metagRoot

F496081

General Info

Members	Datasets	Scaffolds	Average Seq Length
1932	540	1929	212

Family's Representative Sequence

Representative Sequence	3300005614\|Ga0068856_100166548\|Ga0068856_1001665482
Length	247
Sequence	VNTISTGRCHNYHIEYDGEGLNFPPQASFAKASRSGNLFAMKIARKATQQSVPPGRGYLDGQMLIAMPAMSDERFTRAVIYVCAHSTEGAMGIIVNQPAQNIKFPDLLVQLEVIPAAERIQLPNRAEDVKVLKGGPVETGRGFVLHSADFFIENSTLPIDEGICLTATLDILKAIARGNGPASAILALGYAGWAPGQLEQEIQQNGWLHCAADPELIFGQDTDTKYEKALRKIGIDLGMLSSESGHA

Samples

	Sample ID	Description	Type	Environment
1	2162886007	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1	Metagenome	Rhizosphere
2	2209111006	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1	Metagenome	Rhizosphere
3	2643221733	Bosea sp. Root381	Isolate	Unclassified
4	2643221734	Bosea sp. Root670	Isolate	Unclassified
5	2842694124	Methylopila sp. R-72369	Isolate	Unclassified
6	3300000041	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere	Metagenome	Rhizosphere
7	3300000042	Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young	Metagenome	Rhizosphere
8	3300000043	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere	Metagenome	Rhizosphere
9	3300000044	Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old	Metagenome	Rhizosphere
10	3300000045	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis Col-0 old rhizosphere	Metagenome	Rhizosphere
11	3300000652	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA	Metagenome	Rhizosphere
12	3300001430	Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5	Metagenome	Rhizosphere
13	3300001977	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5	Metagenome	Rhizosphere
14	3300001978	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6	Metagenome	Rhizosphere
15	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
16	3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Metagenome	Rhizosphere
17	3300001990	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3	Metagenome	Rhizosphere
18	3300001991	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2	Metagenome	Rhizosphere
19	3300002070	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4	Metagenome	Rhizosphere
20	3300002073	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4	Metagenome	Rhizosphere
21	3300002074	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1	Metagenome	Rhizosphere
22	3300002075	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4	Metagenome	Rhizosphere
23	3300002076	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3	Metagenome	Rhizosphere
24	3300002077	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3	Metagenome	Rhizosphere
25	3300002126	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5	Metagenome	Rhizosphere
26	3300002155	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7	Metagenome	Rhizosphere
27	3300002239	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2	Metagenome	Rhizosphere
28	3300002244	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1	Metagenome	Rhizosphere
29	3300002987	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB	Metagenome	Endosphere
30	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
31	3300003659	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
32	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
33	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
34	3300003911	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
35	3300004803	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
36	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
37	3300005276	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1	Metagenome	Rhizosphere
38	3300005277	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v2 (version 2)	Metagenome	Rhizosphere
39	3300005288	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
40	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
41	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
42	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
43	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
44	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
45	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
46	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
47	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
48	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
49	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
50	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
51	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
52	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
53	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
54	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
55	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
56	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
57	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
58	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
59	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
60	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
61	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
62	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
63	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
64	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
65	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
66	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
67	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
68	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
69	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
70	3300005406	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG	Metagenome	Rhizosphere
71	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
72	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
73	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
74	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
75	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
76	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
77	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
78	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
79	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
80	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
81	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
82	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
83	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
84	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
85	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
86	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
87	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
88	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
89	3300005507	Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v2 (version 2)	Metagenome	Rhizosphere
90	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
91	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
92	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
93	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
94	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
95	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
96	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
97	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
98	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
99	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
100	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
101	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
102	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
103	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
104	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
105	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
106	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
107	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
108	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
109	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
110	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
111	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
112	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
113	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
114	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
115	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
116	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
117	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
118	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
119	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
120	3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
121	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
122	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
123	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
124	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
125	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
126	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
127	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
128	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
129	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
130	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
131	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
132	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
133	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
134	3300006194	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1	Metagenome	Rhizosphere
135	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
136	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
137	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
138	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
139	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
140	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
141	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
142	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
143	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
144	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
145	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
146	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
147	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
148	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
149	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
150	3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Metagenome	Rhizosphere
151	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
152	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
153	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
154	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
155	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
156	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
157	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
158	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
159	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
160	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
161	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
162	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
163	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
164	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
165	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
166	3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Metagenome	Rhizosphere
167	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
168	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
169	3300012478	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610	Metagenome	Rhizosphere
170	3300012490	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610	Metagenome	Rhizosphere
171	3300012494	Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610	Metagenome	Rhizosphere
172	3300012515	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610	Metagenome	Rhizosphere
173	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
174	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
175	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
176	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
177	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
178	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
179	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
180	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
181	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
182	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
183	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
184	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
185	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
186	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
187	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
188	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
189	3300020069	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
190	3300020082	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
191	3300020610	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
192	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
193	3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Metagenome	Unclassified
194	3300022467	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
195	3300024225	Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5	Metagenome	Rhizosphere
196	3300024227	Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4	Metagenome	Rhizosphere
197	3300025271	Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
198	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
199	3300025290	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2)	Metagenome	Rhizosphere
200	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
201	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
202	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
203	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
204	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
205	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
206	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
207	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
208	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
209	3300025711	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
210	3300025735	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
211	3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
212	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
213	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
214	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
215	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
216	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
217	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
218	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
219	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
220	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
221	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
222	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
223	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
224	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
225	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
226	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
227	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
228	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
229	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
230	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
231	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
232	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
233	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
234	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
235	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
236	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
237	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
238	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
239	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
240	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
241	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
242	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
243	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
244	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
245	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
246	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
247	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
248	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
249	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
250	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
251	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
252	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
253	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
254	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
255	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
256	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
257	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
258	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
259	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
260	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
261	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
262	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
263	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
264	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
265	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
266	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
267	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
268	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
269	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
270	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
271	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
272	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
273	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
274	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
275	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
276	3300027252	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
277	3300027424	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
278	3300027512	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2)	Metagenome	Rhizosphere
279	3300027526	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
280	3300027543	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2)	Metagenome	Rhizosphere
281	3300027552	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
282	3300027617	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
283	3300027665	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
284	3300027671	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2)	Metagenome	Rhizosphere
285	3300027682	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2)	Metagenome	Rhizosphere
286	3300027695	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2)	Metagenome	Rhizosphere
287	3300027717	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
288	3300027876	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2)	Metagenome	Rhizosphere
289	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
290	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
291	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
292	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
293	3300028556	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG	Metagenome	Rhizosphere
294	3300028577	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG	Metagenome	Rhizosphere
295	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
296	3300029957	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG	Metagenome	Rhizosphere
297	3300031090	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
298	3300031235	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG	Metagenome	Rhizosphere
299	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
300	3300031239	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG	Metagenome	Rhizosphere
301	3300031240	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG	Metagenome	Rhizosphere
302	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
303	3300031242	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG	Metagenome	Rhizosphere
304	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
305	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
306	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
307	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
308	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
309	3300031665	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3	Metagenome	Rhizosphere
310	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
311	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
312	3300031728	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC	Metagenome	Rhizosphere
313	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
314	3300032133	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA	Metagenome	Rhizosphere
315	3300034816	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3	Metagenome	Rhizosphere
316	3300034817	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1	Metagenome	Rhizosphere
317	3300034818	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3	Metagenome	Rhizosphere
318	3300034819	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1	Metagenome	Rhizosphere
319	3300034820	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2	Metagenome	Rhizosphere
320	3300034957	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2	Metagenome	Rhizosphere
321	3300035083	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17	Metagenome	Rhizosphere
322	3300035084	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1	Metagenome	Rhizosphere
323	3300035085	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2	Metagenome	Rhizosphere
324	3300035086	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4	Metagenome	Rhizosphere
325	3300035088	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4	Metagenome	Rhizosphere
326	3300035089	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2	Metagenome	Rhizosphere
327	3300035090	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2	Metagenome	Rhizosphere
328	3300035091	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4	Metagenome	Rhizosphere
329	3300035092	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11	Metagenome	Rhizosphere
330	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
331	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
332	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
333	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
334	3300035115	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11	Metagenome	Rhizosphere
335	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
336	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
337	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
338	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
339	3300035120	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5	Metagenome	Rhizosphere
340	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
341	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
342	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
343	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
344	3300035207	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16	Metagenome	Rhizosphere
345	3300035241	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4	Metagenome	Rhizosphere
346	3300035242	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11	Metagenome	Rhizosphere
347	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
348	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
349	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
350	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
351	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
352	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
353	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
354	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
355	3300036647	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA	Metagenome	Rhizosphere
356	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
357	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
358	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
359	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
360	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
361	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
362	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
363	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
364	3300039438	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2	Metagenome	Rhizosphere
365	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
366	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
367	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
368	3300041408	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195	Metagenome	Rhizosphere
369	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
370	3300042005	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216	Metagenome	Rhizosphere
371	3300042012	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213	Metagenome	Rhizosphere
372	3300042157	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210	Metagenome	Rhizosphere
373	3300042439	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363	Metagenome	Rhizosphere
374	3300042461	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366	Metagenome	Rhizosphere
375	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
376	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
377	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
378	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
379	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
380	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
381	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
382	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
383	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
384	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
385	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
386	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
387	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
388	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
389	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
390	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
391	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
392	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
393	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
394	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
395	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
396	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
397	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
398	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
399	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
400	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
401	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
402	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
403	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
404	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
405	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
406	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
407	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
408	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
409	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
410	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
411	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
412	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
413	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
414	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
415	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
416	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
417	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
418	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
419	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
420	3300046537	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere	Metagenome	Rhizosphere
421	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
422	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
423	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
424	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
425	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
426	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
427	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
428	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
429	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
430	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
431	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
432	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
433	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
434	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
435	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
436	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
437	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
438	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
439	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
440	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
441	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
442	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
443	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
444	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
445	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
446	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
447	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
448	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
449	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
450	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
451	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
452	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
453	3300047446	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere	Metagenome	Rhizosphere
454	3300047447	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere	Metagenome	Rhizosphere
455	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
456	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
457	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
458	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
459	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
460	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
461	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
462	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
463	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
464	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
465	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
466	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
467	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
468	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
469	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
470	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
471	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
472	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
473	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
474	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
475	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
476	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
477	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
478	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
479	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
480	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
481	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
482	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
483	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
484	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
485	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
486	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
487	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
488	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
489	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
490	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
491	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
492	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
493	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
494	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
495	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
496	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
497	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
498	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
499	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
500	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
501	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
502	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
503	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
504	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
505	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
506	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
507	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
508	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
509	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
510	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
511	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
512	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
513	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
514	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
515	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
516	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
517	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
518	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
519	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
520	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
521	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
522	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
523	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
524	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
525	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
526	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
527	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
528	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
529	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
530	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
531	3300053083	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere	Metagenome	Rhizosphere
532	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
533	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
534	3300053090	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere	Metagenome	Endosphere
535	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
536	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
537	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
538	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
539	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
540	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	99.53
Metatranscriptomes	0.31
Isolates	0.16

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	2.85
Nodule	0
Rhizoplane	7.09
Rhizosphere	88.92
Stem	0
Stem Tuber	0
Unclassified	1.14

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	SwRhRL2b_contig_3287434	2162886007	Bacteria	980
2	2214600488	2209111006	Bacteria	5565
3	2214950751	2209111006	Bacteria	1285
4	ARcpr5oldR_c000222	3300000041	Bacteria	9363
5	ARSoilYngRDRAFT_c00010	3300000042	Bacteria	29132
6	ARcpr5yngRDRAFT_c000093	3300000043	Bacteria	14412
7	ARSoilOldRDRAFT_c000080	3300000044	Bacteria	18388
8	ARCol0oldRDRAFT_c00686	3300000045	Bacteria	2934
9	ARCol0yngRDRAFT_1000022	3300000652	Bacteria	29214
10	JGI24032J14994_100604	3300001430	Bacteria	1869
11	JGI24746J21847_1003802	3300001977	Bacteria	2384
12	JGI24746J21847_1004575	3300001977	Bacteria	2179
13	JGI24747J21853_1002452	3300001978	Bacteria	1515
14	JGI24740J21852_10050712	3300001979	Bacteria	1192
15	JGI24739J22299_10000539	3300001989	Bacteria	13507
16	JGI24739J22299_10048556	3300001989	Bacteria	1380
17	JGI24739J22299_10097558	3300001989	Bacteria	889
18	JGI24737J22298_10002650	3300001990	Bacteria	6328
19	JGI24737J22298_10010457	3300001990	Bacteria	3061
20	JGI24737J22298_10045760	3300001990	Bacteria	1336
21	JGI24743J22301_10011280	3300001991	Bacteria	1607
22	JGI24743J22301_10026349	3300001991	Bacteria	1131
23	JGI24750J21931_1000402	3300002070	Bacteria	7218
24	JGI24750J21931_1000884	3300002070	Bacteria	4111
25	JGI24750J21931_1016876	3300002070	Bacteria	994
26	JGI24745J21846_1005069	3300002073	Bacteria	1429
27	JGI24745J21846_1006343	3300002073	Bacteria	1310
28	JGI24748J21848_1015384	3300002074	Bacteria	910
29	JGI24748J21848_1020245	3300002074	Bacteria	801
30	JGI24738J21930_10001742	3300002075	Bacteria	5942
31	JGI24738J21930_10031001	3300002075	Bacteria	1091
32	JGI24749J21850_1003479	3300002076	Bacteria	2201
33	JGI24749J21850_1007144	3300002076	Bacteria	1553
34	JGI24749J21850_1007337	3300002076	Bacteria	1536
35	JGI24744J21845_10003391	3300002077	Bacteria	3273
36	JGI24744J21845_10005129	3300002077	Bacteria	2711
37	JGI24035J26624_1000173	3300002126	Bacteria	5979
38	JGI24033J26618_1001249	3300002155	Bacteria	2494
39	JGI24034J26672_10001474	3300002239	Bacteria	3128
40	JGI24034J26672_10025504	3300002239	Bacteria	945
41	JGI24742J22300_10000012	3300002244	Bacteria	29909
42	JGI24742J22300_10000673	3300002244	Bacteria	5136
43	JGI24742J22300_10020645	3300002244	Bacteria	1123
44	JGI25159J45721_1003105	3300002987	Bacteria	5995
45	JGI25151J46595_10000018	3300003187	Bacteria	238438
46	JGI25151J46595_10000812	3300003187	Bacteria	24940
47	JGI25404J52841_10012331	3300003659	Bacteria	1850
48	Ga0055526_1000571	3300003771	Bacteria	29048
49	Ga0055524_1000048	3300003775	Bacteria	149598
50	JGI25405J52794_10028385	3300003911	Bacteria	1155
51	Ga0058862_12398478	3300004803	Bacteria	719
52	Ga0065165_1000430	3300005262	Bacteria	65982
53	Ga0065717_1004624	3300005276	Bacteria	1003
54	Ga0065716_1001772	3300005277	Bacteria	3491
55	Ga0065716_1003841	3300005277	Bacteria	1122
56	Ga0065714_10213331	3300005288	Bacteria	859
57	Ga0065704_10144703	3300005289	Bacteria	1483
58	Ga0065712_10069764	3300005290	Bacteria	6742
59	Ga0065712_10072063	3300005290	Bacteria	4920
60	Ga0065715_10000686	3300005293	Bacteria	14502
61	Ga0065715_10000980	3300005293	Bacteria	7718
62	Ga0065707_10152779	3300005295	Bacteria	1640
63	Ga0070658_10280808	3300005327	Bacteria	1417
64	Ga0070676_10000530	3300005328	Bacteria	18367
65	Ga0070676_10284390	3300005328	Bacteria	1115
66	Ga0070683_100001367	3300005329	Bacteria	18677
67	Ga0070683_100050766	3300005329	Bacteria	3841
68	Ga0070683_100307043	3300005329	Bacteria	1509
69	Ga0070683_101210427	3300005329	Bacteria	726
70	Ga0070690_100001241	3300005330	Bacteria	13231
71	Ga0070670_100003506	3300005331	Bacteria	13038
72	Ga0070670_100014997	3300005331	Bacteria	6650
73	Ga0070670_100024267	3300005331	Bacteria	5216
74	Ga0070670_100056148	3300005331	Bacteria	3379
75	Ga0070670_100096269	3300005331	Bacteria	2546
76	Ga0070670_100133465	3300005331	Bacteria	2145
77	Ga0070677_10000032	3300005333	Bacteria	41719
78	Ga0070677_10058138	3300005333	Bacteria	1587
79	Ga0068869_100000009	3300005334	Bacteria	78566
80	Ga0068869_100139006	3300005334	Bacteria	1874
81	Ga0068869_100229161	3300005334	Bacteria	1475
82	Ga0070666_10018495	3300005335	Bacteria	4482
83	Ga0070666_10038886	3300005335	Bacteria	3167
84	Ga0070666_10088655	3300005335	Bacteria	2123
85	Ga0070680_100016815	3300005336	Bacteria	5755
86	Ga0070680_100026608	3300005336	Bacteria	4626
87	Ga0070680_100042028	3300005336	Bacteria	3707
88	Ga0070680_100096477	3300005336	Bacteria	2451
89	Ga0070680_100219364	3300005336	Bacteria	1605
90	Ga0070680_100347769	3300005336	Bacteria	1260
91	Ga0070680_100468367	3300005336	Bacteria	1077
92	Ga0070680_100603494	3300005336	Bacteria	942
93	Ga0070682_100001355	3300005337	Bacteria	13820
94	Ga0070682_100026711	3300005337	Bacteria	3458
95	Ga0070682_100075209	3300005337	Bacteria	2171
96	Ga0068868_100006136	3300005338	Bacteria	8492
97	Ga0068868_100007204	3300005338	Bacteria	7903
98	Ga0068868_100621699	3300005338	Bacteria	959
99	Ga0070660_100004079	3300005339	Bacteria	10081
100	Ga0070660_100066387	3300005339	Bacteria	2808
101	Ga0070660_100097365	3300005339	Bacteria	2327
102	Ga0070660_100103597	3300005339	Bacteria	2257
103	Ga0070689_100000052	3300005340	Bacteria	73146
104	Ga0070689_100014550	3300005340	Bacteria	5718
105	Ga0070689_100021740	3300005340	Bacteria	4781
106	Ga0070689_100061516	3300005340	Bacteria	2921
107	Ga0070689_100182113	3300005340	Bacteria	1707
108	Ga0070691_10005422	3300005341	Bacteria	5802
109	Ga0070691_10016598	3300005341	Bacteria	3384
110	Ga0070691_10044683	3300005341	Bacteria	2101
111	Ga0070687_100000193	3300005343	Bacteria	21321
112	Ga0070687_100001335	3300005343	Bacteria	8636
113	Ga0070687_100484263	3300005343	Bacteria	830
114	Ga0070661_100000094	3300005344	Bacteria	73019
115	Ga0070661_100024027	3300005344	Bacteria	4372
116	Ga0070692_10000422	3300005345	Bacteria	12791
117	Ga0070692_10007747	3300005345	Bacteria	4755
118	Ga0070692_10158526	3300005345	Bacteria	1295
119	Ga0070668_100003109	3300005347	Bacteria	12255
120	Ga0070668_100152062	3300005347	Bacteria	1872
121	Ga0070668_100190534	3300005347	Bacteria	1679
122	Ga0070668_101090563	3300005347	Bacteria	720
123	Ga0070669_100002385	3300005353	Bacteria	13594
124	Ga0070669_100079124	3300005353	Bacteria	2444
125	Ga0070675_100002474	3300005354	Bacteria	13831
126	Ga0070675_100021052	3300005354	Bacteria	5207
127	Ga0070675_100066852	3300005354	Bacteria	2973
128	Ga0070675_100083930	3300005354	Bacteria	2660
129	Ga0070675_100087511	3300005354	Bacteria	2605
130	Ga0070671_100003835	3300005355	Bacteria	11809
131	Ga0070671_100009664	3300005355	Bacteria	7748
132	Ga0070671_100020118	3300005355	Bacteria	5440
133	Ga0070671_100035296	3300005355	Bacteria	4142
134	Ga0070671_100055908	3300005355	Bacteria	3283
135	Ga0070671_100763178	3300005355	Bacteria	841
136	Ga0070674_100000878	3300005356	Bacteria	15666
137	Ga0070674_100482695	3300005356	Bacteria	1029
138	Ga0070673_100000122	3300005364	Bacteria	36106
139	Ga0070673_100005532	3300005364	Bacteria	8098
140	Ga0070673_100019097	3300005364	Bacteria	4917
141	Ga0070673_100024597	3300005364	Bacteria	4419
142	Ga0070673_100320230	3300005364	Bacteria	1370
143	Ga0070688_100001086	3300005365	Bacteria	13588
144	Ga0070688_100001965	3300005365	Bacteria	10333
145	Ga0070688_100009815	3300005365	Bacteria	5261
146	Ga0070688_100036064	3300005365	Bacteria	3006
147	Ga0070688_100057575	3300005365	Bacteria	2444
148	Ga0070688_100138193	3300005365	Bacteria	1652
149	Ga0070659_100000190	3300005366	Bacteria	47087
150	Ga0070659_100119454	3300005366	Bacteria	2133
151	Ga0070659_100212096	3300005366	Bacteria	1596
152	Ga0070659_100339844	3300005366	Bacteria	1257
153	Ga0070659_100454014	3300005366	Bacteria	1087
154	Ga0070659_100665233	3300005366	Bacteria	899
155	Ga0070667_100006892	3300005367	Bacteria	9438
156	Ga0070667_100020239	3300005367	Bacteria	5524
157	Ga0070667_100026199	3300005367	Bacteria	4849
158	Ga0070667_100131741	3300005367	Bacteria	2183
159	Ga0070703_10010623	3300005406	Bacteria	2596
160	Ga0070703_10062928	3300005406	Bacteria	1219
161	Ga0070703_10074398	3300005406	Bacteria	1142
162	Ga0070709_10003813	3300005434	Bacteria	8109
163	Ga0070709_10006069	3300005434	Bacteria	6576
164	Ga0070709_10016480	3300005434	Bacteria	4220
165	Ga0070709_10072260	3300005434	Bacteria	2230
166	Ga0070709_10118605	3300005434	Bacteria	1790
167	Ga0070709_10160072	3300005434	Bacteria	1564
168	Ga0070709_10206822	3300005434	Bacteria	1393
169	Ga0070709_10417427	3300005434	Bacteria	1005
170	Ga0070714_100030054	3300005435	Bacteria	4521
171	Ga0070714_100030739	3300005435	Bacteria	4474
172	Ga0070714_100040641	3300005435	Bacteria	3920
173	Ga0070714_100042425	3300005435	Bacteria	3843
174	Ga0070714_100533188	3300005435	Bacteria	1122
175	Ga0070713_100001142	3300005436	Bacteria	17016
176	Ga0070713_100001597	3300005436	Bacteria	14523
177	Ga0070713_100017199	3300005436	Bacteria	5462
178	Ga0070713_100069682	3300005436	Bacteria	2966
179	Ga0070713_100076980	3300005436	Bacteria	2835
180	Ga0070713_100155426	3300005436	Bacteria	2038
181	Ga0070713_100488508	3300005436	Bacteria	1160
182	Ga0070713_100971145	3300005436	Bacteria	819
183	Ga0070713_101401787	3300005436	Bacteria	678
184	Ga0070710_10006169	3300005437	Bacteria	5737
185	Ga0070710_10006353	3300005437	Bacteria	5672
186	Ga0070710_10018122	3300005437	Bacteria	3617
187	Ga0070710_10117929	3300005437	Bacteria	1603
188	Ga0070710_10152219	3300005437	Bacteria	1428
189	Ga0070701_10000135	3300005438	Bacteria	22131
190	Ga0070701_10013973	3300005438	Bacteria	3669
191	Ga0070711_100017462	3300005439	Bacteria	4570
192	Ga0070711_100021339	3300005439	Bacteria	4186
193	Ga0070711_100031335	3300005439	Bacteria	3530
194	Ga0070711_100033378	3300005439	Bacteria	3427
195	Ga0070711_100043478	3300005439	Bacteria	3043
196	Ga0070711_100062402	3300005439	Bacteria	2597
197	Ga0070711_100114679	3300005439	Bacteria	1983
198	Ga0070711_100244746	3300005439	Bacteria	1404
199	Ga0070711_100522858	3300005439	Bacteria	981
200	Ga0070705_100099254	3300005440	Bacteria	1834
201	Ga0070705_100222607	3300005440	Bacteria	1307
202	Ga0070705_100324728	3300005440	Bacteria	1112
203	Ga0070700_100007040	3300005441	Bacteria	6043
204	Ga0070700_100013905	3300005441	Bacteria	4531
205	Ga0070700_100018762	3300005441	Bacteria	3981
206	Ga0070700_100116270	3300005441	Bacteria	1786
207	Ga0070694_100002026	3300005444	Bacteria	12018
208	Ga0070694_100008079	3300005444	Bacteria	6428
209	Ga0070694_100102785	3300005444	Bacteria	2024
210	Ga0070694_100114859	3300005444	Bacteria	1923
211	Ga0070694_100397294	3300005444	Bacteria	1078
212	Ga0070708_100431287	3300005445	Bacteria	1243
213	Ga0070663_100000079	3300005455	Bacteria	42912
214	Ga0070663_100003326	3300005455	Bacteria	9268
215	Ga0070663_100030975	3300005455	Bacteria	3671
216	Ga0070663_100160422	3300005455	Bacteria	1730
217	Ga0070663_100184961	3300005455	Bacteria	1618
218	Ga0070678_100000275	3300005456	Bacteria	23831
219	Ga0070678_100003132	3300005456	Bacteria	9159
220	Ga0070678_100013078	3300005456	Bacteria	5188
221	Ga0070662_100002536	3300005457	Bacteria	11261
222	Ga0070662_100016156	3300005457	Bacteria	5008
223	Ga0070662_100036809	3300005457	Bacteria	3465
224	Ga0070662_100621487	3300005457	Bacteria	910
225	Ga0070681_10025028	3300005458	Bacteria	6006
226	Ga0070681_10049795	3300005458	Bacteria	4182
227	Ga0070681_10079521	3300005458	Bacteria	3235
228	Ga0070681_10123529	3300005458	Bacteria	2521
229	Ga0070681_10178932	3300005458	Bacteria	2042
230	Ga0070681_10313376	3300005458	Bacteria	1478
231	Ga0070681_10693773	3300005458	Bacteria	934
232	Ga0068867_100000073	3300005459	Bacteria	61471
233	Ga0068867_100070708	3300005459	Bacteria	2609
234	Ga0068867_100116634	3300005459	Bacteria	2058
235	Ga0070685_10003240	3300005466	Bacteria	8272
236	Ga0070706_100347467	3300005467	Bacteria	1383
237	Ga0070707_100177476	3300005468	Bacteria	2076
238	Ga0070707_101095037	3300005468	Bacteria	763
239	Ga0074259_10549652	3300005507	Bacteria	1265
240	Ga0070699_100016828	3300005518	Bacteria	6277
241	Ga0070679_100012038	3300005530	Bacteria	8257
242	Ga0070679_100016983	3300005530	Bacteria	7036
243	Ga0070679_100031265	3300005530	Bacteria	5258
244	Ga0070679_100050724	3300005530	Bacteria	4133
245	Ga0070679_100147459	3300005530	Bacteria	2330
246	Ga0070679_100157505	3300005530	Bacteria	2245
247	Ga0070679_100175477	3300005530	Bacteria	2115
248	Ga0070679_100240800	3300005530	Bacteria	1766
249	Ga0070679_100352312	3300005530	Bacteria	1420
250	Ga0070679_100539242	3300005530	Bacteria	1110
251	Ga0070684_100000884	3300005535	Bacteria	21187
252	Ga0070684_100025057	3300005535	Bacteria	5010
253	Ga0070684_100179294	3300005535	Bacteria	1926
254	Ga0070684_100215099	3300005535	Bacteria	1752
255	Ga0070684_100725880	3300005535	Bacteria	927
256	Ga0070697_100004405	3300005536	Bacteria	10810
257	Ga0070697_100053613	3300005536	Bacteria	3278
258	Ga0070697_100090484	3300005536	Bacteria	2529
259	Ga0070697_100280860	3300005536	Bacteria	1429
260	Ga0070697_100352047	3300005536	Bacteria	1272
261	Ga0068853_100003880	3300005539	Bacteria	11456
262	Ga0068853_100009248	3300005539	Bacteria	7941
263	Ga0068853_100716388	3300005539	Bacteria	955
264	Ga0068853_100720172	3300005539	Bacteria	952
265	Ga0070672_100001297	3300005543	Bacteria	15393
266	Ga0070672_100009354	3300005543	Bacteria	6751
267	Ga0070672_100087867	3300005543	Bacteria	2502
268	Ga0070672_100094059	3300005543	Bacteria	2422
269	Ga0070672_100138603	3300005543	Bacteria	2005
270	Ga0070672_100178240	3300005543	Bacteria	1770
271	Ga0070672_100298638	3300005543	Bacteria	1365
272	Ga0070686_100000622	3300005544	Bacteria	20719
273	Ga0070686_100004184	3300005544	Bacteria	7944
274	Ga0070686_100005087	3300005544	Bacteria	7262
275	Ga0070686_100013330	3300005544	Bacteria	4702
276	Ga0070695_100000828	3300005545	Bacteria	16693
277	Ga0070695_100002251	3300005545	Bacteria	11042
278	Ga0070695_100011630	3300005545	Bacteria	5267
279	Ga0070695_100578655	3300005545	Bacteria	879
280	Ga0070696_100016982	3300005546	Bacteria	4910
281	Ga0070696_100026115	3300005546	Bacteria	3973
282	Ga0070696_100027484	3300005546	Bacteria	3877
283	Ga0070696_100052350	3300005546	Bacteria	2840
284	Ga0070696_100081447	3300005546	Bacteria	2293
285	Ga0070696_100163222	3300005546	Bacteria	1643
286	Ga0070696_100237390	3300005546	Bacteria	1373
287	Ga0070693_100000233	3300005547	Bacteria	25914
288	Ga0070693_100045683	3300005547	Bacteria	2484
289	Ga0070693_100079583	3300005547	Bacteria	1950
290	Ga0070693_100086465	3300005547	Bacteria	1881
291	Ga0070693_100344140	3300005547	Bacteria	1019
292	Ga0070665_100052504	3300005548	Bacteria	4088
293	Ga0070665_100133906	3300005548	Bacteria	2480
294	Ga0070665_100414516	3300005548	Bacteria	1356
295	Ga0070665_100603679	3300005548	Bacteria	1110
296	Ga0070704_100001494	3300005549	Bacteria	12576
297	Ga0070704_100005981	3300005549	Bacteria	7133
298	Ga0070704_100067070	3300005549	Bacteria	2590
299	Ga0070704_100098207	3300005549	Bacteria	2200
300	Ga0070704_100435107	3300005549	Bacteria	1126
301	Ga0068855_100059666	3300005563	Bacteria	4463
302	Ga0068855_100080600	3300005563	Bacteria	3774
303	Ga0068855_100087804	3300005563	Bacteria	3593
304	Ga0068855_100171208	3300005563	Bacteria	2459
305	Ga0068855_100173514	3300005563	Bacteria	2441
306	Ga0068855_100556205	3300005563	Bacteria	1241
307	Ga0070664_100000253	3300005564	Bacteria	38404
308	Ga0070664_100023420	3300005564	Bacteria	5100
309	Ga0070664_100941234	3300005564	Bacteria	811
310	Ga0068857_100000423	3300005577	Bacteria	29909
311	Ga0068854_100000064	3300005578	Bacteria	77057
312	Ga0068854_100036375	3300005578	Bacteria	3452
313	Ga0068854_100251655	3300005578	Bacteria	1411
314	Ga0068854_100413565	3300005578	Bacteria	1119
315	Ga0068856_100003420	3300005614	Bacteria	16051
316	Ga0068856_100158695	3300005614	Bacteria	2272
317	Ga0068856_100166548	3300005614	Bacteria	2215
318	Ga0068856_100210673	3300005614	Bacteria	1959
319	Ga0068856_100282097	3300005614	Bacteria	1678
320	Ga0068856_100401783	3300005614	Bacteria	1390
321	Ga0068856_101090690	3300005614	Bacteria	816
322	Ga0070702_100000057	3300005615	Bacteria	31879
323	Ga0070702_100038416	3300005615	Bacteria	2666
324	Ga0070702_100041448	3300005615	Bacteria	2582
325	Ga0070702_100063076	3300005615	Bacteria	2162
326	Ga0068852_100020097	3300005616	Bacteria	5305
327	Ga0068852_100062704	3300005616	Bacteria	3234
328	Ga0068852_100070667	3300005616	Bacteria	3063
329	Ga0068852_100292357	3300005616	Bacteria	1574
330	Ga0068852_100437047	3300005616	Bacteria	1293
331	Ga0068852_100638344	3300005616	Bacteria	1071
332	Ga0068859_100003532	3300005617	Bacteria	15924
333	Ga0068859_100008041	3300005617	Bacteria	10692
334	Ga0068859_100056632	3300005617	Bacteria	3946
335	Ga0068859_100182413	3300005617	Bacteria	2182
336	Ga0068859_100450017	3300005617	Bacteria	1384
337	Ga0068864_100001982	3300005618	Bacteria	16851
338	Ga0068864_100022498	3300005618	Bacteria	5286
339	Ga0068864_100203358	3300005618	Bacteria	1820
340	Ga0068866_10000133	3300005718	Bacteria	33082
341	Ga0068866_10020275	3300005718	Bacteria	3044
342	Ga0068866_10078490	3300005718	Bacteria	1767
343	Ga0068861_100000077	3300005719	Bacteria	47717
344	Ga0068861_100030676	3300005719	Bacteria	3942
345	Ga0068861_100325622	3300005719	Bacteria	1339
346	Ga0068851_10020861	3300005834	Bacteria	3177
347	Ga0068851_10077384	3300005834	Bacteria	1732
348	Ga0068870_10000001	3300005840	Bacteria	97513
349	Ga0068870_10211947	3300005840	Bacteria	1181
350	Ga0068863_100000144	3300005841	Bacteria	74865
351	Ga0068863_100006758	3300005841	Bacteria	11246
352	Ga0068863_100040544	3300005841	Bacteria	4427
353	Ga0068863_100310072	3300005841	Bacteria	1532
354	Ga0068858_100004197	3300005842	Bacteria	14181
355	Ga0068858_100019366	3300005842	Bacteria	6364
356	Ga0068858_100078526	3300005842	Bacteria	3067
357	Ga0068858_100101973	3300005842	Bacteria	2677
358	Ga0068858_100511631	3300005842	Bacteria	1160
359	Ga0068860_100022953	3300005843	Bacteria	6033
360	Ga0068860_100025770	3300005843	Bacteria	5672
361	Ga0068860_100063400	3300005843	Bacteria	3511
362	Ga0068860_100160769	3300005843	Bacteria	2166
363	Ga0068860_100344581	3300005843	Bacteria	1465
364	Ga0068860_100376563	3300005843	Bacteria	1401
365	Ga0068862_100000304	3300005844	Bacteria	53990
366	Ga0068862_100005189	3300005844	Bacteria	10949
367	Ga0068862_100286480	3300005844	Bacteria	1511
368	Ga0068862_100455405	3300005844	Bacteria	1207
369	Ga0081455_10000031	3300005937	Bacteria	146486
370	Ga0081455_10006810	3300005937	Bacteria	12183
371	Ga0081455_10009265	3300005937	Bacteria	10140
372	Ga0081455_10257468	3300005937	Bacteria	1273
373	Ga0081455_10494318	3300005937	Bacteria	823
374	Ga0081538_10015352	3300005981	Bacteria	5935
375	Ga0081538_10016099	3300005981	Bacteria	5748
376	Ga0081538_10020744	3300005981	Bacteria	4824
377	Ga0081540_1000054	3300005983	Bacteria	122877
378	Ga0081540_1001289	3300005983	Bacteria	21882
379	Ga0081540_1007396	3300005983	Bacteria	7831
380	Ga0081540_1009366	3300005983	Bacteria	6753
381	Ga0081540_1063054	3300005983	Bacteria	1756
382	Ga0081539_10178461	3300005985	Bacteria	998
383	Ga0070717_10000869	3300006028	Bacteria	20007
384	Ga0070717_10015480	3300006028	Bacteria	5893
385	Ga0070717_10052171	3300006028	Bacteria	3368
386	Ga0070717_10449347	3300006028	Bacteria	1161
387	Ga0070717_10458111	3300006028	Bacteria	1150
388	Ga0075365_10081620	3300006038	Bacteria	2191
389	Ga0075365_10106896	3300006038	Bacteria	1920
390	Ga0075368_10006605	3300006042	Bacteria	4063
391	Ga0075363_100053297	3300006048	Bacteria	2161
392	Ga0075432_10033167	3300006058	Bacteria	1790
393	Ga0070715_10002795	3300006163	Bacteria	5434
394	Ga0070715_10006527	3300006163	Bacteria	3972
395	Ga0070715_10148995	3300006163	Bacteria	1144
396	Ga0070715_10178276	3300006163	Bacteria	1064
397	Ga0070716_100038610	3300006173	Bacteria	2645
398	Ga0070716_100069981	3300006173	Bacteria	2058
399	Ga0070716_100391227	3300006173	Bacteria	997
400	Ga0070716_100567478	3300006173	Bacteria	849
401	Ga0070712_100000791	3300006175	Bacteria	18739
402	Ga0070712_100025958	3300006175	Bacteria	3899
403	Ga0070712_100028408	3300006175	Bacteria	3741
404	Ga0070712_100056325	3300006175	Bacteria	2757
405	Ga0070712_100062415	3300006175	Bacteria	2635
406	Ga0070712_100261645	3300006175	Bacteria	1386
407	Ga0070712_100396054	3300006175	Bacteria	1139
408	Ga0075362_10018797	3300006177	Bacteria	2864
409	Ga0075367_10011088	3300006178	Bacteria	4754
410	Ga0075367_10035337	3300006178	Bacteria	2892
411	Ga0075367_10067442	3300006178	Bacteria	2145
412	Ga0075369_10042429	3300006186	Bacteria	1950
413	Ga0075427_10002174	3300006194	Bacteria	2607
414	Ga0075366_10075225	3300006195	Bacteria	2014
415	Ga0075366_10206747	3300006195	Bacteria	1194
416	Ga0097621_100000062	3300006237	Bacteria	55885
417	Ga0097621_100004295	3300006237	Bacteria	9897
418	Ga0075370_10215336	3300006353	Bacteria	1134
419	Ga0075370_10220832	3300006353	Bacteria	1120
420	Ga0075370_10377476	3300006353	Bacteria	849
421	Ga0075370_10396778	3300006353	Bacteria	827
422	Ga0068871_100000007	3300006358	Bacteria	115829
423	Ga0068871_100012659	3300006358	Bacteria	6232
424	Ga0068871_100031433	3300006358	Bacteria	4187
425	Ga0075428_100027128	3300006844	Bacteria	6341
426	Ga0075428_100033047	3300006844	Bacteria	5713
427	Ga0075428_100088230	3300006844	Bacteria	3383
428	Ga0075428_100178571	3300006844	Bacteria	2299
429	Ga0075428_101169152	3300006844	Bacteria	811
430	Ga0075430_100000194	3300006846	Bacteria	41024
431	Ga0075430_100004109	3300006846	Bacteria	12280
432	Ga0075430_100018996	3300006846	Bacteria	5848
433	Ga0075430_100022665	3300006846	Bacteria	5344
434	Ga0075430_100194368	3300006846	Bacteria	1686
435	Ga0075431_100019500	3300006847	Bacteria	6916
436	Ga0075431_100020477	3300006847	Bacteria	6757
437	Ga0075431_100060933	3300006847	Bacteria	3894
438	Ga0075431_100901613	3300006847	Bacteria	854
439	Ga0075433_10000273	3300006852	Bacteria	30404
440	Ga0075433_10020367	3300006852	Bacteria	5544
441	Ga0075433_10059020	3300006852	Bacteria	3357
442	Ga0075433_10197539	3300006852	Bacteria	1789
443	Ga0075433_10301295	3300006852	Bacteria	1419
444	Ga0075433_10431102	3300006852	Bacteria	1162
445	Ga0075433_10628891	3300006852	Bacteria	942
446	Ga0075433_10697024	3300006852	Bacteria	890
447	Ga0075434_100000210	3300006871	Bacteria	39685
448	Ga0075434_100000421	3300006871	Bacteria	31416
449	Ga0075434_100025282	3300006871	Bacteria	5810
450	Ga0075434_100029211	3300006871	Bacteria	5422
451	Ga0075434_100041503	3300006871	Bacteria	4558
452	Ga0075434_100084976	3300006871	Bacteria	3163
453	Ga0075434_100119212	3300006871	Bacteria	2653
454	Ga0075434_100168420	3300006871	Bacteria	2211
455	Ga0075434_100525536	3300006871	Bacteria	1204
456	Ga0075434_100650934	3300006871	Bacteria	1072
457	Ga0075429_100008384	3300006880	Bacteria	8996
458	Ga0075429_100208774	3300006880	Bacteria	1711
459	Ga0075429_100312908	3300006880	Bacteria	1375
460	Ga0068865_100000469	3300006881	Bacteria	22579
461	Ga0068865_100051637	3300006881	Bacteria	2847
462	Ga0068865_100070534	3300006881	Bacteria	2476
463	Ga0068865_100129856	3300006881	Bacteria	1886
464	Ga0075436_100001509	3300006914	Bacteria	15869
465	Ga0075436_100072036	3300006914	Bacteria	2390
466	Ga0075436_100186761	3300006914	Bacteria	1466
467	Ga0075436_100192323	3300006914	Bacteria	1444
468	Ga0075436_100285296	3300006914	Bacteria	1181
469	Ga0075436_100477825	3300006914	Bacteria	910
470	Ga0097620_100003532	3300006931	Bacteria	15924
471	Ga0097620_100008041	3300006931	Bacteria	10692
472	Ga0097620_100056630	3300006931	Bacteria	3946
473	Ga0097620_100182423	3300006931	Bacteria	2182
474	Ga0097620_100450009	3300006931	Bacteria	1384
475	Ga0075435_100017965	3300007076	Bacteria	5363
476	Ga0075435_100027583	3300007076	Bacteria	4444
477	Ga0075435_100029434	3300007076	Bacteria	4309
478	Ga0075435_100056781	3300007076	Bacteria	3165
479	Ga0075435_100060282	3300007076	Bacteria	3077
480	Ga0075435_100071289	3300007076	Bacteria	2837
481	Ga0075435_100088757	3300007076	Bacteria	2549
482	Ga0075435_100089033	3300007076	Bacteria	2544
483	Ga0075435_100184218	3300007076	Bacteria	1765
484	Ga0075435_100196825	3300007076	Bacteria	1707
485	Ga0099794_10017549	3300007265	Bacteria	3192
486	Ga0099795_10002530	3300007788	Bacteria	4324
487	Ga0105251_10084561	3300009011	Bacteria	1463
488	Ga0105244_10013432	3300009036	Bacteria	4789
489	Ga0105250_10015948	3300009092	Bacteria	3070
490	Ga0105250_10083071	3300009092	Bacteria	1299
491	Ga0105240_10019295	3300009093	Bacteria	9113
492	Ga0105240_10032153	3300009093	Bacteria	6795
493	Ga0105240_10474600	3300009093	Bacteria	1395
494	Ga0111539_10000229	3300009094	Bacteria	67148
495	Ga0111539_10001379	3300009094	Bacteria	32283
496	Ga0111539_10007639	3300009094	Bacteria	13818
497	Ga0111539_10043359	3300009094	Bacteria	5393
498	Ga0111539_10119602	3300009094	Bacteria	3087
499	Ga0111539_10126052	3300009094	Bacteria	3000
500	Ga0111539_10418595	3300009094	Bacteria	1560
501	Ga0105245_10002466	3300009098	Bacteria	16730
502	Ga0105245_10078738	3300009098	Bacteria	3008
503	Ga0105245_10101658	3300009098	Bacteria	2661
504	Ga0105245_10221716	3300009098	Bacteria	1825
505	Ga0105245_10431117	3300009098	Bacteria	1323
506	Ga0105247_10001732	3300009101	Bacteria	15371
507	Ga0105247_10008786	3300009101	Bacteria	6159
508	Ga0105247_10017918	3300009101	Bacteria	4249
509	Ga0105247_10024793	3300009101	Bacteria	3616
510	Ga0105247_10107489	3300009101	Bacteria	1791
511	Ga0105247_10118072	3300009101	Bacteria	1715
512	Ga0114129_10002175	3300009147	Bacteria	26976
513	Ga0114129_10003274	3300009147	Bacteria	22735
514	Ga0114129_10006074	3300009147	Bacteria	17120
515	Ga0114129_10019125	3300009147	Bacteria	9756
516	Ga0114129_10560195	3300009147	Bacteria	1485
517	Ga0114129_10562620	3300009147	Bacteria	1481
518	Ga0105243_10007597	3300009148	Bacteria	8335
519	Ga0105243_10021838	3300009148	Bacteria	4860
520	Ga0105243_10056909	3300009148	Bacteria	3112
521	Ga0105243_10072306	3300009148	Bacteria	2791
522	Ga0105243_10119460	3300009148	Bacteria	2220
523	Ga0105243_10203055	3300009148	Bacteria	1740
524	Ga0105241_10000448	3300009174	Bacteria	30969
525	Ga0105241_10091754	3300009174	Bacteria	2397
526	Ga0105241_10109510	3300009174	Bacteria	2209
527	Ga0105241_10142467	3300009174	Bacteria	1953
528	Ga0105241_10299260	3300009174	Bacteria	1380
529	Ga0105242_10052546	3300009176	Bacteria	3325
530	Ga0105242_10262050	3300009176	Bacteria	1562
531	Ga0105242_10374772	3300009176	Bacteria	1321
532	Ga0105242_10479056	3300009176	Bacteria	1179
533	Ga0105248_10001616	3300009177	Bacteria	25024
534	Ga0105248_10012785	3300009177	Bacteria	9259
535	Ga0105248_10019025	3300009177	Bacteria	7594
536	Ga0105237_10015072	3300009545	Bacteria	8055
537	Ga0105237_10045576	3300009545	Bacteria	4412
538	Ga0105237_10127538	3300009545	Bacteria	2538
539	Ga0105237_10212769	3300009545	Bacteria	1933
540	Ga0105237_10351898	3300009545	Bacteria	1477
541	Ga0105238_10040894	3300009551	Bacteria	4696
542	Ga0105238_10097754	3300009551	Bacteria	2921
543	Ga0105238_10356411	3300009551	Bacteria	1452
544	Ga0105238_10387646	3300009551	Bacteria	1389
545	Ga0105249_10006722	3300009553	Bacteria	10016
546	Ga0105249_10008342	3300009553	Bacteria	9024
547	Ga0105249_10010155	3300009553	Bacteria	8264
548	Ga0105249_10145925	3300009553	Bacteria	2273
549	Ga0099796_10024807	3300010159	Bacteria	1886
550	Ga0105239_10007143	3300010375	Bacteria	12846
551	Ga0105239_10031725	3300010375	Bacteria	5806
552	Ga0105239_10203689	3300010375	Bacteria	2217
553	Ga0105239_10753305	3300010375	Bacteria	1115
554	Ga0105246_10029907	3300011119	Bacteria	3593
555	Ga0105246_10033422	3300011119	Bacteria	3419
556	Ga0105246_10047493	3300011119	Bacteria	2932
557	Ga0105246_10183155	3300011119	Bacteria	1614
558	Ga0157328_1000280	3300012478	Bacteria	1886
559	Ga0157322_1009344	3300012490	Bacteria	769
560	Ga0157341_1001714	3300012494	Bacteria	1368
561	Ga0157338_1002099	3300012515	Bacteria	1528
562	Ga0157373_10024792	3300013100	Bacteria	4342
563	Ga0157373_10115203	3300013100	Bacteria	1890
564	Ga0157371_10014868	3300013102	Bacteria	5858
565	Ga0157371_10042600	3300013102	Bacteria	3236
566	Ga0157371_10126632	3300013102	Bacteria	1817
567	Ga0157371_10216866	3300013102	Bacteria	1374
568	Ga0157370_10238981	3300013104	Bacteria	1681
569	Ga0157369_10291142	3300013105	Bacteria	1700
570	Ga0157369_10406533	3300013105	Bacteria	1412
571	Ga0157369_10910485	3300013105	Bacteria	902
572	Ga0157374_10000610	3300013296	Bacteria	31677
573	Ga0157374_10030704	3300013296	Bacteria	4881
574	Ga0157374_10075139	3300013296	Bacteria	3193
575	Ga0157374_10138715	3300013296	Bacteria	2359
576	Ga0157374_10598267	3300013296	Bacteria	1113
577	Ga0157374_10617280	3300013296	Bacteria	1095
578	Ga0157378_10000775	3300013297	Bacteria	29694
579	Ga0157378_10384779	3300013297	Bacteria	1378
580	Ga0157378_10600459	3300013297	Bacteria	1112
581	Ga0157378_11419942	3300013297	Bacteria	737
582	Ga0163162_10000559	3300013306	Bacteria	34419
583	Ga0163162_10088841	3300013306	Bacteria	3170
584	Ga0163162_10242836	3300013306	Bacteria	1932
585	Ga0163162_10302660	3300013306	Bacteria	1731
586	Ga0157372_10006750	3300013307	Bacteria	12204
587	Ga0157372_10168162	3300013307	Bacteria	2536
588	Ga0157372_10213353	3300013307	Bacteria	2237
589	Ga0157375_10002985	3300013308	Bacteria	14694
590	Ga0157375_10010016	3300013308	Bacteria	8335
591	Ga0157375_10025227	3300013308	Bacteria	5518
592	Ga0157375_10066544	3300013308	Bacteria	3598
593	Ga0157375_10468609	3300013308	Bacteria	1425
594	Ga0163163_10000673	3300014325	Bacteria	29212
595	Ga0163163_10005500	3300014325	Bacteria	10964
596	Ga0163163_10014233	3300014325	Bacteria	7309
597	Ga0163163_10096311	3300014325	Bacteria	2979
598	Ga0157380_10001859	3300014326	Bacteria	13961
599	Ga0157380_10068702	3300014326	Bacteria	2857
600	Ga0157380_10583685	3300014326	Bacteria	1103
601	Ga0157380_10682475	3300014326	Bacteria	1029
602	Ga0182008_10119635	3300014497	Bacteria	1309
603	Ga0157377_10001018	3300014745	Bacteria	11820
604	Ga0157379_10000991	3300014968	Bacteria	23043
605	Ga0157379_10004227	3300014968	Bacteria	12267
606	Ga0157379_10032541	3300014968	Bacteria	4649
607	Ga0157379_10069675	3300014968	Bacteria	3146
608	Ga0157379_10200624	3300014968	Bacteria	1804
609	Ga0157376_10001415	3300014969	Bacteria	15772
610	Ga0157376_10064745	3300014969	Bacteria	3084
611	Ga0157376_10099832	3300014969	Bacteria	2533
612	Ga0157376_10274458	3300014969	Bacteria	1585
613	Ga0157376_10308995	3300014969	Bacteria	1499
614	Ga0157376_11052178	3300014969	Bacteria	838
615	Ga0157376_11329767	3300014969	Bacteria	749
616	Ga0163161_10004819	3300017792	Bacteria	9402
617	Ga0163161_10061442	3300017792	Bacteria	2735
618	Ga0163161_10456261	3300017792	Bacteria	1034
619	Ga0197907_10134386	3300020069	Bacteria	1146
620	Ga0206353_10333313	3300020082	Bacteria	3622
621	Ga0154015_1658566	3300020610	Bacteria	907
622	Ga0213876_10135439	3300021384	Bacteria	1310
623	Ga0213876_10225310	3300021384	Bacteria	997
624	Ga0213875_10008383	3300021388	Bacteria	5299
625	Ga0224712_10175677	3300022467	Bacteria	963
626	Ga0224572_1018257	3300024225	Bacteria	1348
627	Ga0228598_1002263	3300024227	Bacteria	4212
628	Ga0207666_1000001	3300025271	Bacteria	107728
629	Ga0207666_1000007	3300025271	Bacteria	49628
630	Ga0209130_1002943	3300025284	Bacteria	7773
631	Ga0207673_1003000	3300025290	Bacteria	1957
632	Ga0209675_1000462	3300025291	Bacteria	31165
633	Ga0209676_1028360	3300025292	Bacteria	1744
634	Ga0209025_1000010	3300025294	Bacteria	986612
635	Ga0209025_1034871	3300025294	Bacteria	2286
636	Ga0209564_1000034	3300025295	Bacteria	444284
637	Ga0209758_1000382	3300025297	Bacteria	76653
638	Ga0209758_1047034	3300025297	Bacteria	1549
639	Ga0209256_1000026	3300025299	Bacteria	432835
640	Ga0209256_1000232	3300025299	Bacteria	99687
641	Ga0207426_1015698	3300025302	Bacteria	2741
642	Ga0207697_10003140	3300025315	Bacteria	8247
643	Ga0207697_10046755	3300025315	Bacteria	1783
644	Ga0207656_10061735	3300025321	Bacteria	1646
645	Ga0207696_1083874	3300025711	Bacteria	878
646	Ga0207713_1024665	3300025735	Bacteria	2797
647	Ga0207653_10014266	3300025885	Bacteria	2492
648	Ga0207653_10060813	3300025885	Bacteria	1273
649	Ga0207682_10000002	3300025893	Bacteria	132580
650	Ga0207682_10096622	3300025893	Bacteria	1287
651	Ga0207692_10001821	3300025898	Bacteria	8096
652	Ga0207692_10006420	3300025898	Bacteria	4764
653	Ga0207692_10017225	3300025898	Bacteria	3218
654	Ga0207692_10137545	3300025898	Bacteria	1386
655	Ga0207692_10193299	3300025898	Bacteria	1192
656	Ga0207692_10386877	3300025898	Bacteria	869
657	Ga0207642_10000170	3300025899	Bacteria	18572
658	Ga0207642_10011717	3300025899	Bacteria	3139
659	Ga0207642_10068892	3300025899	Bacteria	1676
660	Ga0207710_10006798	3300025900	Bacteria	4870
661	Ga0207710_10012303	3300025900	Bacteria	3601
662	Ga0207710_10014914	3300025900	Bacteria	3281
663	Ga0207710_10050232	3300025900	Bacteria	1871
664	Ga0207688_10000077	3300025901	Bacteria	37350
665	Ga0207688_10000532	3300025901	Bacteria	18490
666	Ga0207688_10048940	3300025901	Bacteria	2362
667	Ga0207688_10137874	3300025901	Bacteria	1434
668	Ga0207688_10213141	3300025901	Bacteria	1161
669	Ga0207680_10018553	3300025903	Bacteria	3701
670	Ga0207680_10086825	3300025903	Bacteria	1979
671	Ga0207647_10005455	3300025904	Bacteria	9319
672	Ga0207647_10006537	3300025904	Bacteria	8468
673	Ga0207647_10039841	3300025904	Bacteria	2962
674	Ga0207647_10109577	3300025904	Bacteria	1633
675	Ga0207685_10032603	3300025905	Bacteria	1875
676	Ga0207685_10049445	3300025905	Bacteria	1615
677	Ga0207699_10002054	3300025906	Bacteria	9505
678	Ga0207699_10035918	3300025906	Bacteria	2822
679	Ga0207699_10045392	3300025906	Bacteria	2565
680	Ga0207699_10089774	3300025906	Bacteria	1927
681	Ga0207699_10143739	3300025906	Bacteria	1570
682	Ga0207645_10000070	3300025907	Bacteria	73149
683	Ga0207645_10007524	3300025907	Bacteria	7685
684	Ga0207645_10060555	3300025907	Bacteria	2417
685	Ga0207645_10079740	3300025907	Bacteria	2098
686	Ga0207643_10000003	3300025908	Bacteria	207506
687	Ga0207643_10001791	3300025908	Bacteria	11957
688	Ga0207705_10040208	3300025909	Bacteria	3353
689	Ga0207705_10085872	3300025909	Bacteria	2299
690	Ga0207684_10006292	3300025910	Bacteria	10830
691	Ga0207684_10212419	3300025910	Bacteria	1669
692	Ga0207684_10285193	3300025910	Bacteria	1424
693	Ga0207654_10001122	3300025911	Bacteria	14467
694	Ga0207654_10022735	3300025911	Bacteria	3349
695	Ga0207654_10242841	3300025911	Bacteria	1204
696	Ga0207707_10187694	3300025912	Bacteria	1804
697	Ga0207707_10240695	3300025912	Bacteria	1573
698	Ga0207707_10365490	3300025912	Bacteria	1242
699	Ga0207707_10509759	3300025912	Bacteria	1025
700	Ga0207671_10028513	3300025914	Bacteria	4171
701	Ga0207671_10097768	3300025914	Bacteria	2220
702	Ga0207671_10103915	3300025914	Bacteria	2155
703	Ga0207671_10154315	3300025914	Bacteria	1775
704	Ga0207671_10268828	3300025914	Bacteria	1343
705	Ga0207693_10002929	3300025915	Bacteria	14771
706	Ga0207693_10003236	3300025915	Bacteria	13979
707	Ga0207693_10004287	3300025915	Bacteria	12087
708	Ga0207693_10056413	3300025915	Bacteria	3080
709	Ga0207693_10062818	3300025915	Bacteria	2909
710	Ga0207693_10063513	3300025915	Bacteria	2893
711	Ga0207693_10066671	3300025915	Bacteria	2818
712	Ga0207693_10079101	3300025915	Bacteria	2573
713	Ga0207693_10081601	3300025915	Bacteria	2532
714	Ga0207693_10111432	3300025915	Bacteria	2146
715	Ga0207693_10113343	3300025915	Bacteria	2127
716	Ga0207693_10212977	3300025915	Bacteria	1519
717	Ga0207693_10350862	3300025915	Bacteria	1154
718	Ga0207663_10031473	3300025916	Bacteria	3141
719	Ga0207663_10050873	3300025916	Bacteria	2577
720	Ga0207663_10061178	3300025916	Bacteria	2388
721	Ga0207663_10074021	3300025916	Bacteria	2206
722	Ga0207663_10137380	3300025916	Bacteria	1698
723	Ga0207663_10157590	3300025916	Bacteria	1599
724	Ga0207663_10284883	3300025916	Bacteria	1229
725	Ga0207660_10001136	3300025917	Bacteria	17794
726	Ga0207660_10017213	3300025917	Bacteria	4797
727	Ga0207660_10030306	3300025917	Bacteria	3718
728	Ga0207662_10003328	3300025918	Bacteria	8247
729	Ga0207662_10013961	3300025918	Bacteria	4497
730	Ga0207662_10286929	3300025918	Bacteria	1091
731	Ga0207662_10341257	3300025918	Bacteria	1004
732	Ga0207657_10009131	3300025919	Bacteria	10005
733	Ga0207657_10023221	3300025919	Bacteria	5781
734	Ga0207657_10033549	3300025919	Bacteria	4626
735	Ga0207657_10091781	3300025919	Bacteria	2531
736	Ga0207657_10185052	3300025919	Bacteria	1682
737	Ga0207657_10270287	3300025919	Bacteria	1351
738	Ga0207657_10306506	3300025919	Bacteria	1257
739	Ga0207649_10000054	3300025920	Bacteria	103258
740	Ga0207649_10018142	3300025920	Bacteria	3996
741	Ga0207649_10135299	3300025920	Bacteria	1679
742	Ga0207649_10530086	3300025920	Bacteria	899
743	Ga0207652_10000059	3300025921	Bacteria	113599
744	Ga0207652_10026978	3300025921	Bacteria	4787
745	Ga0207652_10028200	3300025921	Bacteria	4683
746	Ga0207652_10035704	3300025921	Bacteria	4198
747	Ga0207652_10057234	3300025921	Bacteria	3357
748	Ga0207652_10141064	3300025921	Bacteria	2155
749	Ga0207652_10292846	3300025921	Bacteria	1469
750	Ga0207646_10317702	3300025922	Bacteria	1407
751	Ga0207681_10001076	3300025923	Bacteria	17716
752	Ga0207681_10028861	3300025923	Bacteria	3597
753	Ga0207694_10199139	3300025924	Bacteria	1629
754	Ga0207694_10261354	3300025924	Bacteria	1418
755	Ga0207694_10348994	3300025924	Bacteria	1225
756	Ga0207694_10558073	3300025924	Bacteria	961
757	Ga0207650_10003180	3300025925	Bacteria	11312
758	Ga0207650_10004186	3300025925	Bacteria	9859
759	Ga0207650_10012602	3300025925	Bacteria	5836
760	Ga0207650_10034641	3300025925	Bacteria	3663
761	Ga0207650_10356658	3300025925	Bacteria	1204
762	Ga0207650_10590662	3300025925	Bacteria	933
763	Ga0207659_10000099	3300025926	Bacteria	50921
764	Ga0207659_10068262	3300025926	Bacteria	2585
765	Ga0207659_10131971	3300025926	Bacteria	1929
766	Ga0207659_10172061	3300025926	Bacteria	1709
767	Ga0207687_10000050	3300025927	Bacteria	93290
768	Ga0207687_10013627	3300025927	Bacteria	5307
769	Ga0207687_10026328	3300025927	Bacteria	3894
770	Ga0207687_10123763	3300025927	Bacteria	1938
771	Ga0207687_10174225	3300025927	Bacteria	1662
772	Ga0207700_10004906	3300025928	Bacteria	7947
773	Ga0207700_10037361	3300025928	Bacteria	3516
774	Ga0207700_10201357	3300025928	Bacteria	1678
775	Ga0207700_10592495	3300025928	Bacteria	986
776	Ga0207700_10653774	3300025928	Bacteria	937
777	Ga0207700_10739390	3300025928	Bacteria	879
778	Ga0207664_10068485	3300025929	Bacteria	2851
779	Ga0207664_10093981	3300025929	Bacteria	2464
780	Ga0207664_10102817	3300025929	Bacteria	2363
781	Ga0207664_10256570	3300025929	Bacteria	1528
782	Ga0207664_10307480	3300025929	Bacteria	1396
783	Ga0207664_10330535	3300025929	Bacteria	1346
784	Ga0207664_10363490	3300025929	Bacteria	1282
785	Ga0207644_10003389	3300025931	Bacteria	10284
786	Ga0207644_10006840	3300025931	Bacteria	7431
787	Ga0207644_10013452	3300025931	Bacteria	5455
788	Ga0207690_10000260	3300025932	Bacteria	37977
789	Ga0207690_10009198	3300025932	Bacteria	5866
790	Ga0207690_10245301	3300025932	Bacteria	1381
791	Ga0207690_10425142	3300025932	Bacteria	1063
792	Ga0207706_10001170	3300025933	Bacteria	26622
793	Ga0207706_10001566	3300025933	Bacteria	22667
794	Ga0207706_10006794	3300025933	Bacteria	10578
795	Ga0207706_10032775	3300025933	Bacteria	4624
796	Ga0207706_10106061	3300025933	Bacteria	2472
797	Ga0207706_10151154	3300025933	Bacteria	2042
798	Ga0207706_10497693	3300025933	Bacteria	1052
799	Ga0207686_10000256	3300025934	Bacteria	40403
800	Ga0207686_10039284	3300025934	Bacteria	2871
801	Ga0207709_10000352	3300025935	Bacteria	47062
802	Ga0207709_10014095	3300025935	Bacteria	4412
803	Ga0207709_10057650	3300025935	Bacteria	2410
804	Ga0207709_10311764	3300025935	Bacteria	1174
805	Ga0207709_10328201	3300025935	Bacteria	1148
806	Ga0207709_10479223	3300025935	Bacteria	967
807	Ga0207670_10000073	3300025936	Bacteria	70848
808	Ga0207670_10029106	3300025936	Bacteria	3515
809	Ga0207670_10030114	3300025936	Bacteria	3465
810	Ga0207670_10289558	3300025936	Bacteria	1279
811	Ga0207670_10328409	3300025936	Bacteria	1205
812	Ga0207669_10000442	3300025937	Bacteria	18032
813	Ga0207669_10367062	3300025937	Bacteria	1117
814	Ga0207704_10000031	3300025938	Bacteria	111710
815	Ga0207704_10081322	3300025938	Bacteria	2095
816	Ga0207704_10145267	3300025938	Bacteria	1665
817	Ga0207704_10513036	3300025938	Bacteria	968
818	Ga0207704_10600986	3300025938	Bacteria	901
819	Ga0207665_10004653	3300025939	Bacteria	9114
820	Ga0207665_10005878	3300025939	Bacteria	8163
821	Ga0207665_10037556	3300025939	Bacteria	3224
822	Ga0207665_10044749	3300025939	Bacteria	2962
823	Ga0207665_10137776	3300025939	Bacteria	1738
824	Ga0207665_10246298	3300025939	Bacteria	1319
825	Ga0207665_10515555	3300025939	Bacteria	925
826	Ga0207665_10622459	3300025939	Bacteria	844
827	Ga0207691_10001871	3300025940	Bacteria	20574
828	Ga0207691_10002068	3300025940	Bacteria	19576
829	Ga0207691_10034673	3300025940	Bacteria	4691
830	Ga0207691_10087941	3300025940	Bacteria	2787
831	Ga0207691_10101939	3300025940	Bacteria	2561
832	Ga0207691_10371731	3300025940	Bacteria	1221
833	Ga0207711_10000478	3300025941	Bacteria	41339
834	Ga0207711_10002137	3300025941	Bacteria	17813
835	Ga0207711_10038057	3300025941	Bacteria	4090
836	Ga0207711_10303348	3300025941	Bacteria	1473
837	Ga0207711_10426884	3300025941	Bacteria	1233
838	Ga0207689_10000040	3300025942	Bacteria	93271
839	Ga0207689_10016646	3300025942	Bacteria	6222
840	Ga0207689_10050437	3300025942	Bacteria	3432
841	Ga0207661_10000076	3300025944	Bacteria	67452
842	Ga0207661_10057532	3300025944	Bacteria	3127
843	Ga0207661_10212939	3300025944	Bacteria	1704
844	Ga0207661_10380940	3300025944	Bacteria	1277
845	Ga0207679_10000014	3300025945	Bacteria	275841
846	Ga0207679_10028530	3300025945	Bacteria	3874
847	Ga0207679_10127737	3300025945	Bacteria	2034
848	Ga0207679_10300086	3300025945	Bacteria	1384
849	Ga0207679_10775727	3300025945	Bacteria	873
850	Ga0207667_10031873	3300025949	Bacteria	5684
851	Ga0207667_10123947	3300025949	Bacteria	2662
852	Ga0207667_10150847	3300025949	Bacteria	2392
853	Ga0207667_10162455	3300025949	Bacteria	2297
854	Ga0207667_10268375	3300025949	Bacteria	1744
855	Ga0207667_10385599	3300025949	Bacteria	1427
856	Ga0207651_10003191	3300025960	Bacteria	8007
857	Ga0207651_10066453	3300025960	Bacteria	2533
858	Ga0207651_10094265	3300025960	Bacteria	2201
859	Ga0207651_10263841	3300025960	Bacteria	1415
860	Ga0207651_10299673	3300025960	Bacteria	1336
861	Ga0207651_10769305	3300025960	Bacteria	852
862	Ga0207712_10000258	3300025961	Bacteria	51369
863	Ga0207712_10008283	3300025961	Bacteria	6571
864	Ga0207712_10565522	3300025961	Bacteria	980
865	Ga0207668_10000057	3300025972	Bacteria	92890
866	Ga0207668_10048827	3300025972	Bacteria	2906
867	Ga0207668_10076829	3300025972	Bacteria	2406
868	Ga0207668_10434644	3300025972	Bacteria	1117
869	Ga0207640_10000258	3300025981	Bacteria	35961
870	Ga0207640_10023375	3300025981	Bacteria	3714
871	Ga0207658_10034541	3300025986	Bacteria	3614
872	Ga0207658_10062727	3300025986	Bacteria	2782
873	Ga0207658_10079926	3300025986	Bacteria	2503
874	Ga0207658_10093845	3300025986	Bacteria	2334
875	Ga0207658_10541348	3300025986	Bacteria	1041
876	Ga0207677_10009629	3300026023	Bacteria	5441
877	Ga0207677_10068977	3300026023	Bacteria	2484
878	Ga0207677_10186372	3300026023	Bacteria	1637
879	Ga0207677_10368739	3300026023	Bacteria	1208
880	Ga0207677_10668321	3300026023	Bacteria	919
881	Ga0207703_10002166	3300026035	Bacteria	17253
882	Ga0207703_10031600	3300026035	Bacteria	4187
883	Ga0207703_10047878	3300026035	Bacteria	3448
884	Ga0207703_10089270	3300026035	Bacteria	2588
885	Ga0207639_10001844	3300026041	Bacteria	14267
886	Ga0207639_10250003	3300026041	Bacteria	1546
887	Ga0207639_10264644	3300026041	Bacteria	1505
888	Ga0207639_10392679	3300026041	Bacteria	1248
889	Ga0207678_10001623	3300026067	Bacteria	20664
890	Ga0207678_10001875	3300026067	Bacteria	19187
891	Ga0207678_10005996	3300026067	Bacteria	10814
892	Ga0207678_10062436	3300026067	Bacteria	3202
893	Ga0207678_10070524	3300026067	Bacteria	2996
894	Ga0207708_10000155	3300026075	Bacteria	54651
895	Ga0207708_10007155	3300026075	Bacteria	8247
896	Ga0207708_10027227	3300026075	Bacteria	4328
897	Ga0207708_10134185	3300026075	Bacteria	1938
898	Ga0207702_10006740	3300026078	Bacteria	9863
899	Ga0207702_10149660	3300026078	Bacteria	2122
900	Ga0207702_10255129	3300026078	Bacteria	1649
901	Ga0207702_10491447	3300026078	Bacteria	1195
902	Ga0207641_10000272	3300026088	Bacteria	65806
903	Ga0207641_10029261	3300026088	Bacteria	4554
904	Ga0207641_10632995	3300026088	Bacteria	1049
905	Ga0207641_10635419	3300026088	Bacteria	1047
906	Ga0207648_10002624	3300026089	Bacteria	19247
907	Ga0207648_10003341	3300026089	Bacteria	16859
908	Ga0207648_10076359	3300026089	Bacteria	2920
909	Ga0207648_10494136	3300026089	Bacteria	1119
910	Ga0207676_10006530	3300026095	Bacteria	8245
911	Ga0207676_10025342	3300026095	Bacteria	4400
912	Ga0207676_10030248	3300026095	Bacteria	4063
913	Ga0207676_10142838	3300026095	Bacteria	2051
914	Ga0207676_10401105	3300026095	Bacteria	1281
915	Ga0207674_10000555	3300026116	Bacteria	48860
916	Ga0207674_10120380	3300026116	Bacteria	2593
917	Ga0207675_100011580	3300026118	Bacteria	8247
918	Ga0207675_100036723	3300026118	Bacteria	4569
919	Ga0207683_10000002	3300026121	Bacteria	258441
920	Ga0207683_10002386	3300026121	Bacteria	16404
921	Ga0207683_10016569	3300026121	Bacteria	6275
922	Ga0207698_10072486	3300026142	Bacteria	2738
923	Ga0207698_10391146	3300026142	Bacteria	1326
924	Ga0207698_10396178	3300026142	Bacteria	1318
925	Ga0209973_1001539	3300027252	Bacteria	2029
926	Ga0209984_1012040	3300027424	Bacteria	1125
927	Ga0209179_1002313	3300027512	Bacteria	2553
928	Ga0209968_1010117	3300027526	Bacteria	1447
929	Ga0209999_1008900	3300027543	Bacteria	1816
930	Ga0209982_1004372	3300027552	Bacteria	2022
931	Ga0210002_1000353	3300027617	Bacteria	6265
932	Ga0209983_1034468	3300027665	Bacteria	1084
933	Ga0209588_1060620	3300027671	Bacteria	1223
934	Ga0209971_1017527	3300027682	Bacteria	1698
935	Ga0209966_1006364	3300027695	Bacteria	2047
936	Ga0209998_10002117	3300027717	Bacteria	4622
937	Ga0209998_10005651	3300027717	Bacteria	2610
938	Ga0209974_10005205	3300027876	Bacteria	4591
939	Ga0209974_10013201	3300027876	Bacteria	2754
940	Ga0207428_10000011	3300027907	Bacteria	354388
941	Ga0207428_10000243	3300027907	Bacteria	74403
942	Ga0207428_10001408	3300027907	Bacteria	25327
943	Ga0207428_10046260	3300027907	Bacteria	3500
944	Ga0207428_10362116	3300027907	Bacteria	1066
945	Ga0207428_10406661	3300027907	Bacteria	996
946	Ga0268266_10019956	3300028379	Bacteria	5711
947	Ga0268266_10194844	3300028379	Bacteria	1851
948	Ga0268266_10336758	3300028379	Bacteria	1415
949	Ga0268266_10415861	3300028379	Bacteria	1273
950	Ga0268265_10000476	3300028380	Bacteria	42108
951	Ga0268265_10080091	3300028380	Bacteria	2575
952	Ga0268264_10002223	3300028381	Bacteria	17209
953	Ga0268264_10009905	3300028381	Bacteria	7890
954	Ga0268264_10032203	3300028381	Bacteria	4301
955	Ga0268264_10106242	3300028381	Bacteria	2450
956	Ga0268264_10165862	3300028381	Bacteria	1994
957	Ga0265337_1016847	3300028556	Bacteria	2354
958	Ga0265318_10014169	3300028577	Bacteria	3351
959	Ga0265318_10080204	3300028577	Bacteria	1206
960	Ga0265338_10210200	3300028800	Bacteria	1461
961	Ga0265338_10382324	3300028800	Bacteria	1006
962	Ga0265324_10107075	3300029957	Bacteria	950
963	Ga0265760_10057905	3300031090	Bacteria	1174
964	Ga0265330_10017466	3300031235	Bacteria	3303
965	Ga0265330_10038516	3300031235	Bacteria	2126
966	Ga0265330_10043802	3300031235	Bacteria	1978
967	Ga0265330_10243349	3300031235	Bacteria	758
968	Ga0265332_10156141	3300031238	Bacteria	954
969	Ga0265328_10013446	3300031239	Bacteria	3240
970	Ga0265320_10075988	3300031240	Bacteria	1574
971	Ga0265325_10000111	3300031241	Bacteria	56612
972	Ga0265325_10016882	3300031241	Bacteria	4071
973	Ga0265325_10018093	3300031241	Bacteria	3909
974	Ga0265325_10029853	3300031241	Bacteria	2927
975	Ga0265325_10032894	3300031241	Bacteria	2766
976	Ga0265325_10034271	3300031241	Bacteria	2702
977	Ga0265325_10105113	3300031241	Bacteria	1378
978	Ga0265325_10205791	3300031241	Bacteria	906
979	Ga0265329_10014395	3300031242	Bacteria	2795
980	Ga0265329_10019977	3300031242	Bacteria	2267
981	Ga0265340_10007569	3300031247	Bacteria	5893
982	Ga0265340_10024264	3300031247	Bacteria	3082
983	Ga0265340_10033873	3300031247	Bacteria	2541
984	Ga0265340_10055573	3300031247	Bacteria	1906
985	Ga0265340_10079759	3300031247	Bacteria	1542
986	Ga0265340_10256391	3300031247	Bacteria	779
987	Ga0265339_10001195	3300031249	Bacteria	19578
988	Ga0265339_10004423	3300031249	Bacteria	9592
989	Ga0265339_10012187	3300031249	Bacteria	5259
990	Ga0265339_10025062	3300031249	Bacteria	3429
991	Ga0265339_10070394	3300031249	Bacteria	1865
992	Ga0265331_10005990	3300031250	Bacteria	7254
993	Ga0265331_10052442	3300031250	Bacteria	1948
994	Ga0265316_10029986	3300031344	Bacteria	4466
995	Ga0265316_10137532	3300031344	Bacteria	1837
996	Ga0265316_10144524	3300031344	Bacteria	1784
997	Ga0265316_10146783	3300031344	Bacteria	1768
998	Ga0265316_10424976	3300031344	Bacteria	955
999	Ga0265316_10648930	3300031344	Bacteria	746
1000	Ga0265313_10001335	3300031595	Bacteria	23228
1001	Ga0265313_10023086	3300031595	Bacteria	3358
1002	Ga0265313_10028219	3300031595	Bacteria	2921
1003	Ga0265313_10036467	3300031595	Bacteria	2468
1004	Ga0265313_10037449	3300031595	Bacteria	2425
1005	Ga0316575_10119394	3300031665	Bacteria	1078
1006	Ga0265314_10076541	3300031711	Bacteria	2222
1007	Ga0265314_10088422	3300031711	Bacteria	2023
1008	Ga0265314_10095381	3300031711	Bacteria	1926
1009	Ga0265314_10150778	3300031711	Bacteria	1426
1010	Ga0265342_10000464	3300031712	Bacteria	43974
1011	Ga0265342_10000681	3300031712	Bacteria	35543
1012	Ga0265342_10011775	3300031712	Bacteria	5963
1013	Ga0265342_10014912	3300031712	Bacteria	5137
1014	Ga0265342_10085482	3300031712	Bacteria	1815
1015	Ga0265342_10298800	3300031712	Bacteria	848
1016	Ga0265342_10387831	3300031712	Bacteria	723
1017	Ga0316578_10046646	3300031728	Bacteria	2526
1018	Ga0307416_100254775	3300032002	Bacteria	1711
1019	Ga0316583_10001664	3300032133	Bacteria	7526
1020	Ga0373930_0000052	3300034816	Bacteria	10665
1021	Ga0373930_0002102	3300034816	Bacteria	3049
1022	Ga0373930_0018418	3300034816	Bacteria	1342
1023	Ga0373948_0000088	3300034817	Bacteria	9364
1024	Ga0373950_0000969	3300034818	Bacteria	3632
1025	Ga0373958_0003156	3300034819	Bacteria	2361
1026	Ga0373958_0004512	3300034819	Bacteria	2065
1027	Ga0373958_0025773	3300034819	Bacteria	1122
1028	Ga0373958_0027944	3300034819	Bacteria	1089
1029	Ga0373959_0000293	3300034820	Bacteria	10648
1030	Ga0373959_0002107	3300034820	Bacteria	3175
1031	Ga0373938_0000102	3300034957	Bacteria	11599
1032	Ga0373938_0000628	3300034957	Bacteria	5682
1033	Ga0373938_0006137	3300034957	Bacteria	2066
1034	Ga0373926_0003954	3300035083	Bacteria	4841
1035	Ga0373926_0004141	3300035083	Bacteria	4735
1036	Ga0373926_0043043	3300035083	Bacteria	1616
1037	Ga0373928_0009182	3300035084	Bacteria	1929
1038	Ga0373928_0017428	3300035084	Bacteria	1479
1039	Ga0373929_0001597	3300035085	Bacteria	4305
1040	Ga0373929_0002588	3300035085	Bacteria	3318
1041	Ga0373934_0030583	3300035086	Bacteria	2106
1042	Ga0373934_0049564	3300035086	Bacteria	1663
1043	Ga0373934_0098427	3300035086	Bacteria	1182
1044	Ga0373940_0000047	3300035088	Bacteria	13606
1045	Ga0373940_0003013	3300035088	Bacteria	3374
1046	Ga0373940_0041161	3300035088	Bacteria	1270
1047	Ga0373944_0001285	3300035089	Bacteria	6308
1048	Ga0373944_0049924	3300035089	Bacteria	1316
1049	Ga0373944_0059174	3300035089	Bacteria	1225
1050	Ga0373949_0001296	3300035090	Bacteria	7260
1051	Ga0373949_0002261	3300035090	Bacteria	5020
1052	Ga0373949_0002524	3300035090	Bacteria	4662
1053	Ga0373949_0020854	3300035090	Bacteria	1503
1054	Ga0373951_0002080	3300035091	Bacteria	5129
1055	Ga0373951_0029203	3300035091	Bacteria	1295
1056	Ga0373951_0034545	3300035091	Bacteria	1201
1057	Ga0373951_0073920	3300035091	Bacteria	872
1058	Ga0373952_0000681	3300035092	Bacteria	6029
1059	Ga0373952_0001502	3300035092	Bacteria	4245
1060	Ga0373952_0014969	3300035092	Bacteria	1559
1061	Ga0373923_0002471	3300035111	Bacteria	5702
1062	Ga0373923_0006522	3300035111	Bacteria	4041
1063	Ga0373923_0009668	3300035111	Bacteria	3488
1064	Ga0373923_0103619	3300035111	Bacteria	1257
1065	Ga0373932_0002959	3300035112	Bacteria	4178
1066	Ga0373932_0003713	3300035112	Bacteria	3646
1067	Ga0373932_0005468	3300035112	Bacteria	2988
1068	Ga0373932_0229960	3300035112	Bacteria	670
1069	Ga0373936_0000612	3300035113	Bacteria	12341
1070	Ga0373936_0017125	3300035113	Bacteria	2789
1071	Ga0373936_0046215	3300035113	Bacteria	1755
1072	Ga0373936_0078664	3300035113	Bacteria	1369
1073	Ga0373936_0112439	3300035113	Bacteria	1157
1074	Ga0373936_0152196	3300035113	Bacteria	1003
1075	Ga0373939_0000444	3300035114	Bacteria	10430
1076	Ga0373939_0001760	3300035114	Bacteria	5212
1077	Ga0373939_0011602	3300035114	Bacteria	2229
1078	Ga0373939_0026296	3300035114	Bacteria	1639
1079	Ga0373939_0077360	3300035114	Bacteria	1097
1080	Ga0373941_0000204	3300035115	Bacteria	11326
1081	Ga0373941_0006294	3300035115	Bacteria	2851
1082	Ga0373941_0009346	3300035115	Bacteria	2466
1083	Ga0373941_0021138	3300035115	Bacteria	1833
1084	Ga0373945_0002893	3300035116	Bacteria	5393
1085	Ga0373945_0014218	3300035116	Bacteria	2662
1086	Ga0373945_0020707	3300035116	Bacteria	2254
1087	Ga0373945_0027142	3300035116	Bacteria	1999
1088	Ga0373945_0064766	3300035116	Bacteria	1371
1089	Ga0373945_0067568	3300035116	Bacteria	1346
1090	Ga0373953_0005438	3300035117	Bacteria	4133
1091	Ga0373953_0025374	3300035117	Bacteria	2264
1092	Ga0373953_0077725	3300035117	Bacteria	1376
1093	Ga0373953_0107955	3300035117	Bacteria	1175
1094	Ga0373954_0006450	3300035118	Bacteria	5117
1095	Ga0373954_0015182	3300035118	Bacteria	3441
1096	Ga0373954_0015236	3300035118	Bacteria	3435
1097	Ga0373954_0055251	3300035118	Bacteria	1868
1098	Ga0373954_0104082	3300035118	Bacteria	1370
1099	Ga0373956_0001325	3300035119	Bacteria	10227
1100	Ga0373956_0020706	3300035119	Bacteria	2801
1101	Ga0373956_0035733	3300035119	Bacteria	2192
1102	Ga0373956_0040569	3300035119	Bacteria	2065
1103	Ga0373956_0067714	3300035119	Bacteria	1626
1104	Ga0373956_0142037	3300035119	Bacteria	1127
1105	Ga0373956_0171851	3300035119	Bacteria	1023
1106	Ga0373956_0198335	3300035119	Bacteria	951
1107	Ga0373956_0262271	3300035119	Bacteria	822
1108	Ga0373957_0017555	3300035120	Bacteria	2495
1109	Ga0373957_0020267	3300035120	Bacteria	2348
1110	Ga0373957_0062688	3300035120	Bacteria	1443
1111	Ga0373957_0193401	3300035120	Bacteria	846
1112	Ga0373960_0000129	3300035121	Bacteria	12366
1113	Ga0373960_0134349	3300035121	Bacteria	832
1114	Ga0373943_0095360	3300035170	Bacteria	1547
1115	Ga0373943_0113597	3300035170	Bacteria	1431
1116	Ga0373943_0142593	3300035170	Bacteria	1292
1117	Ga0373943_0159962	3300035170	Bacteria	1225
1118	Ga0373946_0002102	3300035171	Bacteria	6989
1119	Ga0373946_0016105	3300035171	Bacteria	2844
1120	Ga0373946_0062658	3300035171	Bacteria	1586
1121	Ga0373946_0087128	3300035171	Bacteria	1378
1122	Ga0373946_0202300	3300035171	Bacteria	952
1123	Ga0373955_0001182	3300035172	Bacteria	11112
1124	Ga0373955_0001320	3300035172	Bacteria	10519
1125	Ga0373955_0006843	3300035172	Bacteria	5211
1126	Ga0373955_0007421	3300035172	Bacteria	5042
1127	Ga0373955_0010067	3300035172	Bacteria	4451
1128	Ga0373955_0044068	3300035172	Bacteria	2401
1129	Ga0373955_0133980	3300035172	Bacteria	1448
1130	Ga0373955_0302092	3300035172	Bacteria	965
1131	Ga0373942_0001562	3300035207	Bacteria	5872
1132	Ga0373961_0001737	3300035241	Bacteria	6059
1133	Ga0373961_0002339	3300035241	Bacteria	4945
1134	Ga0373961_0006779	3300035241	Bacteria	2755
1135	Ga0373961_0009460	3300035241	Bacteria	2385
1136	Ga0373962_0004122	3300035242	Bacteria	3503
1137	Ga0373962_0025161	3300035242	Bacteria	1597
1138	Ga0373962_0064167	3300035242	Bacteria	1085
1139	Ga0316574_0003152	3300035398	Bacteria	8440
1140	Ga0373924_0000296	3300035410	Bacteria	15383
1141	Ga0373924_0006516	3300035410	Bacteria	4186
1142	Ga0373924_0076590	3300035410	Bacteria	1417
1143	Ga0373924_0169990	3300035410	Bacteria	958
1144	Ga0373931_0000447	3300035691	Bacteria	16798
1145	Ga0373931_0001441	3300035691	Bacteria	10203
1146	Ga0373931_0065698	3300035691	Bacteria	1966
1147	Ga0373931_0194260	3300035691	Bacteria	1209
1148	Ga0373935_0000484	3300035692	Bacteria	20574
1149	Ga0373935_0011942	3300035692	Bacteria	5216
1150	Ga0373935_0130054	3300035692	Bacteria	1691
1151	Ga0373935_0132142	3300035692	Bacteria	1678
1152	Ga0373935_0170588	3300035692	Bacteria	1488
1153	Ga0373935_0495838	3300035692	Bacteria	886
1154	Ga0373927_0012550	3300035695	Bacteria	5642
1155	Ga0373927_0013536	3300035695	Bacteria	5418
1156	Ga0373927_0079200	3300035695	Bacteria	2128
1157	Ga0373927_0194410	3300035695	Bacteria	1331
1158	Ga0373933_0001384	3300035724	Bacteria	14229
1159	Ga0373933_0002087	3300035724	Bacteria	11470
1160	Ga0373933_0006665	3300035724	Bacteria	6290
1161	Ga0373933_0047777	3300035724	Bacteria	2547
1162	Ga0373933_0096437	3300035724	Bacteria	1830
1163	Ga0373933_0157016	3300035724	Bacteria	1443
1164	Ga0373947_0000858	3300035725	Bacteria	18335
1165	Ga0373947_0048738	3300035725	Bacteria	2542
1166	Ga0373947_0061037	3300035725	Bacteria	2290
1167	Ga0373947_0085179	3300035725	Bacteria	1962
1168	Ga0373947_0127418	3300035725	Bacteria	1622
1169	Ga0373947_0156888	3300035725	Bacteria	1469
1170	Ga0373947_0191291	3300035725	Bacteria	1335
1171	Ga0373947_0395474	3300035725	Bacteria	931
1172	Ga0373947_0518028	3300035725	Bacteria	811
1173	Ga0373937_0000058	3300036401	Bacteria	99025
1174	Ga0373937_0002520	3300036401	Bacteria	15212
1175	Ga0373937_0006720	3300036401	Bacteria	9921
1176	Ga0373937_0007014	3300036401	Bacteria	9725
1177	Ga0373937_0013886	3300036401	Bacteria	7101
1178	Ga0373937_0019211	3300036401	Bacteria	6118
1179	Ga0373937_0094864	3300036401	Bacteria	2766
1180	Ga0373937_0483965	3300036401	Bacteria	1175
1181	Ga0373937_0510925	3300036401	Bacteria	1142
1182	Ga0373937_0540406	3300036401	Bacteria	1107
1183	Ga0316582_0485816	3300036647	Bacteria	851
1184	Ga0316584_0029387	3300036712	Bacteria	4056
1185	Ga0373925_0000036	3300037068	Bacteria	143388
1186	Ga0373925_0006937	3300037068	Bacteria	8287
1187	Ga0373925_0015939	3300037068	Bacteria	5440
1188	Ga0373925_0024734	3300037068	Bacteria	4386
1189	Ga0373925_0028987	3300037068	Bacteria	4059
1190	Ga0373925_0078339	3300037068	Bacteria	2509
1191	Ga0373925_0107947	3300037068	Bacteria	2147
1192	Ga0373925_0113223	3300037068	Bacteria	2098
1193	Ga0373925_0127691	3300037068	Bacteria	1980
1194	Ga0373925_0187903	3300037068	Bacteria	1638
1195	Ga0395899_0124488	3300037312	Bacteria	1844
1196	Ga0395899_0224807	3300037312	Bacteria	1299
1197	Ga0395900_0003699	3300037418	Bacteria	16435
1198	Ga0395900_0015404	3300037418	Bacteria	7793
1199	Ga0395900_0132302	3300037418	Bacteria	2556
1200	Ga0395898_0024894	3300037466	Bacteria	6034
1201	Ga0395898_0070660	3300037466	Bacteria	3374
1202	Ga0436364_0234810	3300037853	Bacteria	3824
1203	Ga0395901_0300451	3300038443	Bacteria	1664
1204	Ga0395901_0328311	3300038443	Bacteria	1582
1205	Ga0395901_0541443	3300038443	Bacteria	1181
1206	Ga0436365_0091274	3300039437	Bacteria	2216
1207	Ga0436365_0304759	3300039437	Bacteria	17649
1208	Ga0436365_0689813	3300039437	Bacteria	1663
1209	Ga0436365_0920303	3300039437	Bacteria	3233
1210	Ga0436365_1078850	3300039437	Bacteria	3694
1211	Ga0436365_1584586	3300039437	Bacteria	1146
1212	Ga0436360_0298928	3300039438	Bacteria	1861
1213	Ga0436361_0857818	3300039447	Bacteria	13715
1214	Ga0436363_1054208	3300039450	Bacteria	1627
1215	Ga0436363_1249494	3300039450	Bacteria	1411
1216	Ga0436362_0504108	3300039453	Bacteria	2366
1217	Ga0436362_0933042	3300039453	Bacteria	1133
1218	Ga0436362_0984765	3300039453	Bacteria	1477
1219	Ga0439453_0009679	3300041408	Bacteria	1574
1220	Ga0451853_3126676	3300041512	Bacteria	3075
1221	Ga0439448_0059908	3300042005	Bacteria	1257
1222	Ga0439455_0023162	3300042012	Bacteria	1493
1223	Ga0439458_0033670	3300042157	Bacteria	1228
1224	Ga0439464_0050811	3300042439	Bacteria	1198
1225	Ga0439460_0055226	3300042461	Bacteria	1200
1226	Ga0451577_0272778	3300042876	Bacteria	1532
1227	Ga0466966_0089825	3300044684	Bacteria	1908
1228	Ga0466966_0211006	3300044684	Bacteria	1173
1229	Ga0466961_0331965	3300044693	Bacteria	927
1230	Ga0466963_0071554	3300044694	Bacteria	2334
1231	Ga0466963_0117562	3300044694	Bacteria	1828
1232	Ga0466963_0363488	3300044694	Bacteria	1019
1233	Ga0466971_0136266	3300044719	Bacteria	1142
1234	Ga0466971_0325918	3300044719	Bacteria	741
1235	Ga0466968_0100536	3300044735	Bacteria	1290
1236	Ga0466957_0010865	3300044842	Bacteria	5235
1237	Ga0466957_0042945	3300044842	Bacteria	2736
1238	Ga0466957_0156349	3300044842	Bacteria	1478
1239	Ga0466959_0035291	3300045049	Bacteria	3700
1240	Ga0466959_0455927	3300045049	Bacteria	867
1241	Ga0451576_0021541	3300045051	Bacteria	7006
1242	Ga0451576_0283265	3300045051	Bacteria	1733
1243	Ga0466958_0094271	3300045836	Bacteria	1855
1244	Ga0466958_0162628	3300045836	Bacteria	1411
1245	Ga0466967_0056965	3300045976	Bacteria	3448
1246	Ga0466967_0446547	3300045976	Bacteria	1263
1247	Ga0466967_0625775	3300045976	Bacteria	1063
1248	Ga0495592_0000232	3300046454	Bacteria	48214
1249	Ga0495592_0007647	3300046454	Bacteria	8091
1250	Ga0495592_0011144	3300046454	Bacteria	6789
1251	Ga0495592_0016642	3300046454	Bacteria	5582
1252	Ga0495592_0150314	3300046454	Bacteria	1611
1253	Ga0495592_0241754	3300046454	Bacteria	1197
1254	Ga0495603_0012098	3300046455	Bacteria	5225
1255	Ga0495603_0012905	3300046455	Bacteria	5051
1256	Ga0495603_0070448	3300046455	Bacteria	2055
1257	Ga0495603_0350607	3300046455	Bacteria	847
1258	Ga0495603_0462026	3300046455	Bacteria	727
1259	Ga0495590_0046641	3300046457	Bacteria	1512
1260	Ga0495629_0000102	3300046459	Bacteria	75235
1261	Ga0495629_0007419	3300046459	Bacteria	8082
1262	Ga0495629_0057350	3300046459	Bacteria	2723
1263	Ga0495629_0109721	3300046459	Bacteria	1924
1264	Ga0495629_0139332	3300046459	Bacteria	1688
1265	Ga0495641_0005447	3300046461	Bacteria	8603
1266	Ga0495641_0025767	3300046461	Bacteria	2882
1267	Ga0495641_0191618	3300046461	Bacteria	916
1268	Ga0495641_0202680	3300046461	Bacteria	889
1269	Ga0495651_0001333	3300046462	Bacteria	19125
1270	Ga0495651_0007663	3300046462	Bacteria	8253
1271	Ga0495651_0013099	3300046462	Bacteria	6409
1272	Ga0495651_0017316	3300046462	Bacteria	5582
1273	Ga0495651_0108308	3300046462	Bacteria	2058
1274	Ga0495653_0000069	3300046463	Bacteria	89715
1275	Ga0495653_0011679	3300046463	Bacteria	7166
1276	Ga0495653_0019997	3300046463	Bacteria	5426
1277	Ga0495653_0106637	3300046463	Bacteria	2020
1278	Ga0495650_0046437	3300046471	Bacteria	1822
1279	Ga0495580_0046307	3300046472	Bacteria	3086
1280	Ga0495580_0115564	3300046472	Bacteria	1864
1281	Ga0495580_0342721	3300046472	Bacteria	1013
1282	Ga0495582_0003215	3300046473	Bacteria	9173
1283	Ga0495582_0007707	3300046473	Bacteria	5952
1284	Ga0495582_0010411	3300046473	Bacteria	5116
1285	Ga0495582_0031945	3300046473	Bacteria	2896
1286	Ga0495582_0079865	3300046473	Bacteria	1816
1287	Ga0495582_0336502	3300046473	Bacteria	869
1288	Ga0495639_0040344	3300046475	Bacteria	2100
1289	Ga0495639_0089481	3300046475	Bacteria	1442
1290	Ga0495639_0204340	3300046475	Bacteria	968
1291	Ga0495662_0000613	3300046476	Bacteria	16534
1292	Ga0495662_0021690	3300046476	Bacteria	3103
1293	Ga0495662_0062958	3300046476	Bacteria	1792
1294	Ga0495662_0088675	3300046476	Bacteria	1507
1295	Ga0495662_0092320	3300046476	Bacteria	1476
1296	Ga0495662_0164243	3300046476	Bacteria	1094
1297	Ga0495664_0000010	3300046477	Bacteria	268381
1298	Ga0495664_0002644	3300046477	Bacteria	9637
1299	Ga0495664_0011595	3300046477	Bacteria	4971
1300	Ga0495664_0123542	3300046477	Bacteria	1565
1301	Ga0495664_0239378	3300046477	Bacteria	1098
1302	Ga0495584_0012116	3300046491	Bacteria	4407
1303	Ga0495584_0041726	3300046491	Bacteria	2316
1304	Ga0495584_0056730	3300046491	Bacteria	1971
1305	Ga0495584_0097465	3300046491	Bacteria	1485
1306	Ga0495585_0002020	3300046492	Bacteria	15025
1307	Ga0495585_0056859	3300046492	Bacteria	2160
1308	Ga0495594_0002542	3300046499	Bacteria	9495
1309	Ga0495594_0066926	3300046499	Bacteria	1993
1310	Ga0495594_0142783	3300046499	Bacteria	1358
1311	Ga0495596_0060639	3300046500	Bacteria	1474
1312	Ga0495607_0003567	3300046501	Bacteria	11838
1313	Ga0495583_0182039	3300046506	Bacteria	860
1314	Ga0495608_0000008	3300046511	Bacteria	268629
1315	Ga0495608_0003324	3300046511	Bacteria	11503
1316	Ga0495608_0004292	3300046511	Bacteria	10205
1317	Ga0495608_0012743	3300046511	Bacteria	5835
1318	Ga0495608_0030360	3300046511	Bacteria	3659
1319	Ga0495608_0061345	3300046511	Bacteria	2473
1320	Ga0495608_0074451	3300046511	Bacteria	2213
1321	Ga0495616_0061136	3300046513	Bacteria	1848
1322	Ga0495618_0000002	3300046514	Bacteria	271353
1323	Ga0495618_0012275	3300046514	Bacteria	5200
1324	Ga0495618_0022324	3300046514	Bacteria	3908
1325	Ga0495618_0035161	3300046514	Bacteria	3145
1326	Ga0495618_0158907	3300046514	Bacteria	1442
1327	Ga0495618_0184323	3300046514	Bacteria	1325
1328	Ga0495618_0199223	3300046514	Bacteria	1268
1329	Ga0495620_0064670	3300046515	Bacteria	1512
1330	Ga0495628_0000009	3300046516	Bacteria	237611
1331	Ga0495628_0014477	3300046516	Bacteria	6610
1332	Ga0495628_0035608	3300046516	Bacteria	3999
1333	Ga0495628_0148000	3300046516	Bacteria	1789
1334	Ga0495628_0178029	3300046516	Bacteria	1610
1335	Ga0495628_0290575	3300046516	Bacteria	1212
1336	Ga0495628_0360381	3300046516	Bacteria	1067
1337	Ga0495628_0750946	3300046516	Bacteria	686
1338	Ga0495630_0001382	3300046517	Bacteria	16742
1339	Ga0495630_0097239	3300046517	Bacteria	2227
1340	Ga0495630_0099128	3300046517	Bacteria	2204
1341	Ga0495630_0110579	3300046517	Bacteria	2081
1342	Ga0495630_0605166	3300046517	Bacteria	840
1343	Ga0495631_0049490	3300046518	Bacteria	1840
1344	Ga0495631_0091200	3300046518	Bacteria	1312
1345	Ga0495637_0043072	3300046520	Bacteria	1929
1346	Ga0495637_0062305	3300046520	Bacteria	1527
1347	Ga0495644_0017876	3300046523	Bacteria	2708
1348	Ga0495666_0017957	3300046526	Bacteria	3522
1349	Ga0495652_0000011	3300046529	Bacteria	255329
1350	Ga0495652_0009380	3300046529	Bacteria	8898
1351	Ga0495652_0074079	3300046529	Bacteria	2832
1352	Ga0495652_0089339	3300046529	Bacteria	2523
1353	Ga0495652_0112615	3300046529	Bacteria	2185
1354	Ga0495652_0410856	3300046529	Bacteria	956
1355	Ga0495665_0024627	3300046531	Bacteria	3232
1356	Ga0495640_0000009	3300046533	Bacteria	217086
1357	Ga0495640_0006806	3300046533	Bacteria	9012
1358	Ga0495640_0036665	3300046533	Bacteria	3463
1359	Ga0495640_0040756	3300046533	Bacteria	3250
1360	Ga0495640_0058133	3300046533	Bacteria	2638
1361	Ga0495640_0079588	3300046533	Bacteria	2181
1362	Ga0495640_0094304	3300046533	Bacteria	1971
1363	Ga0495640_0109063	3300046533	Bacteria	1810
1364	Ga0495586_0116411	3300046535	Bacteria	1491
1365	Ga0495587_0000006	3300046536	Bacteria	310070
1366	Ga0495587_0007663	3300046536	Bacteria	6984
1367	Ga0495587_0009191	3300046536	Bacteria	6342
1368	Ga0495587_0011259	3300046536	Bacteria	5670
1369	Ga0495587_0035256	3300046536	Bacteria	3014
1370	Ga0495587_0036541	3300046536	Bacteria	2954
1371	Ga0495587_0109795	3300046536	Bacteria	1585
1372	Ga0495598_0004921	3300046537	Bacteria	2927
1373	Ga0495598_0049661	3300046537	Bacteria	1258
1374	Ga0495609_0042885	3300046538	Bacteria	2032
1375	Ga0495621_0011395	3300046539	Bacteria	2749
1376	Ga0495597_0170683	3300046542	Bacteria	883
1377	Ga0495645_0000010	3300046543	Bacteria	238337
1378	Ga0495645_0001459	3300046543	Bacteria	15985
1379	Ga0495645_0004024	3300046543	Bacteria	10040
1380	Ga0495645_0015026	3300046543	Bacteria	5500
1381	Ga0495622_0007555	3300046557	Bacteria	5047
1382	Ga0495622_0059816	3300046557	Bacteria	1764
1383	Ga0495633_0002150	3300046558	Bacteria	14125
1384	Ga0495667_0000005	3300046559	Bacteria	268252
1385	Ga0495667_0002463	3300046559	Bacteria	12360
1386	Ga0495667_0005094	3300046559	Bacteria	8878
1387	Ga0495667_0012321	3300046559	Bacteria	5795
1388	Ga0495667_0014925	3300046559	Bacteria	5249
1389	Ga0495667_0028586	3300046559	Bacteria	3755
1390	Ga0495667_0153059	3300046559	Bacteria	1484
1391	Ga0495667_0340752	3300046559	Bacteria	948
1392	Ga0495656_0000939	3300046615	Bacteria	9429
1393	Ga0495656_0237633	3300046615	Bacteria	916
1394	Ga0495668_0078377	3300046616	Bacteria	1814
1395	Ga0495634_0000055	3300046642	Bacteria	89761
1396	Ga0495634_0011979	3300046642	Bacteria	6290
1397	Ga0495634_0034172	3300046642	Bacteria	3489
1398	Ga0495634_0044077	3300046642	Bacteria	3021
1399	Ga0495634_0148336	3300046642	Bacteria	1485
1400	Ga0495634_0238775	3300046642	Bacteria	1115
1401	Ga0495634_0402056	3300046642	Bacteria	813
1402	Ga0495611_0160088	3300046648	Bacteria	1052
1403	Ga0495635_0000008	3300046663	Bacteria	268349
1404	Ga0495635_0002563	3300046663	Bacteria	12435
1405	Ga0495635_0009765	3300046663	Bacteria	6707
1406	Ga0495635_0024610	3300046663	Bacteria	4195
1407	Ga0495635_0059165	3300046663	Bacteria	2635
1408	Ga0495635_0065761	3300046663	Bacteria	2487
1409	Ga0495635_0373891	3300046663	Bacteria	949
1410	Ga0495659_0001477	3300046664	Bacteria	7974
1411	Ga0495588_0005328	3300046674	Bacteria	5719
1412	Ga0495588_0019191	3300046674	Bacteria	3347
1413	Ga0495588_0196143	3300046674	Bacteria	1066
1414	Ga0495657_0000470	3300046675	Bacteria	37809
1415	Ga0495657_0003904	3300046675	Bacteria	11994
1416	Ga0495657_0004733	3300046675	Bacteria	10845
1417	Ga0495657_0029756	3300046675	Bacteria	3829
1418	Ga0495657_0056164	3300046675	Bacteria	2623
1419	Ga0495657_0169591	3300046675	Bacteria	1345
1420	Ga0495599_0000250	3300046678	Bacteria	34000
1421	Ga0495599_0012492	3300046678	Bacteria	5236
1422	Ga0495599_0039750	3300046678	Bacteria	2955
1423	Ga0495599_0041146	3300046678	Bacteria	2902
1424	Ga0495599_0103957	3300046678	Bacteria	1769
1425	Ga0495599_0183640	3300046678	Bacteria	1288
1426	Ga0495623_0000004	3300046679	Bacteria	142249
1427	Ga0495623_0003416	3300046679	Bacteria	10512
1428	Ga0495623_0037873	3300046679	Bacteria	3084
1429	Ga0495623_0070345	3300046679	Bacteria	2180
1430	Ga0495623_0226205	3300046679	Bacteria	1063
1431	Ga0495646_0000040	3300046680	Bacteria	71368
1432	Ga0495646_0007106	3300046680	Bacteria	7112
1433	Ga0495646_0039063	3300046680	Bacteria	2927
1434	Ga0495646_0208308	3300046680	Bacteria	1062
1435	Ga0495646_0216460	3300046680	Bacteria	1037
1436	Ga0495647_0031928	3300046681	Bacteria	1960
1437	Ga0495647_0034149	3300046681	Bacteria	1904
1438	Ga0495647_0174829	3300046681	Bacteria	931
1439	Ga0495658_0000053	3300046683	Bacteria	58161
1440	Ga0495658_0048023	3300046683	Bacteria	2405
1441	Ga0495669_0041298	3300046684	Bacteria	2048
1442	Ga0495613_0018289	3300046689	Bacteria	5225
1443	Ga0495613_0055179	3300046689	Bacteria	2920
1444	Ga0495613_0129298	3300046689	Bacteria	1809
1445	Ga0495613_0160523	3300046689	Bacteria	1599
1446	Ga0495613_0352440	3300046689	Bacteria	1011
1447	Ga0495624_0013728	3300046690	Bacteria	5516
1448	Ga0495624_0023574	3300046690	Bacteria	4058
1449	Ga0495624_0294825	3300046690	Bacteria	978
1450	Ga0495624_0367516	3300046690	Bacteria	865
1451	Ga0495670_0007201	3300046691	Bacteria	5473
1452	Ga0495670_0065076	3300046691	Bacteria	1837
1453	Ga0495670_0096322	3300046691	Bacteria	1519
1454	Ga0495589_0063524	3300046794	Bacteria	1811
1455	Ga0495589_0239001	3300046794	Bacteria	850
1456	Ga0495600_0000080	3300046809	Bacteria	53421
1457	Ga0495600_0001024	3300046809	Bacteria	15107
1458	Ga0495600_0003597	3300046809	Bacteria	9135
1459	Ga0495600_0004877	3300046809	Bacteria	8061
1460	Ga0495600_0011591	3300046809	Bacteria	5498
1461	Ga0495600_0052445	3300046809	Bacteria	2663
1462	Ga0495600_0128158	3300046809	Bacteria	1650
1463	Ga0495581_0014143	3300047315	Bacteria	4625
1464	Ga0495581_0048133	3300047315	Bacteria	2462
1465	Ga0495581_0057553	3300047315	Bacteria	2243
1466	Ga0495581_0154312	3300047315	Bacteria	1342
1467	Ga0495581_0198328	3300047315	Bacteria	1174
1468	Ga0495581_0303586	3300047315	Bacteria	933
1469	Ga0495604_0000012	3300047317	Bacteria	268341
1470	Ga0495604_0004069	3300047317	Bacteria	11622
1471	Ga0495604_0004585	3300047317	Bacteria	10946
1472	Ga0495604_0021904	3300047317	Bacteria	5101
1473	Ga0495604_0036686	3300047317	Bacteria	3864
1474	Ga0495604_0117852	3300047317	Bacteria	1925
1475	Ga0495604_0247501	3300047317	Bacteria	1216
1476	Ga0495604_0429012	3300047317	Bacteria	866
1477	Ga0495674_0000011	3300047319	Bacteria	270911
1478	Ga0495674_0009544	3300047319	Bacteria	9216
1479	Ga0495674_0024777	3300047319	Bacteria	5508
1480	Ga0495674_0036339	3300047319	Bacteria	4434
1481	Ga0495674_0047040	3300047319	Bacteria	3827
1482	Ga0495674_0192540	3300047319	Bacteria	1694
1483	Ga0495674_0423336	3300047319	Bacteria	1072
1484	Ga0495674_0580904	3300047319	Bacteria	889
1485	Ga0495676_0008276	3300047321	Bacteria	9539
1486	Ga0495676_0056654	3300047321	Bacteria	3098
1487	Ga0495676_0086333	3300047321	Bacteria	2361
1488	Ga0495680_0001797	3300047322	Bacteria	22695
1489	Ga0495680_0008015	3300047322	Bacteria	9631
1490	Ga0495680_0008693	3300047322	Bacteria	9208
1491	Ga0495680_0014371	3300047322	Bacteria	6859
1492	Ga0495680_0014554	3300047322	Bacteria	6810
1493	Ga0495680_0033604	3300047322	Bacteria	4150
1494	Ga0495680_0122529	3300047322	Bacteria	1918
1495	Ga0495680_0165661	3300047322	Bacteria	1603
1496	Ga0495680_0192985	3300047322	Bacteria	1464
1497	Ga0495675_0000254	3300047444	Bacteria	38553
1498	Ga0495675_0009014	3300047444	Bacteria	6203
1499	Ga0495675_0024904	3300047444	Bacteria	3817
1500	Ga0495675_0248636	3300047444	Bacteria	1068
1501	Ga0495675_0286521	3300047444	Bacteria	981
1502	Ga0495679_042415	3300047446	Bacteria	1404
1503	Ga0495685_079353	3300047447	Bacteria	1094
1504	Ga0495673_0057757	3300047469	Bacteria	1675
1505	Ga0495684_0000014	3300047471	Bacteria	172111
1506	Ga0495684_0006501	3300047471	Bacteria	9073
1507	Ga0495684_0012614	3300047471	Bacteria	6519
1508	Ga0495684_0189227	3300047471	Bacteria	1522
1509	Ga0495684_0235385	3300047471	Bacteria	1338
1510	Ga0495593_0002525	3300047673	Bacteria	10998
1511	Ga0495593_0008094	3300047673	Bacteria	6117
1512	Ga0495593_0067278	3300047673	Bacteria	1865
1513	Ga0495593_0087817	3300047673	Bacteria	1603
1514	Ga0495602_0000019	3300048088	Bacteria	170922
1515	Ga0495602_0006541	3300048088	Bacteria	12220
1516	Ga0495602_0012673	3300048088	Bacteria	8651
1517	Ga0495602_0015772	3300048088	Bacteria	7610
1518	Ga0495602_0023797	3300048088	Bacteria	5957
1519	Ga0495602_0052349	3300048088	Bacteria	3627
1520	Ga0496100_0000579	3300048903	Bacteria	17288
1521	Ga0496100_0009825	3300048903	Bacteria	5391
1522	Ga0496100_0013514	3300048903	Bacteria	4712
1523	Ga0496100_0029503	3300048903	Bacteria	3394
1524	Ga0496100_0036429	3300048903	Bacteria	3103
1525	Ga0496100_0079433	3300048903	Bacteria	2210
1526	Ga0496100_0093375	3300048903	Bacteria	2058
1527	Ga0496100_0365707	3300048903	Bacteria	1092
1528	Ga0496101_0000061	3300048904	Bacteria	127480
1529	Ga0496101_0011060	3300048904	Bacteria	5978
1530	Ga0496101_0033437	3300048904	Bacteria	3626
1531	Ga0496101_0099523	3300048904	Bacteria	2173
1532	Ga0496101_0101800	3300048904	Bacteria	2151
1533	Ga0496101_0517049	3300048904	Bacteria	943
1534	Ga0496101_0616709	3300048904	Bacteria	857
1535	Ga0496101_0629951	3300048904	Bacteria	848
1536	Ga0496102_0000667	3300048905	Bacteria	34297
1537	Ga0496102_0002835	3300048905	Bacteria	14729
1538	Ga0496102_0016499	3300048905	Bacteria	6455
1539	Ga0496102_0061398	3300048905	Bacteria	3440
1540	Ga0496102_0120747	3300048905	Bacteria	2447
1541	Ga0496102_0202021	3300048905	Bacteria	1873
1542	Ga0496102_0226086	3300048905	Bacteria	1764
1543	Ga0496103_0000398	3300048906	Bacteria	38644
1544	Ga0496103_0008814	3300048906	Bacteria	5983
1545	Ga0496103_0055195	3300048906	Bacteria	2463
1546	Ga0496103_0080979	3300048906	Bacteria	2042
1547	Ga0496103_0120236	3300048906	Bacteria	1672
1548	Ga0496103_0122157	3300048906	Bacteria	1659
1549	Ga0496104_0001796	3300048907	Bacteria	18590
1550	Ga0496104_0009118	3300048907	Bacteria	8823
1551	Ga0496104_0016646	3300048907	Bacteria	6682
1552	Ga0496104_0022986	3300048907	Bacteria	5729
1553	Ga0496104_0109874	3300048907	Bacteria	2642
1554	Ga0496104_0167090	3300048907	Bacteria	2109
1555	Ga0496104_0284114	3300048907	Bacteria	1567
1556	Ga0496104_0309191	3300048907	Bacteria	1493
1557	Ga0496104_0330497	3300048907	Bacteria	1437
1558	Ga0496104_0353742	3300048907	Bacteria	1381
1559	Ga0496104_0863933	3300048907	Bacteria	810
1560	Ga0496105_0005227	3300048908	Bacteria	9838
1561	Ga0496105_0012184	3300048908	Bacteria	6807
1562	Ga0496105_0017055	3300048908	Bacteria	5813
1563	Ga0496105_0132925	3300048908	Bacteria	2050
1564	Ga0496105_0169774	3300048908	Bacteria	1788
1565	Ga0496105_0192184	3300048908	Bacteria	1668
1566	Ga0496105_0376584	3300048908	Bacteria	1130
1567	Ga0496105_0472140	3300048908	Bacteria	988
1568	Ga0496105_0488465	3300048908	Bacteria	968
1569	Ga0496106_0003893	3300048909	Bacteria	11139
1570	Ga0496106_0006735	3300048909	Bacteria	8509
1571	Ga0496106_0026554	3300048909	Bacteria	4312
1572	Ga0496106_0040217	3300048909	Bacteria	3501
1573	Ga0496106_0041651	3300048909	Bacteria	3442
1574	Ga0496106_0067496	3300048909	Bacteria	2727
1575	Ga0496106_0074635	3300048909	Bacteria	2596
1576	Ga0496106_0104711	3300048909	Bacteria	2197
1577	Ga0496106_0187106	3300048909	Bacteria	1645
1578	Ga0496106_0233553	3300048909	Bacteria	1469
1579	Ga0496106_0249974	3300048909	Bacteria	1417
1580	Ga0496106_0551985	3300048909	Bacteria	924
1581	Ga0496106_0697856	3300048909	Bacteria	809
1582	Ga0496107_0000308	3300048910	Bacteria	26232
1583	Ga0496107_0003073	3300048910	Bacteria	11076
1584	Ga0496107_0004490	3300048910	Bacteria	9466
1585	Ga0496107_0007790	3300048910	Bacteria	7396
1586	Ga0496107_0008959	3300048910	Bacteria	6935
1587	Ga0496107_0033451	3300048910	Bacteria	3678
1588	Ga0496107_0070452	3300048910	Bacteria	2538
1589	Ga0496107_0072941	3300048910	Bacteria	2496
1590	Ga0496107_0132643	3300048910	Bacteria	1839
1591	Ga0496108_0000619	3300048911	Bacteria	27898
1592	Ga0496108_0004947	3300048911	Bacteria	10767
1593	Ga0496108_0011911	3300048911	Bacteria	7075
1594	Ga0496108_0073829	3300048911	Bacteria	2879
1595	Ga0496108_0084241	3300048911	Bacteria	2698
1596	Ga0496108_0105362	3300048911	Bacteria	2407
1597	Ga0496108_0214188	3300048911	Bacteria	1672
1598	Ga0496108_0324429	3300048911	Bacteria	1342
1599	Ga0496109_0000530	3300048912	Bacteria	32282
1600	Ga0496109_0001296	3300048912	Bacteria	20714
1601	Ga0496109_0001606	3300048912	Bacteria	18869
1602	Ga0496109_0044865	3300048912	Bacteria	4011
1603	Ga0496109_0045255	3300048912	Bacteria	3992
1604	Ga0496109_0049415	3300048912	Bacteria	3828
1605	Ga0496109_0086293	3300048912	Bacteria	2898
1606	Ga0496109_0094534	3300048912	Bacteria	2767
1607	Ga0496109_0211112	3300048912	Bacteria	1826
1608	Ga0496109_0386185	3300048912	Bacteria	1323
1609	Ga0496110_0008615	3300048913	Bacteria	8214
1610	Ga0496110_0010405	3300048913	Bacteria	7563
1611	Ga0496110_0014646	3300048913	Bacteria	6517
1612	Ga0496110_0033069	3300048913	Bacteria	4472
1613	Ga0496110_0033674	3300048913	Bacteria	4433
1614	Ga0496110_0148935	3300048913	Bacteria	2118
1615	Ga0496110_0231347	3300048913	Bacteria	1681
1616	Ga0496110_0338720	3300048913	Bacteria	1370
1617	Ga0496110_0363384	3300048913	Bacteria	1319
1618	Ga0496110_0707253	3300048913	Bacteria	909
1619	Ga0496111_0000484	3300048914	Bacteria	20435
1620	Ga0496111_0003565	3300048914	Bacteria	9638
1621	Ga0496111_0003849	3300048914	Bacteria	9377
1622	Ga0496111_0014923	3300048914	Bacteria	5319
1623	Ga0496111_0050150	3300048914	Bacteria	3009
1624	Ga0496111_0121838	3300048914	Bacteria	1926
1625	Ga0496111_0374361	3300048914	Bacteria	1053
1626	Ga0496112_0000727	3300048915	Bacteria	22874
1627	Ga0496112_0001311	3300048915	Bacteria	18910
1628	Ga0496112_0021405	3300048915	Bacteria	6149
1629	Ga0496112_0042434	3300048915	Bacteria	4450
1630	Ga0496112_0115509	3300048915	Bacteria	2655
1631	Ga0496112_0180239	3300048915	Bacteria	2076
1632	Ga0496112_0271110	3300048915	Bacteria	1645
1633	Ga0496112_0414092	3300048915	Bacteria	1287
1634	Ga0496113_0000122	3300048916	Bacteria	33708
1635	Ga0496113_0007581	3300048916	Bacteria	6999
1636	Ga0496113_0051992	3300048916	Bacteria	3058
1637	Ga0496113_0064168	3300048916	Bacteria	2776
1638	Ga0496113_0224506	3300048916	Bacteria	1497
1639	Ga0496113_0267649	3300048916	Bacteria	1366
1640	Ga0496113_0533632	3300048916	Bacteria	942
1641	Ga0496114_0000475	3300048917	Bacteria	29382
1642	Ga0496114_0010152	3300048917	Bacteria	7493
1643	Ga0496114_0090566	3300048917	Bacteria	2596
1644	Ga0496114_0105234	3300048917	Bacteria	2413
1645	Ga0496114_0170461	3300048917	Bacteria	1896
1646	Ga0496114_0219366	3300048917	Bacteria	1669
1647	Ga0496114_0407301	3300048917	Bacteria	1204
1648	Ga0496114_0573939	3300048917	Bacteria	996
1649	Ga0496115_0006333	3300048918	Bacteria	8666
1650	Ga0496115_0007278	3300048918	Bacteria	8141
1651	Ga0496115_0041302	3300048918	Bacteria	3670
1652	Ga0496115_0057076	3300048918	Bacteria	3140
1653	Ga0496115_0075428	3300048918	Bacteria	2739
1654	Ga0496115_0099501	3300048918	Bacteria	2383
1655	Ga0496115_0116074	3300048918	Bacteria	2201
1656	Ga0496115_0118378	3300048918	Bacteria	2179
1657	Ga0496121_0001149	3300048924	Bacteria	46424
1658	Ga0496122_0070452	3300048925	Bacteria	2498
1659	Ga0496125_0106965	3300048928	Bacteria	2040
1660	Ga0496126_0020392	3300048929	Bacteria	6500
1661	Ga0496126_0126070	3300048929	Bacteria	2216
1662	Ga0496126_0243390	3300048929	Bacteria	1502
1663	Ga0501031_0011122	3300049568	Bacteria	5864
1664	Ga0501032_0007744	3300049569	Bacteria	7830
1665	Ga0501032_0021578	3300049569	Bacteria	4475
1666	Ga0501032_0022282	3300049569	Bacteria	4392
1667	Ga0501032_0066827	3300049569	Bacteria	2403
1668	Ga0501032_0585121	3300049569	Bacteria	710
1669	Ga0501033_0000207	3300049570	Bacteria	56200
1670	Ga0501033_0008177	3300049570	Bacteria	8103
1671	Ga0501033_0013167	3300049570	Bacteria	6301
1672	Ga0501033_0277169	3300049570	Bacteria	1184
1673	Ga0501034_0009593	3300049571	Bacteria	10128
1674	Ga0501034_0015256	3300049571	Bacteria	7896
1675	Ga0501034_0031861	3300049571	Bacteria	5355
1676	Ga0501034_0032869	3300049571	Bacteria	5267
1677	Ga0501034_0041386	3300049571	Bacteria	4661
1678	Ga0501034_0055124	3300049571	Bacteria	4001
1679	Ga0501034_0155959	3300049571	Bacteria	2257
1680	Ga0501034_0228579	3300049571	Bacteria	1810
1681	Ga0501034_0355806	3300049571	Bacteria	1392
1682	Ga0501036_0011440	3300049572	Bacteria	7346
1683	Ga0501036_0016232	3300049572	Bacteria	6219
1684	Ga0501036_0062332	3300049572	Bacteria	3158
1685	Ga0501036_0234243	3300049572	Bacteria	1540
1686	Ga0501036_0789322	3300049572	Bacteria	782
1687	Ga0501037_0006669	3300049573	Bacteria	8443
1688	Ga0501037_0061728	3300049573	Bacteria	2733
1689	Ga0501037_0115667	3300049573	Bacteria	1930
1690	Ga0501037_0335183	3300049573	Bacteria	1045
1691	Ga0501038_0016142	3300049574	Bacteria	6776
1692	Ga0501038_0024089	3300049574	Bacteria	5432
1693	Ga0501038_0040783	3300049574	Bacteria	4050
1694	Ga0501038_0088453	3300049574	Bacteria	2600
1695	Ga0501038_0214375	3300049574	Bacteria	1539
1696	Ga0501038_0346524	3300049574	Bacteria	1157
1697	Ga0501039_0013212	3300049575	Bacteria	6311
1698	Ga0501039_0013351	3300049575	Bacteria	6278
1699	Ga0501039_0085965	3300049575	Bacteria	2449
1700	Ga0501040_0251454	3300049576	Bacteria	1261
1701	Ga0501041_0022480	3300049577	Bacteria	3776
1702	Ga0501042_0065437	3300049578	Bacteria	2598
1703	Ga0501042_0070361	3300049578	Bacteria	2503
1704	Ga0501042_0091344	3300049578	Bacteria	2185
1705	Ga0501043_0008031	3300049579	Bacteria	8331
1706	Ga0501043_0008468	3300049579	Bacteria	8095
1707	Ga0501043_0054014	3300049579	Bacteria	3154
1708	Ga0501043_0138517	3300049579	Bacteria	1906
1709	Ga0501043_0143013	3300049579	Bacteria	1873
1710	Ga0501043_0251280	3300049579	Bacteria	1362
1711	Ga0501043_0662403	3300049579	Bacteria	766
1712	Ga0501046_0149957	3300049580	Bacteria	1759
1713	Ga0501046_0230094	3300049580	Bacteria	1370
1714	Ga0501047_0008986	3300049581	Bacteria	9433
1715	Ga0501047_0021729	3300049581	Bacteria	6162
1716	Ga0501047_0025713	3300049581	Bacteria	5661
1717	Ga0501047_0048445	3300049581	Bacteria	4103
1718	Ga0501047_0118977	3300049581	Bacteria	2524
1719	Ga0501047_0219118	3300049581	Bacteria	1759
1720	Ga0501048_0011685	3300049582	Bacteria	6549
1721	Ga0501067_0009573	3300049583	Bacteria	5367
1722	Ga0501068_0119052	3300049584	Bacteria	1646
1723	Ga0501068_0173626	3300049584	Bacteria	1361
1724	Ga0501069_0005740	3300049585	Bacteria	6467
1725	Ga0501069_0325050	3300049585	Bacteria	904
1726	Ga0501070_0024065	3300049586	Bacteria	5106
1727	Ga0501070_0036639	3300049586	Bacteria	4096
1728	Ga0501070_0091614	3300049586	Bacteria	2515
1729	Ga0501070_0092221	3300049586	Bacteria	2507
1730	Ga0501070_0124620	3300049586	Bacteria	2129
1731	Ga0501071_0085978	3300049587	Bacteria	2306
1732	Ga0501071_0258396	3300049587	Bacteria	1315
1733	Ga0501072_0003267	3300049588	Bacteria	12185
1734	Ga0501072_0011471	3300049588	Bacteria	6775
1735	Ga0501072_0120224	3300049588	Bacteria	2093
1736	Ga0501072_0351454	3300049588	Bacteria	1170
1737	Ga0501073_0025323	3300049589	Bacteria	4256
1738	Ga0501073_0036346	3300049589	Bacteria	3500
1739	Ga0501073_0297158	3300049589	Bacteria	1114
1740	Ga0501074_0035152	3300049590	Bacteria	3630
1741	Ga0501074_0069944	3300049590	Bacteria	2524
1742	Ga0501074_0283456	3300049590	Bacteria	1178
1743	Ga0501074_0672764	3300049590	Bacteria	731
1744	Ga0501075_0009087	3300049591	Bacteria	6941
1745	Ga0501075_0386644	3300049591	Bacteria	1067
1746	Ga0501076_0014998	3300049592	Bacteria	5851
1747	Ga0501076_0171422	3300049592	Bacteria	1769
1748	Ga0501076_0321686	3300049592	Bacteria	1269
1749	Ga0501076_0500889	3300049592	Bacteria	1001
1750	Ga0501076_0946598	3300049592	Bacteria	710
1751	Ga0501076_0952188	3300049592	Bacteria	708
1752	Ga0501077_0017178	3300049593	Bacteria	4564
1753	Ga0501077_0062757	3300049593	Bacteria	2357
1754	Ga0501077_0073308	3300049593	Bacteria	2169
1755	Ga0501077_0201526	3300049593	Bacteria	1264
1756	Ga0501077_0220041	3300049593	Bacteria	1207
1757	Ga0501079_0023956	3300049741	Bacteria	4683
1758	Ga0501079_0075943	3300049741	Bacteria	2599
1759	Ga0501079_0129096	3300049741	Bacteria	1967
1760	Ga0501080_0032936	3300049742	Bacteria	4835
1761	Ga0501080_0111777	3300049742	Bacteria	2532
1762	Ga0501080_0125474	3300049742	Bacteria	2377
1763	Ga0501080_0221774	3300049742	Bacteria	1730
1764	Ga0501080_0355658	3300049742	Bacteria	1322
1765	Ga0501081_0038098	3300049743	Bacteria	3283
1766	Ga0501081_0161606	3300049743	Bacteria	1614
1767	Ga0501081_0292949	3300049743	Bacteria	1193
1768	Ga0501083_0019719	3300049744	Bacteria	4694
1769	Ga0501083_0023985	3300049744	Bacteria	4229
1770	Ga0501083_0028897	3300049744	Bacteria	3819
1771	Ga0501083_0108426	3300049744	Bacteria	1826
1772	Ga0501083_0553223	3300049744	Bacteria	749
1773	Ga0501035_0013984	3300049822	Bacteria	7403
1774	Ga0501035_0050257	3300049822	Bacteria	3736
1775	Ga0501035_0050333	3300049822	Bacteria	3734
1776	Ga0501035_0060468	3300049822	Bacteria	3372
1777	Ga0501035_0077648	3300049822	Bacteria	2934
1778	Ga0501035_0281735	3300049822	Bacteria	1405
1779	Ga0501035_0540290	3300049822	Bacteria	956
1780	Ga0501035_0783885	3300049822	Bacteria	763
1781	Ga0501044_0000243	3300049823	Bacteria	68966
1782	Ga0501044_0004402	3300049823	Bacteria	15755
1783	Ga0501044_0022460	3300049823	Bacteria	6722
1784	Ga0501044_0029864	3300049823	Bacteria	5747
1785	Ga0501044_0031958	3300049823	Bacteria	5534
1786	Ga0501044_0361470	3300049823	Bacteria	1369
1787	Ga0501044_0523173	3300049823	Bacteria	1086
1788	Ga0501044_1077452	3300049823	Bacteria	673
1789	Ga0501045_0097170	3300049824	Bacteria	2179
1790	Ga0501045_0109874	3300049824	Bacteria	2044
1791	nmdc:mga03683_79610_c1	3300050489	Bacteria	1413
1792	nmdc:mga03683_92874_c1	3300050489	Bacteria	1317
1793	nmdc:mga03n38_114116_c1	3300050490	Bacteria	1320
1794	nmdc:mga03n38_131647_c1	3300050490	Bacteria	1240
1795	nmdc:mga00v17_211610_c1	3300050491	Bacteria	1255
1796	nmdc:mga0yw44_149676_c1	3300050492	Bacteria	1522
1797	nmdc:mga0yw44_30539_c1	3300050492	Bacteria	3124
1798	nmdc:mga0yw44_36922_c1	3300050492	Bacteria	2882
1799	nmdc:mga0yw44_48940_c1	3300050492	Bacteria	2149
1800	nmdc:mga0k408_227623_c1	3300050493	Bacteria	1113
1801	nmdc:mga0k408_4242_c1	3300050493	Bacteria	7606
1802	nmdc:mga06z11_27766_c1	3300050494	Bacteria	2708
1803	nmdc:mga06z11_46628_c1	3300050494	Bacteria	1751
1804	nmdc:mga06z11_5497_c1	3300050494	Bacteria	5090
1805	nmdc:mga06z11_91734_c1	3300050494	Bacteria	1650
1806	nmdc:mga07m45_190197_c1	3300050496	Bacteria	1194
1807	nmdc:mga07m45_248705_c1	3300050496	Bacteria	1034
1808	nmdc:mga05p37_1068505_c1	3300050507	Bacteria	849
1809	nmdc:mga05p37_1081085_c1	3300050507	Bacteria	842
1810	nmdc:mga05p37_22273_c1	3300050507	Bacteria	7683
1811	nmdc:mga05p37_250_c1	3300050507	Bacteria	32288
1812	nmdc:mga05p37_394378_c1	3300050507	Bacteria	1618
1813	nmdc:mga05p37_48218_c1	3300050507	Bacteria	3774
1814	nmdc:mga05p37_968_c2	3300050507	Bacteria	22586
1815	nmdc:mga09592_11757_c1	3300050508	Bacteria	7116
1816	nmdc:mga09592_3818_c1	3300050508	Bacteria	12136
1817	nmdc:mga0qj67_103_c1	3300050509	Bacteria	56674
1818	nmdc:mga0qj67_18592_c1	3300050509	Bacteria	5297
1819	nmdc:mga0qj67_187914_c1	3300050509	Bacteria	1678
1820	nmdc:mga0qj67_655_c1	3300050509	Bacteria	23866
1821	nmdc:mga0qj67_8658_c1	3300050509	Bacteria	7550
1822	nmdc:mga0qj67_99221_c1	3300050509	Bacteria	2346
1823	nmdc:mga06r32_1003985_c1	3300050510	Bacteria	787
1824	nmdc:mga06r32_1213_c1	3300050510	Bacteria	23225
1825	nmdc:mga06r32_1261_c1	3300050510	Bacteria	22739
1826	nmdc:mga06r32_156305_c1	3300050510	Bacteria	2262
1827	nmdc:mga06r32_288170_c1	3300050510	Bacteria	1629
1828	nmdc:mga06r32_381899_c1	3300050510	Bacteria	1391
1829	nmdc:mga08y16_15216_c1	3300050511	Bacteria	8092
1830	nmdc:mga08y16_314706_c1	3300050511	Bacteria	1612
1831	nmdc:mga08y16_3357_c1	3300050511	Bacteria	16585
1832	nmdc:mga08y16_36458_c1	3300050511	Bacteria	5165
1833	nmdc:mga08y16_374508_c1	3300050511	Bacteria	1460
1834	nmdc:mga08y16_506_c1	3300050511	Bacteria	35981
1835	nmdc:mga08y16_5394_c1	3300050511	Bacteria	13370
1836	nmdc:mga08y16_549903_c1	3300050511	Bacteria	1168
1837	nmdc:mga0n895_13618_c1	3300050512	Bacteria	7349
1838	nmdc:mga0n895_141548_c1	3300050512	Bacteria	2434
1839	nmdc:mga0n895_176261_c1	3300050512	Bacteria	2169
1840	nmdc:mga0n895_253734_c1	3300050512	Bacteria	1785
1841	nmdc:mga0n895_447_c1	3300050512	Bacteria	27667
1842	nmdc:mga0n895_612652_c1	3300050512	Bacteria	1090
1843	nmdc:mga0n895_660550_c1	3300050512	Bacteria	1043
1844	nmdc:mga0n895_666826_c1	3300050512	Bacteria	1038
1845	nmdc:mga0n895_852606_c1	3300050512	Bacteria	899
1846	nmdc:mga0n895_87850_c1	3300050512	Bacteria	3107
1847	nmdc:mga0rr50_1028759_c1	3300050513	Bacteria	701
1848	nmdc:mga0rr50_118588_c1	3300050513	Bacteria	2103
1849	nmdc:mga0rr50_174218_c1	3300050513	Bacteria	1755
1850	nmdc:mga0rr50_380744_c1	3300050513	Bacteria	1190
1851	nmdc:mga0rr50_41247_c1	3300050513	Bacteria	3362
1852	nmdc:mga0rr50_44740_c1	3300050513	Bacteria	3249
1853	nmdc:mga0rr50_4596_c1	3300050513	Bacteria	8127
1854	nmdc:mga0rr50_50414_c1	3300050513	Bacteria	3084
1855	nmdc:mga0rr50_55106_c1	3300050513	Bacteria	2965
1856	nmdc:mga0rr50_77964_c1	3300050513	Bacteria	2548
1857	nmdc:mga0rr50_80635_c1	3300050513	Bacteria	2509
1858	nmdc:mga08x19_2061_c1	3300050514	Bacteria	12326
1859	nmdc:mga08x19_55363_c1	3300050514	Bacteria	2556
1860	nmdc:mga08x19_6_c1	3300050514	Bacteria	405679
1861	nmdc:mga08x19_711250_c1	3300050514	Bacteria	713
1862	nmdc:mga08x19_801243_c1	3300050514	Bacteria	669
1863	nmdc:mga0a205_2114_c1	3300050515	Bacteria	17423
1864	nmdc:mga0a205_25607_c1	3300050515	Bacteria	5621
1865	nmdc:mga0a205_306016_c1	3300050515	Bacteria	1462
1866	nmdc:mga0a205_34678_c1	3300050515	Bacteria	4842
1867	nmdc:mga0a205_597169_c1	3300050515	Bacteria	957
1868	nmdc:mga0a205_859_c1	3300050515	Bacteria	24861
1869	nmdc:mga0sz30_84471_c1	3300050516	Bacteria	1377
1870	Ga0495601_0000009	3300053077	Bacteria	270622
1871	Ga0495601_0000047	3300053077	Bacteria	70553
1872	Ga0495601_0000422	3300053077	Bacteria	22193
1873	Ga0495601_0000772	3300053077	Bacteria	17271
1874	Ga0495601_0005028	3300053077	Bacteria	7675
1875	Ga0495601_0007829	3300053077	Bacteria	6286
1876	Ga0495601_0060869	3300053077	Bacteria	2396
1877	Ga0495612_0000021	3300053078	Bacteria	130528
1878	Ga0495612_0000780	3300053078	Bacteria	12945
1879	Ga0495612_0003466	3300053078	Bacteria	6536
1880	Ga0495612_0012925	3300053078	Bacteria	3363
1881	Ga0495612_0050538	3300053078	Bacteria	1707
1882	Ga0495612_0071520	3300053078	Bacteria	1447
1883	Ga0495612_0090252	3300053078	Bacteria	1296
1884	Ga0495612_0139607	3300053078	Bacteria	1050
1885	Ga0495655_0054860	3300053083	Bacteria	1067
1886	Ga0495655_0113536	3300053083	Bacteria	817
1887	Ga0495595_0000067	3300053084	Bacteria	51316
1888	Ga0495595_0000211	3300053084	Bacteria	23480
1889	Ga0495595_0000303	3300053084	Bacteria	19124
1890	Ga0495595_0000743	3300053084	Bacteria	12382
1891	Ga0495595_0001054	3300053084	Bacteria	10648
1892	Ga0495595_0001057	3300053084	Bacteria	10642
1893	Ga0495595_0029308	3300053084	Bacteria	2462
1894	Ga0495595_0061895	3300053084	Bacteria	1754
1895	Ga0495595_0064986	3300053084	Bacteria	1715
1896	Ga0495595_0099902	3300053084	Bacteria	1399
1897	Ga0495595_0102066	3300053084	Bacteria	1385
1898	Ga0495619_0000012	3300053085	Bacteria	268349
1899	Ga0495619_0000521	3300053085	Bacteria	25480
1900	Ga0495619_0002048	3300053085	Bacteria	13397
1901	Ga0495619_0002784	3300053085	Bacteria	11413
1902	Ga0495619_0008310	3300053085	Bacteria	6564
1903	Ga0495619_0012331	3300053085	Bacteria	5379
1904	Ga0495619_0026602	3300053085	Bacteria	3722
1905	Ga0495619_0028572	3300053085	Bacteria	3598
1906	Ga0495619_0150280	3300053085	Bacteria	1607
1907	Ga0495619_0170408	3300053085	Bacteria	1505
1908	Ga0495619_0320184	3300053085	Bacteria	1073
1909	Ga0495619_0450672	3300053085	Bacteria	887
1910	Ga0500646_0104556	3300053090	Bacteria	893
1911	Ga0500641_0002620	3300053096	Bacteria	6346
1912	Ga0500595_041367	3300053119	Bacteria	1481
1913	Ga0500616_0016866	3300053153	Bacteria	4149
1914	Ga0500616_0145230	3300053153	Bacteria	1104
1915	Ga0501084_0033076	3300054114	Bacteria	4325
1916	Ga0501084_0036335	3300054114	Bacteria	4115
1917	Ga0501084_0073315	3300054114	Bacteria	2867
1918	Ga0501084_0174387	3300054114	Bacteria	1815
1919	Ga0501084_0263705	3300054114	Bacteria	1454
1920	Ga0501082_0000306	3300060353	Bacteria	43493
1921	Ga0501082_0018929	3300060353	Bacteria	5933
1922	Ga0501082_0072662	3300060353	Bacteria	2963
1923	Ga0501082_0122204	3300060353	Bacteria	2257
1924	Ga0501082_0150337	3300060353	Bacteria	2022
1925	Ga0501082_0296890	3300060353	Bacteria	1407
1926	Ga0501082_0753737	3300060353	Bacteria	852
1927	Ga0530510_0052606	3300061734	Bacteria	2942
1928	Ga0530510_0151225	3300061734	Bacteria	1714
1929	Ga0530510_0678304	3300061734	Bacteria	785

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300049569	Ga0501032_0585121	Ga0501032_0585121_24_632	196
2	3300005366	Ga0070659_100212096	Ga0070659_1002120962	198
3	3300007265	Ga0099794_10017549	Ga0099794_100175493	198
4	3300046516	Ga0495628_0178029	Ga0495628_0178029_115_720	198
5	3300048913	Ga0496110_0231347	Ga0496110_0231347_385_1134	198
6	3300048914	Ga0496111_0374361	Ga0496111_0374361_189_938	198
7	3300050513	nmdc:mga0rr50_380744_c1	nmdc:mga0rr50_380744_c1_300_1049	198
8	iso_pu_bacteria	2643221733	2644727972	198
9	iso_pu_bacteria	2643221734	2644733773	198
10	3300005439	Ga0070711_100043478	Ga0070711_1000434782	199
11	3300006175	Ga0070712_100000791	Ga0070712_1000007919	199
12	3300014326	Ga0157380_10583685	Ga0157380_105836852	199
13	3300025915	Ga0207693_10003236	Ga0207693_1000323610	199
14	3300025916	Ga0207663_10050873	Ga0207663_100508732	199
15	3300025933	Ga0207706_10106061	Ga0207706_101060612	199
16	3300031239	Ga0265328_10013446	Ga0265328_100134462	199
17	3300031241	Ga0265325_10032894	Ga0265325_100328942	199
18	3300031249	Ga0265339_10001195	Ga0265339_100011954	199
19	3300031344	Ga0265316_10137532	Ga0265316_101375321	199
20	3300031344	Ga0265316_10424976	Ga0265316_104249761	199
21	3300031711	Ga0265314_10076541	Ga0265314_100765412	199
22	3300031712	Ga0265342_10298800	Ga0265342_102988001	199
23	3300031712	Ga0265342_10387831	Ga0265342_103878311	199
24	3300039447	Ga0436361_0857818	Ga0436361_0857818_12583_13332	199
25	3300039450	Ga0436363_1249494	Ga0436363_1249494_32_634	199
26	3300044684	Ga0466966_0211006	Ga0466966_0211006_421_1023	199
27	3300044693	Ga0466961_0331965	Ga0466961_0331965_116_718	199
28	3300044842	Ga0466957_0156349	Ga0466957_0156349_83_685	199
29	3300046537	Ga0495598_0049661	Ga0495598_0049661_41_667	199
30	3300048912	Ga0496109_0211112	Ga0496109_0211112_1085_1684	199
31	3300049824	Ga0501045_0097170	Ga0501045_0097170_1209_1808	199
32	3300050507	nmdc:mga05p37_394378_c1	nmdc:mga05p37_394378_c1_377_976	199
33	3300050512	nmdc:mga0n895_253734_c1	nmdc:mga0n895_253734_c1_471_1070	199
34	iso_pu_bacteria	2842694124	2842696414	199
35	3300004803	Ga0058862_12398478	Ga0058862_123984781	200
36	3300005331	Ga0070670_100014997	Ga0070670_1000149975	200
37	3300005338	Ga0068868_100621699	Ga0068868_1006216991	200
38	3300005340	Ga0070689_100061516	Ga0070689_1000615162	200
39	3300005354	Ga0070675_100087511	Ga0070675_1000875112	200
40	3300005355	Ga0070671_100020118	Ga0070671_1000201184	200
41	3300005364	Ga0070673_100005532	Ga0070673_1000055328	200
42	3300005365	Ga0070688_100057575	Ga0070688_1000575752	200
43	3300005434	Ga0070709_10160072	Ga0070709_101600722	200
44	3300005436	Ga0070713_100069682	Ga0070713_1000696822	200
45	3300005436	Ga0070713_100971145	Ga0070713_1009711451	200
46	3300005439	Ga0070711_100021339	Ga0070711_1000213392	200
47	3300005467	Ga0070706_100347467	Ga0070706_1003474672	200
48	3300005518	Ga0070699_100016828	Ga0070699_1000168282	200
49	3300005530	Ga0070679_100031265	Ga0070679_1000312653	200
50	3300005543	Ga0070672_100138603	Ga0070672_1001386034	200
51	3300005546	Ga0070696_100163222	Ga0070696_1001632221	200
52	3300005548	Ga0070665_100052504	Ga0070665_1000525044	200
53	3300005616	Ga0068852_100437047	Ga0068852_1004370472	200
54	3300006846	Ga0075430_100194368	Ga0075430_1001943682	200
55	3300025901	Ga0207688_10137874	Ga0207688_101378743	200
56	3300025906	Ga0207699_10045392	Ga0207699_100453922	200
57	3300025907	Ga0207645_10079740	Ga0207645_100797402	200
58	3300025910	Ga0207684_10212419	Ga0207684_102124192	200
59	3300025915	Ga0207693_10111432	Ga0207693_101114322	200
60	3300025916	Ga0207663_10284883	Ga0207663_102848832	200
61	3300025921	Ga0207652_10026978	Ga0207652_100269782	200
62	3300025925	Ga0207650_10003180	Ga0207650_100031809	200
63	3300025928	Ga0207700_10739390	Ga0207700_107393902	200
64	3300025929	Ga0207664_10363490	Ga0207664_103634902	200
65	3300025931	Ga0207644_10006840	Ga0207644_100068406	200
66	3300025933	Ga0207706_10497693	Ga0207706_104976931	200
67	3300025938	Ga0207704_10600986	Ga0207704_106009861	200
68	3300025939	Ga0207665_10622459	Ga0207665_106224591	200
69	3300025940	Ga0207691_10087941	Ga0207691_100879412	200
70	3300025945	Ga0207679_10127737	Ga0207679_101277372	200
71	3300025986	Ga0207658_10093845	Ga0207658_100938452	200
72	3300026023	Ga0207677_10668321	Ga0207677_106683212	200
73	3300026075	Ga0207708_10134185	Ga0207708_101341852	200
74	3300028379	Ga0268266_10336758	Ga0268266_103367582	200
75	3300032002	Ga0307416_100254775	Ga0307416_1002547752	200
76	3300035241	Ga0373961_0002339	Ga0373961_0002339_2496_3113	200
77	3300035692	Ga0373935_0495838	Ga0373935_0495838_262_873	200
78	3300035725	Ga0373947_0191291	Ga0373947_0191291_689_1300	200
79	3300037068	Ga0373925_0028987	Ga0373925_0028987_388_999	200
80	3300037312	Ga0395899_0224807	Ga0395899_0224807_430_1113	200
81	3300039437	Ga0436365_0091274	Ga0436365_0091274_934_1545	200
82	3300039438	Ga0436360_0298928	Ga0436360_0298928_246_857	200
83	3300039450	Ga0436363_1054208	Ga0436363_1054208_357_968	200
84	3300039453	Ga0436362_0504108	Ga0436362_0504108_34_645	200
85	3300044735	Ga0466968_0100536	Ga0466968_0100536_570_1187	200
86	3300046455	Ga0495603_0070448	Ga0495603_0070448_781_1392	200
87	3300046476	Ga0495662_0164243	Ga0495662_0164243_327_938	200
88	3300046515	Ga0495620_0064670	Ga0495620_0064670_822_1436	200
89	3300046516	Ga0495628_0290575	Ga0495628_0290575_451_1062	200
90	3300046533	Ga0495640_0058133	Ga0495640_0058133_1967_2578	200
91	3300046680	Ga0495646_0208308	Ga0495646_0208308_424_1035	200
92	3300046689	Ga0495613_0129298	Ga0495613_0129298_276_887	200
93	3300046690	Ga0495624_0294825	Ga0495624_0294825_316_927	200
94	3300047317	Ga0495604_0429012	Ga0495604_0429012_231_842	200
95	3300047319	Ga0495674_0047040	Ga0495674_0047040_1767_2378	200
96	3300047322	Ga0495680_0165661	Ga0495680_0165661_309_920	200
97	3300047471	Ga0495684_0235385	Ga0495684_0235385_626_1237	200
98	3300048904	Ga0496101_0101800	Ga0496101_0101800_1195_1806	200
99	3300048907	Ga0496104_0309191	Ga0496104_0309191_294_935	200
100	3300048908	Ga0496105_0488465	Ga0496105_0488465_124_735	200
101	3300048909	Ga0496106_0187106	Ga0496106_0187106_963_1574	200
102	3300048912	Ga0496109_0094534	Ga0496109_0094534_1935_2576	200
103	3300048912	Ga0496109_0386185	Ga0496109_0386185_121_735	200
104	3300048913	Ga0496110_0707253	Ga0496110_0707253_66_677	200
105	3300048915	Ga0496112_0115509	Ga0496112_0115509_1438_2049	200
106	3300048918	Ga0496115_0118378	Ga0496115_0118378_824_1435	200
107	3300048929	Ga0496126_0243390	Ga0496126_0243390_52_663	200
108	3300049572	Ga0501036_0789322	Ga0501036_0789322_20_718	200
109	3300053077	Ga0495601_0007829	Ga0495601_0007829_4425_5036	200
110	3300053083	Ga0495655_0113536	Ga0495655_0113536_170_787	200
111	3300053084	Ga0495595_0029308	Ga0495595_0029308_1782_2393	200
112	3300053085	Ga0495619_0028572	Ga0495619_0028572_2936_3547	200
113	3300053153	Ga0500616_0016866	Ga0500616_0016866_3326_3940	200
114	3300002987	JGI25159J45721_1003105	JGI25159J45721_10031055	201
115	3300003187	JGI25151J46595_10000018	JGI25151J46595_100000182	201
116	3300003187	JGI25151J46595_10000812	JGI25151J46595_1000081211	201
117	3300003771	Ga0055526_1000571	Ga0055526_100057132	201
118	3300003775	Ga0055524_1000048	Ga0055524_1000048125	201
119	3300005262	Ga0065165_1000430	Ga0065165_10004305	201
120	3300005356	Ga0070674_100482695	Ga0070674_1004826951	201
121	3300020610	Ga0154015_1658566	Ga0154015_16585662	201
122	3300025284	Ga0209130_1002943	Ga0209130_10029435	201
123	3300025291	Ga0209675_1000462	Ga0209675_100046218	201
124	3300025292	Ga0209676_1028360	Ga0209676_10283602	201
125	3300025294	Ga0209025_1000010	Ga0209025_100001012	201
126	3300025294	Ga0209025_1034871	Ga0209025_10348713	201
127	3300025295	Ga0209564_1000034	Ga0209564_1000034180	201
128	3300025297	Ga0209758_1047034	Ga0209758_10470342	201
129	3300025299	Ga0209256_1000026	Ga0209256_1000026168	201
130	3300025299	Ga0209256_1000232	Ga0209256_100023254	201
131	3300025302	Ga0207426_1015698	Ga0207426_10156984	201
132	3300025898	Ga0207692_10386877	Ga0207692_103868771	201
133	3300025972	Ga0207668_10076829	Ga0207668_100768294	201
134	3300032133	Ga0316583_10001664	Ga0316583_100016642	201
135	3300036647	Ga0316582_0485816	Ga0316582_0485816_225_839	201
136	3300048925	Ga0496122_0070452	Ga0496122_0070452_1125_1736	201
137	3300048928	Ga0496125_0106965	Ga0496125_0106965_1103_1714	201
138	3300048929	Ga0496126_0126070	Ga0496126_0126070_1070_1690	201
139	3300049568	Ga0501031_0011122	Ga0501031_0011122_3922_4539	201
140	3300049569	Ga0501032_0021578	Ga0501032_0021578_914_1531	201
141	3300049570	Ga0501033_0013167	Ga0501033_0013167_1596_2213	201
142	3300049571	Ga0501034_0032869	Ga0501034_0032869_3867_4484	201
143	3300049571	Ga0501034_0228579	Ga0501034_0228579_834_1457	201
144	3300049572	Ga0501036_0016232	Ga0501036_0016232_3848_4465	201
145	3300049573	Ga0501037_0061728	Ga0501037_0061728_1231_1848	201
146	3300049574	Ga0501038_0024089	Ga0501038_0024089_4089_4706	201
147	3300049574	Ga0501038_0088453	Ga0501038_0088453_405_1028	201
148	3300049575	Ga0501039_0013212	Ga0501039_0013212_805_1422	201
149	3300049579	Ga0501043_0138517	Ga0501043_0138517_111_734	201
150	3300049579	Ga0501043_0143013	Ga0501043_0143013_948_1565	201
151	3300049581	Ga0501047_0008986	Ga0501047_0008986_7195_7812	201
152	3300049586	Ga0501070_0036639	Ga0501070_0036639_1139_1756	201
153	3300049586	Ga0501070_0124620	Ga0501070_0124620_831_1454	201
154	3300049592	Ga0501076_0952188	Ga0501076_0952188_79_696	201
155	3300049822	Ga0501035_0050257	Ga0501035_0050257_1169_1786	201
156	3300049823	Ga0501044_0022460	Ga0501044_0022460_4465_5082	201
157	3300050490	nmdc:mga03n38_114116_c1	nmdc:mga03n38_114116_c1_389_1006	201
158	3300050491	nmdc:mga00v17_211610_c1	nmdc:mga00v17_211610_c1_546_1163	201
159	3300050496	nmdc:mga07m45_190197_c1	nmdc:mga07m45_190197_c1_551_1168	201
160	3300050509	nmdc:mga0qj67_187914_c1	nmdc:mga0qj67_187914_c1_444_1064	201
161	3300050511	nmdc:mga08y16_549903_c1	nmdc:mga08y16_549903_c1_187_792	201
162	3300050516	nmdc:mga0sz30_84471_c1	nmdc:mga0sz30_84471_c1_234_851	201
163	3300053119	Ga0500595_041367	Ga0500595_041367_103_723	201
164	3300005436	Ga0070713_100076980	Ga0070713_1000769802	202
165	3300005441	Ga0070700_100116270	Ga0070700_1001162702	202
166	3300005444	Ga0070694_100008079	Ga0070694_1000080792	202
167	3300005457	Ga0070662_100621487	Ga0070662_1006214871	202
168	3300005546	Ga0070696_100026115	Ga0070696_1000261154	202
169	3300005549	Ga0070704_100005981	Ga0070704_1000059812	202
170	3300005549	Ga0070704_100435107	Ga0070704_1004351071	202
171	3300009094	Ga0111539_10418595	Ga0111539_104185952	202
172	3300009098	Ga0105245_10431117	Ga0105245_104311172	202
173	3300009148	Ga0105243_10203055	Ga0105243_102030552	202
174	3300009553	Ga0105249_10006722	Ga0105249_100067222	202
175	3300025912	Ga0207707_10187694	Ga0207707_101876942	202
176	3300025961	Ga0207712_10008283	Ga0207712_1000828312	202
177	3300031238	Ga0265332_10156141	Ga0265332_101561412	202
178	3300031241	Ga0265325_10016882	Ga0265325_100168822	202
179	3300031712	Ga0265342_10085482	Ga0265342_100854822	202
180	3300041408	Ga0439453_0009679	Ga0439453_0009679_77_700	202
181	3300044684	Ga0466966_0089825	Ga0466966_0089825_367_978	202
182	3300044842	Ga0466957_0010865	Ga0466957_0010865_2798_3409	202
183	3300045049	Ga0466959_0035291	Ga0466959_0035291_2262_2873	202
184	3300046529	Ga0495652_0410856	Ga0495652_0410856_213_908	202
185	3300048909	Ga0496106_0233553	Ga0496106_0233553_185_808	202
186	3300049822	Ga0501035_0540290	Ga0501035_0540290_227_931	202
187	3300050489	nmdc:mga03683_92874_c1	nmdc:mga03683_92874_c1_321_1037	202
188	3300050492	nmdc:mga0yw44_149676_c1	nmdc:mga0yw44_149676_c1_282_998	202
189	3300050492	nmdc:mga0yw44_30539_c1	nmdc:mga0yw44_30539_c1_274_987	202
190	3300050511	nmdc:mga08y16_374508_c1	nmdc:mga08y16_374508_c1_694_1449	202
191	3300053077	Ga0495601_0060869	Ga0495601_0060869_441_1157	202
192	3300053085	Ga0495619_0450672	Ga0495619_0450672_68_784	202
193	3300005329	Ga0070683_101210427	Ga0070683_1012104271	203
194	3300005336	Ga0070680_100042028	Ga0070680_1000420283	203
195	3300005536	Ga0070697_100004405	Ga0070697_1000044053	203
196	3300005545	Ga0070695_100002251	Ga0070695_10000225110	203
197	3300006178	Ga0075367_10067442	Ga0075367_100674423	203
198	3300006186	Ga0075369_10042429	Ga0075369_100424292	203
199	3300006195	Ga0075366_10206747	Ga0075366_102067471	203
200	3300006353	Ga0075370_10396778	Ga0075370_103967781	203
201	3300006914	Ga0075436_100001509	Ga0075436_10000150918	203
202	3300007076	Ga0075435_100017965	Ga0075435_1000179652	203
203	3300009147	Ga0114129_10003274	Ga0114129_100032747	203
204	3300014968	Ga0157379_10200624	Ga0157379_102006242	203
205	3300024225	Ga0224572_1018257	Ga0224572_10182572	203
206	3300025920	Ga0207649_10530086	Ga0207649_105300862	203
207	3300028800	Ga0265338_10210200	Ga0265338_102102002	203
208	3300031090	Ga0265760_10057905	Ga0265760_100579052	203
209	3300031241	Ga0265325_10205791	Ga0265325_102057911	203
210	3300031247	Ga0265340_10024264	Ga0265340_100242644	203
211	3300035112	Ga0373932_0229960	Ga0373932_0229960_26_643	203
212	3300039437	Ga0436365_0304759	Ga0436365_0304759_15490_16107	203
213	3300044694	Ga0466963_0071554	Ga0466963_0071554_672_1283	203
214	3300044694	Ga0466963_0363488	Ga0466963_0363488_33_644	203
215	3300044719	Ga0466971_0136266	Ga0466971_0136266_328_1017	203
216	3300044719	Ga0466971_0325918	Ga0466971_0325918_53_664	203
217	3300044842	Ga0466957_0042945	Ga0466957_0042945_1917_2528	203
218	3300045049	Ga0466959_0455927	Ga0466959_0455927_148_828	203
219	3300045836	Ga0466958_0094271	Ga0466958_0094271_698_1309	203
220	3300045836	Ga0466958_0162628	Ga0466958_0162628_371_1051	203
221	3300045976	Ga0466967_0446547	Ga0466967_0446547_431_1042	203
222	3300045976	Ga0466967_0625775	Ga0466967_0625775_316_930	203
223	3300048918	Ga0496115_0099501	Ga0496115_0099501_1676_2368	203
224	3300050494	nmdc:mga06z11_46628_c1	nmdc:mga06z11_46628_c1_234_857	203
225	3300050507	nmdc:mga05p37_968_c2	nmdc:mga05p37_968_c2_6669_7361	203
226	3300050508	nmdc:mga09592_11757_c1	nmdc:mga09592_11757_c1_2610_3302	203
227	3300050509	nmdc:mga0qj67_8658_c1	nmdc:mga0qj67_8658_c1_3514_4206	203
228	3300050510	nmdc:mga06r32_1261_c1	nmdc:mga06r32_1261_c1_6805_7497	203
229	3300050511	nmdc:mga08y16_36458_c1	nmdc:mga08y16_36458_c1_507_1127	203
230	3300050511	nmdc:mga08y16_5394_c1	nmdc:mga08y16_5394_c1_6739_7431	203
231	3300050514	nmdc:mga08x19_6_c1	nmdc:mga08x19_6_c1_230865_231488	203
232	3300053096	Ga0500641_0002620	Ga0500641_0002620_5190_5813	203
233	3300005336	Ga0070680_100219364	Ga0070680_1002193642	204
234	3300005336	Ga0070680_100603494	Ga0070680_1006034941	204
235	3300005434	Ga0070709_10417427	Ga0070709_104174271	204
236	3300005436	Ga0070713_100488508	Ga0070713_1004885082	204
237	3300005458	Ga0070681_10049795	Ga0070681_100497954	204
238	3300005530	Ga0070679_100157505	Ga0070679_1001575053	204
239	3300005535	Ga0070684_100725880	Ga0070684_1007258802	204
240	3300005547	Ga0070693_100086465	Ga0070693_1000864652	204
241	3300005614	Ga0068856_101090690	Ga0068856_1010906902	204
242	3300005937	Ga0081455_10494318	Ga0081455_104943181	204
243	3300005981	Ga0081538_10015352	Ga0081538_100153522	204
244	3300005981	Ga0081538_10016099	Ga0081538_100160994	204
245	3300006028	Ga0070717_10458111	Ga0070717_104581111	204
246	3300006177	Ga0075362_10018797	Ga0075362_100187972	204
247	3300006195	Ga0075366_10075225	Ga0075366_100752252	204
248	3300006353	Ga0075370_10377476	Ga0075370_103774761	204
249	3300006852	Ga0075433_10431102	Ga0075433_104311021	204
250	3300006871	Ga0075434_100119212	Ga0075434_1001192122	204
251	3300006880	Ga0075429_100208774	Ga0075429_1002087742	204
252	3300006914	Ga0075436_100285296	Ga0075436_1002852963	204
253	3300007076	Ga0075435_100027583	Ga0075435_1000275833	204
254	3300017792	Ga0163161_10456261	Ga0163161_104562612	204
255	3300025921	Ga0207652_10292846	Ga0207652_102928462	204
256	3300026023	Ga0207677_10368739	Ga0207677_103687392	204
257	3300027671	Ga0209588_1060620	Ga0209588_10606201	204
258	3300028577	Ga0265318_10014169	Ga0265318_100141692	204
259	3300028577	Ga0265318_10080204	Ga0265318_100802041	204
260	3300031235	Ga0265330_10043802	Ga0265330_100438022	204
261	3300031240	Ga0265320_10075988	Ga0265320_100759881	204
262	3300031241	Ga0265325_10018093	Ga0265325_100180935	204
263	3300031242	Ga0265329_10014395	Ga0265329_100143954	204
264	3300031247	Ga0265340_10033873	Ga0265340_100338733	204
265	3300031247	Ga0265340_10256391	Ga0265340_102563912	204
266	3300031249	Ga0265339_10025062	Ga0265339_100250622	204
267	3300031250	Ga0265331_10052442	Ga0265331_100524422	204
268	3300031344	Ga0265316_10144524	Ga0265316_101445242	204
269	3300031344	Ga0265316_10146783	Ga0265316_101467832	204
270	3300031595	Ga0265313_10037449	Ga0265313_100374494	204
271	3300031711	Ga0265314_10095381	Ga0265314_100953813	204
272	3300031712	Ga0265342_10014912	Ga0265342_100149123	204
273	3300039437	Ga0436365_1078850	Ga0436365_1078850_676_1299	204
274	3300039453	Ga0436362_0933042	Ga0436362_0933042_75_692	204
275	3300039453	Ga0436362_0984765	Ga0436362_0984765_791_1405	204
276	3300046615	Ga0495656_0237633	Ga0495656_0237633_179_880	204
277	3300048905	Ga0496102_0061398	Ga0496102_0061398_1866_2582	204
278	3300048907	Ga0496104_0009118	Ga0496104_0009118_2242_2958	204
279	3300048908	Ga0496105_0132925	Ga0496105_0132925_1162_1878	204
280	3300048909	Ga0496106_0551985	Ga0496106_0551985_92_808	204
281	3300048911	Ga0496108_0084241	Ga0496108_0084241_1559_2275	204
282	3300048917	Ga0496114_0407301	Ga0496114_0407301_68_784	204
283	3300048918	Ga0496115_0057076	Ga0496115_0057076_1169_1885	204
284	3300049570	Ga0501033_0008177	Ga0501033_0008177_5797_6420	204
285	3300049574	Ga0501038_0040783	Ga0501038_0040783_225_848	204
286	3300049574	Ga0501038_0214375	Ga0501038_0214375_842_1465	204
287	3300049579	Ga0501043_0662403	Ga0501043_0662403_20_724	204
288	3300049581	Ga0501047_0021729	Ga0501047_0021729_1978_2601	204
289	3300049581	Ga0501047_0118977	Ga0501047_0118977_985_1602	204
290	3300049584	Ga0501068_0119052	Ga0501068_0119052_222_926	204
291	3300049586	Ga0501070_0024065	Ga0501070_0024065_1286_1909	204
292	3300049586	Ga0501070_0092221	Ga0501070_0092221_908_1525	204
293	3300049587	Ga0501071_0258396	Ga0501071_0258396_668_1285	204
294	3300049588	Ga0501072_0003267	Ga0501072_0003267_2622_3236	204
295	3300049588	Ga0501072_0120224	Ga0501072_0120224_16_645	204
296	3300049592	Ga0501076_0500889	Ga0501076_0500889_284_988	204
297	3300049592	Ga0501076_0946598	Ga0501076_0946598_29_643	204
298	3300049742	Ga0501080_0032936	Ga0501080_0032936_1599_2222	204
299	3300049742	Ga0501080_0111777	Ga0501080_0111777_1599_2228	204
300	3300049742	Ga0501080_0221774	Ga0501080_0221774_12_626	204
301	3300049744	Ga0501083_0019719	Ga0501083_0019719_2869_3486	204
302	3300049744	Ga0501083_0028897	Ga0501083_0028897_2380_2994	204
303	3300049744	Ga0501083_0108426	Ga0501083_0108426_890_1504	204
304	3300049744	Ga0501083_0553223	Ga0501083_0553223_95_724	204
305	3300049822	Ga0501035_0077648	Ga0501035_0077648_487_1110	204
306	3300049822	Ga0501035_0281735	Ga0501035_0281735_387_1004	204
307	3300049823	Ga0501044_0004402	Ga0501044_0004402_3645_4268	204
308	3300049823	Ga0501044_1077452	Ga0501044_1077452_22_639	204
309	3300050489	nmdc:mga03683_79610_c1	nmdc:mga03683_79610_c1_782_1396	204
310	3300050493	nmdc:mga0k408_4242_c1	nmdc:mga0k408_4242_c1_17_631	204
311	3300050494	nmdc:mga06z11_91734_c1	nmdc:mga06z11_91734_c1_811_1425	204
312	3300050507	nmdc:mga05p37_1081085_c1	nmdc:mga05p37_1081085_c1_106_732	204
313	3300050512	nmdc:mga0n895_87850_c1	nmdc:mga0n895_87850_c1_1534_2148	204
314	3300050513	nmdc:mga0rr50_50414_c1	nmdc:mga0rr50_50414_c1_1888_2502	204
315	3300054114	Ga0501084_0033076	Ga0501084_0033076_1310_1924	204
316	3300054114	Ga0501084_0174387	Ga0501084_0174387_1116_1733	204
317	3300060353	Ga0501082_0000306	Ga0501082_0000306_4076_4690	204
318	3300060353	Ga0501082_0072662	Ga0501082_0072662_2144_2758	204
319	3300060353	Ga0501082_0753737	Ga0501082_0753737_156_773	204
320	3300061734	Ga0530510_0678304	Ga0530510_0678304_24_638	204
321	2209111006	2214950751	2214012966	205
322	3300002074	JGI24748J21848_1020245	JGI24748J21848_10202452	205
323	3300005277	Ga0065716_1003841	Ga0065716_10038412	205
324	3300005327	Ga0070658_10280808	Ga0070658_102808081	205
325	3300005329	Ga0070683_100050766	Ga0070683_1000507664	205
326	3300005329	Ga0070683_100307043	Ga0070683_1003070432	205
327	3300005331	Ga0070670_100056148	Ga0070670_1000561482	205
328	3300005335	Ga0070666_10038886	Ga0070666_100388863	205
329	3300005335	Ga0070666_10088655	Ga0070666_100886552	205
330	3300005336	Ga0070680_100016815	Ga0070680_1000168153	205
331	3300005336	Ga0070680_100468367	Ga0070680_1004683671	205
332	3300005337	Ga0070682_100026711	Ga0070682_1000267115	205
333	3300005337	Ga0070682_100075209	Ga0070682_1000752092	205
334	3300005339	Ga0070660_100066387	Ga0070660_1000663873	205
335	3300005339	Ga0070660_100097365	Ga0070660_1000973652	205
336	3300005340	Ga0070689_100014550	Ga0070689_1000145502	205
337	3300005340	Ga0070689_100182113	Ga0070689_1001821132	205
338	3300005341	Ga0070691_10044683	Ga0070691_100446831	205
339	3300005344	Ga0070661_100024027	Ga0070661_1000240273	205
340	3300005347	Ga0070668_101090563	Ga0070668_1010905631	205
341	3300005355	Ga0070671_100009664	Ga0070671_1000096647	205
342	3300005355	Ga0070671_100035296	Ga0070671_1000352962	205
343	3300005364	Ga0070673_100019097	Ga0070673_1000190974	205
344	3300005364	Ga0070673_100320230	Ga0070673_1003202302	205
345	3300005365	Ga0070688_100036064	Ga0070688_1000360642	205
346	3300005366	Ga0070659_100454014	Ga0070659_1004540141	205
347	3300005366	Ga0070659_100665233	Ga0070659_1006652332	205
348	3300005367	Ga0070667_100026199	Ga0070667_1000261993	205
349	3300005406	Ga0070703_10074398	Ga0070703_100743981	205
350	3300005434	Ga0070709_10003813	Ga0070709_100038135	205
351	3300005434	Ga0070709_10072260	Ga0070709_100722602	205
352	3300005434	Ga0070709_10118605	Ga0070709_101186052	205
353	3300005435	Ga0070714_100030054	Ga0070714_1000300544	205
354	3300005435	Ga0070714_100030739	Ga0070714_1000307392	205
355	3300005435	Ga0070714_100040641	Ga0070714_1000406412	205
356	3300005435	Ga0070714_100533188	Ga0070714_1005331881	205
357	3300005436	Ga0070713_100001597	Ga0070713_10000159715	205
358	3300005436	Ga0070713_100017199	Ga0070713_1000171992	205
359	3300005436	Ga0070713_101401787	Ga0070713_1014017871	205
360	3300005437	Ga0070710_10006353	Ga0070710_100063532	205
361	3300005437	Ga0070710_10117929	Ga0070710_101179292	205
362	3300005437	Ga0070710_10152219	Ga0070710_101522192	205
363	3300005439	Ga0070711_100031335	Ga0070711_1000313352	205
364	3300005439	Ga0070711_100062402	Ga0070711_1000624022	205
365	3300005439	Ga0070711_100114679	Ga0070711_1001146792	205
366	3300005444	Ga0070694_100102785	Ga0070694_1001027852	205
367	3300005445	Ga0070708_100431287	Ga0070708_1004312872	205
368	3300005455	Ga0070663_100160422	Ga0070663_1001604222	205
369	3300005456	Ga0070678_100003132	Ga0070678_1000031325	205
370	3300005458	Ga0070681_10079521	Ga0070681_100795213	205
371	3300005458	Ga0070681_10123529	Ga0070681_101235292	205
372	3300005459	Ga0068867_100116634	Ga0068867_1001166342	205
373	3300005468	Ga0070707_100177476	Ga0070707_1001774761	205
374	3300005530	Ga0070679_100016983	Ga0070679_1000169836	205
375	3300005530	Ga0070679_100147459	Ga0070679_1001474592	205
376	3300005530	Ga0070679_100175477	Ga0070679_1001754772	205
377	3300005530	Ga0070679_100240800	Ga0070679_1002408001	205
378	3300005535	Ga0070684_100179294	Ga0070684_1001792942	205
379	3300005536	Ga0070697_100090484	Ga0070697_1000904842	205
380	3300005536	Ga0070697_100352047	Ga0070697_1003520472	205
381	3300005539	Ga0068853_100716388	Ga0068853_1007163881	205
382	3300005539	Ga0068853_100720172	Ga0068853_1007201721	205
383	3300005543	Ga0070672_100087867	Ga0070672_1000878672	205
384	3300005543	Ga0070672_100178240	Ga0070672_1001782402	205
385	3300005543	Ga0070672_100298638	Ga0070672_1002986382	205
386	3300005544	Ga0070686_100005087	Ga0070686_1000050872	205
387	3300005546	Ga0070696_100237390	Ga0070696_1002373902	205
388	3300005547	Ga0070693_100079583	Ga0070693_1000795832	205
389	3300005549	Ga0070704_100098207	Ga0070704_1000982072	205
390	3300005563	Ga0068855_100059666	Ga0068855_1000596662	205
391	3300005563	Ga0068855_100080600	Ga0068855_1000806003	205
392	3300005563	Ga0068855_100087804	Ga0068855_1000878043	205
393	3300005563	Ga0068855_100171208	Ga0068855_1001712082	205
394	3300005563	Ga0068855_100173514	Ga0068855_1001735143	205
395	3300005578	Ga0068854_100251655	Ga0068854_1002516552	205
396	3300005614	Ga0068856_100282097	Ga0068856_1002820972	205
397	3300005614	Ga0068856_100401783	Ga0068856_1004017832	205
398	3300005615	Ga0070702_100038416	Ga0070702_1000384162	205
399	3300005616	Ga0068852_100020097	Ga0068852_1000200972	205
400	3300005616	Ga0068852_100062704	Ga0068852_1000627043	205
401	3300005616	Ga0068852_100070667	Ga0068852_1000706672	205
402	3300005617	Ga0068859_100056632	Ga0068859_1000566322	205
403	3300005617	Ga0068859_100450017	Ga0068859_1004500172	205
404	3300005618	Ga0068864_100022498	Ga0068864_1000224987	205
405	3300005841	Ga0068863_100040544	Ga0068863_1000405442	205
406	3300005842	Ga0068858_100078526	Ga0068858_1000785262	205
407	3300005843	Ga0068860_100063400	Ga0068860_1000634004	205
408	3300005843	Ga0068860_100160769	Ga0068860_1001607692	205
409	3300005844	Ga0068862_100455405	Ga0068862_1004554052	205
410	3300005937	Ga0081455_10006810	Ga0081455_100068107	205
411	3300005937	Ga0081455_10257468	Ga0081455_102574681	205
412	3300005983	Ga0081540_1001289	Ga0081540_100128916	205
413	3300005983	Ga0081540_1009366	Ga0081540_10093663	205
414	3300006028	Ga0070717_10000869	Ga0070717_100008696	205
415	3300006028	Ga0070717_10449347	Ga0070717_104493472	205
416	3300006058	Ga0075432_10033167	Ga0075432_100331672	205
417	3300006163	Ga0070715_10002795	Ga0070715_100027953	205
418	3300006163	Ga0070715_10148995	Ga0070715_101489952	205
419	3300006173	Ga0070716_100038610	Ga0070716_1000386102	205
420	3300006173	Ga0070716_100069981	Ga0070716_1000699812	205
421	3300006175	Ga0070712_100028408	Ga0070712_1000284085	205
422	3300006175	Ga0070712_100261645	Ga0070712_1002616452	205
423	3300006175	Ga0070712_100396054	Ga0070712_1003960542	205
424	3300006194	Ga0075427_10002174	Ga0075427_100021742	205
425	3300006237	Ga0097621_100004295	Ga0097621_1000042952	205
426	3300006358	Ga0068871_100031433	Ga0068871_1000314333	205
427	3300006844	Ga0075428_100088230	Ga0075428_1000882301	205
428	3300006844	Ga0075428_100178571	Ga0075428_1001785714	205
429	3300006844	Ga0075428_101169152	Ga0075428_1011691521	205
430	3300006846	Ga0075430_100004109	Ga0075430_10000410911	205
431	3300006846	Ga0075430_100018996	Ga0075430_1000189963	205
432	3300006846	Ga0075430_100022665	Ga0075430_1000226654	205
433	3300006847	Ga0075431_100020477	Ga0075431_1000204773	205
434	3300006847	Ga0075431_100060933	Ga0075431_1000609333	205
435	3300006847	Ga0075431_100901613	Ga0075431_1009016132	205
436	3300006852	Ga0075433_10000273	Ga0075433_100002734	205
437	3300006852	Ga0075433_10197539	Ga0075433_101975392	205
438	3300006852	Ga0075433_10301295	Ga0075433_103012952	205
439	3300006852	Ga0075433_10628891	Ga0075433_106288912	205
440	3300006871	Ga0075434_100000421	Ga0075434_10000042120	205
441	3300006871	Ga0075434_100025282	Ga0075434_1000252823	205
442	3300006871	Ga0075434_100041503	Ga0075434_1000415033	205
443	3300006871	Ga0075434_100525536	Ga0075434_1005255362	205
444	3300006880	Ga0075429_100008384	Ga0075429_1000083849	205
445	3300006880	Ga0075429_100312908	Ga0075429_1003129082	205
446	3300006881	Ga0068865_100129856	Ga0068865_1001298562	205
447	3300006914	Ga0075436_100072036	Ga0075436_1000720362	205
448	3300006914	Ga0075436_100192323	Ga0075436_1001923232	205
449	3300006914	Ga0075436_100477825	Ga0075436_1004778251	205
450	3300006931	Ga0097620_100056630	Ga0097620_1000566302	205
451	3300006931	Ga0097620_100450009	Ga0097620_1004500092	205
452	3300007076	Ga0075435_100029434	Ga0075435_1000294342	205
453	3300007076	Ga0075435_100056781	Ga0075435_1000567812	205
454	3300007076	Ga0075435_100060282	Ga0075435_1000602823	205
455	3300007076	Ga0075435_100088757	Ga0075435_1000887572	205
456	3300009011	Ga0105251_10084561	Ga0105251_100845612	205
457	3300009092	Ga0105250_10083071	Ga0105250_100830712	205
458	3300009093	Ga0105240_10019295	Ga0105240_100192953	205
459	3300009093	Ga0105240_10474600	Ga0105240_104746002	205
460	3300009094	Ga0111539_10001379	Ga0111539_100013792	205
461	3300009094	Ga0111539_10043359	Ga0111539_100433592	205
462	3300009098	Ga0105245_10221716	Ga0105245_102217163	205
463	3300009101	Ga0105247_10024793	Ga0105247_100247932	205
464	3300009101	Ga0105247_10107489	Ga0105247_101074892	205
465	3300009147	Ga0114129_10002175	Ga0114129_1000217526	205
466	3300009147	Ga0114129_10019125	Ga0114129_100191259	205
467	3300009148	Ga0105243_10056909	Ga0105243_100569093	205
468	3300009148	Ga0105243_10072306	Ga0105243_100723062	205
469	3300009174	Ga0105241_10091754	Ga0105241_100917542	205
470	3300009174	Ga0105241_10109510	Ga0105241_101095102	205
471	3300009174	Ga0105241_10142467	Ga0105241_101424672	205
472	3300009176	Ga0105242_10052546	Ga0105242_100525462	205
473	3300009545	Ga0105237_10212769	Ga0105237_102127692	205
474	3300009545	Ga0105237_10351898	Ga0105237_103518982	205
475	3300009551	Ga0105238_10040894	Ga0105238_100408942	205
476	3300009551	Ga0105238_10097754	Ga0105238_100977544	205
477	3300009551	Ga0105238_10356411	Ga0105238_103564112	205
478	3300011119	Ga0105246_10047493	Ga0105246_100474933	205
479	3300012490	Ga0157322_1009344	Ga0157322_10093441	205
480	3300012494	Ga0157341_1001714	Ga0157341_10017142	205
481	3300013102	Ga0157371_10042600	Ga0157371_100426003	205
482	3300013102	Ga0157371_10126632	Ga0157371_101266322	205
483	3300013102	Ga0157371_10216866	Ga0157371_102168662	205
484	3300013104	Ga0157370_10238981	Ga0157370_102389813	205
485	3300013105	Ga0157369_10291142	Ga0157369_102911422	205
486	3300013105	Ga0157369_10406533	Ga0157369_104065332	205
487	3300013105	Ga0157369_10910485	Ga0157369_109104851	205
488	3300013296	Ga0157374_10138715	Ga0157374_101387152	205
489	3300013296	Ga0157374_10617280	Ga0157374_106172801	205
490	3300013297	Ga0157378_10384779	Ga0157378_103847792	205
491	3300013297	Ga0157378_10600459	Ga0157378_106004591	205
492	3300013306	Ga0163162_10088841	Ga0163162_100888411	205
493	3300013306	Ga0163162_10242836	Ga0163162_102428362	205
494	3300013307	Ga0157372_10213353	Ga0157372_102133532	205
495	3300013308	Ga0157375_10468609	Ga0157375_104686091	205
496	3300014326	Ga0157380_10682475	Ga0157380_106824751	205
497	3300014968	Ga0157379_10004227	Ga0157379_1000422712	205
498	3300014969	Ga0157376_10274458	Ga0157376_102744582	205
499	3300014969	Ga0157376_10308995	Ga0157376_103089952	205
500	3300014969	Ga0157376_11052178	Ga0157376_110521782	205
501	3300014969	Ga0157376_11329767	Ga0157376_113297672	205
502	3300017792	Ga0163161_10061442	Ga0163161_100614422	205
503	3300020069	Ga0197907_10134386	Ga0197907_101343862	205
504	3300020082	Ga0206353_10333313	Ga0206353_103333133	205
505	3300021384	Ga0213876_10225310	Ga0213876_102253101	205
506	3300021388	Ga0213875_10008383	Ga0213875_100083836	205
507	3300022467	Ga0224712_10175677	Ga0224712_101756771	205
508	3300025297	Ga0209758_1000382	Ga0209758_100038210	205
509	3300025711	Ga0207696_1083874	Ga0207696_10838741	205
510	3300025735	Ga0207713_1024665	Ga0207713_10246653	205
511	3300025898	Ga0207692_10017225	Ga0207692_100172252	205
512	3300025898	Ga0207692_10137545	Ga0207692_101375452	205
513	3300025898	Ga0207692_10193299	Ga0207692_101932991	205
514	3300025900	Ga0207710_10012303	Ga0207710_100123032	205
515	3300025901	Ga0207688_10213141	Ga0207688_102131412	205
516	3300025903	Ga0207680_10018553	Ga0207680_100185533	205
517	3300025905	Ga0207685_10049445	Ga0207685_100494452	205
518	3300025906	Ga0207699_10002054	Ga0207699_100020547	205
519	3300025906	Ga0207699_10035918	Ga0207699_100359182	205
520	3300025906	Ga0207699_10143739	Ga0207699_101437392	205
521	3300025907	Ga0207645_10060555	Ga0207645_100605552	205
522	3300025909	Ga0207705_10040208	Ga0207705_100402082	205
523	3300025909	Ga0207705_10085872	Ga0207705_100858722	205
524	3300025910	Ga0207684_10006292	Ga0207684_100062923	205
525	3300025910	Ga0207684_10285193	Ga0207684_102851932	205
526	3300025911	Ga0207654_10022735	Ga0207654_100227352	205
527	3300025912	Ga0207707_10240695	Ga0207707_102406951	205
528	3300025914	Ga0207671_10097768	Ga0207671_100977682	205
529	3300025914	Ga0207671_10154315	Ga0207671_101543152	205
530	3300025915	Ga0207693_10002929	Ga0207693_100029295	205
531	3300025915	Ga0207693_10062818	Ga0207693_100628185	205
532	3300025915	Ga0207693_10063513	Ga0207693_100635131	205
533	3300025915	Ga0207693_10081601	Ga0207693_100816012	205
534	3300025915	Ga0207693_10113343	Ga0207693_101133432	205
535	3300025915	Ga0207693_10350862	Ga0207693_103508621	205
536	3300025916	Ga0207663_10061178	Ga0207663_100611783	205
537	3300025916	Ga0207663_10157590	Ga0207663_101575902	205
538	3300025917	Ga0207660_10030306	Ga0207660_100303063	205
539	3300025919	Ga0207657_10009131	Ga0207657_100091313	205
540	3300025919	Ga0207657_10091781	Ga0207657_100917812	205
541	3300025919	Ga0207657_10270287	Ga0207657_102702872	205
542	3300025920	Ga0207649_10018142	Ga0207649_100181422	205
543	3300025921	Ga0207652_10057234	Ga0207652_100572345	205
544	3300025921	Ga0207652_10141064	Ga0207652_101410643	205
545	3300025924	Ga0207694_10199139	Ga0207694_101991392	205
546	3300025924	Ga0207694_10261354	Ga0207694_102613541	205
547	3300025924	Ga0207694_10558073	Ga0207694_105580731	205
548	3300025925	Ga0207650_10590662	Ga0207650_105906622	205
549	3300025926	Ga0207659_10172061	Ga0207659_101720612	205
550	3300025927	Ga0207687_10026328	Ga0207687_100263285	205
551	3300025927	Ga0207687_10174225	Ga0207687_101742252	205
552	3300025928	Ga0207700_10037361	Ga0207700_100373612	205
553	3300025928	Ga0207700_10201357	Ga0207700_102013572	205
554	3300025928	Ga0207700_10592495	Ga0207700_105924951	205
555	3300025929	Ga0207664_10068485	Ga0207664_100684852	205
556	3300025929	Ga0207664_10093981	Ga0207664_100939812	205
557	3300025929	Ga0207664_10102817	Ga0207664_101028172	205
558	3300025929	Ga0207664_10256570	Ga0207664_102565701	205
559	3300025929	Ga0207664_10307480	Ga0207664_103074802	205
560	3300025931	Ga0207644_10013452	Ga0207644_100134522	205
561	3300025932	Ga0207690_10245301	Ga0207690_102453012	205
562	3300025932	Ga0207690_10425142	Ga0207690_104251421	205
563	3300025933	Ga0207706_10006794	Ga0207706_100067944	205
564	3300025933	Ga0207706_10151154	Ga0207706_101511542	205
565	3300025935	Ga0207709_10311764	Ga0207709_103117641	205
566	3300025935	Ga0207709_10328201	Ga0207709_103282012	205
567	3300025935	Ga0207709_10479223	Ga0207709_104792231	205
568	3300025936	Ga0207670_10328409	Ga0207670_103284092	205
569	3300025938	Ga0207704_10081322	Ga0207704_100813222	205
570	3300025938	Ga0207704_10513036	Ga0207704_105130361	205
571	3300025939	Ga0207665_10005878	Ga0207665_100058787	205
572	3300025939	Ga0207665_10037556	Ga0207665_100375562	205
573	3300025939	Ga0207665_10044749	Ga0207665_100447492	205
574	3300025940	Ga0207691_10101939	Ga0207691_101019392	205
575	3300025940	Ga0207691_10371731	Ga0207691_103717311	205
576	3300025941	Ga0207711_10002137	Ga0207711_1000213714	205
577	3300025941	Ga0207711_10426884	Ga0207711_104268841	205
578	3300025942	Ga0207689_10050437	Ga0207689_100504372	205
579	3300025944	Ga0207661_10057532	Ga0207661_100575322	205
580	3300025945	Ga0207679_10300086	Ga0207679_103000861	205
581	3300025945	Ga0207679_10775727	Ga0207679_107757272	205
582	3300025949	Ga0207667_10150847	Ga0207667_101508473	205
583	3300025949	Ga0207667_10162455	Ga0207667_101624553	205
584	3300025949	Ga0207667_10268375	Ga0207667_102683752	205
585	3300025949	Ga0207667_10385599	Ga0207667_103855993	205
586	3300025960	Ga0207651_10003191	Ga0207651_100031912	205
587	3300025960	Ga0207651_10094265	Ga0207651_100942652	205
588	3300025960	Ga0207651_10769305	Ga0207651_107693051	205
589	3300025972	Ga0207668_10434644	Ga0207668_104346442	205
590	3300025981	Ga0207640_10023375	Ga0207640_100233753	205
591	3300025986	Ga0207658_10062727	Ga0207658_100627274	205
592	3300025986	Ga0207658_10541348	Ga0207658_105413481	205
593	3300026023	Ga0207677_10068977	Ga0207677_100689772	205
594	3300026035	Ga0207703_10031600	Ga0207703_100316002	205
595	3300026041	Ga0207639_10250003	Ga0207639_102500032	205
596	3300026067	Ga0207678_10062436	Ga0207678_100624362	205
597	3300026078	Ga0207702_10491447	Ga0207702_104914472	205
598	3300026088	Ga0207641_10635419	Ga0207641_106354192	205
599	3300026089	Ga0207648_10076359	Ga0207648_100763592	205
600	3300026089	Ga0207648_10494136	Ga0207648_104941362	205
601	3300026095	Ga0207676_10401105	Ga0207676_104011052	205
602	3300026121	Ga0207683_10016569	Ga0207683_100165692	205
603	3300026142	Ga0207698_10391146	Ga0207698_103911462	205
604	3300026142	Ga0207698_10396178	Ga0207698_103961782	205
605	3300027907	Ga0207428_10000243	Ga0207428_1000024358	205
606	3300027907	Ga0207428_10362116	Ga0207428_103621162	205
607	3300027907	Ga0207428_10406661	Ga0207428_104066611	205
608	3300028379	Ga0268266_10019956	Ga0268266_100199562	205
609	3300028380	Ga0268265_10080091	Ga0268265_100800911	205
610	3300028381	Ga0268264_10106242	Ga0268264_101062423	205
611	3300028556	Ga0265337_1016847	Ga0265337_10168472	205
612	3300028800	Ga0265338_10382324	Ga0265338_103823242	205
613	3300031235	Ga0265330_10017466	Ga0265330_100174662	205
614	3300031241	Ga0265325_10029853	Ga0265325_100298532	205
615	3300031241	Ga0265325_10105113	Ga0265325_101051132	205
616	3300031242	Ga0265329_10019977	Ga0265329_100199772	205
617	3300031247	Ga0265340_10007569	Ga0265340_100075695	205
618	3300031247	Ga0265340_10055573	Ga0265340_100555732	205
619	3300031247	Ga0265340_10079759	Ga0265340_100797592	205
620	3300031249	Ga0265339_10004423	Ga0265339_100044238	205
621	3300031249	Ga0265339_10012187	Ga0265339_100121872	205
622	3300031249	Ga0265339_10070394	Ga0265339_100703942	205
623	3300031595	Ga0265313_10001335	Ga0265313_1000133513	205
624	3300031595	Ga0265313_10023086	Ga0265313_100230862	205
625	3300031595	Ga0265313_10036467	Ga0265313_100364674	205
626	3300031665	Ga0316575_10119394	Ga0316575_101193942	205
627	3300031711	Ga0265314_10088422	Ga0265314_100884223	205
628	3300031711	Ga0265314_10150778	Ga0265314_101507782	205
629	3300031712	Ga0265342_10000464	Ga0265342_100004646	205
630	3300031712	Ga0265342_10000681	Ga0265342_1000068118	205
631	3300031712	Ga0265342_10011775	Ga0265342_100117756	205
632	3300031728	Ga0316578_10046646	Ga0316578_100466463	205
633	3300034816	Ga0373930_0002102	Ga0373930_0002102_424_1044	205
634	3300034819	Ga0373958_0025773	Ga0373958_0025773_128_745	205
635	3300034819	Ga0373958_0027944	Ga0373958_0027944_34_654	205
636	3300034820	Ga0373959_0002107	Ga0373959_0002107_2206_2826	205
637	3300034957	Ga0373938_0006137	Ga0373938_0006137_441_1061	205
638	3300035083	Ga0373926_0003954	Ga0373926_0003954_3174_3794	205
639	3300035083	Ga0373926_0004141	Ga0373926_0004141_598_1215	205
640	3300035084	Ga0373928_0017428	Ga0373928_0017428_494_1111	205
641	3300035085	Ga0373929_0002588	Ga0373929_0002588_1879_2499	205
642	3300035086	Ga0373934_0049564	Ga0373934_0049564_918_1535	205
643	3300035086	Ga0373934_0098427	Ga0373934_0098427_430_1047	205
644	3300035088	Ga0373940_0041161	Ga0373940_0041161_562_1182	205
645	3300035089	Ga0373944_0001285	Ga0373944_0001285_2901_3518	205
646	3300035090	Ga0373949_0002524	Ga0373949_0002524_2808_3428	205
647	3300035090	Ga0373949_0020854	Ga0373949_0020854_692_1309	205
648	3300035091	Ga0373951_0029203	Ga0373951_0029203_328_945	205
649	3300035091	Ga0373951_0034545	Ga0373951_0034545_418_1038	205
650	3300035092	Ga0373952_0001502	Ga0373952_0001502_2419_3039	205
651	3300035111	Ga0373923_0006522	Ga0373923_0006522_899_1516	205
652	3300035112	Ga0373932_0002959	Ga0373932_0002959_453_1073	205
653	3300035113	Ga0373936_0017125	Ga0373936_0017125_1757_2374	205
654	3300035113	Ga0373936_0078664	Ga0373936_0078664_345_962	205
655	3300035113	Ga0373936_0112439	Ga0373936_0112439_78_695	205
656	3300035114	Ga0373939_0001760	Ga0373939_0001760_4205_4825	205
657	3300035114	Ga0373939_0011602	Ga0373939_0011602_1172_1789	205
658	3300035115	Ga0373941_0009346	Ga0373941_0009346_1151_1771	205
659	3300035115	Ga0373941_0021138	Ga0373941_0021138_823_1440	205
660	3300035116	Ga0373945_0014218	Ga0373945_0014218_895_1512	205
661	3300035116	Ga0373945_0020707	Ga0373945_0020707_778_1398	205
662	3300035116	Ga0373945_0027142	Ga0373945_0027142_909_1526	205
663	3300035117	Ga0373953_0025374	Ga0373953_0025374_844_1461	205
664	3300035118	Ga0373954_0015236	Ga0373954_0015236_1866_2483	205
665	3300035118	Ga0373954_0055251	Ga0373954_0055251_990_1607	205
666	3300035119	Ga0373956_0001325	Ga0373956_0001325_3282_3899	205
667	3300035119	Ga0373956_0020706	Ga0373956_0020706_230_847	205
668	3300035119	Ga0373956_0040569	Ga0373956_0040569_429_1046	205
669	3300035119	Ga0373956_0171851	Ga0373956_0171851_393_1010	205
670	3300035119	Ga0373956_0198335	Ga0373956_0198335_170_787	205
671	3300035119	Ga0373956_0262271	Ga0373956_0262271_113_730	205
672	3300035120	Ga0373957_0020267	Ga0373957_0020267_197_814	205
673	3300035120	Ga0373957_0193401	Ga0373957_0193401_17_634	205
674	3300035170	Ga0373943_0159962	Ga0373943_0159962_148_765	205
675	3300035171	Ga0373946_0016105	Ga0373946_0016105_162_779	205
676	3300035171	Ga0373946_0062658	Ga0373946_0062658_324_941	205
677	3300035172	Ga0373955_0001182	Ga0373955_0001182_8834_9451	205
678	3300035172	Ga0373955_0001320	Ga0373955_0001320_8757_9374	205
679	3300035172	Ga0373955_0010067	Ga0373955_0010067_793_1410	205
680	3300035172	Ga0373955_0133980	Ga0373955_0133980_697_1314	205
681	3300035172	Ga0373955_0302092	Ga0373955_0302092_228_845	205
682	3300035241	Ga0373961_0006779	Ga0373961_0006779_1888_2508	205
683	3300035242	Ga0373962_0064167	Ga0373962_0064167_280_897	205
684	3300035398	Ga0316574_0003152	Ga0316574_0003152_4963_5583	205
685	3300035410	Ga0373924_0006516	Ga0373924_0006516_2115_2732	205
686	3300035410	Ga0373924_0169990	Ga0373924_0169990_302_919	205
687	3300035691	Ga0373931_0001441	Ga0373931_0001441_4595_5215	205
688	3300035691	Ga0373931_0194260	Ga0373931_0194260_397_1017	205
689	3300035692	Ga0373935_0011942	Ga0373935_0011942_4493_5113	205
690	3300035695	Ga0373927_0013536	Ga0373927_0013536_3883_4503	205
691	3300035695	Ga0373927_0194410	Ga0373927_0194410_10_627	205
692	3300035724	Ga0373933_0001384	Ga0373933_0001384_5133_5750	205
693	3300035724	Ga0373933_0047777	Ga0373933_0047777_151_768	205
694	3300035724	Ga0373933_0096437	Ga0373933_0096437_105_722	205
695	3300035725	Ga0373947_0000858	Ga0373947_0000858_4121_4741	205
696	3300035725	Ga0373947_0127418	Ga0373947_0127418_148_765	205
697	3300035725	Ga0373947_0156888	Ga0373947_0156888_285_902	205
698	3300035725	Ga0373947_0395474	Ga0373947_0395474_97_714	205
699	3300035725	Ga0373947_0518028	Ga0373947_0518028_140_757	205
700	3300036401	Ga0373937_0002520	Ga0373937_0002520_13831_14448	205
701	3300036401	Ga0373937_0007014	Ga0373937_0007014_8437_9054	205
702	3300036401	Ga0373937_0019211	Ga0373937_0019211_1739_2356	205
703	3300036401	Ga0373937_0094864	Ga0373937_0094864_1337_1954	205
704	3300036401	Ga0373937_0510925	Ga0373937_0510925_144_761	205
705	3300036712	Ga0316584_0029387	Ga0316584_0029387_1475_2095	205
706	3300037068	Ga0373925_0006937	Ga0373925_0006937_2076_2696	205
707	3300037068	Ga0373925_0078339	Ga0373925_0078339_1073_1690	205
708	3300037068	Ga0373925_0113223	Ga0373925_0113223_1302_1919	205
709	3300037853	Ga0436364_0234810	Ga0436364_0234810_2953_3570	205
710	3300039437	Ga0436365_0920303	Ga0436365_0920303_1181_1798	205
711	3300039437	Ga0436365_1584586	Ga0436365_1584586_303_920	205
712	3300044694	Ga0466963_0117562	Ga0466963_0117562_920_1537	205
713	3300045051	Ga0451576_0283265	Ga0451576_0283265_736_1356	205
714	3300045976	Ga0466967_0056965	Ga0466967_0056965_1033_1650	205
715	3300046454	Ga0495592_0011144	Ga0495592_0011144_1685_2302	205
716	3300046454	Ga0495592_0016642	Ga0495592_0016642_648_1265	205
717	3300046454	Ga0495592_0150314	Ga0495592_0150314_338_955	205
718	3300046455	Ga0495603_0012098	Ga0495603_0012098_883_1503	205
719	3300046455	Ga0495603_0012905	Ga0495603_0012905_2540_3157	205
720	3300046459	Ga0495629_0000102	Ga0495629_0000102_41439_42059	205
721	3300046459	Ga0495629_0057350	Ga0495629_0057350_1656_2273	205
722	3300046461	Ga0495641_0005447	Ga0495641_0005447_3935_4552	205
723	3300046461	Ga0495641_0025767	Ga0495641_0025767_617_1237	205
724	3300046461	Ga0495641_0191618	Ga0495641_0191618_140_757	205
725	3300046462	Ga0495651_0013099	Ga0495651_0013099_1169_1786	205
726	3300046462	Ga0495651_0108308	Ga0495651_0108308_28_645	205
727	3300046463	Ga0495653_0011679	Ga0495653_0011679_4242_4859	205
728	3300046463	Ga0495653_0019997	Ga0495653_0019997_349_966	205
729	3300046472	Ga0495580_0046307	Ga0495580_0046307_2252_2869	205
730	3300046473	Ga0495582_0007707	Ga0495582_0007707_4185_4802	205
731	3300046473	Ga0495582_0010411	Ga0495582_0010411_4399_5019	205
732	3300046473	Ga0495582_0079865	Ga0495582_0079865_893_1510	205
733	3300046473	Ga0495582_0336502	Ga0495582_0336502_68_685	205
734	3300046475	Ga0495639_0040344	Ga0495639_0040344_1099_1719	205
735	3300046475	Ga0495639_0089481	Ga0495639_0089481_218_835	205
736	3300046476	Ga0495662_0092320	Ga0495662_0092320_324_941	205
737	3300046477	Ga0495664_0011595	Ga0495664_0011595_2368_2985	205
738	3300046477	Ga0495664_0123542	Ga0495664_0123542_475_1092	205
739	3300046477	Ga0495664_0239378	Ga0495664_0239378_294_911	205
740	3300046491	Ga0495584_0012116	Ga0495584_0012116_1875_2492	205
741	3300046491	Ga0495584_0056730	Ga0495584_0056730_1224_1841	205
742	3300046492	Ga0495585_0002020	Ga0495585_0002020_12266_12883	205
743	3300046499	Ga0495594_0002542	Ga0495594_0002542_5011_5631	205
744	3300046499	Ga0495594_0066926	Ga0495594_0066926_47_664	205
745	3300046501	Ga0495607_0003567	Ga0495607_0003567_1992_2609	205
746	3300046511	Ga0495608_0003324	Ga0495608_0003324_4836_5453	205
747	3300046511	Ga0495608_0012743	Ga0495608_0012743_1655_2272	205
748	3300046511	Ga0495608_0061345	Ga0495608_0061345_1251_1868	205
749	3300046514	Ga0495618_0035161	Ga0495618_0035161_184_801	205
750	3300046514	Ga0495618_0184323	Ga0495618_0184323_424_1041	205
751	3300046514	Ga0495618_0199223	Ga0495618_0199223_76_693	205
752	3300046516	Ga0495628_0014477	Ga0495628_0014477_1506_2123	205
753	3300046516	Ga0495628_0035608	Ga0495628_0035608_342_959	205
754	3300046516	Ga0495628_0750946	Ga0495628_0750946_28_645	205
755	3300046517	Ga0495630_0097239	Ga0495630_0097239_569_1186	205
756	3300046517	Ga0495630_0099128	Ga0495630_0099128_821_1438	205
757	3300046517	Ga0495630_0110579	Ga0495630_0110579_462_1079	205
758	3300046520	Ga0495637_0043072	Ga0495637_0043072_568_1185	205
759	3300046520	Ga0495637_0062305	Ga0495637_0062305_767_1384	205
760	3300046523	Ga0495644_0017876	Ga0495644_0017876_1087_1704	205
761	3300046526	Ga0495666_0017957	Ga0495666_0017957_2681_3298	205
762	3300046529	Ga0495652_0074079	Ga0495652_0074079_182_799	205
763	3300046529	Ga0495652_0089339	Ga0495652_0089339_475_1092	205
764	3300046529	Ga0495652_0112615	Ga0495652_0112615_852_1469	205
765	3300046531	Ga0495665_0024627	Ga0495665_0024627_763_1380	205
766	3300046533	Ga0495640_0036665	Ga0495640_0036665_540_1157	205
767	3300046533	Ga0495640_0079588	Ga0495640_0079588_558_1175	205
768	3300046533	Ga0495640_0109063	Ga0495640_0109063_474_1091	205
769	3300046536	Ga0495587_0009191	Ga0495587_0009191_805_1422	205
770	3300046536	Ga0495587_0035256	Ga0495587_0035256_2202_2819	205
771	3300046536	Ga0495587_0109795	Ga0495587_0109795_670_1287	205
772	3300046537	Ga0495598_0004921	Ga0495598_0004921_2236_2853	205
773	3300046539	Ga0495621_0011395	Ga0495621_0011395_832_1449	205
774	3300046543	Ga0495645_0004024	Ga0495645_0004024_4853_5470	205
775	3300046557	Ga0495622_0007555	Ga0495622_0007555_3912_4529	205
776	3300046557	Ga0495622_0059816	Ga0495622_0059816_692_1309	205
777	3300046558	Ga0495633_0002150	Ga0495633_0002150_874_1491	205
778	3300046559	Ga0495667_0012321	Ga0495667_0012321_4595_5212	205
779	3300046559	Ga0495667_0014925	Ga0495667_0014925_1485_2102	205
780	3300046559	Ga0495667_0028586	Ga0495667_0028586_584_1201	205
781	3300046615	Ga0495656_0000939	Ga0495656_0000939_3868_4485	205
782	3300046642	Ga0495634_0034172	Ga0495634_0034172_467_1084	205
783	3300046642	Ga0495634_0238775	Ga0495634_0238775_402_1019	205
784	3300046642	Ga0495634_0402056	Ga0495634_0402056_133_750	205
785	3300046663	Ga0495635_0009765	Ga0495635_0009765_2395_3012	205
786	3300046663	Ga0495635_0024610	Ga0495635_0024610_2996_3613	205
787	3300046663	Ga0495635_0065761	Ga0495635_0065761_1552_2169	205
788	3300046664	Ga0495659_0001477	Ga0495659_0001477_4367_4984	205
789	3300046674	Ga0495588_0005328	Ga0495588_0005328_2902_3519	205
790	3300046674	Ga0495588_0196143	Ga0495588_0196143_64_681	205
791	3300046675	Ga0495657_0003904	Ga0495657_0003904_7855_8472	205
792	3300046675	Ga0495657_0029756	Ga0495657_0029756_901_1518	205
793	3300046675	Ga0495657_0169591	Ga0495657_0169591_170_787	205
794	3300046678	Ga0495599_0039750	Ga0495599_0039750_224_841	205
795	3300046678	Ga0495599_0103957	Ga0495599_0103957_806_1423	205
796	3300046678	Ga0495599_0183640	Ga0495599_0183640_334_951	205
797	3300046679	Ga0495623_0037873	Ga0495623_0037873_855_1472	205
798	3300046680	Ga0495646_0039063	Ga0495646_0039063_2162_2779	205
799	3300046681	Ga0495647_0034149	Ga0495647_0034149_298_918	205
800	3300046681	Ga0495647_0174829	Ga0495647_0174829_97_714	205
801	3300046683	Ga0495658_0000053	Ga0495658_0000053_31280_31900	205
802	3300046683	Ga0495658_0048023	Ga0495658_0048023_664_1281	205
803	3300046689	Ga0495613_0018289	Ga0495613_0018289_1817_2434	205
804	3300046691	Ga0495670_0007201	Ga0495670_0007201_568_1185	205
805	3300046794	Ga0495589_0239001	Ga0495589_0239001_94_711	205
806	3300046809	Ga0495600_0003597	Ga0495600_0003597_4593_5210	205
807	3300046809	Ga0495600_0052445	Ga0495600_0052445_1631_2248	205
808	3300046809	Ga0495600_0128158	Ga0495600_0128158_197_814	205
809	3300047315	Ga0495581_0048133	Ga0495581_0048133_381_998	205
810	3300047315	Ga0495581_0057553	Ga0495581_0057553_933_1553	205
811	3300047317	Ga0495604_0004585	Ga0495604_0004585_8866_9483	205
812	3300047317	Ga0495604_0117852	Ga0495604_0117852_800_1417	205
813	3300047317	Ga0495604_0247501	Ga0495604_0247501_475_1092	205
814	3300047319	Ga0495674_0024777	Ga0495674_0024777_4349_4966	205
815	3300047319	Ga0495674_0036339	Ga0495674_0036339_2489_3106	205
816	3300047319	Ga0495674_0423336	Ga0495674_0423336_430_1047	205
817	3300047319	Ga0495674_0580904	Ga0495674_0580904_247_864	205
818	3300047321	Ga0495676_0008276	Ga0495676_0008276_8622_9242	205
819	3300047322	Ga0495680_0008015	Ga0495680_0008015_8338_8955	205
820	3300047322	Ga0495680_0008693	Ga0495680_0008693_3436_4053	205
821	3300047322	Ga0495680_0014371	Ga0495680_0014371_4315_4935	205
822	3300047322	Ga0495680_0122529	Ga0495680_0122529_829_1446	205
823	3300047444	Ga0495675_0009014	Ga0495675_0009014_621_1238	205
824	3300047444	Ga0495675_0248636	Ga0495675_0248636_73_690	205
825	3300047444	Ga0495675_0286521	Ga0495675_0286521_123_740	205
826	3300047471	Ga0495684_0012614	Ga0495684_0012614_767_1384	205
827	3300047471	Ga0495684_0189227	Ga0495684_0189227_435_1052	205
828	3300047673	Ga0495593_0002525	Ga0495593_0002525_5866_6486	205
829	3300047673	Ga0495593_0067278	Ga0495593_0067278_429_1046	205
830	3300048088	Ga0495602_0015772	Ga0495602_0015772_702_1319	205
831	3300048088	Ga0495602_0023797	Ga0495602_0023797_4749_5366	205
832	3300048903	Ga0496100_0036429	Ga0496100_0036429_2223_2840	205
833	3300048903	Ga0496100_0093375	Ga0496100_0093375_370_990	205
834	3300048904	Ga0496101_0099523	Ga0496101_0099523_485_1105	205
835	3300048904	Ga0496101_0629951	Ga0496101_0629951_14_631	205
836	3300048905	Ga0496102_0202021	Ga0496102_0202021_249_869	205
837	3300048906	Ga0496103_0120236	Ga0496103_0120236_443_1063	205
838	3300048906	Ga0496103_0122157	Ga0496103_0122157_899_1516	205
839	3300048907	Ga0496104_0167090	Ga0496104_0167090_336_956	205
840	3300048907	Ga0496104_0284114	Ga0496104_0284114_15_632	205
841	3300048908	Ga0496105_0017055	Ga0496105_0017055_2906_3523	205
842	3300048908	Ga0496105_0169774	Ga0496105_0169774_1018_1638	205
843	3300048908	Ga0496105_0192184	Ga0496105_0192184_428_1048	205
844	3300048909	Ga0496106_0040217	Ga0496106_0040217_1868_2488	205
845	3300048909	Ga0496106_0067496	Ga0496106_0067496_356_973	205
846	3300048910	Ga0496107_0070452	Ga0496107_0070452_1820_2437	205
847	3300048910	Ga0496107_0132643	Ga0496107_0132643_151_771	205
848	3300048911	Ga0496108_0105362	Ga0496108_0105362_1580_2200	205
849	3300048911	Ga0496108_0324429	Ga0496108_0324429_14_631	205
850	3300048912	Ga0496109_0044865	Ga0496109_0044865_2494_3111	205
851	3300048912	Ga0496109_0049415	Ga0496109_0049415_2873_3493	205
852	3300048913	Ga0496110_0148935	Ga0496110_0148935_971_1603	205
853	3300048913	Ga0496110_0338720	Ga0496110_0338720_342_959	205
854	3300048914	Ga0496111_0050150	Ga0496111_0050150_1069_1689	205
855	3300048915	Ga0496112_0021405	Ga0496112_0021405_3087_3707	205
856	3300048916	Ga0496113_0051992	Ga0496113_0051992_1014_1634	205
857	3300048916	Ga0496113_0267649	Ga0496113_0267649_115_732	205
858	3300048917	Ga0496114_0170461	Ga0496114_0170461_208_828	205
859	3300048917	Ga0496114_0573939	Ga0496114_0573939_47_667	205
860	3300048918	Ga0496115_0116074	Ga0496115_0116074_1246_1866	205
861	3300049571	Ga0501034_0009593	Ga0501034_0009593_1490_2110	205
862	3300049579	Ga0501043_0251280	Ga0501043_0251280_26_643	205
863	3300049589	Ga0501073_0297158	Ga0501073_0297158_231_851	205
864	3300049590	Ga0501074_0069944	Ga0501074_0069944_647_1264	205
865	3300049590	Ga0501074_0672764	Ga0501074_0672764_84_701	205
866	3300049591	Ga0501075_0386644	Ga0501075_0386644_374_991	205
867	3300049592	Ga0501076_0171422	Ga0501076_0171422_52_669	205
868	3300049741	Ga0501079_0129096	Ga0501079_0129096_432_1052	205
869	3300049743	Ga0501081_0161606	Ga0501081_0161606_101_718	205
870	3300049823	Ga0501044_0029864	Ga0501044_0029864_4551_5168	205
871	3300049823	Ga0501044_0523173	Ga0501044_0523173_120_737	205
872	3300050493	nmdc:mga0k408_227623_c1	nmdc:mga0k408_227623_c1_315_938	205
873	3300050496	nmdc:mga07m45_248705_c1	nmdc:mga07m45_248705_c1_132_764	205
874	3300050507	nmdc:mga05p37_250_c1	nmdc:mga05p37_250_c1_1392_2009	205
875	3300050507	nmdc:mga05p37_48218_c1	nmdc:mga05p37_48218_c1_2356_2973	205
876	3300050508	nmdc:mga09592_3818_c1	nmdc:mga09592_3818_c1_5743_6360	205
877	3300050509	nmdc:mga0qj67_18592_c1	nmdc:mga0qj67_18592_c1_2403_3164	205
878	3300050509	nmdc:mga0qj67_655_c1	nmdc:mga0qj67_655_c1_21907_22524	205
879	3300050509	nmdc:mga0qj67_99221_c1	nmdc:mga0qj67_99221_c1_1135_1752	205
880	3300050510	nmdc:mga06r32_1213_c1	nmdc:mga06r32_1213_c1_3336_3953	205
881	3300050510	nmdc:mga06r32_156305_c1	nmdc:mga06r32_156305_c1_512_1273	205
882	3300050510	nmdc:mga06r32_288170_c1	nmdc:mga06r32_288170_c1_71_688	205
883	3300050511	nmdc:mga08y16_314706_c1	nmdc:mga08y16_314706_c1_175_795	205
884	3300050511	nmdc:mga08y16_3357_c1	nmdc:mga08y16_3357_c1_12589_13206	205
885	3300050512	nmdc:mga0n895_176261_c1	nmdc:mga0n895_176261_c1_812_1432	205
886	3300050512	nmdc:mga0n895_447_c1	nmdc:mga0n895_447_c1_1877_2494	205
887	3300050513	nmdc:mga0rr50_1028759_c1	nmdc:mga0rr50_1028759_c1_31_648	205
888	3300050513	nmdc:mga0rr50_118588_c1	nmdc:mga0rr50_118588_c1_1234_1851	205
889	3300050513	nmdc:mga0rr50_41247_c1	nmdc:mga0rr50_41247_c1_738_1358	205
890	3300050513	nmdc:mga0rr50_4596_c1	nmdc:mga0rr50_4596_c1_2868_3485	205
891	3300050513	nmdc:mga0rr50_55106_c1	nmdc:mga0rr50_55106_c1_1107_1727	205
892	3300050514	nmdc:mga08x19_2061_c1	nmdc:mga08x19_2061_c1_6178_6795	205
893	3300050514	nmdc:mga08x19_55363_c1	nmdc:mga08x19_55363_c1_966_1583	205
894	3300050514	nmdc:mga08x19_711250_c1	nmdc:mga08x19_711250_c1_28_645	205
895	3300050515	nmdc:mga0a205_25607_c1	nmdc:mga0a205_25607_c1_3926_4543	205
896	3300050515	nmdc:mga0a205_306016_c1	nmdc:mga0a205_306016_c1_512_1132	205
897	3300050515	nmdc:mga0a205_597169_c1	nmdc:mga0a205_597169_c1_74_691	205
898	3300050515	nmdc:mga0a205_859_c1	nmdc:mga0a205_859_c1_19396_20013	205
899	3300053077	Ga0495601_0000422	Ga0495601_0000422_7230_7847	205
900	3300053077	Ga0495601_0000772	Ga0495601_0000772_7513_8130	205
901	3300053077	Ga0495601_0005028	Ga0495601_0005028_4696_5313	205
902	3300053078	Ga0495612_0012925	Ga0495612_0012925_2025_2642	205
903	3300053078	Ga0495612_0050538	Ga0495612_0050538_324_941	205
904	3300053078	Ga0495612_0071520	Ga0495612_0071520_282_899	205
905	3300053078	Ga0495612_0139607	Ga0495612_0139607_125_742	205
906	3300053084	Ga0495595_0000211	Ga0495595_0000211_15801_16418	205
907	3300053084	Ga0495595_0000303	Ga0495595_0000303_9569_10186	205
908	3300053084	Ga0495595_0000743	Ga0495595_0000743_7579_8196	205
909	3300053084	Ga0495595_0001054	Ga0495595_0001054_8835_9452	205
910	3300053084	Ga0495595_0064986	Ga0495595_0064986_40_657	205
911	3300053085	Ga0495619_0000521	Ga0495619_0000521_20353_20973	205
912	3300053085	Ga0495619_0002784	Ga0495619_0002784_8175_8792	205
913	3300053085	Ga0495619_0008310	Ga0495619_0008310_1890_2507	205
914	3300053085	Ga0495619_0170408	Ga0495619_0170408_222_839	205
915	3300053085	Ga0495619_0320184	Ga0495619_0320184_430_1047	205
916	3300053090	Ga0500646_0104556	Ga0500646_0104556_14_643	205
917	3300053153	Ga0500616_0145230	Ga0500616_0145230_354_986	205
918	3300060353	Ga0501082_0296890	Ga0501082_0296890_131_760	205
919	3300003659	JGI25404J52841_10012331	JGI25404J52841_100123312	206
920	3300005336	Ga0070680_100096477	Ga0070680_1000964773	206
921	3300005455	Ga0070663_100003326	Ga0070663_1000033263	206
922	3300005458	Ga0070681_10693773	Ga0070681_106937732	206
923	3300005530	Ga0070679_100050724	Ga0070679_1000507244	206
924	3300005530	Ga0070679_100539242	Ga0070679_1005392422	206
925	3300005548	Ga0070665_100414516	Ga0070665_1004145162	206
926	3300005563	Ga0068855_100556205	Ga0068855_1005562052	206
927	3300005614	Ga0068856_100158695	Ga0068856_1001586952	206
928	3300005615	Ga0070702_100063076	Ga0070702_1000630762	206
929	3300005616	Ga0068852_100638344	Ga0068852_1006383441	206
930	3300005937	Ga0081455_10000031	Ga0081455_1000003190	206
931	3300005983	Ga0081540_1000054	Ga0081540_100005458	206
932	3300006163	Ga0070715_10178276	Ga0070715_101782762	206
933	3300006173	Ga0070716_100391227	Ga0070716_1003912272	206
934	3300006846	Ga0075430_100000194	Ga0075430_10000019437	206
935	3300006871	Ga0075434_100650934	Ga0075434_1006509342	206
936	3300006881	Ga0068865_100070534	Ga0068865_1000705342	206
937	3300007076	Ga0075435_100071289	Ga0075435_1000712892	206
938	3300009098	Ga0105245_10078738	Ga0105245_100787382	206
939	3300011119	Ga0105246_10029907	Ga0105246_100299073	206
940	3300013296	Ga0157374_10030704	Ga0157374_100307045	206
941	3300013308	Ga0157375_10010016	Ga0157375_100100163	206
942	3300014325	Ga0163163_10005500	Ga0163163_100055003	206
943	3300014969	Ga0157376_10064745	Ga0157376_100647453	206
944	3300021384	Ga0213876_10135439	Ga0213876_101354392	206
945	3300024227	Ga0228598_1002263	Ga0228598_10022632	206
946	3300025904	Ga0207647_10109577	Ga0207647_101095771	206
947	3300025912	Ga0207707_10509759	Ga0207707_105097592	206
948	3300025919	Ga0207657_10306506	Ga0207657_103065062	206
949	3300025921	Ga0207652_10035704	Ga0207652_100357045	206
950	3300025922	Ga0207646_10317702	Ga0207646_103177022	206
951	3300025927	Ga0207687_10123763	Ga0207687_101237632	206
952	3300025939	Ga0207665_10137776	Ga0207665_101377762	206
953	3300025939	Ga0207665_10515555	Ga0207665_105155551	206
954	3300025944	Ga0207661_10380940	Ga0207661_103809402	206
955	3300026067	Ga0207678_10005996	Ga0207678_100059967	206
956	3300026095	Ga0207676_10142838	Ga0207676_101428382	206
957	3300028379	Ga0268266_10415861	Ga0268266_104158612	206
958	3300031235	Ga0265330_10243349	Ga0265330_102433491	206
959	3300031344	Ga0265316_10029986	Ga0265316_100299866	206
960	3300035086	Ga0373934_0030583	Ga0373934_0030583_228_851	206
961	3300035089	Ga0373944_0059174	Ga0373944_0059174_308_958	206
962	3300035111	Ga0373923_0002471	Ga0373923_0002471_4394_5044	206
963	3300035111	Ga0373923_0103619	Ga0373923_0103619_200_823	206
964	3300035113	Ga0373936_0000612	Ga0373936_0000612_5012_5662	206
965	3300035113	Ga0373936_0046215	Ga0373936_0046215_400_1023	206
966	3300035114	Ga0373939_0026296	Ga0373939_0026296_874_1512	206
967	3300035116	Ga0373945_0064766	Ga0373945_0064766_669_1319	206
968	3300035117	Ga0373953_0005438	Ga0373953_0005438_3116_3766	206
969	3300035117	Ga0373953_0107955	Ga0373953_0107955_481_1104	206
970	3300035118	Ga0373954_0006450	Ga0373954_0006450_2174_2824	206
971	3300035118	Ga0373954_0015182	Ga0373954_0015182_357_980	206
972	3300035118	Ga0373954_0104082	Ga0373954_0104082_214_837	206
973	3300035119	Ga0373956_0035733	Ga0373956_0035733_1468_2118	206
974	3300035119	Ga0373956_0067714	Ga0373956_0067714_592_1215	206
975	3300035120	Ga0373957_0017555	Ga0373957_0017555_449_1099	206
976	3300035170	Ga0373943_0095360	Ga0373943_0095360_212_835	206
977	3300035170	Ga0373943_0142593	Ga0373943_0142593_155_778	206
978	3300035171	Ga0373946_0002102	Ga0373946_0002102_4538_5188	206
979	3300035171	Ga0373946_0087128	Ga0373946_0087128_407_1030	206
980	3300035172	Ga0373955_0006843	Ga0373955_0006843_3187_3837	206
981	3300035172	Ga0373955_0044068	Ga0373955_0044068_869_1492	206
982	3300035410	Ga0373924_0000296	Ga0373924_0000296_7468_8118	206
983	3300035410	Ga0373924_0076590	Ga0373924_0076590_783_1406	206
984	3300035692	Ga0373935_0000484	Ga0373935_0000484_2100_2750	206
985	3300035692	Ga0373935_0132142	Ga0373935_0132142_44_667	206
986	3300035692	Ga0373935_0170588	Ga0373935_0170588_520_1143	206
987	3300035695	Ga0373927_0012550	Ga0373927_0012550_697_1329	206
988	3300035724	Ga0373933_0002087	Ga0373933_0002087_6613_7263	206
989	3300035724	Ga0373933_0006665	Ga0373933_0006665_1368_1991	206
990	3300035724	Ga0373933_0157016	Ga0373933_0157016_463_1086	206
991	3300035725	Ga0373947_0048738	Ga0373947_0048738_1195_1818	206
992	3300035725	Ga0373947_0061037	Ga0373947_0061037_1643_2266	206
993	3300036401	Ga0373937_0000058	Ga0373937_0000058_70163_70813	206
994	3300036401	Ga0373937_0006720	Ga0373937_0006720_2251_2874	206
995	3300036401	Ga0373937_0483965	Ga0373937_0483965_213_836	206
996	3300037068	Ga0373925_0000036	Ga0373925_0000036_15251_15901	206
997	3300037068	Ga0373925_0024734	Ga0373925_0024734_3043_3675	206
998	3300037068	Ga0373925_0187903	Ga0373925_0187903_205_828	206
999	3300037312	Ga0395899_0124488	Ga0395899_0124488_793_1419	206
1000	3300037418	Ga0395900_0003699	Ga0395900_0003699_6604_7230	206
1001	3300037418	Ga0395900_0015404	Ga0395900_0015404_2823_3509	206
1002	3300037466	Ga0395898_0024894	Ga0395898_0024894_4740_5366	206
1003	3300038443	Ga0395901_0300451	Ga0395901_0300451_262_948	206
1004	3300038443	Ga0395901_0328311	Ga0395901_0328311_118_750	206
1005	3300038443	Ga0395901_0541443	Ga0395901_0541443_360_1070	206
1006	3300039437	Ga0436365_0689813	Ga0436365_0689813_518_1141	206
1007	3300046454	Ga0495592_0000232	Ga0495592_0000232_35744_36394	206
1008	3300046454	Ga0495592_0007647	Ga0495592_0007647_498_1121	206
1009	3300046454	Ga0495592_0241754	Ga0495592_0241754_446_1069	206
1010	3300046455	Ga0495603_0350607	Ga0495603_0350607_79_702	206
1011	3300046455	Ga0495603_0462026	Ga0495603_0462026_10_660	206
1012	3300046459	Ga0495629_0007419	Ga0495629_0007419_4774_5397	206
1013	3300046459	Ga0495629_0109721	Ga0495629_0109721_552_1184	206
1014	3300046459	Ga0495629_0139332	Ga0495629_0139332_848_1471	206
1015	3300046461	Ga0495641_0202680	Ga0495641_0202680_145_768	206
1016	3300046462	Ga0495651_0001333	Ga0495651_0001333_15807_16457	206
1017	3300046462	Ga0495651_0007663	Ga0495651_0007663_7082_7705	206
1018	3300046462	Ga0495651_0017316	Ga0495651_0017316_1238_1861	206
1019	3300046463	Ga0495653_0000069	Ga0495653_0000069_12910_13560	206
1020	3300046463	Ga0495653_0106637	Ga0495653_0106637_1178_1801	206
1021	3300046472	Ga0495580_0115564	Ga0495580_0115564_764_1387	206
1022	3300046472	Ga0495580_0342721	Ga0495580_0342721_90_713	206
1023	3300046473	Ga0495582_0031945	Ga0495582_0031945_1731_2354	206
1024	3300046476	Ga0495662_0000613	Ga0495662_0000613_6428_7078	206
1025	3300046476	Ga0495662_0021690	Ga0495662_0021690_274_906	206
1026	3300046476	Ga0495662_0062958	Ga0495662_0062958_224_847	206
1027	3300046477	Ga0495664_0000010	Ga0495664_0000010_28202_28852	206
1028	3300046477	Ga0495664_0002644	Ga0495664_0002644_4776_5399	206
1029	3300046511	Ga0495608_0000008	Ga0495608_0000008_239797_240447	206
1030	3300046511	Ga0495608_0004292	Ga0495608_0004292_7272_7895	206
1031	3300046511	Ga0495608_0030360	Ga0495608_0030360_3007_3630	206
1032	3300046514	Ga0495618_0000002	Ga0495618_0000002_30475_31125	206
1033	3300046514	Ga0495618_0012275	Ga0495618_0012275_3579_4202	206
1034	3300046514	Ga0495618_0022324	Ga0495618_0022324_1276_1899	206
1035	3300046514	Ga0495618_0158907	Ga0495618_0158907_576_1208	206
1036	3300046516	Ga0495628_0000009	Ga0495628_0000009_28230_28880	206
1037	3300046516	Ga0495628_0148000	Ga0495628_0148000_353_976	206
1038	3300046516	Ga0495628_0360381	Ga0495628_0360381_30_653	206
1039	3300046517	Ga0495630_0001382	Ga0495630_0001382_1971_2621	206
1040	3300046517	Ga0495630_0605166	Ga0495630_0605166_29_652	206
1041	3300046529	Ga0495652_0000011	Ga0495652_0000011_239487_240137	206
1042	3300046529	Ga0495652_0009380	Ga0495652_0009380_4771_5394	206
1043	3300046533	Ga0495640_0000009	Ga0495640_0000009_188239_188889	206
1044	3300046533	Ga0495640_0006806	Ga0495640_0006806_4557_5180	206
1045	3300046533	Ga0495640_0094304	Ga0495640_0094304_862_1494	206
1046	3300046535	Ga0495586_0116411	Ga0495586_0116411_837_1469	206
1047	3300046536	Ga0495587_0000006	Ga0495587_0000006_141948_142598	206
1048	3300046536	Ga0495587_0007663	Ga0495587_0007663_1632_2255	206
1049	3300046536	Ga0495587_0036541	Ga0495587_0036541_1612_2235	206
1050	3300046543	Ga0495645_0000010	Ga0495645_0000010_208860_209510	206
1051	3300046543	Ga0495645_0015026	Ga0495645_0015026_27_650	206
1052	3300046559	Ga0495667_0000005	Ga0495667_0000005_28230_28880	206
1053	3300046559	Ga0495667_0002463	Ga0495667_0002463_7183_7806	206
1054	3300046559	Ga0495667_0153059	Ga0495667_0153059_399_1022	206
1055	3300046642	Ga0495634_0000055	Ga0495634_0000055_28218_28868	206
1056	3300046642	Ga0495634_0011979	Ga0495634_0011979_1134_1757	206
1057	3300046642	Ga0495634_0044077	Ga0495634_0044077_1498_2130	206
1058	3300046663	Ga0495635_0000008	Ga0495635_0000008_239470_240120	206
1059	3300046663	Ga0495635_0002563	Ga0495635_0002563_7213_7836	206
1060	3300046663	Ga0495635_0059165	Ga0495635_0059165_1283_1906	206
1061	3300046675	Ga0495657_0000470	Ga0495657_0000470_30503_31153	206
1062	3300046675	Ga0495657_0004733	Ga0495657_0004733_3182_3805	206
1063	3300046678	Ga0495599_0000250	Ga0495599_0000250_2848_3498	206
1064	3300046678	Ga0495599_0041146	Ga0495599_0041146_1126_1749	206
1065	3300046679	Ga0495623_0000004	Ga0495623_0000004_63895_64545	206
1066	3300046679	Ga0495623_0003416	Ga0495623_0003416_2721_3344	206
1067	3300046679	Ga0495623_0070345	Ga0495623_0070345_1291_1914	206
1068	3300046680	Ga0495646_0000040	Ga0495646_0000040_42489_43139	206
1069	3300046680	Ga0495646_0007106	Ga0495646_0007106_5934_6557	206
1070	3300046680	Ga0495646_0216460	Ga0495646_0216460_64_687	206
1071	3300046689	Ga0495613_0055179	Ga0495613_0055179_1235_1885	206
1072	3300046689	Ga0495613_0352440	Ga0495613_0352440_351_974	206
1073	3300046690	Ga0495624_0013728	Ga0495624_0013728_4829_5479	206
1074	3300046809	Ga0495600_0000080	Ga0495600_0000080_28219_28869	206
1075	3300046809	Ga0495600_0004877	Ga0495600_0004877_80_703	206
1076	3300046809	Ga0495600_0011591	Ga0495600_0011591_1844_2467	206
1077	3300047315	Ga0495581_0014143	Ga0495581_0014143_97_720	206
1078	3300047315	Ga0495581_0198328	Ga0495581_0198328_408_1040	206
1079	3300047317	Ga0495604_0000012	Ga0495604_0000012_28217_28867	206
1080	3300047317	Ga0495604_0004069	Ga0495604_0004069_3594_4217	206
1081	3300047317	Ga0495604_0021904	Ga0495604_0021904_1000_1623	206
1082	3300047319	Ga0495674_0000011	Ga0495674_0000011_30503_31153	206
1083	3300047319	Ga0495674_0009544	Ga0495674_0009544_3833_4456	206
1084	3300047319	Ga0495674_0192540	Ga0495674_0192540_915_1538	206
1085	3300047321	Ga0495676_0056654	Ga0495676_0056654_230_853	206
1086	3300047322	Ga0495680_0001797	Ga0495680_0001797_9078_9728	206
1087	3300047322	Ga0495680_0014554	Ga0495680_0014554_1346_1969	206
1088	3300047322	Ga0495680_0192985	Ga0495680_0192985_155_778	206
1089	3300047444	Ga0495675_0000254	Ga0495675_0000254_36314_36964	206
1090	3300047444	Ga0495675_0024904	Ga0495675_0024904_2381_3004	206
1091	3300047471	Ga0495684_0000014	Ga0495684_0000014_28219_28869	206
1092	3300047471	Ga0495684_0006501	Ga0495684_0006501_7274_7897	206
1093	3300047673	Ga0495593_0008094	Ga0495593_0008094_5005_5655	206
1094	3300047673	Ga0495593_0087817	Ga0495593_0087817_132_755	206
1095	3300048088	Ga0495602_0000019	Ga0495602_0000019_28195_28845	206
1096	3300048088	Ga0495602_0012673	Ga0495602_0012673_996_1619	206
1097	3300048088	Ga0495602_0052349	Ga0495602_0052349_2791_3414	206
1098	3300048903	Ga0496100_0009825	Ga0496100_0009825_1052_1702	206
1099	3300048903	Ga0496100_0365707	Ga0496100_0365707_299_1015	206
1100	3300048904	Ga0496101_0011060	Ga0496101_0011060_2703_3353	206
1101	3300048904	Ga0496101_0033437	Ga0496101_0033437_1594_2310	206
1102	3300048905	Ga0496102_0002835	Ga0496102_0002835_3761_4411	206
1103	3300048905	Ga0496102_0016499	Ga0496102_0016499_4897_5613	206
1104	3300048907	Ga0496104_0109874	Ga0496104_0109874_1663_2379	206
1105	3300048907	Ga0496104_0330497	Ga0496104_0330497_292_942	206
1106	3300048908	Ga0496105_0012184	Ga0496105_0012184_4946_5596	206
1107	3300048908	Ga0496105_0472140	Ga0496105_0472140_152_775	206
1108	3300048909	Ga0496106_0006735	Ga0496106_0006735_5596_6312	206
1109	3300048909	Ga0496106_0249974	Ga0496106_0249974_288_938	206
1110	3300048909	Ga0496106_0697856	Ga0496106_0697856_81_737	206
1111	3300048910	Ga0496107_0003073	Ga0496107_0003073_7842_8558	206
1112	3300048910	Ga0496107_0004490	Ga0496107_0004490_7711_8361	206
1113	3300048910	Ga0496107_0008959	Ga0496107_0008959_4421_5077	206
1114	3300048911	Ga0496108_0004947	Ga0496108_0004947_2114_2830	206
1115	3300048911	Ga0496108_0214188	Ga0496108_0214188_979_1629	206
1116	3300048912	Ga0496109_0045255	Ga0496109_0045255_2542_3192	206
1117	3300048912	Ga0496109_0086293	Ga0496109_0086293_1437_2153	206
1118	3300048913	Ga0496110_0008615	Ga0496110_0008615_955_1671	206
1119	3300048914	Ga0496111_0003565	Ga0496111_0003565_6619_7335	206
1120	3300048914	Ga0496111_0121838	Ga0496111_0121838_802_1452	206
1121	3300048915	Ga0496112_0180239	Ga0496112_0180239_911_1627	206
1122	3300048915	Ga0496112_0271110	Ga0496112_0271110_281_931	206
1123	3300048916	Ga0496113_0064168	Ga0496113_0064168_1359_2009	206
1124	3300048916	Ga0496113_0533632	Ga0496113_0533632_172_795	206
1125	3300048917	Ga0496114_0219366	Ga0496114_0219366_221_937	206
1126	3300048918	Ga0496115_0007278	Ga0496115_0007278_5435_6085	206
1127	3300048924	Ga0496121_0001149	Ga0496121_0001149_24481_25137	206
1128	3300048929	Ga0496126_0020392	Ga0496126_0020392_5078_5734	206
1129	3300049569	Ga0501032_0007744	Ga0501032_0007744_6906_7544	206
1130	3300049569	Ga0501032_0022282	Ga0501032_0022282_1361_2041	206
1131	3300049569	Ga0501032_0066827	Ga0501032_0066827_902_1531	206
1132	3300049570	Ga0501033_0000207	Ga0501033_0000207_52784_53464	206
1133	3300049570	Ga0501033_0277169	Ga0501033_0277169_482_1132	206
1134	3300049571	Ga0501034_0031861	Ga0501034_0031861_2760_3410	206
1135	3300049571	Ga0501034_0041386	Ga0501034_0041386_366_1004	206
1136	3300049571	Ga0501034_0055124	Ga0501034_0055124_963_1637	206
1137	3300049571	Ga0501034_0155959	Ga0501034_0155959_1157_1837	206
1138	3300049571	Ga0501034_0355806	Ga0501034_0355806_381_1031	206
1139	3300049572	Ga0501036_0011440	Ga0501036_0011440_3891_4529	206
1140	3300049572	Ga0501036_0062332	Ga0501036_0062332_1331_1981	206
1141	3300049572	Ga0501036_0234243	Ga0501036_0234243_592_1272	206
1142	3300049573	Ga0501037_0006669	Ga0501037_0006669_398_1078	206
1143	3300049573	Ga0501037_0115667	Ga0501037_0115667_757_1407	206
1144	3300049573	Ga0501037_0335183	Ga0501037_0335183_232_870	206
1145	3300049574	Ga0501038_0016142	Ga0501038_0016142_717_1355	206
1146	3300049574	Ga0501038_0346524	Ga0501038_0346524_324_1004	206
1147	3300049575	Ga0501039_0013351	Ga0501039_0013351_4796_5434	206
1148	3300049575	Ga0501039_0085965	Ga0501039_0085965_1109_1789	206
1149	3300049576	Ga0501040_0251454	Ga0501040_0251454_415_1053	206
1150	3300049577	Ga0501041_0022480	Ga0501041_0022480_1360_2040	206
1151	3300049578	Ga0501042_0070361	Ga0501042_0070361_12_650	206
1152	3300049578	Ga0501042_0091344	Ga0501042_0091344_397_1077	206
1153	3300049579	Ga0501043_0008031	Ga0501043_0008031_5332_6012	206
1154	3300049579	Ga0501043_0008468	Ga0501043_0008468_2893_3543	206
1155	3300049579	Ga0501043_0054014	Ga0501043_0054014_919_1557	206
1156	3300049580	Ga0501046_0149957	Ga0501046_0149957_584_1222	206
1157	3300049581	Ga0501047_0025713	Ga0501047_0025713_459_1109	206
1158	3300049581	Ga0501047_0219118	Ga0501047_0219118_538_1176	206
1159	3300049582	Ga0501048_0011685	Ga0501048_0011685_3570_4208	206
1160	3300049583	Ga0501067_0009573	Ga0501067_0009573_2161_2799	206
1161	3300049584	Ga0501068_0173626	Ga0501068_0173626_527_1177	206
1162	3300049585	Ga0501069_0005740	Ga0501069_0005740_321_959	206
1163	3300049585	Ga0501069_0325050	Ga0501069_0325050_143_859	206
1164	3300049586	Ga0501070_0091614	Ga0501070_0091614_790_1428	206
1165	3300049587	Ga0501071_0085978	Ga0501071_0085978_844_1482	206
1166	3300049588	Ga0501072_0011471	Ga0501072_0011471_2022_2657	206
1167	3300049588	Ga0501072_0351454	Ga0501072_0351454_218_868	206
1168	3300049589	Ga0501073_0025323	Ga0501073_0025323_2064_2702	206
1169	3300049590	Ga0501074_0035152	Ga0501074_0035152_175_813	206
1170	3300049591	Ga0501075_0009087	Ga0501075_0009087_4287_4922	206
1171	3300049592	Ga0501076_0014998	Ga0501076_0014998_959_1594	206
1172	3300049592	Ga0501076_0321686	Ga0501076_0321686_371_1051	206
1173	3300049593	Ga0501077_0073308	Ga0501077_0073308_183_818	206
1174	3300049593	Ga0501077_0220041	Ga0501077_0220041_503_1141	206
1175	3300049741	Ga0501079_0023956	Ga0501079_0023956_1090_1725	206
1176	3300049741	Ga0501079_0075943	Ga0501079_0075943_175_813	206
1177	3300049742	Ga0501080_0125474	Ga0501080_0125474_1725_2363	206
1178	3300049742	Ga0501080_0355658	Ga0501080_0355658_501_1151	206
1179	3300049744	Ga0501083_0023985	Ga0501083_0023985_2578_3216	206
1180	3300049822	Ga0501035_0013984	Ga0501035_0013984_154_834	206
1181	3300049822	Ga0501035_0050333	Ga0501035_0050333_1738_2388	206
1182	3300049822	Ga0501035_0060468	Ga0501035_0060468_288_968	206
1183	3300049823	Ga0501044_0000243	Ga0501044_0000243_37433_38107	206
1184	3300049823	Ga0501044_0031958	Ga0501044_0031958_2482_3162	206
1185	3300049823	Ga0501044_0361470	Ga0501044_0361470_15_653	206
1186	3300050509	nmdc:mga0qj67_103_c1	nmdc:mga0qj67_103_c1_33114_33833	206
1187	3300050512	nmdc:mga0n895_612652_c1	nmdc:mga0n895_612652_c1_157_777	206
1188	3300050513	nmdc:mga0rr50_44740_c1	nmdc:mga0rr50_44740_c1_761_1381	206
1189	3300053077	Ga0495601_0000009	Ga0495601_0000009_239470_240120	206
1190	3300053078	Ga0495612_0000021	Ga0495612_0000021_28109_28759	206
1191	3300053078	Ga0495612_0003466	Ga0495612_0003466_1346_1969	206
1192	3300053078	Ga0495612_0090252	Ga0495612_0090252_126_749	206
1193	3300053084	Ga0495595_0000067	Ga0495595_0000067_31189_31839	206
1194	3300053084	Ga0495595_0001057	Ga0495595_0001057_5389_6012	206
1195	3300053084	Ga0495595_0102066	Ga0495595_0102066_43_666	206
1196	3300053085	Ga0495619_0000012	Ga0495619_0000012_239470_240120	206
1197	3300053085	Ga0495619_0012331	Ga0495619_0012331_3579_4202	206
1198	3300053085	Ga0495619_0026602	Ga0495619_0026602_798_1421	206
1199	3300054114	Ga0501084_0036335	Ga0501084_0036335_150_788	206
1200	3300054114	Ga0501084_0073315	Ga0501084_0073315_1302_1937	206
1201	3300060353	Ga0501082_0122204	Ga0501082_0122204_14_652	206
1202	3300060353	Ga0501082_0150337	Ga0501082_0150337_19_654	206
1203	3300061734	Ga0530510_0052606	Ga0530510_0052606_1426_2061	206
1204	2162886007	SwRhRL2b_contig_3287434	SwRhRL2b_0901.00002470	207
1205	2209111006	2214600488	2213637864	207
1206	3300000041	ARcpr5oldR_c000222	ARcpr5oldR_00022211	207
1207	3300000042	ARSoilYngRDRAFT_c00010	ARSoilYngRDRAFT_0001025	207
1208	3300000043	ARcpr5yngRDRAFT_c000093	ARcpr5yngRDRAFT_00009311	207
1209	3300000044	ARSoilOldRDRAFT_c000080	ARSoilOldRDRAFT_0000802	207
1210	3300000045	ARCol0oldRDRAFT_c00686	ARCol0oldRDRAFT_006862	207
1211	3300000652	ARCol0yngRDRAFT_1000022	ARCol0yngRDRAFT_10000222	207
1212	3300001430	JGI24032J14994_100604	JGI24032J14994_1006042	207
1213	3300001977	JGI24746J21847_1003802	JGI24746J21847_10038023	207
1214	3300001977	JGI24746J21847_1004575	JGI24746J21847_10045751	207
1215	3300001978	JGI24747J21853_1002452	JGI24747J21853_10024522	207
1216	3300001979	JGI24740J21852_10050712	JGI24740J21852_100507122	207
1217	3300001989	JGI24739J22299_10000539	JGI24739J22299_100005394	207
1218	3300001989	JGI24739J22299_10048556	JGI24739J22299_100485561	207
1219	3300001989	JGI24739J22299_10097558	JGI24739J22299_100975581	207
1220	3300001990	JGI24737J22298_10002650	JGI24737J22298_100026502	207
1221	3300001990	JGI24737J22298_10010457	JGI24737J22298_100104574	207
1222	3300001990	JGI24737J22298_10045760	JGI24737J22298_100457602	207
1223	3300001991	JGI24743J22301_10011280	JGI24743J22301_100112802	207
1224	3300001991	JGI24743J22301_10026349	JGI24743J22301_100263492	207
1225	3300002070	JGI24750J21931_1000402	JGI24750J21931_10004023	207
1226	3300002070	JGI24750J21931_1000884	JGI24750J21931_10008846	207
1227	3300002070	JGI24750J21931_1016876	JGI24750J21931_10168761	207
1228	3300002073	JGI24745J21846_1005069	JGI24745J21846_10050692	207
1229	3300002073	JGI24745J21846_1006343	JGI24745J21846_10063432	207
1230	3300002074	JGI24748J21848_1015384	JGI24748J21848_10153841	207
1231	3300002075	JGI24738J21930_10001742	JGI24738J21930_100017423	207
1232	3300002075	JGI24738J21930_10031001	JGI24738J21930_100310012	207
1233	3300002076	JGI24749J21850_1003479	JGI24749J21850_10034792	207
1234	3300002076	JGI24749J21850_1007144	JGI24749J21850_10071442	207
1235	3300002076	JGI24749J21850_1007337	JGI24749J21850_10073372	207
1236	3300002077	JGI24744J21845_10003391	JGI24744J21845_100033912	207
1237	3300002077	JGI24744J21845_10005129	JGI24744J21845_100051292	207
1238	3300002126	JGI24035J26624_1000173	JGI24035J26624_10001732	207
1239	3300002155	JGI24033J26618_1001249	JGI24033J26618_10012494	207
1240	3300002239	JGI24034J26672_10001474	JGI24034J26672_100014743	207
1241	3300002239	JGI24034J26672_10025504	JGI24034J26672_100255042	207
1242	3300002244	JGI24742J22300_10000012	JGI24742J22300_1000001220	207
1243	3300002244	JGI24742J22300_10000673	JGI24742J22300_100006732	207
1244	3300002244	JGI24742J22300_10020645	JGI24742J22300_100206451	207
1245	3300003911	JGI25405J52794_10028385	JGI25405J52794_100283851	207
1246	3300005276	Ga0065717_1004624	Ga0065717_10046241	207
1247	3300005277	Ga0065716_1001772	Ga0065716_10017722	207
1248	3300005288	Ga0065714_10213331	Ga0065714_102133311	207
1249	3300005289	Ga0065704_10144703	Ga0065704_101447032	207
1250	3300005290	Ga0065712_10069764	Ga0065712_100697644	207
1251	3300005290	Ga0065712_10072063	Ga0065712_100720632	207
1252	3300005293	Ga0065715_10000686	Ga0065715_100006862	207
1253	3300005293	Ga0065715_10000980	Ga0065715_100009802	207
1254	3300005295	Ga0065707_10152779	Ga0065707_101527792	207
1255	3300005328	Ga0070676_10000530	Ga0070676_1000053014	207
1256	3300005328	Ga0070676_10284390	Ga0070676_102843902	207
1257	3300005329	Ga0070683_100001367	Ga0070683_10000136714	207
1258	3300005330	Ga0070690_100001241	Ga0070690_1000012414	207
1259	3300005331	Ga0070670_100003506	Ga0070670_1000035064	207
1260	3300005331	Ga0070670_100024267	Ga0070670_1000242674	207
1261	3300005331	Ga0070670_100096269	Ga0070670_1000962692	207
1262	3300005331	Ga0070670_100133465	Ga0070670_1001334653	207
1263	3300005333	Ga0070677_10000032	Ga0070677_1000003237	207
1264	3300005333	Ga0070677_10058138	Ga0070677_100581382	207
1265	3300005334	Ga0068869_100000009	Ga0068869_10000000986	207
1266	3300005334	Ga0068869_100139006	Ga0068869_1001390062	207
1267	3300005334	Ga0068869_100229161	Ga0068869_1002291611	207
1268	3300005335	Ga0070666_10018495	Ga0070666_100184953	207
1269	3300005336	Ga0070680_100026608	Ga0070680_1000266082	207
1270	3300005336	Ga0070680_100347769	Ga0070680_1003477692	207
1271	3300005337	Ga0070682_100001355	Ga0070682_10000135511	207
1272	3300005338	Ga0068868_100006136	Ga0068868_1000061364	207
1273	3300005338	Ga0068868_100007204	Ga0068868_1000072045	207
1274	3300005339	Ga0070660_100004079	Ga0070660_10000407911	207
1275	3300005339	Ga0070660_100103597	Ga0070660_1001035972	207
1276	3300005340	Ga0070689_100000052	Ga0070689_1000000524	207
1277	3300005340	Ga0070689_100021740	Ga0070689_1000217403	207
1278	3300005341	Ga0070691_10005422	Ga0070691_100054223	207
1279	3300005341	Ga0070691_10016598	Ga0070691_100165982	207
1280	3300005343	Ga0070687_100000193	Ga0070687_1000001934	207
1281	3300005343	Ga0070687_100001335	Ga0070687_1000013352	207
1282	3300005343	Ga0070687_100484263	Ga0070687_1004842631	207
1283	3300005344	Ga0070661_100000094	Ga0070661_10000009412	207
1284	3300005345	Ga0070692_10000422	Ga0070692_100004222	207
1285	3300005345	Ga0070692_10007747	Ga0070692_100077473	207
1286	3300005345	Ga0070692_10158526	Ga0070692_101585262	207
1287	3300005347	Ga0070668_100003109	Ga0070668_1000031098	207
1288	3300005347	Ga0070668_100152062	Ga0070668_1001520622	207
1289	3300005347	Ga0070668_100190534	Ga0070668_1001905342	207
1290	3300005353	Ga0070669_100002385	Ga0070669_1000023854	207
1291	3300005353	Ga0070669_100079124	Ga0070669_1000791243	207
1292	3300005354	Ga0070675_100002474	Ga0070675_1000024744	207
1293	3300005354	Ga0070675_100021052	Ga0070675_1000210524	207
1294	3300005354	Ga0070675_100066852	Ga0070675_1000668522	207
1295	3300005354	Ga0070675_100083930	Ga0070675_1000839302	207
1296	3300005355	Ga0070671_100003835	Ga0070671_1000038358	207
1297	3300005355	Ga0070671_100055908	Ga0070671_1000559082	207
1298	3300005355	Ga0070671_100763178	Ga0070671_1007631782	207
1299	3300005356	Ga0070674_100000878	Ga0070674_10000087815	207
1300	3300005364	Ga0070673_100000122	Ga0070673_10000012214	207
1301	3300005364	Ga0070673_100024597	Ga0070673_1000245973	207
1302	3300005365	Ga0070688_100001086	Ga0070688_1000010864	207
1303	3300005365	Ga0070688_100001965	Ga0070688_10000196512	207
1304	3300005365	Ga0070688_100009815	Ga0070688_1000098152	207
1305	3300005365	Ga0070688_100138193	Ga0070688_1001381932	207
1306	3300005366	Ga0070659_100000190	Ga0070659_10000019037	207
1307	3300005366	Ga0070659_100119454	Ga0070659_1001194542	207
1308	3300005366	Ga0070659_100339844	Ga0070659_1003398442	207
1309	3300005367	Ga0070667_100006892	Ga0070667_1000068922	207
1310	3300005367	Ga0070667_100020239	Ga0070667_1000202393	207
1311	3300005367	Ga0070667_100131741	Ga0070667_1001317412	207
1312	3300005406	Ga0070703_10010623	Ga0070703_100106232	207
1313	3300005406	Ga0070703_10062928	Ga0070703_100629281	207
1314	3300005434	Ga0070709_10006069	Ga0070709_100060692	207
1315	3300005434	Ga0070709_10016480	Ga0070709_100164802	207
1316	3300005434	Ga0070709_10206822	Ga0070709_102068221	207
1317	3300005435	Ga0070714_100042425	Ga0070714_1000424252	207
1318	3300005436	Ga0070713_100001142	Ga0070713_1000011429	207
1319	3300005436	Ga0070713_100155426	Ga0070713_1001554261	207
1320	3300005437	Ga0070710_10006169	Ga0070710_100061697	207
1321	3300005437	Ga0070710_10018122	Ga0070710_100181222	207
1322	3300005438	Ga0070701_10000135	Ga0070701_1000013519	207
1323	3300005438	Ga0070701_10013973	Ga0070701_100139732	207
1324	3300005439	Ga0070711_100017462	Ga0070711_1000174624	207
1325	3300005439	Ga0070711_100033378	Ga0070711_1000333782	207
1326	3300005439	Ga0070711_100244746	Ga0070711_1002447462	207
1327	3300005439	Ga0070711_100522858	Ga0070711_1005228581	207
1328	3300005440	Ga0070705_100099254	Ga0070705_1000992542	207
1329	3300005440	Ga0070705_100222607	Ga0070705_1002226071	207
1330	3300005440	Ga0070705_100324728	Ga0070705_1003247282	207
1331	3300005441	Ga0070700_100007040	Ga0070700_1000070404	207
1332	3300005441	Ga0070700_100013905	Ga0070700_1000139054	207
1333	3300005441	Ga0070700_100018762	Ga0070700_1000187625	207
1334	3300005444	Ga0070694_100002026	Ga0070694_1000020262	207
1335	3300005444	Ga0070694_100114859	Ga0070694_1001148592	207
1336	3300005444	Ga0070694_100397294	Ga0070694_1003972941	207
1337	3300005455	Ga0070663_100000079	Ga0070663_10000007941	207
1338	3300005455	Ga0070663_100030975	Ga0070663_1000309752	207
1339	3300005455	Ga0070663_100184961	Ga0070663_1001849612	207
1340	3300005456	Ga0070678_100000275	Ga0070678_10000027514	207
1341	3300005456	Ga0070678_100013078	Ga0070678_1000130782	207
1342	3300005457	Ga0070662_100002536	Ga0070662_1000025368	207
1343	3300005457	Ga0070662_100016156	Ga0070662_1000161563	207
1344	3300005457	Ga0070662_100036809	Ga0070662_1000368091	207
1345	3300005458	Ga0070681_10025028	Ga0070681_100250284	207
1346	3300005458	Ga0070681_10178932	Ga0070681_101789322	207
1347	3300005458	Ga0070681_10313376	Ga0070681_103133762	207
1348	3300005459	Ga0068867_100000073	Ga0068867_10000007350	207
1349	3300005459	Ga0068867_100070708	Ga0068867_1000707082	207
1350	3300005466	Ga0070685_10003240	Ga0070685_100032404	207
1351	3300005468	Ga0070707_101095037	Ga0070707_1010950371	207
1352	3300005507	Ga0074259_10549652	Ga0074259_105496522	207
1353	3300005530	Ga0070679_100012038	Ga0070679_1000120384	207
1354	3300005530	Ga0070679_100352312	Ga0070679_1003523122	207
1355	3300005535	Ga0070684_100000884	Ga0070684_1000008844	207
1356	3300005535	Ga0070684_100025057	Ga0070684_1000250573	207
1357	3300005535	Ga0070684_100215099	Ga0070684_1002150992	207
1358	3300005536	Ga0070697_100053613	Ga0070697_1000536132	207
1359	3300005536	Ga0070697_100280860	Ga0070697_1002808602	207
1360	3300005539	Ga0068853_100003880	Ga0068853_1000038802	207
1361	3300005539	Ga0068853_100009248	Ga0068853_1000092482	207
1362	3300005543	Ga0070672_100001297	Ga0070672_10000129711	207
1363	3300005543	Ga0070672_100009354	Ga0070672_1000093548	207
1364	3300005543	Ga0070672_100094059	Ga0070672_1000940592	207
1365	3300005544	Ga0070686_100000622	Ga0070686_1000006222	207
1366	3300005544	Ga0070686_100004184	Ga0070686_1000041844	207
1367	3300005544	Ga0070686_100013330	Ga0070686_1000133302	207
1368	3300005545	Ga0070695_100000828	Ga0070695_1000008281	207
1369	3300005545	Ga0070695_100011630	Ga0070695_1000116302	207
1370	3300005545	Ga0070695_100578655	Ga0070695_1005786551	207
1371	3300005546	Ga0070696_100016982	Ga0070696_1000169822	207
1372	3300005546	Ga0070696_100027484	Ga0070696_1000274842	207
1373	3300005546	Ga0070696_100052350	Ga0070696_1000523502	207
1374	3300005546	Ga0070696_100081447	Ga0070696_1000814472	207
1375	3300005547	Ga0070693_100000233	Ga0070693_10000023323	207
1376	3300005547	Ga0070693_100045683	Ga0070693_1000456833	207
1377	3300005547	Ga0070693_100344140	Ga0070693_1003441402	207
1378	3300005548	Ga0070665_100133906	Ga0070665_1001339063	207
1379	3300005548	Ga0070665_100603679	Ga0070665_1006036791	207
1380	3300005549	Ga0070704_100001494	Ga0070704_10000149411	207
1381	3300005549	Ga0070704_100067070	Ga0070704_1000670702	207
1382	3300005564	Ga0070664_100000253	Ga0070664_10000025323	207
1383	3300005564	Ga0070664_100023420	Ga0070664_1000234204	207
1384	3300005564	Ga0070664_100941234	Ga0070664_1009412341	207
1385	3300005577	Ga0068857_100000423	Ga0068857_1000004234	207
1386	3300005578	Ga0068854_100000064	Ga0068854_10000006480	207
1387	3300005578	Ga0068854_100036375	Ga0068854_1000363752	207
1388	3300005578	Ga0068854_100413565	Ga0068854_1004135651	207
1389	3300005614	Ga0068856_100003420	Ga0068856_1000034204	207
1390	3300005614	Ga0068856_100166548	Ga0068856_1001665482	207
1391	3300005614	Ga0068856_100210673	Ga0068856_1002106732	207
1392	3300005615	Ga0070702_100000057	Ga0070702_1000000577	207
1393	3300005615	Ga0070702_100041448	Ga0070702_1000414483	207
1394	3300005616	Ga0068852_100292357	Ga0068852_1002923572	207
1395	3300005617	Ga0068859_100003532	Ga0068859_10000353217	207
1396	3300005617	Ga0068859_100008041	Ga0068859_10000804110	207
1397	3300005617	Ga0068859_100182413	Ga0068859_1001824131	207
1398	3300005618	Ga0068864_100001982	Ga0068864_10000198215	207
1399	3300005618	Ga0068864_100203358	Ga0068864_1002033582	207
1400	3300005718	Ga0068866_10000133	Ga0068866_100001334	207
1401	3300005718	Ga0068866_10020275	Ga0068866_100202752	207
1402	3300005718	Ga0068866_10078490	Ga0068866_100784902	207
1403	3300005719	Ga0068861_100000077	Ga0068861_10000007731	207
1404	3300005719	Ga0068861_100030676	Ga0068861_1000306762	207
1405	3300005719	Ga0068861_100325622	Ga0068861_1003256222	207
1406	3300005834	Ga0068851_10020861	Ga0068851_100208612	207
1407	3300005834	Ga0068851_10077384	Ga0068851_100773842	207
1408	3300005840	Ga0068870_10000001	Ga0068870_1000000188	207
1409	3300005840	Ga0068870_10211947	Ga0068870_102119471	207
1410	3300005841	Ga0068863_100000144	Ga0068863_10000014479	207
1411	3300005841	Ga0068863_100006758	Ga0068863_1000067584	207
1412	3300005841	Ga0068863_100310072	Ga0068863_1003100722	207
1413	3300005842	Ga0068858_100004197	Ga0068858_10000419714	207
1414	3300005842	Ga0068858_100019366	Ga0068858_1000193665	207
1415	3300005842	Ga0068858_100101973	Ga0068858_1001019732	207
1416	3300005842	Ga0068858_100511631	Ga0068858_1005116311	207
1417	3300005843	Ga0068860_100022953	Ga0068860_1000229532	207
1418	3300005843	Ga0068860_100025770	Ga0068860_1000257702	207
1419	3300005843	Ga0068860_100344581	Ga0068860_1003445811	207
1420	3300005843	Ga0068860_100376563	Ga0068860_1003765632	207
1421	3300005844	Ga0068862_100000304	Ga0068862_1000003041	207
1422	3300005844	Ga0068862_100005189	Ga0068862_1000051892	207
1423	3300005844	Ga0068862_100286480	Ga0068862_1002864802	207
1424	3300005937	Ga0081455_10009265	Ga0081455_100092656	207
1425	3300005981	Ga0081538_10020744	Ga0081538_100207444	207
1426	3300005983	Ga0081540_1007396	Ga0081540_10073962	207
1427	3300005983	Ga0081540_1063054	Ga0081540_10630542	207
1428	3300005985	Ga0081539_10178461	Ga0081539_101784611	207
1429	3300006028	Ga0070717_10015480	Ga0070717_100154806	207
1430	3300006028	Ga0070717_10052171	Ga0070717_100521712	207
1431	3300006038	Ga0075365_10081620	Ga0075365_100816202	207
1432	3300006038	Ga0075365_10106896	Ga0075365_101068961	207
1433	3300006042	Ga0075368_10006605	Ga0075368_100066052	207
1434	3300006048	Ga0075363_100053297	Ga0075363_1000532973	207
1435	3300006163	Ga0070715_10006527	Ga0070715_100065271	207
1436	3300006173	Ga0070716_100567478	Ga0070716_1005674781	207
1437	3300006175	Ga0070712_100025958	Ga0070712_1000259583	207
1438	3300006175	Ga0070712_100056325	Ga0070712_1000563252	207
1439	3300006175	Ga0070712_100062415	Ga0070712_1000624152	207
1440	3300006178	Ga0075367_10011088	Ga0075367_100110882	207
1441	3300006178	Ga0075367_10035337	Ga0075367_100353371	207
1442	3300006237	Ga0097621_100000062	Ga0097621_10000006214	207
1443	3300006353	Ga0075370_10215336	Ga0075370_102153361	207
1444	3300006353	Ga0075370_10220832	Ga0075370_102208322	207
1445	3300006358	Ga0068871_100000007	Ga0068871_100000007105	207
1446	3300006358	Ga0068871_100012659	Ga0068871_1000126596	207
1447	3300006844	Ga0075428_100027128	Ga0075428_1000271283	207
1448	3300006844	Ga0075428_100033047	Ga0075428_1000330474	207
1449	3300006847	Ga0075431_100019500	Ga0075431_1000195003	207
1450	3300006852	Ga0075433_10020367	Ga0075433_100203676	207
1451	3300006852	Ga0075433_10059020	Ga0075433_100590202	207
1452	3300006852	Ga0075433_10697024	Ga0075433_106970241	207
1453	3300006871	Ga0075434_100000210	Ga0075434_10000021018	207
1454	3300006871	Ga0075434_100029211	Ga0075434_1000292114	207
1455	3300006871	Ga0075434_100084976	Ga0075434_1000849762	207
1456	3300006871	Ga0075434_100168420	Ga0075434_1001684202	207
1457	3300006881	Ga0068865_100000469	Ga0068865_1000004694	207
1458	3300006881	Ga0068865_100051637	Ga0068865_1000516372	207
1459	3300006914	Ga0075436_100186761	Ga0075436_1001867612	207
1460	3300006931	Ga0097620_100003532	Ga0097620_10000353217	207
1461	3300006931	Ga0097620_100008041	Ga0097620_1000080412	207
1462	3300006931	Ga0097620_100182423	Ga0097620_1001824233	207
1463	3300007076	Ga0075435_100089033	Ga0075435_1000890333	207
1464	3300007076	Ga0075435_100184218	Ga0075435_1001842182	207
1465	3300007076	Ga0075435_100196825	Ga0075435_1001968252	207
1466	3300007788	Ga0099795_10002530	Ga0099795_100025303	207
1467	3300009036	Ga0105244_10013432	Ga0105244_100134322	207
1468	3300009092	Ga0105250_10015948	Ga0105250_100159484	207
1469	3300009093	Ga0105240_10032153	Ga0105240_100321532	207
1470	3300009094	Ga0111539_10000229	Ga0111539_100002294	207
1471	3300009094	Ga0111539_10007639	Ga0111539_100076394	207
1472	3300009094	Ga0111539_10119602	Ga0111539_101196022	207
1473	3300009094	Ga0111539_10126052	Ga0111539_101260522	207
1474	3300009098	Ga0105245_10002466	Ga0105245_100024667	207
1475	3300009098	Ga0105245_10101658	Ga0105245_101016582	207
1476	3300009101	Ga0105247_10001732	Ga0105247_1000173213	207
1477	3300009101	Ga0105247_10008786	Ga0105247_100087865	207
1478	3300009101	Ga0105247_10017918	Ga0105247_100179184	207
1479	3300009101	Ga0105247_10118072	Ga0105247_101180722	207
1480	3300009147	Ga0114129_10006074	Ga0114129_100060746	207
1481	3300009147	Ga0114129_10560195	Ga0114129_105601951	207
1482	3300009147	Ga0114129_10562620	Ga0114129_105626202	207
1483	3300009148	Ga0105243_10007597	Ga0105243_100075976	207
1484	3300009148	Ga0105243_10021838	Ga0105243_100218385	207
1485	3300009148	Ga0105243_10119460	Ga0105243_101194602	207
1486	3300009174	Ga0105241_10000448	Ga0105241_1000044824	207
1487	3300009174	Ga0105241_10299260	Ga0105241_102992601	207
1488	3300009176	Ga0105242_10262050	Ga0105242_102620501	207
1489	3300009176	Ga0105242_10374772	Ga0105242_103747722	207
1490	3300009176	Ga0105242_10479056	Ga0105242_104790561	207
1491	3300009177	Ga0105248_10001616	Ga0105248_100016164	207
1492	3300009177	Ga0105248_10012785	Ga0105248_1001278510	207
1493	3300009177	Ga0105248_10019025	Ga0105248_100190256	207
1494	3300009545	Ga0105237_10015072	Ga0105237_100150724	207
1495	3300009545	Ga0105237_10045576	Ga0105237_100455763	207
1496	3300009545	Ga0105237_10127538	Ga0105237_101275382	207
1497	3300009551	Ga0105238_10387646	Ga0105238_103876462	207
1498	3300009553	Ga0105249_10008342	Ga0105249_100083423	207
1499	3300009553	Ga0105249_10010155	Ga0105249_100101555	207
1500	3300009553	Ga0105249_10145925	Ga0105249_101459251	207
1501	3300010159	Ga0099796_10024807	Ga0099796_100248072	207
1502	3300010375	Ga0105239_10007143	Ga0105239_1000714311	207
1503	3300010375	Ga0105239_10031725	Ga0105239_100317256	207
1504	3300010375	Ga0105239_10203689	Ga0105239_102036892	207
1505	3300010375	Ga0105239_10753305	Ga0105239_107533051	207
1506	3300011119	Ga0105246_10033422	Ga0105246_100334222	207
1507	3300011119	Ga0105246_10183155	Ga0105246_101831551	207
1508	3300012478	Ga0157328_1000280	Ga0157328_10002802	207
1509	3300012515	Ga0157338_1002099	Ga0157338_10020991	207
1510	3300013100	Ga0157373_10024792	Ga0157373_100247925	207
1511	3300013100	Ga0157373_10115203	Ga0157373_101152032	207
1512	3300013102	Ga0157371_10014868	Ga0157371_100148682	207
1513	3300013296	Ga0157374_10000610	Ga0157374_1000061026	207
1514	3300013296	Ga0157374_10075139	Ga0157374_100751392	207
1515	3300013296	Ga0157374_10598267	Ga0157374_105982671	207
1516	3300013297	Ga0157378_10000775	Ga0157378_100007752	207
1517	3300013297	Ga0157378_11419942	Ga0157378_114199421	207
1518	3300013306	Ga0163162_10000559	Ga0163162_1000055933	207
1519	3300013306	Ga0163162_10302660	Ga0163162_103026602	207
1520	3300013307	Ga0157372_10006750	Ga0157372_1000675010	207
1521	3300013307	Ga0157372_10168162	Ga0157372_101681622	207
1522	3300013308	Ga0157375_10002985	Ga0157375_100029856	207
1523	3300013308	Ga0157375_10025227	Ga0157375_100252275	207
1524	3300013308	Ga0157375_10066544	Ga0157375_100665442	207
1525	3300014325	Ga0163163_10000673	Ga0163163_1000067324	207
1526	3300014325	Ga0163163_10014233	Ga0163163_100142331	207
1527	3300014325	Ga0163163_10096311	Ga0163163_100963112	207
1528	3300014326	Ga0157380_10001859	Ga0157380_100018595	207
1529	3300014326	Ga0157380_10068702	Ga0157380_100687022	207
1530	3300014497	Ga0182008_10119635	Ga0182008_101196351	207
1531	3300014745	Ga0157377_10001018	Ga0157377_100010186	207
1532	3300014968	Ga0157379_10000991	Ga0157379_100009914	207
1533	3300014968	Ga0157379_10032541	Ga0157379_100325412	207
1534	3300014968	Ga0157379_10069675	Ga0157379_100696752	207
1535	3300014969	Ga0157376_10001415	Ga0157376_100014157	207
1536	3300014969	Ga0157376_10099832	Ga0157376_100998322	207
1537	3300017792	Ga0163161_10004819	Ga0163161_100048192	207
1538	3300025271	Ga0207666_1000001	Ga0207666_10000012	207
1539	3300025271	Ga0207666_1000007	Ga0207666_10000075	207
1540	3300025290	Ga0207673_1003000	Ga0207673_10030003	207
1541	3300025315	Ga0207697_10003140	Ga0207697_100031404	207
1542	3300025315	Ga0207697_10046755	Ga0207697_100467552	207
1543	3300025321	Ga0207656_10061735	Ga0207656_100617351	207
1544	3300025885	Ga0207653_10014266	Ga0207653_100142662	207
1545	3300025885	Ga0207653_10060813	Ga0207653_100608132	207
1546	3300025893	Ga0207682_10000002	Ga0207682_10000002102	207
1547	3300025893	Ga0207682_10096622	Ga0207682_100966222	207
1548	3300025898	Ga0207692_10001821	Ga0207692_100018213	207
1549	3300025898	Ga0207692_10006420	Ga0207692_100064202	207
1550	3300025899	Ga0207642_10000170	Ga0207642_1000017011	207
1551	3300025899	Ga0207642_10011717	Ga0207642_100117172	207
1552	3300025899	Ga0207642_10068892	Ga0207642_100688922	207
1553	3300025900	Ga0207710_10006798	Ga0207710_100067982	207
1554	3300025900	Ga0207710_10014914	Ga0207710_100149144	207
1555	3300025900	Ga0207710_10050232	Ga0207710_100502321	207
1556	3300025901	Ga0207688_10000077	Ga0207688_1000007722	207
1557	3300025901	Ga0207688_10000532	Ga0207688_100005322	207
1558	3300025901	Ga0207688_10048940	Ga0207688_100489403	207
1559	3300025903	Ga0207680_10086825	Ga0207680_100868252	207
1560	3300025904	Ga0207647_10005455	Ga0207647_1000545510	207
1561	3300025904	Ga0207647_10006537	Ga0207647_100065372	207
1562	3300025904	Ga0207647_10039841	Ga0207647_100398412	207
1563	3300025905	Ga0207685_10032603	Ga0207685_100326032	207
1564	3300025906	Ga0207699_10089774	Ga0207699_100897742	207
1565	3300025907	Ga0207645_10000070	Ga0207645_1000007074	207
1566	3300025907	Ga0207645_10007524	Ga0207645_100075245	207
1567	3300025908	Ga0207643_10000003	Ga0207643_1000000344	207
1568	3300025908	Ga0207643_10001791	Ga0207643_100017912	207
1569	3300025911	Ga0207654_10001122	Ga0207654_100011228	207
1570	3300025911	Ga0207654_10242841	Ga0207654_102428412	207
1571	3300025912	Ga0207707_10365490	Ga0207707_103654901	207
1572	3300025914	Ga0207671_10028513	Ga0207671_100285132	207
1573	3300025914	Ga0207671_10103915	Ga0207671_101039151	207
1574	3300025914	Ga0207671_10268828	Ga0207671_102688282	207
1575	3300025915	Ga0207693_10004287	Ga0207693_1000428711	207
1576	3300025915	Ga0207693_10056413	Ga0207693_100564132	207
1577	3300025915	Ga0207693_10066671	Ga0207693_100666712	207
1578	3300025915	Ga0207693_10079101	Ga0207693_100791012	207
1579	3300025915	Ga0207693_10212977	Ga0207693_102129771	207
1580	3300025916	Ga0207663_10031473	Ga0207663_100314732	207
1581	3300025916	Ga0207663_10074021	Ga0207663_100740212	207
1582	3300025916	Ga0207663_10137380	Ga0207663_101373802	207
1583	3300025917	Ga0207660_10001136	Ga0207660_100011364	207
1584	3300025917	Ga0207660_10017213	Ga0207660_100172132	207
1585	3300025918	Ga0207662_10003328	Ga0207662_100033285	207
1586	3300025918	Ga0207662_10013961	Ga0207662_100139612	207
1587	3300025918	Ga0207662_10286929	Ga0207662_102869291	207
1588	3300025918	Ga0207662_10341257	Ga0207662_103412572	207
1589	3300025919	Ga0207657_10023221	Ga0207657_100232213	207
1590	3300025919	Ga0207657_10033549	Ga0207657_100335495	207
1591	3300025919	Ga0207657_10185052	Ga0207657_101850521	207
1592	3300025920	Ga0207649_10000054	Ga0207649_1000005467	207
1593	3300025920	Ga0207649_10135299	Ga0207649_101352991	207
1594	3300025921	Ga0207652_10000059	Ga0207652_1000005979	207
1595	3300025921	Ga0207652_10028200	Ga0207652_100282001	207
1596	3300025923	Ga0207681_10001076	Ga0207681_100010764	207
1597	3300025923	Ga0207681_10028861	Ga0207681_100288613	207
1598	3300025924	Ga0207694_10348994	Ga0207694_103489941	207
1599	3300025925	Ga0207650_10004186	Ga0207650_1000418611	207
1600	3300025925	Ga0207650_10012602	Ga0207650_100126024	207
1601	3300025925	Ga0207650_10034641	Ga0207650_100346413	207
1602	3300025925	Ga0207650_10356658	Ga0207650_103566582	207
1603	3300025926	Ga0207659_10000099	Ga0207659_1000009946	207
1604	3300025926	Ga0207659_10068262	Ga0207659_100682622	207
1605	3300025926	Ga0207659_10131971	Ga0207659_101319712	207
1606	3300025927	Ga0207687_10000050	Ga0207687_1000005013	207
1607	3300025927	Ga0207687_10013627	Ga0207687_100136271	207
1608	3300025928	Ga0207700_10004906	Ga0207700_100049066	207
1609	3300025928	Ga0207700_10653774	Ga0207700_106537741	207
1610	3300025929	Ga0207664_10330535	Ga0207664_103305352	207
1611	3300025931	Ga0207644_10003389	Ga0207644_100033898	207
1612	3300025932	Ga0207690_10000260	Ga0207690_1000026010	207
1613	3300025932	Ga0207690_10009198	Ga0207690_100091985	207
1614	3300025933	Ga0207706_10001170	Ga0207706_1000117022	207
1615	3300025933	Ga0207706_10001566	Ga0207706_1000156622	207
1616	3300025933	Ga0207706_10032775	Ga0207706_100327755	207
1617	3300025934	Ga0207686_10000256	Ga0207686_1000025610	207
1618	3300025934	Ga0207686_10039284	Ga0207686_100392842	207
1619	3300025935	Ga0207709_10000352	Ga0207709_1000035227	207
1620	3300025935	Ga0207709_10014095	Ga0207709_100140952	207
1621	3300025935	Ga0207709_10057650	Ga0207709_100576502	207
1622	3300025936	Ga0207670_10000073	Ga0207670_1000007340	207
1623	3300025936	Ga0207670_10029106	Ga0207670_100291062	207
1624	3300025936	Ga0207670_10030114	Ga0207670_100301142	207
1625	3300025936	Ga0207670_10289558	Ga0207670_102895582	207
1626	3300025937	Ga0207669_10000442	Ga0207669_100004424	207
1627	3300025937	Ga0207669_10367062	Ga0207669_103670622	207
1628	3300025938	Ga0207704_10000031	Ga0207704_1000003111	207
1629	3300025938	Ga0207704_10145267	Ga0207704_101452672	207
1630	3300025939	Ga0207665_10004653	Ga0207665_100046536	207
1631	3300025939	Ga0207665_10246298	Ga0207665_102462981	207
1632	3300025940	Ga0207691_10001871	Ga0207691_1000187116	207
1633	3300025940	Ga0207691_10002068	Ga0207691_1000206817	207
1634	3300025940	Ga0207691_10034673	Ga0207691_100346735	207
1635	3300025941	Ga0207711_10000478	Ga0207711_1000047811	207
1636	3300025941	Ga0207711_10038057	Ga0207711_100380572	207
1637	3300025941	Ga0207711_10303348	Ga0207711_103033482	207
1638	3300025942	Ga0207689_10000040	Ga0207689_1000004027	207
1639	3300025942	Ga0207689_10016646	Ga0207689_100166462	207
1640	3300025944	Ga0207661_10000076	Ga0207661_100000764	207
1641	3300025944	Ga0207661_10212939	Ga0207661_102129392	207
1642	3300025945	Ga0207679_10000014	Ga0207679_10000014106	207
1643	3300025945	Ga0207679_10028530	Ga0207679_100285302	207
1644	3300025949	Ga0207667_10031873	Ga0207667_100318737	207
1645	3300025949	Ga0207667_10123947	Ga0207667_101239473	207
1646	3300025960	Ga0207651_10066453	Ga0207651_100664532	207
1647	3300025960	Ga0207651_10263841	Ga0207651_102638412	207
1648	3300025960	Ga0207651_10299673	Ga0207651_102996732	207
1649	3300025961	Ga0207712_10000258	Ga0207712_1000025846	207
1650	3300025961	Ga0207712_10565522	Ga0207712_105655221	207
1651	3300025972	Ga0207668_10000057	Ga0207668_100000572	207
1652	3300025972	Ga0207668_10048827	Ga0207668_100488274	207
1653	3300025981	Ga0207640_10000258	Ga0207640_1000025812	207
1654	3300025986	Ga0207658_10034541	Ga0207658_100345413	207
1655	3300025986	Ga0207658_10079926	Ga0207658_100799263	207
1656	3300026023	Ga0207677_10009629	Ga0207677_100096297	207
1657	3300026023	Ga0207677_10186372	Ga0207677_101863721	207
1658	3300026035	Ga0207703_10002166	Ga0207703_1000216617	207
1659	3300026035	Ga0207703_10047878	Ga0207703_100478783	207
1660	3300026035	Ga0207703_10089270	Ga0207703_100892703	207
1661	3300026041	Ga0207639_10001844	Ga0207639_1000184412	207
1662	3300026041	Ga0207639_10264644	Ga0207639_102646442	207
1663	3300026041	Ga0207639_10392679	Ga0207639_103926791	207
1664	3300026067	Ga0207678_10001623	Ga0207678_1000162314	207
1665	3300026067	Ga0207678_10001875	Ga0207678_1000187515	207
1666	3300026067	Ga0207678_10070524	Ga0207678_100705242	207
1667	3300026075	Ga0207708_10000155	Ga0207708_1000015519	207
1668	3300026075	Ga0207708_10007155	Ga0207708_100071555	207
1669	3300026075	Ga0207708_10027227	Ga0207708_100272275	207
1670	3300026078	Ga0207702_10006740	Ga0207702_100067402	207
1671	3300026078	Ga0207702_10149660	Ga0207702_101496601	207
1672	3300026078	Ga0207702_10255129	Ga0207702_102551292	207
1673	3300026088	Ga0207641_10000272	Ga0207641_1000027211	207
1674	3300026088	Ga0207641_10029261	Ga0207641_100292612	207
1675	3300026088	Ga0207641_10632995	Ga0207641_106329951	207
1676	3300026089	Ga0207648_10002624	Ga0207648_100026245	207
1677	3300026089	Ga0207648_10003341	Ga0207648_100033415	207
1678	3300026095	Ga0207676_10006530	Ga0207676_100065305	207
1679	3300026095	Ga0207676_10025342	Ga0207676_100253422	207
1680	3300026095	Ga0207676_10030248	Ga0207676_100302485	207
1681	3300026116	Ga0207674_10000555	Ga0207674_1000055521	207
1682	3300026116	Ga0207674_10120380	Ga0207674_101203802	207
1683	3300026118	Ga0207675_100011580	Ga0207675_1000115804	207
1684	3300026118	Ga0207675_100036723	Ga0207675_1000367232	207
1685	3300026121	Ga0207683_10000002	Ga0207683_10000002119	207
1686	3300026121	Ga0207683_10002386	Ga0207683_1000238611	207
1687	3300026142	Ga0207698_10072486	Ga0207698_100724862	207
1688	3300027252	Ga0209973_1001539	Ga0209973_10015393	207
1689	3300027424	Ga0209984_1012040	Ga0209984_10120401	207
1690	3300027512	Ga0209179_1002313	Ga0209179_10023133	207
1691	3300027526	Ga0209968_1010117	Ga0209968_10101172	207
1692	3300027543	Ga0209999_1008900	Ga0209999_10089002	207
1693	3300027552	Ga0209982_1004372	Ga0209982_10043723	207
1694	3300027617	Ga0210002_1000353	Ga0210002_10003532	207
1695	3300027665	Ga0209983_1034468	Ga0209983_10344681	207
1696	3300027682	Ga0209971_1017527	Ga0209971_10175272	207
1697	3300027695	Ga0209966_1006364	Ga0209966_10063642	207
1698	3300027717	Ga0209998_10002117	Ga0209998_100021172	207
1699	3300027717	Ga0209998_10005651	Ga0209998_100056512	207
1700	3300027876	Ga0209974_10005205	Ga0209974_100052052	207
1701	3300027876	Ga0209974_10013201	Ga0209974_100132012	207
1702	3300027907	Ga0207428_10000011	Ga0207428_10000011183	207
1703	3300027907	Ga0207428_10001408	Ga0207428_1000140818	207
1704	3300027907	Ga0207428_10046260	Ga0207428_100462602	207
1705	3300028379	Ga0268266_10194844	Ga0268266_101948442	207
1706	3300028380	Ga0268265_10000476	Ga0268265_1000047634	207
1707	3300028381	Ga0268264_10002223	Ga0268264_1000222314	207
1708	3300028381	Ga0268264_10009905	Ga0268264_100099057	207
1709	3300028381	Ga0268264_10032203	Ga0268264_100322031	207
1710	3300028381	Ga0268264_10165862	Ga0268264_101658621	207
1711	3300029957	Ga0265324_10107075	Ga0265324_101070751	207
1712	3300031235	Ga0265330_10038516	Ga0265330_100385162	207
1713	3300031241	Ga0265325_10000111	Ga0265325_1000011121	207
1714	3300031241	Ga0265325_10034271	Ga0265325_100342712	207
1715	3300031250	Ga0265331_10005990	Ga0265331_100059902	207
1716	3300031344	Ga0265316_10648930	Ga0265316_106489301	207
1717	3300031595	Ga0265313_10028219	Ga0265313_100282192	207
1718	3300034816	Ga0373930_0000052	Ga0373930_0000052_5006_5629	207
1719	3300034816	Ga0373930_0018418	Ga0373930_0018418_586_1209	207
1720	3300034817	Ga0373948_0000088	Ga0373948_0000088_582_1205	207
1721	3300034818	Ga0373950_0000969	Ga0373950_0000969_583_1206	207
1722	3300034819	Ga0373958_0003156	Ga0373958_0003156_1211_1834	207
1723	3300034819	Ga0373958_0004512	Ga0373958_0004512_741_1364	207
1724	3300034820	Ga0373959_0000293	Ga0373959_0000293_3657_4280	207
1725	3300034957	Ga0373938_0000102	Ga0373938_0000102_523_1146	207
1726	3300034957	Ga0373938_0000628	Ga0373938_0000628_3702_4325	207
1727	3300035083	Ga0373926_0043043	Ga0373926_0043043_817_1530	207
1728	3300035084	Ga0373928_0009182	Ga0373928_0009182_562_1185	207
1729	3300035085	Ga0373929_0001597	Ga0373929_0001597_2865_3488	207
1730	3300035088	Ga0373940_0000047	Ga0373940_0000047_5827_6450	207
1731	3300035088	Ga0373940_0003013	Ga0373940_0003013_985_1608	207
1732	3300035089	Ga0373944_0049924	Ga0373944_0049924_645_1271	207
1733	3300035090	Ga0373949_0001296	Ga0373949_0001296_3442_4065	207
1734	3300035090	Ga0373949_0002261	Ga0373949_0002261_3837_4460	207
1735	3300035091	Ga0373951_0002080	Ga0373951_0002080_2696_3319	207
1736	3300035091	Ga0373951_0073920	Ga0373951_0073920_171_794	207
1737	3300035092	Ga0373952_0000681	Ga0373952_0000681_4951_5574	207
1738	3300035092	Ga0373952_0014969	Ga0373952_0014969_785_1408	207
1739	3300035111	Ga0373923_0009668	Ga0373923_0009668_1163_1789	207
1740	3300035112	Ga0373932_0003713	Ga0373932_0003713_1339_1962	207
1741	3300035112	Ga0373932_0005468	Ga0373932_0005468_200_823	207
1742	3300035113	Ga0373936_0152196	Ga0373936_0152196_121_834	207
1743	3300035114	Ga0373939_0000444	Ga0373939_0000444_1865_2488	207
1744	3300035114	Ga0373939_0077360	Ga0373939_0077360_328_951	207
1745	3300035115	Ga0373941_0000204	Ga0373941_0000204_10182_10805	207
1746	3300035115	Ga0373941_0006294	Ga0373941_0006294_135_758	207
1747	3300035116	Ga0373945_0002893	Ga0373945_0002893_882_1595	207
1748	3300035116	Ga0373945_0067568	Ga0373945_0067568_669_1295	207
1749	3300035117	Ga0373953_0077725	Ga0373953_0077725_29_655	207
1750	3300035119	Ga0373956_0142037	Ga0373956_0142037_279_905	207
1751	3300035120	Ga0373957_0062688	Ga0373957_0062688_749_1375	207
1752	3300035121	Ga0373960_0000129	Ga0373960_0000129_741_1364	207
1753	3300035121	Ga0373960_0134349	Ga0373960_0134349_57_680	207
1754	3300035170	Ga0373943_0113597	Ga0373943_0113597_324_1037	207
1755	3300035171	Ga0373946_0202300	Ga0373946_0202300_16_657	207
1756	3300035172	Ga0373955_0007421	Ga0373955_0007421_4187_4813	207
1757	3300035207	Ga0373942_0001562	Ga0373942_0001562_1791_2414	207
1758	3300035241	Ga0373961_0001737	Ga0373961_0001737_4851_5474	207
1759	3300035241	Ga0373961_0009460	Ga0373961_0009460_53_676	207
1760	3300035242	Ga0373962_0004122	Ga0373962_0004122_988_1611	207
1761	3300035242	Ga0373962_0025161	Ga0373962_0025161_943_1566	207
1762	3300035691	Ga0373931_0000447	Ga0373931_0000447_1945_2568	207
1763	3300035691	Ga0373931_0065698	Ga0373931_0065698_730_1353	207
1764	3300035692	Ga0373935_0130054	Ga0373935_0130054_1015_1641	207
1765	3300035695	Ga0373927_0079200	Ga0373927_0079200_898_1611	207
1766	3300035725	Ga0373947_0085179	Ga0373947_0085179_299_1012	207
1767	3300036401	Ga0373937_0013886	Ga0373937_0013886_6293_6919	207
1768	3300036401	Ga0373937_0540406	Ga0373937_0540406_157_870	207
1769	3300037068	Ga0373925_0015939	Ga0373925_0015939_2444_3070	207
1770	3300037068	Ga0373925_0107947	Ga0373925_0107947_1156_1869	207
1771	3300037068	Ga0373925_0127691	Ga0373925_0127691_1223_1936	207
1772	3300037418	Ga0395900_0132302	Ga0395900_0132302_377_1084	207
1773	3300037466	Ga0395898_0070660	Ga0395898_0070660_940_1647	207
1774	3300041512	Ga0451853_3126676	Ga0451853_3126676_1540_2256	207
1775	3300042005	Ga0439448_0059908	Ga0439448_0059908_624_1247	207
1776	3300042012	Ga0439455_0023162	Ga0439455_0023162_745_1368	207
1777	3300042157	Ga0439458_0033670	Ga0439458_0033670_231_854	207
1778	3300042439	Ga0439464_0050811	Ga0439464_0050811_296_919	207
1779	3300042461	Ga0439460_0055226	Ga0439460_0055226_279_902	207
1780	3300042876	Ga0451577_0272778	Ga0451577_0272778_472_1095	207
1781	3300045051	Ga0451576_0021541	Ga0451576_0021541_3607_4230	207
1782	3300046457	Ga0495590_0046641	Ga0495590_0046641_158_874	207
1783	3300046471	Ga0495650_0046437	Ga0495650_0046437_975_1646	207
1784	3300046473	Ga0495582_0003215	Ga0495582_0003215_2477_3190	207
1785	3300046475	Ga0495639_0204340	Ga0495639_0204340_104_817	207
1786	3300046476	Ga0495662_0088675	Ga0495662_0088675_572_1285	207
1787	3300046491	Ga0495584_0041726	Ga0495584_0041726_1033_1656	207
1788	3300046491	Ga0495584_0097465	Ga0495584_0097465_451_1164	207
1789	3300046492	Ga0495585_0056859	Ga0495585_0056859_829_1542	207
1790	3300046499	Ga0495594_0142783	Ga0495594_0142783_42_755	207
1791	3300046500	Ga0495596_0060639	Ga0495596_0060639_609_1325	207
1792	3300046506	Ga0495583_0182039	Ga0495583_0182039_112_828	207
1793	3300046511	Ga0495608_0074451	Ga0495608_0074451_672_1298	207
1794	3300046513	Ga0495616_0061136	Ga0495616_0061136_378_1094	207
1795	3300046518	Ga0495631_0049490	Ga0495631_0049490_475_1191	207
1796	3300046518	Ga0495631_0091200	Ga0495631_0091200_278_991	207
1797	3300046533	Ga0495640_0040756	Ga0495640_0040756_2257_2883	207
1798	3300046536	Ga0495587_0011259	Ga0495587_0011259_2994_3620	207
1799	3300046538	Ga0495609_0042885	Ga0495609_0042885_85_801	207
1800	3300046542	Ga0495597_0170683	Ga0495597_0170683_62_778	207
1801	3300046543	Ga0495645_0001459	Ga0495645_0001459_525_1151	207
1802	3300046559	Ga0495667_0005094	Ga0495667_0005094_2001_2627	207
1803	3300046559	Ga0495667_0340752	Ga0495667_0340752_84_797	207
1804	3300046616	Ga0495668_0078377	Ga0495668_0078377_1056_1772	207
1805	3300046642	Ga0495634_0148336	Ga0495634_0148336_658_1371	207
1806	3300046648	Ga0495611_0160088	Ga0495611_0160088_172_888	207
1807	3300046663	Ga0495635_0373891	Ga0495635_0373891_169_885	207
1808	3300046674	Ga0495588_0019191	Ga0495588_0019191_294_1007	207
1809	3300046675	Ga0495657_0056164	Ga0495657_0056164_1007_1633	207
1810	3300046678	Ga0495599_0012492	Ga0495599_0012492_1320_1946	207
1811	3300046679	Ga0495623_0226205	Ga0495623_0226205_227_853	207
1812	3300046681	Ga0495647_0031928	Ga0495647_0031928_686_1399	207
1813	3300046684	Ga0495669_0041298	Ga0495669_0041298_1122_1838	207
1814	3300046689	Ga0495613_0160523	Ga0495613_0160523_486_1199	207
1815	3300046690	Ga0495624_0023574	Ga0495624_0023574_3313_4026	207
1816	3300046690	Ga0495624_0367516	Ga0495624_0367516_41_754	207
1817	3300046691	Ga0495670_0065076	Ga0495670_0065076_902_1615	207
1818	3300046691	Ga0495670_0096322	Ga0495670_0096322_751_1467	207
1819	3300046794	Ga0495589_0063524	Ga0495589_0063524_1005_1721	207
1820	3300046809	Ga0495600_0001024	Ga0495600_0001024_1529_2155	207
1821	3300047315	Ga0495581_0154312	Ga0495581_0154312_82_795	207
1822	3300047315	Ga0495581_0303586	Ga0495581_0303586_143_856	207
1823	3300047317	Ga0495604_0036686	Ga0495604_0036686_1673_2299	207
1824	3300047321	Ga0495676_0086333	Ga0495676_0086333_1577_2290	207
1825	3300047322	Ga0495680_0033604	Ga0495680_0033604_972_1598	207
1826	3300047446	Ga0495679_042415	Ga0495679_042415_73_786	207
1827	3300047447	Ga0495685_079353	Ga0495685_079353_139_855	207
1828	3300047469	Ga0495673_0057757	Ga0495673_0057757_222_938	207
1829	3300048088	Ga0495602_0006541	Ga0495602_0006541_8921_9547	207
1830	3300048903	Ga0496100_0000579	Ga0496100_0000579_3957_4580	207
1831	3300048903	Ga0496100_0013514	Ga0496100_0013514_3567_4280	207
1832	3300048903	Ga0496100_0029503	Ga0496100_0029503_1628_2326	207
1833	3300048903	Ga0496100_0079433	Ga0496100_0079433_244_960	207
1834	3300048904	Ga0496101_0000061	Ga0496101_0000061_45343_45966	207
1835	3300048904	Ga0496101_0517049	Ga0496101_0517049_101_724	207
1836	3300048904	Ga0496101_0616709	Ga0496101_0616709_26_742	207
1837	3300048905	Ga0496102_0000667	Ga0496102_0000667_1866_2489	207
1838	3300048905	Ga0496102_0120747	Ga0496102_0120747_139_855	207
1839	3300048905	Ga0496102_0226086	Ga0496102_0226086_759_1472	207
1840	3300048906	Ga0496103_0000398	Ga0496103_0000398_556_1179	207
1841	3300048906	Ga0496103_0008814	Ga0496103_0008814_3231_3944	207
1842	3300048906	Ga0496103_0055195	Ga0496103_0055195_1144_1860	207
1843	3300048906	Ga0496103_0080979	Ga0496103_0080979_583_1206	207
1844	3300048907	Ga0496104_0001796	Ga0496104_0001796_15814_16440	207
1845	3300048907	Ga0496104_0016646	Ga0496104_0016646_793_1536	207
1846	3300048907	Ga0496104_0022986	Ga0496104_0022986_4695_5408	207
1847	3300048907	Ga0496104_0353742	Ga0496104_0353742_219_935	207
1848	3300048907	Ga0496104_0863933	Ga0496104_0863933_15_713	207
1849	3300048908	Ga0496105_0005227	Ga0496105_0005227_3570_4196	207
1850	3300048908	Ga0496105_0376584	Ga0496105_0376584_479_1102	207
1851	3300048909	Ga0496106_0003893	Ga0496106_0003893_9158_9781	207
1852	3300048909	Ga0496106_0026554	Ga0496106_0026554_44_757	207
1853	3300048909	Ga0496106_0041651	Ga0496106_0041651_978_1691	207
1854	3300048909	Ga0496106_0074635	Ga0496106_0074635_1646_2269	207
1855	3300048909	Ga0496106_0104711	Ga0496106_0104711_319_1035	207
1856	3300048910	Ga0496107_0000308	Ga0496107_0000308_21806_22429	207
1857	3300048910	Ga0496107_0007790	Ga0496107_0007790_1401_2114	207
1858	3300048910	Ga0496107_0033451	Ga0496107_0033451_2261_3004	207
1859	3300048910	Ga0496107_0072941	Ga0496107_0072941_827_1450	207
1860	3300048911	Ga0496108_0000619	Ga0496108_0000619_12865_13578	207
1861	3300048911	Ga0496108_0011911	Ga0496108_0011911_1836_2459	207
1862	3300048911	Ga0496108_0073829	Ga0496108_0073829_1428_2144	207
1863	3300048912	Ga0496109_0000530	Ga0496109_0000530_11614_12237	207
1864	3300048912	Ga0496109_0001296	Ga0496109_0001296_5681_6394	207
1865	3300048912	Ga0496109_0001606	Ga0496109_0001606_14597_15340	207
1866	3300048913	Ga0496110_0010405	Ga0496110_0010405_6760_7473	207
1867	3300048913	Ga0496110_0014646	Ga0496110_0014646_5445_6068	207
1868	3300048913	Ga0496110_0033069	Ga0496110_0033069_2299_3042	207
1869	3300048913	Ga0496110_0033674	Ga0496110_0033674_3039_3755	207
1870	3300048913	Ga0496110_0363384	Ga0496110_0363384_629_1252	207
1871	3300048914	Ga0496111_0000484	Ga0496111_0000484_13310_14023	207
1872	3300048914	Ga0496111_0003849	Ga0496111_0003849_1335_2078	207
1873	3300048914	Ga0496111_0014923	Ga0496111_0014923_3058_3774	207
1874	3300048915	Ga0496112_0000727	Ga0496112_0000727_10482_11195	207
1875	3300048915	Ga0496112_0001311	Ga0496112_0001311_16512_17255	207
1876	3300048915	Ga0496112_0042434	Ga0496112_0042434_2295_3011	207
1877	3300048915	Ga0496112_0414092	Ga0496112_0414092_183_806	207
1878	3300048916	Ga0496113_0000122	Ga0496113_0000122_24564_25307	207
1879	3300048916	Ga0496113_0007581	Ga0496113_0007581_5891_6604	207
1880	3300048916	Ga0496113_0224506	Ga0496113_0224506_440_1063	207
1881	3300048917	Ga0496114_0000475	Ga0496114_0000475_13359_13982	207
1882	3300048917	Ga0496114_0010152	Ga0496114_0010152_377_1075	207
1883	3300048917	Ga0496114_0090566	Ga0496114_0090566_1714_2427	207
1884	3300048917	Ga0496114_0105234	Ga0496114_0105234_447_1163	207
1885	3300048918	Ga0496115_0006333	Ga0496115_0006333_3055_3678	207
1886	3300048918	Ga0496115_0041302	Ga0496115_0041302_1253_1966	207
1887	3300048918	Ga0496115_0075428	Ga0496115_0075428_342_1055	207
1888	3300049571	Ga0501034_0015256	Ga0501034_0015256_264_890	207
1889	3300049578	Ga0501042_0065437	Ga0501042_0065437_847_1566	207
1890	3300049580	Ga0501046_0230094	Ga0501046_0230094_633_1259	207
1891	3300049581	Ga0501047_0048445	Ga0501047_0048445_937_1563	207
1892	3300049589	Ga0501073_0036346	Ga0501073_0036346_2601_3227	207
1893	3300049590	Ga0501074_0283456	Ga0501074_0283456_442_1065	207
1894	3300049593	Ga0501077_0017178	Ga0501077_0017178_691_1314	207
1895	3300049593	Ga0501077_0062757	Ga0501077_0062757_725_1444	207
1896	3300049593	Ga0501077_0201526	Ga0501077_0201526_129_851	207
1897	3300049743	Ga0501081_0038098	Ga0501081_0038098_903_1622	207
1898	3300049743	Ga0501081_0292949	Ga0501081_0292949_157_780	207
1899	3300049822	Ga0501035_0783885	Ga0501035_0783885_31_750	207
1900	3300049824	Ga0501045_0109874	Ga0501045_0109874_1356_1979	207
1901	3300050490	nmdc:mga03n38_131647_c1	nmdc:mga03n38_131647_c1_150_773	207
1902	3300050492	nmdc:mga0yw44_36922_c1	nmdc:mga0yw44_36922_c1_1033_1749	207
1903	3300050492	nmdc:mga0yw44_48940_c1	nmdc:mga0yw44_48940_c1_700_1413	207
1904	3300050494	nmdc:mga06z11_27766_c1	nmdc:mga06z11_27766_c1_1960_2676	207
1905	3300050494	nmdc:mga06z11_5497_c1	nmdc:mga06z11_5497_c1_178_879	207
1906	3300050507	nmdc:mga05p37_1068505_c1	nmdc:mga05p37_1068505_c1_124_828	207
1907	3300050507	nmdc:mga05p37_22273_c1	nmdc:mga05p37_22273_c1_4011_4724	207
1908	3300050510	nmdc:mga06r32_1003985_c1	nmdc:mga06r32_1003985_c1_50_763	207
1909	3300050510	nmdc:mga06r32_381899_c1	nmdc:mga06r32_381899_c1_526_1239	207
1910	3300050511	nmdc:mga08y16_15216_c1	nmdc:mga08y16_15216_c1_2777_3400	207
1911	3300050511	nmdc:mga08y16_506_c1	nmdc:mga08y16_506_c1_5420_6043	207
1912	3300050512	nmdc:mga0n895_13618_c1	nmdc:mga0n895_13618_c1_1435_2058	207
1913	3300050512	nmdc:mga0n895_141548_c1	nmdc:mga0n895_141548_c1_1029_1742	207
1914	3300050512	nmdc:mga0n895_660550_c1	nmdc:mga0n895_660550_c1_68_784	207
1915	3300050512	nmdc:mga0n895_666826_c1	nmdc:mga0n895_666826_c1_153_866	207
1916	3300050512	nmdc:mga0n895_852606_c1	nmdc:mga0n895_852606_c1_62_685	207
1917	3300050513	nmdc:mga0rr50_174218_c1	nmdc:mga0rr50_174218_c1_334_1047	207
1918	3300050513	nmdc:mga0rr50_77964_c1	nmdc:mga0rr50_77964_c1_755_1378	207
1919	3300050513	nmdc:mga0rr50_80635_c1	nmdc:mga0rr50_80635_c1_417_1130	207
1920	3300050514	nmdc:mga08x19_801243_c1	nmdc:mga08x19_801243_c1_25_648	207
1921	3300050515	nmdc:mga0a205_2114_c1	nmdc:mga0a205_2114_c1_6832_7455	207
1922	3300050515	nmdc:mga0a205_34678_c1	nmdc:mga0a205_34678_c1_2726_3349	207
1923	3300053077	Ga0495601_0000047	Ga0495601_0000047_52679_53305	207
1924	3300053078	Ga0495612_0000780	Ga0495612_0000780_1242_1868	207
1925	3300053083	Ga0495655_0054860	Ga0495655_0054860_251_967	207
1926	3300053084	Ga0495595_0061895	Ga0495595_0061895_899_1612	207
1927	3300053084	Ga0495595_0099902	Ga0495595_0099902_209_835	207
1928	3300053085	Ga0495619_0002048	Ga0495619_0002048_2133_2759	207
1929	3300053085	Ga0495619_0150280	Ga0495619_0150280_142_858	207
1930	3300054114	Ga0501084_0263705	Ga0501084_0263705_265_984	207
1931	3300060353	Ga0501082_0018929	Ga0501082_0018929_3769_4395	207
1932	3300061734	Ga0530510_0151225	Ga0530510_0151225_844_1566	207

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02622

DUF179

Uncharacterized ACR, COG1678

68

234

0.95 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
2ew0-assembly1.cif.gz_A	x-ray crystal structure of protein q6ff54 from acinetobacter sp. adp1. northeast structural genomics consortium target asr1.	0.9151	18	200
2ew0-assembly1.cif.gz_A	x-ray crystal structure of protein q6ff54 from acinetobacter sp. adp1. northeast structural genomics consortium target asr1.	0.9001	18	200
2haf-assembly1.cif.gz_A	crystal structure of a putative translation repressor from vibrio cholerae	0.8693	1	197
2haf-assembly1.cif.gz_A	crystal structure of a putative translation repressor from vibrio cholerae	0.8558	1	197
2mui-assembly1.cif.gz_A	solution structure of the algh protein from pseudomonas aeruginosa, pa0405, upf0301	0.7973	7	207

ID	Description	Score	Start	End	Superfamily
2ew0A00	Alpha Beta;3-Layer(aba) Sandwich;VC0467-like;VC0467-like	0.9088	18	200	3.40.1740.10
2ew0A00	Alpha Beta;3-Layer(aba) Sandwich;VC0467-like;VC0467-like	0.8938	18	200	3.40.1740.10
af_P0A8W5_4_171_3.40.50.1000	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like	0.8705	21	189	3.40.50.1000
2aj2A01	Alpha Beta;3-Layer(aba) Sandwich;VC0467-like;VC0467-like	0.8557	4	197	3.40.1740.10
af_P0A8W5_4_171_3.40.50.1000	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like	0.8508	21	189	3.40.50.1000

ID	Description	Score	Start	End	GO Terms
AF-M4W589-F1-model_v4	Transcriptional regulator	0.9743	62	191	GO:0005829
AF-M9Z348-F1-model_v4	Transcriptional regulator	0.966	95	197	GO:0005829
AF-A0A434L812-F1-model_v4	YqgE/AlgH family protein	0.9637	43	196	GO:0005829
AF-A0A7L9VTP6-F1-model_v4	YqgE/AlgH family protein	0.9626	36	168	GO:0005829
AF-M4W589-F1-model_v4	Transcriptional regulator	0.9598	62	191	GO:0005829

Feature Viewer

pLDDT	pTM	Quality
82.43	0.8	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F496081

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF02622

DUF179

Uncharacterized ACR, COG1678

68

234

0.95

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map