000108517 281
1876 3300006237 Ga0097621_100042950 Ga0097621_1000429503 281
1877 3300006358 Ga0068871_100007090 Ga0068871_1000070905 281
1878 3300006881 Ga0068865_100000930 Ga0068865_1000009304 281
1879 3300006931 Ga0097620_100003746 Ga0097620_1000037466 281
1880 3300009011 Ga0105251_10165515 Ga0105251_101655152 281
1881 3300009092 Ga0105250_10066318 Ga0105250_100663182 281
1882 3300009093 Ga0105240_10015833 Ga0105240_100158333 281
1883 3300009098 Ga0105245_10006295 Ga0105245_100062959 281
1884 3300009101 Ga0105247_10000624 Ga0105247_1000062415 281
1885 3300009148 Ga0105243_10019362 Ga0105243_100193622 281
1886 3300009174 Ga0105241_10002193 Ga0105241_1000219313 281
1887 3300009176 Ga0105242_10003732 Ga0105242_1000373210 281
1888 3300009177 Ga0105248_10005783 Ga0105248_100057834 281
1889 3300009545 Ga0105237_10004564 Ga0105237_1000456414 281
1890 3300009551 Ga0105238_10032523 Ga0105238_100325232 281
1891 3300009553 Ga0105249_10000377 Ga0105249_1000037727 281
1892 3300010375 Ga0105239_10004343 Ga0105239_100043434 281
1893 3300013100 Ga0157373_10004632 Ga0157373_100046329 281
1894 3300013102 Ga0157371_10011116 Ga0157371_100111164 281
1895 3300013105 Ga0157369_10004244 Ga0157369_100042444 281
1896 3300013296 Ga0157374_10002036 Ga0157374_100020364 281
1897 3300013297 Ga0157378_10001955 Ga0157378_100019554 281
1898 3300013306 Ga0163162_10002791 Ga0163162_1000279114 281
1899 3300013307 Ga0157372_10046229 Ga0157372_100462294 281
1900 3300013308 Ga0157375_10011397 Ga0157375_100113975 281
1901 3300014325 Ga0163163_10005187 Ga0163163_100051874 281
1902 3300014326 Ga0157380_10061096 Ga0157380_100610962 281
1903 3300014745 Ga0157377_10000487 Ga0157377_100004874 281
1904 3300014968 Ga0157379_10001956 Ga0157379_100019565 281
1905 3300014969 Ga0157376_10023541 Ga0157376_100235412 281
1906 3300025315 Ga0207697_10000586 Ga0207697_1000058619 281
1907 3300025321 Ga0207656_10001746 Ga0207656_100017465 281
1908 3300025711 Ga0207696_1040276 Ga0207696_10402762 281
1909 3300025893 Ga0207682_10000732 Ga0207682_100007323 281
1910 3300025899 Ga0207642_10000359 Ga0207642_1000035912 281
1911 3300025900 Ga0207710_10002087 Ga0207710_100020878 281
1912 3300025901 Ga0207688_10000079 Ga0207688_1000007919 281
1913 3300025903 Ga0207680_10001014 Ga0207680_100010144 281
1914 3300025904 Ga0207647_10010432 Ga0207647_100104323 281
1915 3300025907 Ga0207645_10000016 Ga0207645_1000001692 281
1916 3300025908 Ga0207643_10000010 Ga0207643_1000001092 281
1917 3300025909 Ga0207705_10013498 Ga0207705_100134982 281
1918 3300025910 Ga0207684_10000045 Ga0207684_1000004596 281
1919 3300025911 Ga0207654_10001320 Ga0207654_100013204 281
1920 3300025913 Ga0207695_10010900 Ga0207695_100109002 281
1921 3300025914 Ga0207671_10011341 Ga0207671_100113414 281
1922 3300025918 Ga0207662_10000127 Ga0207662_1000012715 281
1923 3300025919 Ga0207657_10000060 Ga0207657_1000006038 281
1924 3300025920 Ga0207649_10003363 Ga0207649_100033637 281
1925 3300025921 Ga0207652_10074122 Ga0207652_100741222 281
1926 3300025922 Ga0207646_10149658 Ga0207646_101496582 281
1927 3300025923 Ga0207681_10012767 Ga0207681_100127672 281
1928 3300025924 Ga0207694_10004715 Ga0207694_100047157 281
1929 3300025925 Ga0207650_10000179 Ga0207650_1000017946 281
1930 3300025926 Ga0207659_10000928 Ga0207659_100009284 281
1931 3300025927 Ga0207687_10003864 Ga0207687_100038645 281
1932 3300025931 Ga0207644_10000932 Ga0207644_1000093217 281
1933 3300025932 Ga0207690_10001609 Ga0207690_1000160912 281
1934 3300025933 Ga0207706_10000132 Ga0207706_1000013253 281
1935 3300025934 Ga0207686_10004545 Ga0207686_100045453 281
1936 3300025935 Ga0207709_10033746 Ga0207709_100337462 281
1937 3300025936 Ga0207670_10000085 Ga0207670_1000008548 281
1938 3300025937 Ga0207669_10002824 Ga0207669_100028245 281
1939 3300025938 Ga0207704_10000778 Ga0207704_1000077812 281
1940 3300025940 Ga0207691_10000011 Ga0207691_1000001134 281
1941 3300025941 Ga0207711_10000230 Ga0207711_1000023046 281
1942 3300025942 Ga0207689_10000011 Ga0207689_1000001192 281
1943 3300025944 Ga0207661_10014442 Ga0207661_100144423 281
1944 3300025945 Ga0207679_10000657 Ga0207679_1000065712 281
1945 3300025949 Ga0207667_10002318 Ga0207667_1000231810 281
1946 3300025960 Ga0207651_10000153 Ga0207651_1000015317 281
1947 3300025961 Ga0207712_10001891 Ga0207712_100018914 281
1948 3300025972 Ga0207668_10001052 Ga0207668_1000105211 281
1949 3300025981 Ga0207640_10001312 Ga0207640_1000131211 281
1950 3300025986 Ga0207658_10000879 Ga0207658_100008799 281
1951 3300026023 Ga0207677_10000827 Ga0207677_1000082715 281
1952 3300026035 Ga0207703_10000850 Ga0207703_100008509 281
1953 3300026041 Ga0207639_10000807 Ga0207639_1000080710 281
1954 3300026067 Ga0207678_10000667 Ga0207678_100006675 281
1955 3300026075 Ga0207708_10007415 Ga0207708_100074156 281
1956 3300026078 Ga0207702_10005017 Ga0207702_100050174 281
1957 3300026088 Ga0207641_10001606 Ga0207641_1000160611 281
1958 3300026089 Ga0207648_10000258 Ga0207648_1000025853 281
1959 3300026095 Ga0207676_10001725 Ga0207676_1000172514 281
1960 3300026116 Ga0207674_10001878 Ga0207674_100018787 281
1961 3300026118 Ga0207675_100000164 Ga0207675_10000016454 281
1962 3300026121 Ga0207683_10000384 Ga0207683_1000038422 281
1963 3300026142 Ga0207698_10005122 Ga0207698_100051224 281
1964 3300027471 Ga0209995_1001020 Ga0209995_10010204 281
1965 3300028379 Ga0268266_10000550 Ga0268266_1000055025 281
1966 3300028380 Ga0268265_10000749 Ga0268265_1000074919 281
1967 3300028381 Ga0268264_10000825 Ga0268264_1000082518 281
1968 3300035695 Ga0373927_0325739 Ga0373927_0325739_41_886 281
1969 3300035725 Ga0373947_0159257 Ga0373947_0159257_574_1419 281
1970 3300039450 Ga0436363_1709801 Ga0436363_1709801_11_856 281
1971 3300046472 Ga0495580_0151186 Ga0495580_0151186_449_1294 281
1972 3300046683 Ga0495658_0013224 Ga0495658_0013224_619_1464 281
1973 3300048905 Ga0496102_0023729 Ga0496102_0023729_249_1094 281
1974 3300048908 Ga0496105_0403266 Ga0496105_0403266_80_925 281
1975 3300048909 Ga0496106_0021785 Ga0496106_0021785_300_1145 281
1976 3300048910 Ga0496107_0020445 Ga0496107_0020445_3559_4404 281
1977 3300048911 Ga0496108_0065006 Ga0496108_0065006_1448_2293 281
1978 3300048912 Ga0496109_0007256 Ga0496109_0007256_7302_8147 281
1979 3300048913 Ga0496110_0199904 Ga0496110_0199904_670_1515 281
1980 3300048914 Ga0496111_0205310 Ga0496111_0205310_245_1090 281
1981 3300048915 Ga0496112_0002248 Ga0496112_0002248_13055_13900 281
1982 3300048916 Ga0496113_0077378 Ga0496113_0077378_1207_2052 281
1983 3300048918 Ga0496115_0033216 Ga0496115_0033216_412_1263 281

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

96

303

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2r6g-assembly1.cif.gz_G the crystal structure of the e. coli maltose transporter 0.8374 8 281
8hpr-assembly1.cif.gz_B lpqy-sugabc in state 4 0.8299 3 266
3rlf-assembly1.cif.gz_G crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to mgamppnp 0.8282 11 281
8hpr-assembly1.cif.gz_B lpqy-sugabc in state 4 0.827 3 266
8hpn-assembly1.cif.gz_B lpqy-sugabc in state 3 0.8252 3 272
ID Description Score Start End Superfamily
af_I6Y1U3_2_266_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.885 3 271 1.10.3720.10
af_I6Y1U3_2_266_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8788 3 271 1.10.3720.10
af_O53483_6_271_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8754 5 271 1.10.3720.10
af_P77716_1_267_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8735 1 265 1.10.3720.10
af_P77716_1_267_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8614 1 265 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A538RBW5-F1-model_v4 Carbohydrate ABC transporter permease 0.9572 5 239 GO:0005886
GO:0055085
AF-A0A535XIW1-F1-model_v4 Carbohydrate ABC transporter permease 0.9502 5 235 GO:0005886
GO:0055085
AF-A0A2V7SKI7-F1-model_v4 Sugar ABC transporter permease 0.9485 32 269 GO:0005886
GO:0055085
AF-A0A537TJL5-F1-model_v4 Carbohydrate ABC transporter permease 0.9448 1 266 GO:0005886
GO:0055085
AF-A0A5Q4G8K8-F1-model_v4 Carbohydrate ABC transporter permease 0.9409 12 281 GO:0005886
GO:0055085

Feature Viewer

pLDDT pTM Quality
87.91 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map