F495995

General Info

Members Datasets Scaffolds Average Seq Length
1893 1275 1075 148

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2515154107|2515611499
Length 175
Sequence RDPQREAGHKCAASLIFSRCSLNSQSMPHFETNHVVKHSAEQMFALVADVERYPEFLPLCEALSVRSRKERDGKVLLLADMTVGYKAIRETFTTQVLLKREERIIDVNYIEGPFKYLDNVWRFEPVNDNQSIVHFCIDYEFKSRLLGALMGSMFDRAFRMFSEAFEKRADVIYGA

Samples

Sample ID Description Type Environment
1 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
2 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
3 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
4 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
5 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
6 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
7 2509276019 Ensifer aridi TW10 Isolate Nodule
8 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
9 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
10 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
11 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
12 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
13 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
14 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
15 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
16 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
17 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
18 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
19 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
20 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
21 2512875024 Mesorhizobium loti R88b Isolate Nodule
22 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
23 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
24 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
25 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
26 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
27 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
28 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
29 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
30 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
31 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
32 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
33 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
34 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
35 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
36 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
37 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
38 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
39 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
40 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
41 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
42 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
43 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
44 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
45 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
46 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
47 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
48 2516143018 Ensifer sp. BR816 Isolate Nodule
49 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
50 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
51 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
52 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
53 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
54 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
55 2519899620 Rhizobium sp. Pop5 Isolate Nodule
56 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
57 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
58 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
59 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
60 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
61 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
62 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
63 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
64 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
65 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
66 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
67 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
68 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
69 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
70 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
71 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
72 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
73 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
74 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
75 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
76 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
77 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
78 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
79 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
80 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
81 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
82 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
83 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
84 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
85 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
86 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
87 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
88 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
89 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
90 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
91 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
92 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
93 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
94 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
95 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
96 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
97 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
98 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
99 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
100 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
101 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
102 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
103 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
104 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
105 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
106 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
107 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
108 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
109 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
110 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
111 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
112 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
113 2643221557 Ensifer sp. Root558 Isolate Unclassified
114 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
115 2643221568 Rhizobium sp. Root564 Isolate Unclassified
116 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
117 2643221599 Rhizobium sp. Root708 Isolate Unclassified
118 2643221607 Rhizobium sp. Root73 Isolate Unclassified
119 2643221610 Ensifer sp. Root74 Isolate Unclassified
120 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
121 2643221626 Ensifer sp. Root31 Isolate Unclassified
122 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
123 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
124 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
125 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
126 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
127 2643221655 Ensifer sp. Root1252 Isolate Unclassified
128 2643221659 Ensifer sp. Root127 Isolate Unclassified
129 2643221668 Ensifer sp. Root423 Isolate Unclassified
130 2643221675 Ensifer sp. Root1298 Isolate Unclassified
131 2643221680 Ensifer sp. Root1312 Isolate Unclassified
132 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
133 2643221688 Rhizobium sp. Root482 Isolate Unclassified
134 2643221698 Ensifer sp. Root142 Isolate Unclassified
135 2643221712 Ensifer sp. Root258 Isolate Unclassified
136 2643221718 Rhizobium sp. Root268 Isolate Unclassified
137 2643221719 Rhizobium sp. Root274 Isolate Unclassified
138 2643221723 Ensifer sp. Root278 Isolate Unclassified
139 2643221726 Ensifer sp. Root954 Isolate Unclassified
140 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
141 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
142 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
143 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
144 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
145 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
146 2718217882 Rhizobium sp. N741 Isolate Nodule
147 2718217927 Rhizobium sp. N324 Isolate Nodule
148 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
149 2718218009 Rhizobium sp. N561 Isolate Nodule
150 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
151 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
152 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
153 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
154 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
155 2718218363 Rhizobium sp. N113 Isolate Nodule
156 2718218365 Rhizobium sp. N731 Isolate Nodule
157 2718218366 Rhizobium sp. N621 Isolate Nodule
158 2718218423 Rhizobium sp. N941 Isolate Nodule
159 2721755514 Rhizobium sp. N6212 Isolate Nodule
160 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
161 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
162 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
163 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
164 2721755809 Rhizobium sp. N541 Isolate Nodule
165 2721755810 Rhizobium sp. N871 Isolate Nodule
166 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
167 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
168 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
169 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
170 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
171 2728369365 Rhizobium sp. N1341 Isolate Nodule
172 2728369397 Rhizobium sp. N1314 Isolate Nodule
173 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
174 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
175 2738543024 Aminobacter sp. AP02 Isolate Unclassified
176 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
177 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
178 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
179 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
180 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
181 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
182 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
183 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
184 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
185 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
186 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
187 2791355256 Rhizobium sp. M10 Isolate Nodule
188 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
189 2791355260 Rhizobium sp. L9 Isolate Nodule
190 2791355261 Rhizobium sp. J15 Isolate Nodule
191 2791355262 Rhizobium sp. M1 Isolate Nodule
192 2791355263 Rhizobium chutanense C5 Isolate Nodule
193 2791355264 Rhizobium sp. S9 Isolate Nodule
194 2791355265 Rhizobium sp. H4 Isolate Nodule
195 2791355266 Rhizobium sp. L43 Isolate Nodule
196 2791355267 Rhizobium sp. L18 Isolate Nodule
197 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
198 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
199 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
200 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
201 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
202 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
203 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
204 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
205 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
206 2802429633 Rhizobium anhuiense J3 Isolate Nodule
207 2802429634 Rhizobium anhuiense S10 Isolate Nodule
208 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
209 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
210 2802429637 Rhizobium anhuiense C15 Isolate Nodule
211 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
212 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
213 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
214 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
215 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
216 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
217 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
218 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
219 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
220 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
221 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
222 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
223 2838048938 Rhizobium pisi 27/80 Isolate Nodule
224 2838061910 Rhizobium phaseoli L15 Isolate Nodule
225 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
226 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
227 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
228 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
229 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
230 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
231 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
232 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
233 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
234 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
235 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
236 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
237 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
238 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
239 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
240 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
241 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
242 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
243 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
244 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
245 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
246 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
247 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
248 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
249 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
250 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
251 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
252 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
253 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
254 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
255 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
256 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
257 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
258 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
259 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
260 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
261 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
262 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
263 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
264 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
265 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
266 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
267 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
268 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
269 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
270 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
271 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
272 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
273 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
274 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
275 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
276 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
277 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
278 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
279 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
280 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
281 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
282 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
283 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
284 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
285 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
286 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
287 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
288 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
289 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
290 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
291 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
292 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
293 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
294 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
295 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
296 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
297 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
298 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
299 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
300 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
301 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
302 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
303 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
304 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
305 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
306 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
307 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
308 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
309 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
310 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
311 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
312 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
313 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
314 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
315 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
316 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
317 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
318 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
319 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
320 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
321 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
322 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
323 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
324 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
325 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
326 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
327 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
328 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
329 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
330 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
331 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
332 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
333 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
334 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
335 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
336 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
337 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
338 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
339 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
340 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
341 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
342 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
343 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
344 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
345 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
346 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
347 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
348 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
349 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
350 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
351 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
352 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
353 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
354 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
355 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
356 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
357 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
358 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
359 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
360 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
361 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
362 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
363 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
364 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
365 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
366 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
367 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
368 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
369 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
370 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
371 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
372 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
373 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
374 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
375 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
376 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
377 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
378 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
379 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
380 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
381 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
382 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
383 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
384 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
385 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
386 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
387 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
388 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
389 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
390 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
391 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
392 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
393 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
394 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
395 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
396 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
397 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
398 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
399 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
400 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
401 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
402 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
403 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
404 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
405 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
406 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
407 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
408 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
409 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
410 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
411 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
412 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
413 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
414 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
415 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
416 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
417 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
418 2909042592 Labrys sp. LIt4 Isolate Nodule
419 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
420 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
421 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
422 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
423 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
424 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
425 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
426 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
427 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
428 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
429 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
430 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
431 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
432 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
433 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
434 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
435 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
436 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
437 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
438 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
439 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
440 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
441 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
442 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
443 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
444 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
445 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
446 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
447 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
448 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
449 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
450 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
451 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
452 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
453 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
454 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
455 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
456 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
457 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
458 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
459 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
460 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
461 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
462 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
463 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
464 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
465 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
466 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
467 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
468 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
469 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
470 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
471 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
472 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
473 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
474 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
475 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
476 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
477 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
478 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
479 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
480 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
481 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
482 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
483 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
484 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
485 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
486 2933599457 Rhizobium phaseoli M3 Isolate Nodule
487 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
488 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
489 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
490 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
491 2936381700 Rhizobium chutanense C16 Isolate Unclassified
492 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
493 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
494 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
495 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
496 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
497 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
498 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
499 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
500 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
501 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
502 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
503 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
504 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
505 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
506 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
507 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
508 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
509 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
510 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
511 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
512 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
513 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
514 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
515 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
516 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
517 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
518 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
519 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
520 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
521 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
522 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
523 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
524 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
525 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
526 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
527 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
528 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
529 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
530 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
531 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
532 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
533 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
534 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
535 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
536 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
537 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
538 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
539 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
540 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
541 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
542 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
543 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
544 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
545 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
546 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
547 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
548 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
549 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
550 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
551 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
552 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
553 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
554 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
555 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
556 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
557 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
558 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
559 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
560 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
561 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
562 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
563 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
564 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
565 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
566 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
567 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
568 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
569 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
570 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
571 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
572 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
573 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
574 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
575 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
576 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
577 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
578 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
579 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
580 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
581 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
582 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
583 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
584 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
585 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
586 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
587 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
588 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
589 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
590 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
591 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
592 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
593 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
594 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
595 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
596 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
597 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
598 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
599 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
600 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
601 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
602 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
603 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
604 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
605 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
606 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
607 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
608 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
609 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
610 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
611 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
612 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
613 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
614 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
615 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
616 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
617 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
618 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
619 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
620 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
621 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
622 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
623 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
624 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
625 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
626 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
627 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
628 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
629 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
630 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
631 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
632 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
633 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
634 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
635 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
636 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
637 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
638 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
639 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
640 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
641 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
642 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
643 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
644 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
645 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
646 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
647 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
648 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
649 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
650 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
651 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
652 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
653 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
654 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
655 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
656 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
657 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
658 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
659 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
660 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
661 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
662 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
663 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
664 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
665 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
666 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
667 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
668 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
669 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
670 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
671 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
672 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
673 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
674 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
675 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
676 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
677 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
678 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
679 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
680 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
681 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
682 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
683 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
684 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
685 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
686 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
687 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
688 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
689 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
690 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
691 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
692 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
693 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
694 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
695 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
696 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
697 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
698 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
699 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
700 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
701 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
702 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
703 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
704 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
705 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
706 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
707 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
708 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
709 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
710 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
711 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
712 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
713 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
714 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
715 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
716 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
717 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
718 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
719 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
720 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
721 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
722 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
723 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
724 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
725 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
726 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
727 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
728 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
729 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
730 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
731 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
732 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
733 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
734 2996887358 Rhizobium sp. R711 Isolate Nodule
735 2996893221 Rhizobium sp. R635 Isolate Nodule
736 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
737 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
738 3004167301 Mesorhizobium loti 582 Isolate Unclassified
739 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
740 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
741 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
742 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
743 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
744 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
745 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
746 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
747 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
748 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
749 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
750 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
751 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
752 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
753 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
754 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
755 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
756 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
757 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
758 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
759 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
760 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
761 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
762 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
763 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
764 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
765 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
766 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
767 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
768 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
769 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
770 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
771 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
772 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
773 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
774 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
775 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
776 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
777 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
778 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
779 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
780 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
781 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
782 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
783 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
784 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
785 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
786 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
787 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
788 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
789 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
790 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
791 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
792 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
793 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
794 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
795 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
796 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
797 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
798 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
799 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
800 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
801 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
802 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
803 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
804 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
805 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
806 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
807 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
808 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
809 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
810 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
811 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
812 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
813 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
814 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
815 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
816 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
817 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
818 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
819 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
820 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
821 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
822 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
823 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
824 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
825 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
826 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
827 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
828 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
829 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
830 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
831 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
832 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
833 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
834 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
835 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
836 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
837 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
838 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
839 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
840 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
841 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
842 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
843 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
844 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
845 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
846 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
847 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
848 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
849 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
850 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
851 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
852 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
853 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
854 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
855 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
856 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
857 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
858 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
859 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
860 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
861 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
862 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
863 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
864 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
865 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
866 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
867 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
868 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
869 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
870 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
871 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
872 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
873 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
874 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
875 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
876 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
877 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
878 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
879 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
880 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
881 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
882 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
883 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
884 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
885 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
886 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
887 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
888 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
889 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
890 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
891 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
892 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
893 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
894 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
895 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
896 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
897 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
898 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
899 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
900 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
901 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
902 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
903 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
904 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
905 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
906 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
907 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
908 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
909 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
910 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
911 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
912 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
913 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
914 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
915 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
916 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
917 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
918 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
919 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
920 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
921 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
922 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
923 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
924 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
925 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
926 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
927 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
928 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
929 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
930 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
931 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
932 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
933 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
934 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
935 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
936 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
937 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
938 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
939 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
940 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
941 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
942 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
943 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
944 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
945 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
946 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
947 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
948 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
949 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
950 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
951 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
952 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
953 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
954 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
955 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
956 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
957 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
958 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
959 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
960 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
961 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
962 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
963 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
964 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
965 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
966 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
967 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
968 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
969 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
970 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
971 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
972 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
973 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
974 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
975 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
976 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
977 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
978 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
979 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
980 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
981 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
982 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
983 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
984 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
985 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
986 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
987 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
988 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
989 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
990 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
991 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
992 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
993 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
994 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
995 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
996 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
997 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
998 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
999 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
1000 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
1001 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
1002 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
1003 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
1004 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
1005 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
1006 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
1007 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
1008 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
1009 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
1010 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
1011 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
1012 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
1013 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
1014 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
1015 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
1016 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
1017 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
1018 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
1019 3300041497 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT Metatranscriptome Unclassified
1020 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
1021 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
1022 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
1023 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
1024 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
1025 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
1026 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
1027 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
1028 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
1029 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
1030 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
1031 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
1032 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
1033 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
1034 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
1035 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
1036 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
1037 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
1038 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
1039 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
1040 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
1041 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
1042 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
1043 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
1044 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
1045 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
1046 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
1047 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
1048 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
1049 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
1050 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
1051 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
1052 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
1053 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
1054 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
1055 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
1056 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
1057 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
1058 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
1059 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
1060 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
1061 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
1062 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
1063 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
1064 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
1065 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
1066 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
1067 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
1068 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
1069 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
1070 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
1071 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
1072 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
1073 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
1074 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
1075 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
1076 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
1077 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
1078 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
1079 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
1080 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
1081 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
1082 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
1083 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
1084 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
1085 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
1086 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
1087 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
1088 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
1089 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
1090 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
1091 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
1092 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
1093 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
1094 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
1095 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
1096 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
1097 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
1098 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
1099 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
1100 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
1101 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
1102 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
1103 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
1104 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
1105 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
1106 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
1107 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
1108 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
1109 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
1110 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
1111 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
1112 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
1113 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
1114 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
1115 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
1116 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
1117 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
1118 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
1119 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
1120 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
1121 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
1122 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
1123 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
1124 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
1125 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
1126 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
1127 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
1128 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
1129 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
1130 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
1131 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
1132 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
1133 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
1134 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
1135 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
1136 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
1137 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
1138 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
1139 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
1140 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
1141 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
1142 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
1143 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
1144 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
1145 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
1146 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
1147 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
1148 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
1149 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
1150 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
1151 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
1152 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
1153 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
1154 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
1155 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
1156 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
1157 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
1158 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
1159 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
1160 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
1161 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
1162 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
1163 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
1164 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
1165 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
1166 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
1167 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
1168 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
1169 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
1170 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
1171 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
1172 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
1173 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
1174 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
1175 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
1176 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
1177 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
1178 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
1179 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
1180 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
1181 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
1182 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
1183 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
1184 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
1185 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
1186 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
1187 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
1188 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
1189 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
1190 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
1191 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
1192 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
1193 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
1194 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
1195 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
1196 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
1197 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
1198 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
1199 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
1200 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
1201 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
1202 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
1203 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
1204 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
1205 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
1206 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
1207 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
1208 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
1209 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1210 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1211 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
1212 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
1213 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
1214 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
1215 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
1216 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
1217 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
1218 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
1219 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
1220 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
1221 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
1222 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
1223 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
1224 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
1225 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
1226 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
1227 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
1228 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
1229 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
1230 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
1231 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
1232 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
1233 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
1234 8005258706 Rhizobium sp. R693 Isolate Nodule
1235 8005275841 Rhizobium sp. N4311 Isolate Nodule
1236 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
1237 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
1238 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
1239 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
1240 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
1241 8005321885 Rhizobium sp. R72 Isolate Nodule
1242 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
1243 8005382845 Rhizobium sp. R634 Isolate Nodule
1244 8005395548 Rhizobium sp. R339 Isolate Nodule
1245 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
1246 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
1247 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
1248 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
1249 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
1250 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
1251 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
1252 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
1253 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
1254 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
1255 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
1256 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
1257 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
1258 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
1259 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
1260 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
1261 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
1262 8018176218 Rhizobium sp. N122 Isolate Nodule
1263 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
1264 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
1265 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
1266 8024501048 Rhizobium sp. H4 Isolate Nodule
1267 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
1268 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
1269 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
1270 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
1271 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
1272 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
1273 8056382006 Rhizobium croatiense 13T Isolate Nodule
1274 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
1275 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 56.52
Metatranscriptomes 0.26
Isolates 43.21

Biome Distribution

Category Percentage (%)
Aerial Root 0.26
Bulb 0
Endosphere 14.26
Nodule 35.55
Rhizoplane 2.32
Rhizosphere 35.82
Stem 0
Stem Tuber 0
Unclassified 11.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 2214702717 2209111006 Bacteria 511
2 JGI24740J21852_10024850 3300001979 Bacteria 2026
3 JGI24739J22299_10085637 3300001989 Bacteria 963
4 JGI24735J21928_10045816 3300002067 Bacteria 1269
5 JGI25155J39150_1000011 3300002704 Bacteria 207685
6 JGI25156J39149_1000027 3300002705 Bacteria 127396
7 JGI25156J39149_1000030 3300002705 Bacteria 126029
8 JGI25156J39149_1004453 3300002705 Bacteria 4265
9 JGI25154J39366_1000057 3300002738 Bacteria 110584
10 JGI25157J39369_1000010 3300002741 Bacteria 207685
11 JGI25157J39369_1000604 3300002741 Bacteria 20770
12 JGI25152J39213_1002131 3300002773 Bacteria 7762
13 JGI25150J39212_1004304 3300002774 Bacteria 3185
14 JGI25159J45721_1000006 3300002987 Bacteria 188201
15 JGI25151J46595_10000238 3300003187 Bacteria 64884
16 JGI25151J46595_10009568 3300003187 Bacteria 4573
17 JGI25406J46586_10008536 3300003203 Bacteria 4633
18 JGI25406J46586_10045653 3300003203 Bacteria 1506
19 JGI25165J46597_1000033 3300003214 Bacteria 293030
20 JGI25165J46597_1000777 3300003214 Bacteria 24294
21 JGI25165J46597_1007469 3300003214 Bacteria 1811
22 JGI25153J46596_10002466 3300003215 Bacteria 10638
23 JGI25153J46596_10010613 3300003215 Bacteria 4148
24 JGI25153J46596_10070545 3300003215 Bacteria 906
25 rootH2_10012004 3300003320 Bacteria 1765
26 rootH2_10040546 3300003320 Bacteria 5255
27 rootL2_10034778 3300003322 Bacteria 2514
28 rootH1_10017647 3300003323 Bacteria 1657
29 rootH1_10113295 3300003323 Bacteria 2515
30 JGI25160J50197_1000004 3300003354 Bacteria 419797
31 JGI25160J50197_1000019 3300003354 Bacteria 233980
32 JGI25160J50197_1004387 3300003354 Bacteria 6112
33 JGI25160J50197_1036036 3300003354 Bacteria 1206
34 JGI25160J50197_1043041 3300003354 Bacteria 1021
35 JGI25161J50226_1000003 3300003374 Bacteria 413345
36 JGI25161J50226_1000330 3300003374 Bacteria 25735
37 JGI25161J50226_1001454 3300003374 Bacteria 7115
38 JGI25161J50226_1008427 3300003374 Bacteria 1589
39 Ga0055542_1000762 3300003762 Bacteria 24410
40 Ga0055529_1002106 3300003763 Bacteria 4232
41 Ga0055526_1000565 3300003771 Bacteria 29180
42 Ga0055526_1000669 3300003771 Bacteria 26309
43 Ga0055526_1002226 3300003771 Bacteria 13285
44 Ga0055526_1040249 3300003771 Bacteria 1180
45 Ga0055524_1004582 3300003775 Bacteria 6358
46 Ga0055524_1006212 3300003775 Bacteria 5213
47 Ga0055524_1007214 3300003775 Bacteria 4752
48 Ga0055524_1010237 3300003775 Bacteria 3747
49 Ga0055524_1035612 3300003775 Bacteria 1354
50 Ga0055536_1000212 3300003781 Bacteria 47611
51 Ga0055536_1004763 3300003781 Bacteria 6809
52 Ga0055534_1047945 3300003784 Bacteria 613
53 Ga0055528_1000918 3300003790 Bacteria 19824
54 Ga0055528_1005988 3300003790 Bacteria 5570
55 Ga0055528_1008737 3300003790 Bacteria 4297
56 Ga0055528_1015144 3300003790 Bacteria 2802
57 Ga0055528_1020888 3300003790 Bacteria 2102
58 Ga0055530_10015221 3300003791 Bacteria 2523
59 Ga0055530_10068443 3300003791 Bacteria 772
60 Ga0055540_1000285 3300003792 Bacteria 45310
61 Ga0055540_1001884 3300003792 Bacteria 11760
62 Ga0055540_1002932 3300003792 Bacteria 8600
63 Ga0055540_1023537 3300003792 Bacteria 1549
64 Ga0055540_1026148 3300003792 Bacteria 1416
65 Ga0055540_1059536 3300003792 Bacteria 766
66 Ga0055540_1059940 3300003792 Bacteria 763
67 Ga0055531_10001165 3300003794 Bacteria 20245
68 Ga0055531_10014995 3300003794 Bacteria 3448
69 Ga0055531_10069570 3300003794 Bacteria 818
70 Ga0058692_1004051 3300003856 Bacteria 4402
71 Ga0055543_1000001 3300004625 Bacteria 419949
72 Ga0055543_1000019 3300004625 Bacteria 161035
73 Ga0055543_1000147 3300004625 Bacteria 58621
74 Ga0055543_1000808 3300004625 Bacteria 15443
75 Ga0065165_1000049 3300005262 Bacteria 195588
76 Ga0065165_1000180 3300005262 Bacteria 111768
77 Ga0065165_1005995 3300005262 Bacteria 6555
78 Ga0065165_1017852 3300005262 Bacteria 2595
79 Ga0065165_1024195 3300005262 Bacteria 2044
80 Ga0070658_10032973 3300005327 Bacteria 4165
81 Ga0070658_11253983 3300005327 Bacteria 644
82 Ga0070670_100001443 3300005331 Bacteria 19089
83 Ga0068869_101109938 3300005334 Bacteria 692
84 Ga0070687_100035726 3300005343 Bacteria 2470
85 Ga0070661_100680165 3300005344 Bacteria 837
86 Ga0070668_100629226 3300005347 Bacteria 941
87 Ga0070675_100238243 3300005354 Bacteria 1589
88 Ga0070671_100310609 3300005355 Bacteria 1343
89 Ga0070671_100434568 3300005355 Bacteria 1125
90 Ga0070674_100319133 3300005356 Bacteria 1245
91 Ga0070659_100090030 3300005366 Bacteria 2459
92 Ga0070667_101468578 3300005367 Bacteria 640
93 Ga0070703_10001607 3300005406 Bacteria 6715
94 Ga0070709_10145167 3300005434 Bacteria 1634
95 Ga0070701_10001368 3300005438 Bacteria 8996
96 Ga0070711_100859884 3300005439 Bacteria 772
97 Ga0070705_100000487 3300005440 Bacteria 22874
98 Ga0070700_100003143 3300005441 Bacteria 8482
99 Ga0070694_100023927 3300005444 Bacteria 3936
100 Ga0070708_100029082 3300005445 Bacteria 4763
101 Ga0070663_100004621 3300005455 Bacteria 8109
102 Ga0070663_101228536 3300005455 Bacteria 659
103 Ga0070662_100411200 3300005457 Bacteria 1118
104 Ga0070662_100910096 3300005457 Bacteria 751
105 Ga0070662_101332326 3300005457 Bacteria 618
106 Ga0070681_10171682 3300005458 Bacteria 2090
107 Ga0070706_100058590 3300005467 Bacteria 3554
108 Ga0070698_100665481 3300005471 Bacteria 983
109 Ga0070699_100002474 3300005518 Bacteria 16609
110 Ga0070679_100050610 3300005530 Bacteria 4138
111 Ga0070679_100065325 3300005530 Bacteria 3627
112 Ga0070697_100000987 3300005536 Bacteria 21511
113 Ga0070697_100119415 3300005536 Bacteria 2204
114 Ga0068853_100002083 3300005539 Bacteria 14829
115 Ga0068853_100320060 3300005539 Bacteria 1438
116 Ga0068853_101041001 3300005539 Bacteria 788
117 Ga0070686_100403550 3300005544 Bacteria 1040
118 Ga0070695_100004914 3300005545 Bacteria 7882
119 Ga0070696_100001714 3300005546 Bacteria 14378
120 Ga0070693_100064714 3300005547 Bacteria 2135
121 Ga0070665_100100274 3300005548 Bacteria 2900
122 Ga0070665_100166889 3300005548 Bacteria 2204
123 Ga0070665_100244907 3300005548 Bacteria 1793
124 Ga0070665_100287216 3300005548 Bacteria 1647
125 Ga0070665_100464658 3300005548 Bacteria 1276
126 Ga0070665_100642398 3300005548 Bacteria 1074
127 Ga0070665_100715156 3300005548 Bacteria 1015
128 Ga0070704_100004568 3300005549 Bacteria 7999
129 Ga0068855_100081541 3300005563 Bacteria 3749
130 Ga0068855_100147887 3300005563 Bacteria 2673
131 Ga0068855_101151476 3300005563 Bacteria 808
132 Ga0068857_100030653 3300005577 Bacteria 4750
133 Ga0068857_100057532 3300005577 Bacteria 3451
134 Ga0068856_100069999 3300005614 Bacteria 3470
135 Ga0068856_100108448 3300005614 Bacteria 2773
136 Ga0068856_100382539 3300005614 Bacteria 1427
137 Ga0068856_100523781 3300005614 Bacteria 1207
138 Ga0068852_100082239 3300005616 Bacteria 2861
139 Ga0068852_101959714 3300005616 Bacteria 608
140 Ga0068859_100011400 3300005617 Bacteria 8936
141 Ga0068859_100051166 3300005617 Bacteria 4151
142 Ga0068864_100081043 3300005618 Bacteria 2845
143 Ga0068851_10104616 3300005834 Bacteria 1505
144 Ga0068863_100170600 3300005841 Bacteria 2087
145 Ga0068858_100051707 3300005842 Bacteria 3802
146 Ga0068858_100136804 3300005842 Bacteria 2299
147 Ga0068860_100007101 3300005843 Bacteria 11206
148 Ga0068860_100877418 3300005843 Bacteria 913
149 Ga0068862_100011359 3300005844 Bacteria 7353
150 Ga0081455_10262695 3300005937 Bacteria 1257
151 Ga0081455_10706243 3300005937 Bacteria 642
152 Ga0081539_10001354 3300005985 Bacteria 42654
153 Ga0081539_10002915 3300005985 Bacteria 22591
154 Ga0075365_10000771 3300006038 Bacteria 13047
155 Ga0075365_10019973 3300006038 Bacteria 4145
156 Ga0075365_10028318 3300006038 Bacteria 3573
157 Ga0075365_10049392 3300006038 Bacteria 2772
158 Ga0075365_10055143 3300006038 Bacteria 2637
159 Ga0075365_10253425 3300006038 Bacteria 1237
160 Ga0075365_10365111 3300006038 Bacteria 1018
161 Ga0075365_10536379 3300006038 Bacteria 827
162 Ga0075368_10058667 3300006042 Bacteria 1538
163 Ga0075368_10063670 3300006042 Bacteria 1480
164 Ga0075368_10119436 3300006042 Bacteria 1091
165 Ga0075363_100012667 3300006048 Bacteria 4068
166 Ga0075363_100050250 3300006048 Bacteria 2221
167 Ga0075363_100099987 3300006048 Bacteria 1604
168 Ga0075363_100100272 3300006048 Bacteria 1602
169 Ga0075363_100133720 3300006048 Bacteria 1392
170 Ga0075363_100731597 3300006048 Bacteria 599
171 Ga0075364_10008131 3300006051 Bacteria 6257
172 Ga0075364_10120674 3300006051 Bacteria 1754
173 Ga0075364_10148623 3300006051 Bacteria 1578
174 Ga0075364_10920067 3300006051 Bacteria 595
175 Ga0070715_10383836 3300006163 Bacteria 776
176 Ga0075362_10051910 3300006177 Bacteria 1836
177 Ga0075362_10224417 3300006177 Bacteria 919
178 Ga0075367_10026480 3300006178 Bacteria 3290
179 Ga0075367_10050505 3300006178 Bacteria 2456
180 Ga0075367_10087828 3300006178 Bacteria 1889
181 Ga0075367_10184751 3300006178 Bacteria 1300
182 Ga0075367_10197438 3300006178 Bacteria 1257
183 Ga0075367_10279322 3300006178 Bacteria 1050
184 Ga0075367_10516081 3300006178 Bacteria 758
185 Ga0075369_10002912 3300006186 Bacteria 6173
186 Ga0075369_10004806 3300006186 Bacteria 5024
187 Ga0075369_10019597 3300006186 Bacteria 2763
188 Ga0075369_10086170 3300006186 Bacteria 1398
189 Ga0075369_10097492 3300006186 Bacteria 1317
190 Ga0075369_10316536 3300006186 Bacteria 730
191 Ga0075366_10003432 3300006195 Bacteria 8356
192 Ga0075366_10365675 3300006195 Bacteria 886
193 Ga0075370_10006155 3300006353 Bacteria 6019
194 Ga0075370_10041398 3300006353 Bacteria 2601
195 Ga0075370_10070723 3300006353 Bacteria 1996
196 Ga0075370_10165121 3300006353 Bacteria 1300
197 Ga0075370_10208580 3300006353 Bacteria 1153
198 Ga0075370_10619750 3300006353 Bacteria 656
199 Ga0075428_100157306 3300006844 Bacteria 2468
200 Ga0075430_100013715 3300006846 Bacteria 6908
201 Ga0075431_100001091 3300006847 Bacteria 24310
202 Ga0075433_10445911 3300006852 Bacteria 1141
203 Ga0075429_100764842 3300006880 Unclassified 846
204 Ga0068865_101490036 3300006881 Bacteria 606
205 Ga0097620_100011399 3300006931 Bacteria 8936
206 Ga0097620_100051168 3300006931 Bacteria 4151
207 Ga0079104_1000187 3300006946 Bacteria 86957
208 Ga0079104_1001924 3300006946 Bacteria 12460
209 Ga0099826_10004117 3300006948 Bacteria 10107
210 Ga0075435_100061966 3300007076 Bacteria 3035
211 Ga0099794_10068986 3300007265 Unclassified 1729
212 Ga0099794_10384984 3300007265 Unclassified 732
213 Ga0099795_10321821 3300007788 Unclassified 685
214 Ga0105251_10011989 3300009011 Bacteria 4921
215 Ga0105240_10000005 3300009093 Bacteria 702630
216 Ga0105240_10483353 3300009093 Bacteria 1380
217 Ga0105240_10698477 3300009093 Bacteria 1107
218 Ga0105240_10799296 3300009093 Bacteria 1022
219 Ga0105245_10504020 3300009098 Bacteria 1227
220 Ga0105245_11155304 3300009098 Bacteria 821
221 Ga0105247_10011923 3300009101 Bacteria 5225
222 Ga0105247_11150484 3300009101 Bacteria 615
223 Ga0105243_10121413 3300009148 Bacteria 2203
224 Ga0105243_10175176 3300009148 Bacteria 1861
225 Ga0105241_10012824 3300009174 Bacteria 6153
226 Ga0105241_10203860 3300009174 Bacteria 1654
227 Ga0105241_10389862 3300009174 Bacteria 1219
228 Ga0105237_10002240 3300009545 Bacteria 24098
229 Ga0105238_10038126 3300009551 Bacteria 4882
230 Ga0105238_10605306 3300009551 Bacteria 1104
231 Ga0105238_11301184 3300009551 Bacteria 753
232 Ga0105249_10000834 3300009553 Bacteria 27750
233 Ga0105249_12837275 3300009553 Bacteria 556
234 Ga0123341_1000001 3300009765 Bacteria 314908
235 Ga0123342_1008195 3300009766 Bacteria 13325
236 Ga0123342_1028840 3300009766 Bacteria 2947
237 Ga0099796_10020084 3300010159 Bacteria 2036
238 Ga0105239_10000739 3300010375 Bacteria 46483
239 Ga0105239_10164100 3300010375 Bacteria 2483
240 Ga0105239_10558827 3300010375 Bacteria 1304
241 Ga0105239_10799707 3300010375 Bacteria 1080
242 Ga0105239_11064602 3300010375 Bacteria 931
243 Ga0105246_10016031 3300011119 Bacteria 4741
244 Ga0105246_11329567 3300011119 Bacteria 667
245 Ga0157319_1053546 3300012497 Bacteria 508
246 Ga0157371_10005765 3300013102 Bacteria 10378
247 Ga0157371_10275070 3300013102 Bacteria 1216
248 Ga0157370_10000284 3300013104 Bacteria 64323
249 Ga0157370_10337116 3300013104 Bacteria 1390
250 Ga0157369_11347411 3300013105 Bacteria 727
251 Ga0171463_1011 3300013249 Bacteria 230603
252 Ga0157374_10261982 3300013296 Bacteria 1703
253 Ga0157374_10515065 3300013296 Bacteria 1202
254 Ga0157374_11875973 3300013296 Bacteria 625
255 Ga0157378_10428295 3300013297 Bacteria 1309
256 Ga0157378_10821988 3300013297 Bacteria 956
257 Ga0157378_10858029 3300013297 Bacteria 937
258 Ga0157372_10704181 3300013307 Bacteria 1175
259 Ga0157372_11034046 3300013307 Bacteria 951
260 Ga0157372_11765158 3300013307 Bacteria 712
261 Ga0157375_11897175 3300013308 Bacteria 707
262 Ga0157375_12566204 3300013308 Bacteria 609
263 Ga0163163_11471464 3300014325 Bacteria 743
264 Ga0163163_11571178 3300014325 Bacteria 719
265 Ga0182008_10132875 3300014497 Bacteria 1242
266 Ga0182008_10336259 3300014497 Bacteria 798
267 Ga0182006_1014407 3300015261 Bacteria 3410
268 Ga0182007_10108824 3300015262 Bacteria 921
269 Ga0182007_10287558 3300015262 Bacteria 600
270 Ga0182005_1003903 3300015265 Bacteria 4936
271 Ga0182005_1006191 3300015265 Bacteria 3676
272 Ga0183363_1111 3300015690 Bacteria 22277
273 Ga0163161_10684764 3300017792 Bacteria 852
274 Ga0163161_11316251 3300017792 Bacteria 628
275 Ga0214544_1000265 3300021320 Bacteria 87060
276 Ga0214542_1000015 3300021321 Bacteria 227912
277 Ga0214543_1000011 3300021327 Bacteria 344093
278 Ga0214543_1000032 3300021327 Bacteria 200766
279 Ga0228711_1000012 3300022739 Bacteria 132594
280 Ga0228710_1000006 3300022740 Bacteria 209134
281 Ga0209435_100022 3300025206 Bacteria 207766
282 Ga0209436_100038 3300025208 Bacteria 76733
283 Ga0209436_100837 3300025208 Bacteria 12443
284 Ga0209436_111465 3300025208 Bacteria 1556
285 Ga0209672_111952 3300025228 Bacteria 1097
286 Ga0209437_100160 3300025233 Bacteria 149451
287 Ga0209437_100310 3300025233 Bacteria 65905
288 Ga0207425_1011762 3300025245 Bacteria 2073
289 Ga0207425_1017027 3300025245 Bacteria 1605
290 Ga0207425_1021384 3300025245 Bacteria 1372
291 Ga0207425_1032792 3300025245 Bacteria 1027
292 Ga0207425_1046284 3300025245 Bacteria 811
293 Ga0209646_1000078 3300025246 Bacteria 207766
294 Ga0209026_1000002 3300025250 Bacteria 1136158
295 Ga0209026_1000065 3300025250 Bacteria 207766
296 Ga0209677_101256 3300025253 Bacteria 11408
297 Ga0209148_1000570 3300025254 Bacteria 34441
298 Ga0209759_1000055 3300025256 Bacteria 207766
299 Ga0209759_1000119 3300025256 Bacteria 141051
300 Ga0209759_1012005 3300025256 Bacteria 2425
301 Ga0209129_1000349 3300025258 Bacteria 38942
302 Ga0209129_1000432 3300025258 Bacteria 31411
303 Ga0209129_1000442 3300025258 Bacteria 30980
304 Ga0209129_1002862 3300025258 Bacteria 7972
305 Ga0209129_1012729 3300025258 Bacteria 1904
306 Ga0209233_1000027 3300025261 Bacteria 652089
307 Ga0209233_1000168 3300025261 Bacteria 149312
308 Ga0209233_1000269 3300025261 Bacteria 74071
309 Ga0209233_1000303 3300025261 Bacteria 59138
310 Ga0209455_1000204 3300025272 Bacteria 85420
311 Ga0209673_1000068 3300025273 Bacteria 245891
312 Ga0209673_1000139 3300025273 Bacteria 157765
313 Ga0209673_1001538 3300025273 Bacteria 20946
314 Ga0209673_1002227 3300025273 Bacteria 14064
315 Ga0209673_1005579 3300025273 Bacteria 6290
316 Ga0209673_1008099 3300025273 Bacteria 4725
317 Ga0209673_1015353 3300025273 Bacteria 2915
318 Ga0209673_1056305 3300025273 Bacteria 1007
319 Ga0209130_1000007 3300025284 Bacteria 591584
320 Ga0209130_1000012 3300025284 Bacteria 421329
321 Ga0209130_1000097 3300025284 Bacteria 143750
322 Ga0209130_1015683 3300025284 Bacteria 1858
323 Ga0209130_1029780 3300025284 Bacteria 1134
324 Ga0209675_1050911 3300025291 Bacteria 855
325 Ga0209675_1061028 3300025291 Bacteria 745
326 Ga0209676_1000399 3300025292 Bacteria 79312
327 Ga0209676_1006026 3300025292 Bacteria 6116
328 Ga0209025_1000237 3300025294 Bacteria 128553
329 Ga0209025_1000358 3300025294 Bacteria 97655
330 Ga0209025_1000729 3300025294 Bacteria 55773
331 Ga0209025_1000923 3300025294 Bacteria 45012
332 Ga0209025_1000949 3300025294 Bacteria 43938
333 Ga0209025_1004865 3300025294 Bacteria 11329
334 Ga0209025_1005123 3300025294 Bacteria 10878
335 Ga0209025_1058527 3300025294 Bacteria 1463
336 Ga0209025_1071341 3300025294 Bacteria 1231
337 Ga0209025_1099690 3300025294 Bacteria 923
338 Ga0209025_1131642 3300025294 Bacteria 726
339 Ga0209564_1000140 3300025295 Bacteria 179856
340 Ga0209564_1000794 3300025295 Bacteria 43506
341 Ga0209564_1000802 3300025295 Bacteria 43078
342 Ga0209564_1000868 3300025295 Bacteria 40261
343 Ga0209564_1001618 3300025295 Bacteria 21851
344 Ga0209564_1005687 3300025295 Bacteria 6993
345 Ga0209564_1014049 3300025295 Bacteria 3356
346 Ga0209564_1041733 3300025295 Bacteria 1227
347 Ga0209758_1000155 3300025297 Bacteria 160455
348 Ga0209758_1000545 3300025297 Bacteria 59830
349 Ga0209758_1000587 3300025297 Bacteria 56803
350 Ga0209758_1001100 3300025297 Bacteria 34985
351 Ga0209758_1002445 3300025297 Bacteria 18964
352 Ga0209758_1007782 3300025297 Bacteria 7170
353 Ga0209758_1019396 3300025297 Bacteria 3280
354 Ga0209758_1026684 3300025297 Bacteria 2492
355 Ga0209758_1100007 3300025297 Bacteria 827
356 Ga0209050_1000650 3300025298 Bacteria 53753
357 Ga0209050_1005095 3300025298 Bacteria 8471
358 Ga0209050_1021205 3300025298 Bacteria 2378
359 Ga0209256_1000557 3300025299 Bacteria 53444
360 Ga0209256_1000687 3300025299 Bacteria 45327
361 Ga0209256_1001048 3300025299 Bacteria 32169
362 Ga0209256_1001371 3300025299 Bacteria 25602
363 Ga0209256_1004147 3300025299 Bacteria 9357
364 Ga0209256_1004371 3300025299 Bacteria 8941
365 Ga0209256_1010809 3300025299 Bacteria 3756
366 Ga0209256_1023871 3300025299 Bacteria 1814
367 Ga0209256_1048199 3300025299 Bacteria 1044
368 Ga0207426_1000003 3300025302 Bacteria 1063212
369 Ga0207426_1000010 3300025302 Bacteria 796003
370 Ga0207426_1000094 3300025302 Bacteria 275293
371 Ga0207426_1000111 3300025302 Bacteria 234032
372 Ga0207426_1001840 3300025302 Bacteria 15628
373 Ga0209051_1000095 3300025303 Bacteria 167840
374 Ga0209051_1001031 3300025303 Bacteria 26450
375 Ga0209051_1001191 3300025303 Bacteria 23500
376 Ga0209051_1003503 3300025303 Bacteria 10260
377 Ga0209051_1007144 3300025303 Bacteria 6154
378 Ga0209051_1008543 3300025303 Bacteria 5410
379 Ga0209051_1017165 3300025303 Bacteria 3243
380 Ga0209051_1072572 3300025303 Bacteria 1029
381 Ga0209257_1001962 3300025304 Bacteria 22185
382 Ga0209257_1003296 3300025304 Bacteria 14065
383 Ga0209257_1010294 3300025304 Bacteria 4766
384 Ga0209257_1060930 3300025304 Bacteria 1025
385 Ga0207656_10064226 3300025321 Bacteria 1618
386 Ga0207653_10001674 3300025885 Bacteria 7097
387 Ga0207647_10072033 3300025904 Bacteria 2084
388 Ga0207647_10402909 3300025904 Bacteria 771
389 Ga0207685_10391020 3300025905 Bacteria 711
390 Ga0207705_10743623 3300025909 Bacteria 762
391 Ga0207654_10024617 3300025911 Bacteria 3238
392 Ga0207654_10119520 3300025911 Bacteria 1652
393 Ga0207654_10161375 3300025911 Bacteria 1448
394 Ga0207654_10581839 3300025911 Bacteria 797
395 Ga0207707_10027670 3300025912 Bacteria 4958
396 Ga0207695_10000011 3300025913 Bacteria 910221
397 Ga0207695_10116388 3300025913 Bacteria 2647
398 Ga0207695_10416388 3300025913 Bacteria 1228
399 Ga0207695_10881666 3300025913 Bacteria 774
400 Ga0207671_10001291 3300025914 Bacteria 29425
401 Ga0207671_10057729 3300025914 Bacteria 2877
402 Ga0207671_10068428 3300025914 Bacteria 2646
403 Ga0207660_10113774 3300025917 Bacteria 2040
404 Ga0207662_10084295 3300025918 Bacteria 1944
405 Ga0207657_10208952 3300025919 Bacteria 1567
406 Ga0207652_10040467 3300025921 Bacteria 3958
407 Ga0207681_11041881 3300025923 Bacteria 687
408 Ga0207694_10018894 3300025924 Bacteria 5211
409 Ga0207650_10002090 3300025925 Bacteria 13962
410 Ga0207650_10101930 3300025925 Bacteria 2211
411 Ga0207687_10068838 3300025927 Bacteria 2522
412 Ga0207687_10449791 3300025927 Bacteria 1068
413 Ga0207687_10734934 3300025927 Bacteria 839
414 Ga0207644_10136348 3300025931 Bacteria 1885
415 Ga0207690_10022460 3300025932 Bacteria 3926
416 Ga0207706_10039545 3300025933 Bacteria 4182
417 Ga0207706_10967608 3300025933 Bacteria 716
418 Ga0207709_10114712 3300025935 Bacteria 1808
419 Ga0207709_10323219 3300025935 Bacteria 1156
420 Ga0207709_10324599 3300025935 Bacteria 1153
421 Ga0207669_10229582 3300025937 Bacteria 1368
422 Ga0207704_10877843 3300025938 Bacteria 753
423 Ga0207665_10065871 3300025939 Bacteria 2464
424 Ga0207667_10060300 3300025949 Bacteria 3971
425 Ga0207667_10375499 3300025949 Bacteria 1449
426 Ga0207667_10888412 3300025949 Bacteria 883
427 Ga0207712_10003210 3300025961 Bacteria 10390
428 Ga0207712_11567645 3300025961 Bacteria 590
429 Ga0207668_10454674 3300025972 Bacteria 1094
430 Ga0207668_10488791 3300025972 Bacteria 1057
431 Ga0207668_12083217 3300025972 Bacteria 511
432 Ga0207640_11271407 3300025981 Unclassified 656
433 Ga0207658_10195410 3300025986 Bacteria 1685
434 Ga0207658_10549102 3300025986 Bacteria 1034
435 Ga0207703_10281150 3300026035 Bacteria 1511
436 Ga0207639_10032104 3300026041 Bacteria 3863
437 Ga0207639_10290502 3300026041 Bacteria 1441
438 Ga0207678_10015487 3300026067 Bacteria 6703
439 Ga0207678_11150419 3300026067 Unclassified 687
440 Ga0207708_10002508 3300026075 Bacteria 13503
441 Ga0207702_10055211 3300026078 Bacteria 3368
442 Ga0207702_10076099 3300026078 Bacteria 2901
443 Ga0207702_10222409 3300026078 Bacteria 1759
444 Ga0207641_10307664 3300026088 Bacteria 1499
445 Ga0207648_10166316 3300026089 Bacteria 1949
446 Ga0207676_10078838 3300026095 Bacteria 2669
447 Ga0207674_10071651 3300026116 Bacteria 3481
448 Ga0207674_10154489 3300026116 Bacteria 2250
449 Ga0207674_10244903 3300026116 Bacteria 1740
450 Ga0207675_101058742 3300026118 Bacteria 830
451 Ga0207683_10197424 3300026121 Bacteria 1828
452 Ga0207698_10391441 3300026142 Bacteria 1325
453 Ga0207698_10750481 3300026142 Bacteria 975
454 Ga0209281_1000310 3300027111 Bacteria 87212
455 Ga0209281_1000334 3300027111 Bacteria 81109
456 Ga0209281_1000361 3300027111 Bacteria 74287
457 Ga0209371_1000021 3300027312 Bacteria 555864
458 Ga0209371_1000469 3300027312 Bacteria 39757
459 Ga0209371_1001465 3300027312 Bacteria 15917
460 Ga0209282_1000073 3300027666 Bacteria 81125
461 Ga0209282_1000162 3300027666 Bacteria 38224
462 Ga0209282_1182870 3300027666 Bacteria 981
463 Ga0209588_1004150 3300027671 Bacteria 4064
464 Ga0209588_1123431 3300027671 Unclassified 828
465 Ga0209813_10117222 3300027866 Bacteria 923
466 Ga0268266_10182102 3300028379 Bacteria 1913
467 Ga0268266_10220018 3300028379 Bacteria 1745
468 Ga0268266_10817448 3300028379 Bacteria 900
469 Ga0268265_10014314 3300028380 Bacteria 5402
470 Ga0268264_10003917 3300028381 Bacteria 12744
471 Ga0268264_10773687 3300028381 Bacteria 958
472 Ga0307515_10000844 3300028794 Bacteria 70375
473 Ga0307515_10004389 3300028794 Bacteria 29220
474 Ga0307515_10013773 3300028794 Bacteria 15073
475 Ga0307515_10020621 3300028794 Bacteria 11742
476 Ga0307515_10767339 3300028794 Bacteria 584
477 Ga0268256_1000020 3300030500 Bacteria 557873
478 Ga0268256_1001794 3300030500 Bacteria 12086
479 Ga0268256_1003189 3300030500 Bacteria 7611
480 Ga0307513_10002223 3300031456 Bacteria 27113
481 Ga0307513_10134632 3300031456 Bacteria 2409
482 Ga0307513_10674661 3300031456 Bacteria 740
483 Ga0307408_100164938 3300031548 Bacteria 1763
484 Ga0307408_100731680 3300031548 Bacteria 892
485 Ga0307514_10300077 3300031649 Bacteria 901
486 Ga0307413_10429669 3300031824 Bacteria 1043
487 Ga0307410_10349349 3300031852 Bacteria 1181
488 Ga0307406_10459222 3300031901 Bacteria 1024
489 Ga0307412_10083096 3300031911 Bacteria 2219
490 Ga0307412_10914255 3300031911 Bacteria 770
491 Ga0307412_11859820 3300031911 Bacteria 555
492 Ga0315914_1000008 3300031967 Bacteria 209133
493 Ga0307409_100255774 3300031995 Bacteria 1604
494 Ga0307416_100266271 3300032002 Bacteria 1679
495 Ga0307416_100668926 3300032002 Bacteria 1125
496 Ga0307414_10072609 3300032004 Bacteria 2486
497 Ga0307411_10544797 3300032005 Bacteria 989
498 Ga0316593_10129338 3300032168 Bacteria 910
499 Ga0307510_10380280 3300033180 Bacteria 857
500 Ga0315913_1000688 3300033430 Bacteria 32300
501 Ga0315915_1000014 3300033464 Bacteria 171068
502 Ga0373934_0000226 3300035086 Bacteria 20517
503 Ga0373934_0004407 3300035086 Bacteria 5200
504 Ga0373952_0071202 3300035092 Bacteria 870
505 Ga0373923_0004582 3300035111 Bacteria 4600
506 Ga0373923_0068921 3300035111 Bacteria 1516
507 Ga0373923_0257184 3300035111 Bacteria 818
508 Ga0373932_0296923 3300035112 Bacteria 602
509 Ga0373936_0007633 3300035113 Bacteria 4064
510 Ga0373939_0115591 3300035114 Bacteria 940
511 Ga0373953_0002165 3300035117 Bacteria 5877
512 Ga0373953_0086933 3300035117 Bacteria 1305
513 Ga0373953_0201701 3300035117 Bacteria 860
514 Ga0373954_0007204 3300035118 Bacteria 4858
515 Ga0373954_0014860 3300035118 Bacteria 3474
516 Ga0373956_0000177 3300035119 Bacteria 24286
517 Ga0373956_0002563 3300035119 Bacteria 7384
518 Ga0373957_0012200 3300035120 Bacteria 2887
519 Ga0373943_0011672 3300035170 Bacteria 3955
520 Ga0373946_0369115 3300035171 Bacteria 720
521 Ga0373955_0161588 3300035172 Unclassified 1322
522 Ga0373955_0182539 3300035172 Bacteria 1245
523 Ga0373955_0951468 3300035172 Unclassified 529
524 Ga0316574_0038897 3300035398 Bacteria 2922
525 Ga0316574_0167518 3300035398 Bacteria 1415
526 Ga0373924_0012475 3300035410 Bacteria 3175
527 Ga0373935_0059231 3300035692 Bacteria 2447
528 Ga0373927_0000055 3300035695 Bacteria 81098
529 Ga0373933_0000312 3300035724 Bacteria 31477
530 Ga0373933_0052360 3300035724 Bacteria 2442
531 Ga0373933_0445669 3300035724 Bacteria 846
532 Ga0373947_0318717 3300035725 Bacteria 1039
533 Ga0373937_0000096 3300036401 Bacteria 81963
534 Ga0373937_0155279 3300036401 Bacteria 2144
535 Ga0373937_0482522 3300036401 Bacteria 1177
536 Ga0316582_0060645 3300036647 Bacteria 2426
537 Ga0316584_0016744 3300036712 Bacteria 5260
538 Ga0373925_0002979 3300037068 Bacteria 13365
539 Ga0373925_0054502 3300037068 Bacteria 2991
540 Ga0395899_0000213 3300037312 Bacteria 83403
541 Ga0395900_0000121 3300037418 Bacteria 135026
542 Ga0395900_0022761 3300037418 Bacteria 6413
543 Ga0395900_0246642 3300037418 Bacteria 1789
544 Ga0395900_0560544 3300037418 Bacteria 1086
545 Ga0395898_0000247 3300037466 Bacteria 135026
546 Ga0395905_0000112 3300037471 Bacteria 135010
547 Ga0395905_0000325 3300037471 Bacteria 68813
548 Ga0395905_0013938 3300037471 Bacteria 7688
549 Ga0395905_0018905 3300037471 Bacteria 6534
550 Ga0395905_0105392 3300037471 Bacteria 2647
551 Ga0395905_0341137 3300037471 Bacteria 1389
552 Ga0395901_0000078 3300038443 Bacteria 135026
553 Ga0395901_0068865 3300038443 Bacteria 3686
554 Ga0395901_0108822 3300038443 Bacteria 2909
555 Ga0395901_0659512 3300038443 Bacteria 1048
556 Ga0439436_0063219 3300041404 Bacteria 1034
557 Ga0439439_0032082 3300041406 Bacteria 1341
558 Ga0439439_0047680 3300041406 Bacteria 1120
559 Ga0439465_0014361 3300041413 Bacteria 2468
560 Ga0439465_0016011 3300041413 Bacteria 2338
561 Ga0439465_0019035 3300041413 Bacteria 2146
562 Ga0439465_0074391 3300041413 Bacteria 1143
563 Ga0439465_0143370 3300041413 Bacteria 850
564 Ga0451791_1489124 3300041451 Bacteria 590
565 Ga0451793_1791429 3300041452 Bacteria 1552
566 Ga0451795_0456879 3300041456 Bacteria 756
567 Ga0451804_0736472 3300041463 Bacteria 1023
568 Ga0451833_0281263 3300041491 Bacteria 1433
569 Ga0451835_0487550 3300041492 Bacteria 917
570 Ga0451837_1680411 3300041494 Bacteria 647
571 Ga0451840_11095 3300041497 Bacteria 756
572 Ga0451841_1014141 3300041498 Bacteria 1841
573 Ga0451845_0513581 3300041501 Bacteria 2368
574 Ga0451846_68000 3300041502 Bacteria 565
575 Ga0451847_0867267 3300041503 Bacteria 1815
576 Ga0451849_1243659 3300041505 Bacteria 1587
577 Ga0451851_0085356 3300041507 Bacteria 2421
578 Ga0451851_0906446 3300041507 Bacteria 1180
579 Ga0451843_0556366 3300041509 Bacteria 3307
580 Ga0451855_0767112 3300041511 Bacteria 1369
581 Ga0451855_1623492 3300041511 Bacteria 537
582 Ga0451853_0114112 3300041512 Bacteria 3097
583 Ga0451853_1600377 3300041512 Bacteria 1441
584 Ga0439431_0084742 3300041997 Bacteria 858
585 Ga0439437_031430 3300042000 Bacteria 668
586 Ga0439432_035895 3300042006 Bacteria 1588
587 Ga0439432_091543 3300042006 Bacteria 915
588 Ga0439449_0024497 3300042007 Bacteria 2256
589 Ga0439449_0030648 3300042007 Bacteria 2005
590 Ga0439449_0113867 3300042007 Bacteria 1002
591 Ga0439455_0113540 3300042012 Bacteria 755
592 Ga0450920_061976 3300042122 Bacteria 756
593 Ga0439458_0151510 3300042157 Bacteria 621
594 Ga0439434_0136733 3300042435 Bacteria 806
595 Ga0450918_083669 3300042531 Bacteria 611
596 Ga0466972_0066750 3300044658 Bacteria 1720
597 Ga0466965_0097468 3300044683 Bacteria 1501
598 Ga0466966_0037410 3300044684 Bacteria 3130
599 Ga0466963_0014097 3300044694 Bacteria 4925
600 Ga0466968_0298045 3300044735 Bacteria 775
601 Ga0466970_0005266 3300044765 Bacteria 6405
602 Ga0466960_0196335 3300044901 Bacteria 1100
603 Ga0466967_0358143 3300045976 Bacteria 1413
604 Ga0466967_0536706 3300045976 Bacteria 1150
605 Ga0495592_0000886 3300046454 Bacteria 20768
606 Ga0495592_0111349 3300046454 Bacteria 1937
607 Ga0495592_0152555 3300046454 Bacteria 1596
608 Ga0495603_0783841 3300046455 Unclassified 544
609 Ga0495590_0338167 3300046457 Bacteria 571
610 Ga0495629_0037247 3300046459 Bacteria 3428
611 Ga0495629_0091148 3300046459 Bacteria 2127
612 Ga0495629_0108595 3300046459 Bacteria 1935
613 Ga0495638_0011505 3300046460 Bacteria 6094
614 Ga0495638_0112270 3300046460 Bacteria 1617
615 Ga0495638_0134219 3300046460 Bacteria 1451
616 Ga0495641_0007023 3300046461 Bacteria 7144
617 Ga0495651_0001037 3300046462 Bacteria 21470
618 Ga0495651_0012125 3300046462 Bacteria 6633
619 Ga0495653_0006555 3300046463 Bacteria 9552
620 Ga0495650_0170839 3300046471 Bacteria 770
621 Ga0495639_0002333 3300046475 Bacteria 8294
622 Ga0495662_0011759 3300046476 Bacteria 4278
623 Ga0495662_0049854 3300046476 Bacteria 2021
624 Ga0495664_0022744 3300046477 Bacteria 3636
625 Ga0495585_0030296 3300046492 Bacteria 3078
626 Ga0495585_0045607 3300046492 Bacteria 2446
627 Ga0495607_0082802 3300046501 Bacteria 1759
628 Ga0495583_0091176 3300046506 Bacteria 1312
629 Ga0495610_0010608 3300046512 Bacteria 5711
630 Ga0495610_0075657 3300046512 Bacteria 1558
631 Ga0495616_0026034 3300046513 Bacteria 3118
632 Ga0495616_0287975 3300046513 Bacteria 697
633 Ga0495618_0010612 3300046514 Bacteria 5574
634 Ga0495618_0202102 3300046514 Bacteria 1257
635 Ga0495620_0031522 3300046515 Bacteria 2429
636 Ga0495620_0062294 3300046515 Bacteria 1549
637 Ga0495620_0066156 3300046515 Bacteria 1490
638 Ga0495628_0060049 3300046516 Bacteria 2984
639 Ga0495628_0200303 3300046516 Bacteria 1504
640 Ga0495630_0001439 3300046517 Bacteria 16463
641 Ga0495631_0082915 3300046518 Bacteria 1382
642 Ga0495631_0183483 3300046518 Bacteria 896
643 Ga0495632_0017000 3300046519 Bacteria 4029
644 Ga0495632_0287786 3300046519 Bacteria 731
645 Ga0495643_0001636 3300046522 Bacteria 19772
646 Ga0495643_0027496 3300046522 Bacteria 3195
647 Ga0495648_0076360 3300046524 Bacteria 1924
648 Ga0495666_0017744 3300046526 Bacteria 3543
649 Ga0495652_0149866 3300046529 Bacteria 1824
650 Ga0495652_0151995 3300046529 Bacteria 1808
651 Ga0495652_0652893 3300046529 Bacteria 712
652 Ga0495654_0006825 3300046530 Bacteria 6442
653 Ga0495654_0047409 3300046530 Bacteria 2112
654 Ga0495654_0056366 3300046530 Bacteria 1900
655 Ga0495640_0008228 3300046533 Bacteria 8184
656 Ga0495586_0010436 3300046535 Bacteria 4936
657 Ga0495587_0069446 3300046536 Bacteria 2051
658 Ga0495587_0317009 3300046536 Bacteria 871
659 Ga0495609_0025916 3300046538 Bacteria 2686
660 Ga0495633_0058720 3300046558 Bacteria 1805
661 Ga0495667_0086244 3300046559 Bacteria 2036
662 Ga0495667_0114995 3300046559 Bacteria 1738
663 Ga0495667_0154021 3300046559 Bacteria 1479
664 Ga0495656_0166823 3300046615 Bacteria 1074
665 Ga0495668_0038831 3300046616 Bacteria 2659
666 Ga0495668_0101187 3300046616 Bacteria 1577
667 Ga0495668_0121572 3300046616 Bacteria 1428
668 Ga0495668_0133404 3300046616 Bacteria 1359
669 Ga0495634_0026780 3300046642 Bacteria 4019
670 Ga0495634_0133055 3300046642 Bacteria 1584
671 Ga0495611_0009786 3300046648 Bacteria 4053
672 Ga0495625_0022163 3300046660 Bacteria 4874
673 Ga0495625_0044796 3300046660 Bacteria 3201
674 Ga0495625_0056641 3300046660 Bacteria 2789
675 Ga0495635_0086793 3300046663 Bacteria 2141
676 Ga0495635_0161182 3300046663 Bacteria 1526
677 Ga0495588_0048733 3300046674 Bacteria 2177
678 Ga0495588_0370574 3300046674 Bacteria 752
679 Ga0495657_0014287 3300046675 Bacteria 5832
680 Ga0495657_0085419 3300046675 Bacteria 2034
681 Ga0495657_0091190 3300046675 Bacteria 1955
682 Ga0495599_0032502 3300046678 Bacteria 3275
683 Ga0495658_0004331 3300046683 Bacteria 6991
684 Ga0495624_0113855 3300046690 Bacteria 1663
685 Ga0495624_0319834 3300046690 Bacteria 935
686 Ga0495670_0031733 3300046691 Bacteria 2626
687 Ga0495670_0363084 3300046691 Bacteria 780
688 Ga0495671_0310575 3300046692 Bacteria 758
689 Ga0495649_0122502 3300046694 Bacteria 1374
690 Ga0495649_0226196 3300046694 Bacteria 967
691 Ga0495600_0000925 3300046809 Bacteria 15753
692 Ga0495600_0036061 3300046809 Bacteria 3213
693 Ga0495660_0191214 3300046810 Bacteria 983
694 Ga0495604_0021238 3300047317 Bacteria 5182
695 Ga0495604_0024264 3300047317 Bacteria 4839
696 Ga0495636_0044906 3300047318 Bacteria 1841
697 Ga0495636_0080229 3300047318 Bacteria 1404
698 Ga0495636_0160057 3300047318 Bacteria 1014
699 Ga0495674_0005040 3300047319 Bacteria 12704
700 Ga0495672_0021456 3300047320 Bacteria 4213
701 Ga0495676_0917551 3300047321 Bacteria 561
702 Ga0495680_0012165 3300047322 Bacteria 7593
703 Ga0495680_0232488 3300047322 Bacteria 1312
704 Ga0495680_0468693 3300047322 Bacteria 859
705 Ga0495683_0398430 3300047323 Bacteria 573
706 Ga0495687_066877 3300047443 Bacteria 1457
707 Ga0495687_227815 3300047443 Bacteria 571
708 Ga0495675_0003423 3300047444 Bacteria 9556
709 Ga0495675_0033960 3300047444 Bacteria 3257
710 Ga0495675_0175941 3300047444 Bacteria 1312
711 Ga0495675_0580147 3300047444 Bacteria 637
712 Ga0495685_062052 3300047447 Bacteria 1259
713 Ga0495684_0062577 3300047471 Bacteria 2830
714 Ga0495684_0107115 3300047471 Bacteria 2111
715 Ga0495684_1010807 3300047471 Bacteria 528
716 Ga0495686_0004865 3300047472 Bacteria 10832
717 Ga0495686_0119407 3300047472 Bacteria 1573
718 Ga0495686_0157036 3300047472 Bacteria 1332
719 Ga0495686_0180354 3300047472 Bacteria 1224
720 Ga0495686_0221559 3300047472 Bacteria 1076
721 Ga0495686_0245842 3300047472 Bacteria 1007
722 Ga0495686_0345242 3300047472 Bacteria 810
723 Ga0495593_0529683 3300047673 Bacteria 591
724 Ga0495614_0035261 3300048089 Bacteria 2150
725 Ga0495615_0115979 3300048090 Bacteria 770
726 Ga0495626_0162717 3300048091 Bacteria 935
727 Ga0495626_0198657 3300048091 Bacteria 823
728 Ga0496100_0012838 3300048903 Bacteria 4815
729 Ga0496101_0208502 3300048904 Bacteria 1513
730 Ga0496102_0008570 3300048905 Bacteria 8769
731 Ga0496102_0014003 3300048905 Bacteria 6964
732 Ga0496102_0177393 3300048905 Bacteria 2007
733 Ga0496102_0296643 3300048905 Bacteria 1524
734 Ga0496102_0766906 3300048905 Bacteria 887
735 Ga0496103_0010686 3300048906 Bacteria 5431
736 Ga0496103_0017556 3300048906 Bacteria 4283
737 Ga0496104_0066142 3300048907 Bacteria 3432
738 Ga0496105_0182249 3300048908 Bacteria 1719
739 Ga0496105_0208925 3300048908 Bacteria 1592
740 Ga0496106_0001217 3300048909 Bacteria 19264
741 Ga0496106_0004921 3300048909 Bacteria 9886
742 Ga0496106_0452007 3300048909 Bacteria 1032
743 Ga0496108_0114926 3300048911 Bacteria 2305
744 Ga0496108_0371611 3300048911 Bacteria 1248
745 Ga0496109_0132401 3300048912 Bacteria 2328
746 Ga0496109_0301457 3300048912 Bacteria 1511
747 Ga0496109_1146305 3300048912 Bacteria 714
748 Ga0496110_0180740 3300048913 Bacteria 1915
749 Ga0496110_0802990 3300048913 Bacteria 845
750 Ga0496110_1133930 3300048913 Bacteria 690
751 Ga0496113_0312317 3300048916 Bacteria 1259
752 Ga0496113_0377285 3300048916 Bacteria 1138
753 Ga0496113_0570148 3300048916 Bacteria 907
754 Ga0496114_0236430 3300048917 Bacteria 1606
755 Ga0496114_0584059 3300048917 Bacteria 986
756 Ga0496115_0023828 3300048918 Bacteria 4753
757 Ga0496115_0237130 3300048918 Bacteria 1504
758 Ga0496115_0653995 3300048918 Bacteria 830
759 Ga0496116_0000043 3300048919 Bacteria 328085
760 Ga0496116_0008089 3300048919 Bacteria 9192
761 Ga0496116_0043036 3300048919 Bacteria 3080
762 Ga0496116_0103446 3300048919 Bacteria 1694
763 Ga0496117_0000338 3300048920 Bacteria 82688
764 Ga0496117_0089281 3300048920 Bacteria 1991
765 Ga0496117_0109558 3300048920 Bacteria 1724
766 Ga0496117_0109935 3300048920 Bacteria 1720
767 Ga0496118_0000958 3300048921 Bacteria 45054
768 Ga0496118_0019045 3300048921 Bacteria 6152
769 Ga0496118_0225279 3300048921 Bacteria 1087
770 Ga0496118_0428829 3300048921 Bacteria 678
771 Ga0496118_0497471 3300048921 Bacteria 607
772 Ga0496118_0566227 3300048921 Bacteria 551
773 Ga0496119_0004440 3300048922 Bacteria 13967
774 Ga0496119_0111222 3300048922 Bacteria 1520
775 Ga0496119_0163672 3300048922 Bacteria 1180
776 Ga0496119_0193562 3300048922 Bacteria 1058
777 Ga0496119_0243093 3300048922 Bacteria 911
778 Ga0496120_0000589 3300048923 Bacteria 55133
779 Ga0496120_0001472 3300048923 Bacteria 28063
780 Ga0496120_0069230 3300048923 Bacteria 1944
781 Ga0496120_0187793 3300048923 Bacteria 1010
782 Ga0496121_0002723 3300048924 Bacteria 26365
783 Ga0496121_0009248 3300048924 Bacteria 11379
784 Ga0496121_0009941 3300048924 Bacteria 10830
785 Ga0496121_0027323 3300048924 Bacteria 5341
786 Ga0496121_0038973 3300048924 Bacteria 4197
787 Ga0496121_0074244 3300048924 Bacteria 2721
788 Ga0496121_0082726 3300048924 Bacteria 2536
789 Ga0496121_0088329 3300048924 Bacteria 2430
790 Ga0496121_0206430 3300048924 Bacteria 1395
791 Ga0496121_0229266 3300048924 Bacteria 1302
792 Ga0496121_0879236 3300048924 Bacteria 518
793 Ga0496122_0000025 3300048925 Bacteria 362915
794 Ga0496122_0016499 3300048925 Bacteria 6981
795 Ga0496122_0018139 3300048925 Bacteria 6519
796 Ga0496122_0055102 3300048925 Bacteria 2978
797 Ga0496122_0062877 3300048925 Bacteria 2714
798 Ga0496122_0093482 3300048925 Bacteria 2039
799 Ga0496122_0246008 3300048925 Bacteria 1004
800 Ga0496123_0000032 3300048926 Bacteria 285282
801 Ga0496123_0000043 3300048926 Bacteria 253752
802 Ga0496123_0012797 3300048926 Bacteria 7114
803 Ga0496123_0016748 3300048926 Bacteria 5931
804 Ga0496123_0064778 3300048926 Bacteria 2327
805 Ga0496123_0079012 3300048926 Bacteria 2012
806 Ga0496123_0263882 3300048926 Bacteria 842
807 Ga0496123_0422272 3300048926 Bacteria 601
808 Ga0496124_0017870 3300048927 Bacteria 6667
809 Ga0496124_0023770 3300048927 Bacteria 5586
810 Ga0496124_0025733 3300048927 Bacteria 5322
811 Ga0496124_0061282 3300048927 Bacteria 3153
812 Ga0496124_0274378 3300048927 Bacteria 1233
813 Ga0496124_0298730 3300048927 Bacteria 1164
814 Ga0496125_0000946 3300048928 Bacteria 45578
815 Ga0496125_0025175 3300048928 Bacteria 5456
816 Ga0496125_0027520 3300048928 Bacteria 5152
817 Ga0496125_0066860 3300048928 Bacteria 2837
818 Ga0496125_0141564 3300048928 Bacteria 1671
819 Ga0496125_0169920 3300048928 Bacteria 1467
820 Ga0496125_0283632 3300048928 Bacteria 1024
821 Ga0496125_0310552 3300048928 Bacteria 961
822 Ga0496126_0000362 3300048929 Bacteria 94734
823 Ga0496126_0034554 3300048929 Bacteria 4747
824 Ga0496126_0047224 3300048929 Bacteria 3943
825 Ga0496126_0244916 3300048929 Bacteria 1496
826 Ga0496126_0266039 3300048929 Bacteria 1424
827 Ga0496126_0267396 3300048929 Bacteria 1420
828 Ga0496126_0340153 3300048929 Bacteria 1229
829 Ga0496126_0445237 3300048929 Bacteria 1043
830 Ga0496126_0756347 3300048929 Bacteria 750
831 Ga0501031_0000095 3300049568 Bacteria 47538
832 Ga0501031_0418336 3300049568 Bacteria 866
833 Ga0501032_0000064 3300049569 Bacteria 91971
834 Ga0501032_0000084 3300049569 Bacteria 82148
835 Ga0501032_0002338 3300049569 Bacteria 14870
836 Ga0501032_0048602 3300049569 Bacteria 2864
837 Ga0501032_1008883 3300049569 Bacteria 523
838 Ga0501033_0000102 3300049570 Bacteria 81583
839 Ga0501033_0000286 3300049570 Bacteria 48628
840 Ga0501033_0007597 3300049570 Bacteria 8429
841 Ga0501033_0020657 3300049570 Bacteria 4975
842 Ga0501033_0029534 3300049570 Bacteria 4119
843 Ga0501033_0050740 3300049570 Bacteria 3076
844 Ga0501033_0083256 3300049570 Bacteria 2345
845 Ga0501033_0528873 3300049570 Bacteria 814
846 Ga0501033_0904293 3300049570 Bacteria 593
847 Ga0501034_0000174 3300049571 Bacteria 119615
848 Ga0501034_0001404 3300049571 Bacteria 32372
849 Ga0501034_0002078 3300049571 Bacteria 24998
850 Ga0501034_0090803 3300049571 Bacteria 3051
851 Ga0501034_0125398 3300049571 Bacteria 2553
852 Ga0501034_0202154 3300049571 Bacteria 1944
853 Ga0501034_0240027 3300049571 Bacteria 1759
854 Ga0501034_0339786 3300049571 Bacteria 1431
855 Ga0501034_0655917 3300049571 Bacteria 951
856 Ga0501034_0831896 3300049571 Bacteria 814
857 Ga0501036_0000040 3300049572 Bacteria 81588
858 Ga0501036_0011420 3300049572 Bacteria 7352
859 Ga0501036_0064582 3300049572 Bacteria 3098
860 Ga0501036_0122760 3300049572 Bacteria 2193
861 Ga0501036_0160163 3300049572 Bacteria 1897
862 Ga0501037_0000098 3300049573 Bacteria 81588
863 Ga0501037_0009152 3300049573 Bacteria 7255
864 Ga0501037_0095169 3300049573 Bacteria 2153
865 Ga0501037_0127415 3300049573 Bacteria 1827
866 Ga0501037_0403344 3300049573 Bacteria 937
867 Ga0501037_0456452 3300049573 Bacteria 871
868 Ga0501038_0000002 3300049574 Bacteria 330446
869 Ga0501038_0000031 3300049574 Bacteria 132231
870 Ga0501038_0022666 3300049574 Bacteria 5622
871 Ga0501038_0031557 3300049574 Bacteria 4682
872 Ga0501038_0117560 3300049574 Bacteria 2196
873 Ga0501038_0272214 3300049574 Bacteria 1335
874 Ga0501038_1112264 3300049574 Bacteria 576
875 Ga0501039_0000002 3300049575 Bacteria 375152
876 Ga0501039_0000057 3300049575 Bacteria 89756
877 Ga0501039_0227793 3300049575 Bacteria 1465
878 Ga0501039_0639444 3300049575 Bacteria 833
879 Ga0501040_0043172 3300049576 Bacteria 3072
880 Ga0501040_0117786 3300049576 Bacteria 1862
881 Ga0501040_0450861 3300049576 Bacteria 926
882 Ga0501040_0673642 3300049576 Bacteria 748
883 Ga0501041_0160634 3300049577 Bacteria 1405
884 Ga0501042_0137759 3300049578 Bacteria 1759
885 Ga0501043_0000048 3300049579 Bacteria 109146
886 Ga0501043_0000104 3300049579 Bacteria 78808
887 Ga0501043_0006479 3300049579 Bacteria 9399
888 Ga0501043_0074629 3300049579 Bacteria 2664
889 Ga0501043_0128235 3300049579 Bacteria 1989
890 Ga0501043_0130374 3300049579 Bacteria 1970
891 Ga0501043_0230438 3300049579 Bacteria 1431
892 Ga0501043_0674507 3300049579 Bacteria 757
893 Ga0501046_0000023 3300049580 Bacteria 213965
894 Ga0501046_0059772 3300049580 Bacteria 2984
895 Ga0501046_0175337 3300049580 Bacteria 1606
896 Ga0501046_0193784 3300049580 Bacteria 1515
897 Ga0501046_0200778 3300049580 Bacteria 1484
898 Ga0501047_0002237 3300049581 Bacteria 18521
899 Ga0501047_0027746 3300049581 Bacteria 5455
900 Ga0501047_0036169 3300049581 Bacteria 4771
901 Ga0501047_0140440 3300049581 Bacteria 2294
902 Ga0501047_0187248 3300049581 Bacteria 1934
903 Ga0501047_0292240 3300049581 Bacteria 1473
904 Ga0501047_0716479 3300049581 Bacteria 818
905 Ga0501048_0022955 3300049582 Bacteria 4560
906 Ga0501048_0038065 3300049582 Bacteria 3453
907 Ga0501048_1215189 3300049582 Bacteria 542
908 Ga0501067_0042887 3300049583 Bacteria 2513
909 Ga0501067_0271062 3300049583 Bacteria 945
910 Ga0501068_0182523 3300049584 Bacteria 1327
911 Ga0501068_0316121 3300049584 Bacteria 1001
912 Ga0501068_0319333 3300049584 Bacteria 995
913 Ga0501068_0365952 3300049584 Bacteria 927
914 Ga0501069_0000018 3300049585 Bacteria 133550
915 Ga0501069_0015350 3300049585 Bacteria 4104
916 Ga0501069_0159953 3300049585 Bacteria 1297
917 Ga0501069_0551510 3300049585 Bacteria 690
918 Ga0501070_0000048 3300049586 Bacteria 105951
919 Ga0501070_0000420 3300049586 Bacteria 38500
920 Ga0501070_0002333 3300049586 Bacteria 16663
921 Ga0501070_0041003 3300049586 Bacteria 3857
922 Ga0501070_0053889 3300049586 Bacteria 3335
923 Ga0501070_0086815 3300049586 Bacteria 2590
924 Ga0501070_0113114 3300049586 Bacteria 2243
925 Ga0501070_0271796 3300049586 Bacteria 1384
926 Ga0501070_0297951 3300049586 Bacteria 1314
927 Ga0501070_0338762 3300049586 Bacteria 1222
928 Ga0501071_0017994 3300049587 Bacteria 4886
929 Ga0501071_0094533 3300049587 Bacteria 2199
930 Ga0501071_0150442 3300049587 Bacteria 1736
931 Ga0501072_0069505 3300049588 Bacteria 2781
932 Ga0501073_0006660 3300049589 Bacteria 8605
933 Ga0501073_0072808 3300049589 Bacteria 2393
934 Ga0501073_0127897 3300049589 Bacteria 1761
935 Ga0501073_0161074 3300049589 Bacteria 1554
936 Ga0501074_0000001 3300049590 Bacteria 123588
937 Ga0501074_0054142 3300049590 Bacteria 2894
938 Ga0501074_0059274 3300049590 Bacteria 2758
939 Ga0501074_0079423 3300049590 Bacteria 2354
940 Ga0501074_0266406 3300049590 Bacteria 1218
941 Ga0501074_0452599 3300049590 Bacteria 910
942 Ga0501074_0678614 3300049590 Bacteria 727
943 Ga0501075_0181324 3300049591 Bacteria 1606
944 Ga0501076_0786847 3300049592 Bacteria 785
945 Ga0501076_1727592 3300049592 Bacteria 513
946 Ga0501079_0807143 3300049741 Bacteria 739
947 Ga0501079_1276381 3300049741 Bacteria 578
948 Ga0501080_0000197 3300049742 Bacteria 44169
949 Ga0501080_0000413 3300049742 Bacteria 32813
950 Ga0501080_0015859 3300049742 Bacteria 6951
951 Ga0501080_0133094 3300049742 Bacteria 2302
952 Ga0501080_0243232 3300049742 Bacteria 1642
953 Ga0501080_0245976 3300049742 Bacteria 1631
954 Ga0501081_0912448 3300049743 Bacteria 663
955 Ga0501083_0005530 3300049744 Bacteria 8955
956 Ga0501083_0008060 3300049744 Bacteria 7452
957 Ga0501083_0502426 3300049744 Bacteria 789
958 Ga0501083_0659780 3300049744 Bacteria 680
959 Ga0501083_0820992 3300049744 Bacteria 605
960 Ga0501280_012617 3300049776 Bacteria 1188
961 Ga0501035_0000048 3300049822 Bacteria 146466
962 Ga0501035_0000163 3300049822 Bacteria 81898
963 Ga0501035_0001343 3300049822 Bacteria 25356
964 Ga0501035_0004746 3300049822 Bacteria 12904
965 Ga0501035_0007944 3300049822 Bacteria 9902
966 Ga0501035_0063455 3300049822 Bacteria 3286
967 Ga0501035_0094218 3300049822 Bacteria 2633
968 Ga0501035_0130236 3300049822 Bacteria 2194
969 Ga0501035_0273987 3300049822 Bacteria 1428
970 Ga0501035_0307036 3300049822 Bacteria 1335
971 Ga0501035_0336768 3300049822 Bacteria 1265
972 Ga0501035_0632845 3300049822 Bacteria 869
973 Ga0501044_0000002 3300049823 Bacteria 375152
974 Ga0501044_0000003 3300049823 Bacteria 345647
975 Ga0501044_0002384 3300049823 Bacteria 21412
976 Ga0501044_0010560 3300049823 Bacteria 10015
977 Ga0501044_0020100 3300049823 Bacteria 7129
978 Ga0501044_0021489 3300049823 Bacteria 6882
979 Ga0501044_0049943 3300049823 Bacteria 4318
980 Ga0501044_0057802 3300049823 Bacteria 3979
981 Ga0501044_0187627 3300049823 Bacteria 2031
982 Ga0501044_0219738 3300049823 Bacteria 1851
983 Ga0501044_0239744 3300049823 Bacteria 1757
984 Ga0501044_0550038 3300049823 Bacteria 1051
985 Ga0501044_0590090 3300049823 Bacteria 1005
986 Ga0501045_0154648 3300049824 Bacteria 1706
987 Ga0501045_0688966 3300049824 Bacteria 754
988 nmdc:mga03683_86913_c1 3300050489 Bacteria 1358
989 nmdc:mga03n38_3751_c1 3300050490 Bacteria 4924
990 nmdc:mga03n38_65686_c1 3300050490 Bacteria 1664
991 nmdc:mga03n38_90093_c1 3300050490 Bacteria 1458
992 nmdc:mga00v17_111801_c1 3300050491 Bacteria 1733
993 nmdc:mga00v17_29610_c1 3300050491 Bacteria 3214
994 nmdc:mga00v17_498650_c1 3300050491 Bacteria 789
995 nmdc:mga0yw44_13733_c1 3300050492 Bacteria 4275
996 nmdc:mga0yw44_17832_c1 3300050492 Bacteria 3873
997 nmdc:mga0yw44_2486_c2 3300050492 Bacteria 7320
998 nmdc:mga0yw44_3537_c1 3300050492 Bacteria 5906
999 nmdc:mga0yw44_354317_c1 3300050492 Bacteria 988
1000 nmdc:mga0yw44_44196_c1 3300050492 Bacteria 2664
1001 nmdc:mga0yw44_47949_c1 3300050492 Bacteria 2574
1002 nmdc:mga0yw44_94644_c1 3300050492 Bacteria 1894
1003 nmdc:mga0k408_126867_c1 3300050493 Bacteria 1514
1004 nmdc:mga0k408_127554_c1 3300050493 Bacteria 1509
1005 nmdc:mga0k408_544382_c1 3300050493 Bacteria 686
1006 nmdc:mga06z11_18343_c1 3300050494 Bacteria 3195
1007 nmdc:mga06z11_255289_c1 3300050494 Bacteria 1033
1008 nmdc:mga06z11_320891_c1 3300050494 Bacteria 924
1009 nmdc:mga06z11_41928_c1 3300050494 Bacteria 2293
1010 nmdc:mga06z11_72589_c1 3300050494 Bacteria 1825
1011 nmdc:mga04h51_362632_c1 3300050495 Bacteria 601
1012 nmdc:mga07m45_10513_c1 3300050496 Bacteria 4836
1013 nmdc:mga07m45_200148_c1 3300050496 Bacteria 1162
1014 nmdc:mga07m45_213173_c1 3300050496 Bacteria 633
1015 nmdc:mga07m45_28645_c1 3300050496 Bacteria 3074
1016 nmdc:mga0qj67_716_c1 3300050509 Bacteria 22579
1017 nmdc:mga06r32_538_c1 3300050510 Bacteria 32874
1018 nmdc:mga08y16_1475345_c1 3300050511 Bacteria 641
1019 nmdc:mga0rr50_53176_c1 3300050513 Bacteria 3012
1020 nmdc:mga08x19_14_c1 3300050514 Bacteria 365567
1021 nmdc:mga0a205_655192_c1 3300050515 Bacteria 901
1022 nmdc:mga0sz30_15908_c1 3300050516 Bacteria 2978
1023 nmdc:mga0sz30_173779_c1 3300050516 Bacteria 955
1024 nmdc:mga0sz30_55470_c1 3300050516 Bacteria 1686
1025 nmdc:mga0sz30_7864_c1 3300050516 Bacteria 4012
1026 nmdc:mga0sz30_85576_c1 3300050516 Bacteria 1368
1027 Ga0495601_0011073 3300053077 Bacteria 5388
1028 Ga0495601_0148381 3300053077 Bacteria 1531
1029 Ga0500610_0019111 3300053079 Bacteria 3325
1030 Ga0500610_0045559 3300053079 Bacteria 2276
1031 Ga0495655_0098817 3300053083 Bacteria 861
1032 Ga0495595_0026834 3300053084 Bacteria 2561
1033 Ga0495619_0009507 3300053085 Bacteria 6133
1034 Ga0495619_0262729 3300053085 Bacteria 1196
1035 Ga0500578_0108162 3300053086 Bacteria 1754
1036 Ga0500644_0195949 3300053088 Bacteria 833
1037 Ga0500651_0208329 3300053093 Bacteria 1151
1038 Ga0500562_045885 3300053108 Bacteria 1165
1039 Ga0500594_0101165 3300053118 Bacteria 887
1040 Ga0500595_079905 3300053119 Bacteria 959
1041 Ga0500608_002494 3300053122 Bacteria 6706
1042 Ga0500618_001230 3300053125 Bacteria 11999
1043 Ga0500618_001417 3300053125 Bacteria 10714
1044 Ga0500618_005279 3300053125 Bacteria 3959
1045 Ga0500658_0001009 3300053134 Bacteria 11474
1046 Ga0500658_0015794 3300053134 Bacteria 2808
1047 Ga0500658_0357987 3300053134 Bacteria 669
1048 Ga0500559_0012609 3300053136 Bacteria 3589
1049 Ga0500559_0031862 3300053136 Bacteria 2262
1050 Ga0500568_0000175 3300053139 Bacteria 56086
1051 Ga0500568_0005268 3300053139 Bacteria 6725
1052 Ga0500568_0016433 3300053139 Bacteria 3291
1053 Ga0500577_0068985 3300053142 Bacteria 1382
1054 Ga0500604_0021875 3300053151 Bacteria 1811
1055 Ga0500616_0000417 3300053153 Bacteria 57047
1056 Ga0500616_0011795 3300053153 Bacteria 5142
1057 Ga0500616_0043680 3300053153 Bacteria 2394
1058 Ga0500616_0165368 3300053153 Bacteria 1010
1059 Ga0500616_0217736 3300053153 Bacteria 835
1060 Ga0500620_000455 3300053155 Bacteria 7365
1061 Ga0500622_0000168 3300053156 Bacteria 70303
1062 Ga0500622_0002307 3300053156 Bacteria 13947
1063 Ga0500627_0231349 3300053158 Bacteria 822
1064 Ga0500633_0001613 3300053160 Bacteria 4343
1065 Ga0500633_0148991 3300053160 Bacteria 877
1066 Ga0500636_0027374 3300053177 Bacteria 3368
1067 Ga0500636_0326033 3300053177 Bacteria 744
1068 Ga0501084_0193881 3300054114 Bacteria 1714
1069 Ga0501084_1159304 3300054114 Bacteria 648
1070 Ga0587090_026434 3300059510 Bacteria 944
1071 Ga0587092_088796 3300059512 Bacteria 621
1072 Ga0501082_0385991 3300060353 Bacteria 1222
1073 Ga0501082_0424074 3300060353 Bacteria 1162
1074 Ga0501082_0473178 3300060353 Bacteria 1095
1075 Ga0501082_0925755 3300060353 Bacteria 762

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047323 Ga0495683_0398430 Ga0495683_0398430_139_549 103
2 3300046454 Ga0495592_0111349 Ga0495592_0111349_1516_1914 107
3 3300046674 Ga0495588_0048733 Ga0495588_0048733_1567_1965 107
4 3300049575 Ga0501039_0639444 Ga0501039_0639444_392_820 108
5 3300007265 Ga0099794_10068986 Ga0099794_100689862 110
6 3300027671 Ga0209588_1123431 Ga0209588_11234312 110
7 3300032168 Ga0316593_10129338 Ga0316593_101293382 110
8 3300035111 Ga0373923_0068921 Ga0373923_0068921_1109_1498 110
9 3300035172 Ga0373955_0161588 Ga0373955_0161588_22_411 110
10 3300035172 Ga0373955_0951468 Ga0373955_0951468_120_509 110
11 iso_pu_bacteria 2869264136 2869268067 112
12 iso_pu_bacteria 2869271264 2869272290 112
13 iso_pu_bacteria 2871435913 2871443336 112
14 iso_pu_bacteria 2871459585 2871463096 112
15 iso_pu_bacteria 2874131515 2874138158 112
16 iso_pu_bacteria 2874162495 2874167887 112
17 iso_pu_bacteria 2876406927 2876411169 112
18 iso_pu_bacteria 2878774303 2878780088 112
19 iso_pu_bacteria 2906363423 2906367053 112
20 iso_pu_bacteria 2906370794 2906375307 112
21 iso_pu_bacteria 2906386501 2906390081 112
22 iso_pu_bacteria 2906393657 2906399185 112
23 iso_pu_bacteria 2906408224 2906414376 112
24 iso_pu_bacteria 2924748358 2924749311 112
25 3300050511 nmdc:mga08y16_1475345_c1 nmdc:mga08y16_1475345_c1_29_454 115
26 3300009101 Ga0105247_11150484 Ga0105247_111504842 116
27 3300041511 Ga0451855_1623492 Ga0451855_1623492_36_449 116
28 3300042157 Ga0439458_0151510 Ga0439458_0151510_177_587 116
29 3300048921 Ga0496118_0497471 Ga0496118_0497471_10_408 116
30 3300048929 Ga0496126_0445237 Ga0496126_0445237_21_431 116
31 3300049583 Ga0501067_0271062 Ga0501067_0271062_22_420 116
32 3300053125 Ga0500618_001230 Ga0500618_001230_2275_2679 116
33 3300026118 Ga0207675_101058742 Ga0207675_1010587422 118
34 iso_pu_bacteria 2979742915 2979747198 118
35 iso_pu_bacteria 2965032056 2965036369 120
36 3300049576 Ga0501040_0450861 Ga0501040_0450861_439_900 122
37 3300049591 Ga0501075_0181324 Ga0501075_0181324_1133_1594 122
38 iso_pu_bacteria 2965102966 2965104648 122
39 3300046459 Ga0495629_0037247 Ga0495629_0037247_1241_1687 123
40 3300046476 Ga0495662_0049854 Ga0495662_0049854_245_691 123
41 3300046642 Ga0495634_0133055 Ga0495634_0133055_873_1319 123
42 3300046663 Ga0495635_0086793 Ga0495635_0086793_793_1239 123
43 3300046675 Ga0495657_0091190 Ga0495657_0091190_45_491 123
44 3300046690 Ga0495624_0113855 Ga0495624_0113855_144_590 123
45 3300046809 Ga0495600_0036061 Ga0495600_0036061_640_1086 123
46 3300047317 Ga0495604_0024264 Ga0495604_0024264_3481_3927 123
47 3300053077 Ga0495601_0148381 Ga0495601_0148381_998_1444 123
48 3300053085 Ga0495619_0262729 Ga0495619_0262729_479_925 123
49 3300053177 Ga0500636_0326033 Ga0500636_0326033_261_707 123
50 3300049571 Ga0501034_0125398 Ga0501034_0125398_495_971 124
51 3300005439 Ga0070711_100859884 Ga0070711_1008598842 126
52 3300006163 Ga0070715_10383836 Ga0070715_103838362 126
53 3300006852 Ga0075433_10445911 Ga0075433_104459112 126
54 3300007265 Ga0099794_10384984 Ga0099794_103849842 126
55 3300007788 Ga0099795_10321821 Ga0099795_103218212 126
56 3300010159 Ga0099796_10020084 Ga0099796_100200843 126
57 3300025905 Ga0207685_10391020 Ga0207685_103910202 126
58 3300025939 Ga0207665_10065871 Ga0207665_100658713 126
59 3300027671 Ga0209588_1004150 Ga0209588_10041504 126
60 3300035086 Ga0373934_0000226 Ga0373934_0000226_5975_6412 126
61 3300035086 Ga0373934_0004407 Ga0373934_0004407_703_1140 126
62 3300035111 Ga0373923_0004582 Ga0373923_0004582_1542_1979 126
63 3300035111 Ga0373923_0257184 Ga0373923_0257184_330_767 126
64 3300035113 Ga0373936_0007633 Ga0373936_0007633_2049_2486 126
65 3300035117 Ga0373953_0002165 Ga0373953_0002165_2982_3419 126
66 3300035117 Ga0373953_0086933 Ga0373953_0086933_798_1235 126
67 3300035117 Ga0373953_0201701 Ga0373953_0201701_47_484 126
68 3300035118 Ga0373954_0007204 Ga0373954_0007204_3265_3702 126
69 3300035118 Ga0373954_0014860 Ga0373954_0014860_169_606 126
70 3300035119 Ga0373956_0000177 Ga0373956_0000177_7069_7506 126
71 3300035119 Ga0373956_0002563 Ga0373956_0002563_912_1349 126
72 3300035120 Ga0373957_0012200 Ga0373957_0012200_748_1185 126
73 3300035170 Ga0373943_0011672 Ga0373943_0011672_282_719 126
74 3300035171 Ga0373946_0369115 Ga0373946_0369115_94_531 126
75 3300035172 Ga0373955_0182539 Ga0373955_0182539_570_1007 126
76 3300035398 Ga0316574_0038897 Ga0316574_0038897_669_1112 126
77 3300035398 Ga0316574_0167518 Ga0316574_0167518_585_1028 126
78 3300035410 Ga0373924_0012475 Ga0373924_0012475_714_1151 126
79 3300035692 Ga0373935_0059231 Ga0373935_0059231_1483_1920 126
80 3300035724 Ga0373933_0000312 Ga0373933_0000312_22798_23235 126
81 3300035724 Ga0373933_0052360 Ga0373933_0052360_1548_1985 126
82 3300035724 Ga0373933_0445669 Ga0373933_0445669_356_793 126
83 3300035725 Ga0373947_0318717 Ga0373947_0318717_10_447 126
84 3300036401 Ga0373937_0000096 Ga0373937_0000096_49919_50356 126
85 3300036401 Ga0373937_0155279 Ga0373937_0155279_1548_1985 126
86 3300036401 Ga0373937_0482522 Ga0373937_0482522_701_1138 126
87 3300036647 Ga0316582_0060645 Ga0316582_0060645_1008_1445 126
88 3300036712 Ga0316584_0016744 Ga0316584_0016744_4239_4676 126
89 3300037068 Ga0373925_0054502 Ga0373925_0054502_1643_2080 126
90 3300042000 Ga0439437_031430 Ga0439437_031430_149_586 126
91 3300046454 Ga0495592_0000886 Ga0495592_0000886_11227_11664 126
92 3300046454 Ga0495592_0152555 Ga0495592_0152555_192_629 126
93 3300046455 Ga0495603_0783841 Ga0495603_0783841_96_533 126
94 3300046459 Ga0495629_0108595 Ga0495629_0108595_745_1182 126
95 3300046461 Ga0495641_0007023 Ga0495641_0007023_4173_4610 126
96 3300046462 Ga0495651_0001037 Ga0495651_0001037_5761_6198 126
97 3300046462 Ga0495651_0012125 Ga0495651_0012125_169_606 126
98 3300046463 Ga0495653_0006555 Ga0495653_0006555_4079_4516 126
99 3300046475 Ga0495639_0002333 Ga0495639_0002333_7202_7639 126
100 3300046476 Ga0495662_0011759 Ga0495662_0011759_3202_3639 126
101 3300046477 Ga0495664_0022744 Ga0495664_0022744_1130_1567 126
102 3300046514 Ga0495618_0010612 Ga0495618_0010612_101_538 126
103 3300046514 Ga0495618_0202102 Ga0495618_0202102_164_601 126
104 3300046516 Ga0495628_0060049 Ga0495628_0060049_1162_1599 126
105 3300046516 Ga0495628_0200303 Ga0495628_0200303_958_1395 126
106 3300046517 Ga0495630_0001439 Ga0495630_0001439_2986_3423 126
107 3300046526 Ga0495666_0017744 Ga0495666_0017744_1092_1529 126
108 3300046529 Ga0495652_0149866 Ga0495652_0149866_79_516 126
109 3300046529 Ga0495652_0652893 Ga0495652_0652893_113_550 126
110 3300046533 Ga0495640_0008228 Ga0495640_0008228_4351_4788 126
111 3300046535 Ga0495586_0010436 Ga0495586_0010436_703_1140 126
112 3300046536 Ga0495587_0069446 Ga0495587_0069446_765_1202 126
113 3300046536 Ga0495587_0317009 Ga0495587_0317009_72_509 126
114 3300046559 Ga0495667_0086244 Ga0495667_0086244_508_945 126
115 3300046559 Ga0495667_0114995 Ga0495667_0114995_691_1128 126
116 3300046559 Ga0495667_0154021 Ga0495667_0154021_908_1345 126
117 3300046642 Ga0495634_0026780 Ga0495634_0026780_586_1023 126
118 3300046663 Ga0495635_0161182 Ga0495635_0161182_240_677 126
119 3300046675 Ga0495657_0014287 Ga0495657_0014287_1999_2436 126
120 3300046675 Ga0495657_0085419 Ga0495657_0085419_1518_1955 126
121 3300046678 Ga0495599_0032502 Ga0495599_0032502_1019_1456 126
122 3300046683 Ga0495658_0004331 Ga0495658_0004331_909_1346 126
123 3300046690 Ga0495624_0319834 Ga0495624_0319834_351_788 126
124 3300046809 Ga0495600_0000925 Ga0495600_0000925_11094_11531 126
125 3300047317 Ga0495604_0021238 Ga0495604_0021238_2223_2660 126
126 3300047318 Ga0495636_0080229 Ga0495636_0080229_252_689 126
127 3300047319 Ga0495674_0005040 Ga0495674_0005040_6822_7259 126
128 3300047322 Ga0495680_0012165 Ga0495680_0012165_4078_4515 126
129 3300047322 Ga0495680_0232488 Ga0495680_0232488_755_1192 126
130 3300047322 Ga0495680_0468693 Ga0495680_0468693_144_581 126
131 3300047444 Ga0495675_0003423 Ga0495675_0003423_8464_8901 126
132 3300047444 Ga0495675_0175941 Ga0495675_0175941_432_869 126
133 3300047444 Ga0495675_0580147 Ga0495675_0580147_165_602 126
134 3300047471 Ga0495684_0062577 Ga0495684_0062577_458_895 126
135 3300047471 Ga0495684_0107115 Ga0495684_0107115_502_939 126
136 3300047673 Ga0495593_0529683 Ga0495593_0529683_101_538 126
137 3300048089 Ga0495614_0035261 Ga0495614_0035261_1604_2041 126
138 3300050515 nmdc:mga0a205_655192_c1 nmdc:mga0a205_655192_c1_230_667 126
139 3300053077 Ga0495601_0011073 Ga0495601_0011073_1049_1486 126
140 3300053084 Ga0495595_0026834 Ga0495595_0026834_110_547 126
141 3300053085 Ga0495619_0009507 Ga0495619_0009507_2711_3148 126
142 iso_pu_bacteria 2837678835 2837679460 126
143 iso_pu_bacteria 2837678835 2837682938 126
144 iso_pu_bacteria 2891048133 2891051563 126
145 3300049580 Ga0501046_0000023 Ga0501046_0000023_113138_113593 127
146 iso_pu_bacteria 2510917022 2511133710 127
147 iso_pu_bacteria 2582581307 2585270600 127
148 iso_pu_bacteria 2585427531 2585558305 127
149 iso_pu_bacteria 2585427608 2585897697 127
150 iso_pu_bacteria 2585427609 2585904707 127
151 iso_pu_bacteria 2585427634 2586000229 127
152 iso_pu_bacteria 2585428125 2587980177 127
153 iso_pu_bacteria 2757320392 2757572399 127
154 iso_pu_bacteria 2837651117 2837653798 127
155 iso_pu_bacteria 2915650412 2915651813 127
156 iso_pu_bacteria 2939669807 2939670879 127
157 iso_pu_bacteria 8055431914 8055435049 127
158 iso_pu_bacteria 2503198000 2503202584 128
159 iso_pu_bacteria 2508501122 2509107870 128
160 iso_pu_bacteria 2508501123 2509114391 128
161 iso_pu_bacteria 2508501127 2509143520 128
162 iso_pu_bacteria 2509276018 2509373171 128
163 iso_pu_bacteria 2509276019 2509376267 128
164 iso_pu_bacteria 2509276021 2509387057 128
165 iso_pu_bacteria 2509276022 2509397098 128
166 iso_pu_bacteria 2509276033 2509442553 128
167 iso_pu_bacteria 2510065019 2510132906 128
168 iso_pu_bacteria 2510065057 2510307044 128
169 iso_pu_bacteria 2510065059 2510317133 128
170 iso_pu_bacteria 2510461076 2510894278 128
171 iso_pu_bacteria 2510461076 2510899303 128
172 iso_pu_bacteria 2510917028 2511182766 128
173 iso_pu_bacteria 2510917030 2511198270 128
174 iso_pu_bacteria 2511231052 2511501363 128
175 iso_pu_bacteria 2512047086 2512532782 128
176 iso_pu_bacteria 2512875016 2512930639 128
177 iso_pu_bacteria 2512875024 2512958386 128
178 iso_pu_bacteria 2512875026 2512971886 128
179 iso_pu_bacteria 2513237084 2513570007 128
180 iso_pu_bacteria 2513237085 2513575262 128
181 iso_pu_bacteria 2513237086 2513587774 128
182 iso_pu_bacteria 2513237088 2513598987 128
183 iso_pu_bacteria 2513237089 2513606288 128
184 iso_pu_bacteria 2513237090 2513614324 128
185 iso_pu_bacteria 2513237091 2513617806 128
186 iso_pu_bacteria 2513237093 2513633050 128
187 iso_pu_bacteria 2513237103 2513710229 128
188 iso_pu_bacteria 2513237140 2513886243 128
189 iso_pu_bacteria 2513237143 2513906298 128
190 iso_pu_bacteria 2513237144 2513909791 128
191 iso_pu_bacteria 2513237156 2513987427 128
192 iso_pu_bacteria 2513237160 2514005437 128
193 iso_pu_bacteria 2513237162 2514019901 128
194 iso_pu_bacteria 2513237164 2514038351 128
195 iso_pu_bacteria 2513237305 2514419076 128
196 iso_pu_bacteria 2513237351 2514590244 128
197 iso_pu_bacteria 2515075009 2515111858 128
198 iso_pu_bacteria 2515154113 2515633643 128
199 iso_pu_bacteria 2515154114 2515642186 128
200 iso_pu_bacteria 2515154116 2515656241 128
201 iso_pu_bacteria 2515154134 2515738960 128
202 iso_pu_bacteria 2516143018 2516209237 128
203 iso_pu_bacteria 2516653046 2516892641 128
204 iso_pu_bacteria 2516653077 2517035576 128
205 iso_pu_bacteria 2516653085 2517076035 128
206 iso_pu_bacteria 2517093000 2517094775 128
207 iso_pu_bacteria 2517287029 2517406402 128
208 iso_pu_bacteria 2517487022 2517569456 128
209 iso_pu_bacteria 2519899620 2520376179 128
210 iso_pu_bacteria 2523231067 2523470292 128
211 iso_pu_bacteria 2524023207 2524452869 128
212 iso_pu_bacteria 2524023209 2524460391 128
213 iso_pu_bacteria 2529292951 2530645158 128
214 iso_pu_bacteria 2534681796 2535516175 128
215 iso_pu_bacteria 2537561587 2537874647 128
216 iso_pu_bacteria 2551306084 2551682275 128
217 iso_pu_bacteria 2551306085 2551684598 128
218 iso_pu_bacteria 2551306086 2551693596 128
219 iso_pu_bacteria 2551306087 2551703236 128
220 iso_pu_bacteria 2551306089 2551708978 128
221 iso_pu_bacteria 2551306090 2551719091 128
222 iso_pu_bacteria 2551306091 2551728214 128
223 iso_pu_bacteria 2551306092 2551734100 128
224 iso_pu_bacteria 2551306093 2551740120 128
225 iso_pu_bacteria 2558860100 2558863135 128
226 iso_pu_bacteria 2582581283 2585168289 128
227 iso_pu_bacteria 2582581294 2585199895 128
228 iso_pu_bacteria 2582581298 2585225878 128
229 iso_pu_bacteria 2582581299 2585230118 128
230 iso_pu_bacteria 2582581304 2585254382 128
231 iso_pu_bacteria 2582581306 2585268916 128
232 iso_pu_bacteria 2582581308 2585276947 128
233 iso_pu_bacteria 2582581315 2585324053 128
234 iso_pu_bacteria 2582581316 2585333554 128
235 iso_pu_bacteria 2582581865 2585389441 128
236 iso_pu_bacteria 2582581866 2585393948 128
237 iso_pu_bacteria 2582581867 2585400733 128
238 iso_pu_bacteria 2585427526 2585528177 128
239 iso_pu_bacteria 2585427527 2585534747 128
240 iso_pu_bacteria 2585427528 2585540385 128
241 iso_pu_bacteria 2585427529 2585546838 128
242 iso_pu_bacteria 2585427530 2585551808 128
243 iso_pu_bacteria 2585427590 2585819707 128
244 iso_pu_bacteria 2585427593 2585838584 128
245 iso_pu_bacteria 2588253730 2588516289 128
246 iso_pu_bacteria 2597489875 2597813753 128
247 iso_pu_bacteria 2599185156 2599333427 128
248 iso_pu_bacteria 2599185210 2599602214 128
249 iso_pu_bacteria 2599185236 2599721199 128
250 iso_pu_bacteria 2599185301 2599939609 128
251 iso_pu_bacteria 2599185352 2600192318 128
252 iso_pu_bacteria 2600254933 2600374446 128
253 iso_pu_bacteria 2600255279 2601608343 128
254 iso_pu_bacteria 2600255308 2601745117 128
255 iso_pu_bacteria 2615840624 2616292793 128
256 iso_pu_bacteria 2615840626 2616308320 128
257 iso_pu_bacteria 2615840698 2616556620 128
258 iso_pu_bacteria 2617270742 2617381670 128
259 iso_pu_bacteria 2643221551 2643775649 128
260 iso_pu_bacteria 2643221555 2643794096 128
261 iso_pu_bacteria 2643221557 2643808399 128
262 iso_pu_bacteria 2643221564 2643837880 128
263 iso_pu_bacteria 2643221568 2643855522 128
264 iso_pu_bacteria 2643221595 2643987147 128
265 iso_pu_bacteria 2643221599 2644005865 128
266 iso_pu_bacteria 2643221607 2644049573 128
267 iso_pu_bacteria 2643221610 2644066507 128
268 iso_pu_bacteria 2643221623 2644132121 128
269 iso_pu_bacteria 2643221626 2644145223 128
270 iso_pu_bacteria 2643221627 2644155698 128
271 iso_pu_bacteria 2643221634 2644193089 128
272 iso_pu_bacteria 2643221636 2644204019 128
273 iso_pu_bacteria 2643221637 2644207616 128
274 iso_pu_bacteria 2643221653 2644300407 128
275 iso_pu_bacteria 2643221655 2644307804 128
276 iso_pu_bacteria 2643221659 2644332580 128
277 iso_pu_bacteria 2643221668 2644378096 128
278 iso_pu_bacteria 2643221675 2644415280 128
279 iso_pu_bacteria 2643221680 2644450319 128
280 iso_pu_bacteria 2643221686 2644482607 128
281 iso_pu_bacteria 2643221688 2644494724 128
282 iso_pu_bacteria 2643221698 2644544326 128
283 iso_pu_bacteria 2643221712 2644613893 128
284 iso_pu_bacteria 2643221718 2644654577 128
285 iso_pu_bacteria 2643221719 2644658631 128
286 iso_pu_bacteria 2643221723 2644677894 128
287 iso_pu_bacteria 2643221726 2644687871 128
288 iso_pu_bacteria 2657244999 2657683713 128
289 iso_pu_bacteria 2667528174 2671115716 128
290 iso_pu_bacteria 2687453392 2688599134 128
291 iso_pu_bacteria 2690316117 2692316441 128
292 iso_pu_bacteria 2693429783 2694631980 128
293 iso_pu_bacteria 2693429784 2694634599 128
294 iso_pu_bacteria 2718217882 2719180796 128
295 iso_pu_bacteria 2718217927 2719385435 128
296 iso_pu_bacteria 2718217997 2719665262 128
297 iso_pu_bacteria 2718218009 2719731545 128
298 iso_pu_bacteria 2718218199 2720491682 128
299 iso_pu_bacteria 2718218232 2720612936 128
300 iso_pu_bacteria 2718218233 2720619795 128
301 iso_pu_bacteria 2718218235 2720631226 128
302 iso_pu_bacteria 2718218269 2720774953 128
303 iso_pu_bacteria 2718218363 2721146890 128
304 iso_pu_bacteria 2718218365 2721158417 128
305 iso_pu_bacteria 2718218366 2721163769 128
306 iso_pu_bacteria 2718218423 2721399184 128
307 iso_pu_bacteria 2721755514 2722839939 128
308 iso_pu_bacteria 2721755556 2723026590 128
309 iso_pu_bacteria 2721755684 2723560194 128
310 iso_pu_bacteria 2721755685 2723566773 128
311 iso_pu_bacteria 2721755686 2723576139 128
312 iso_pu_bacteria 2721755809 2724037997 128
313 iso_pu_bacteria 2721755810 2724044301 128
314 iso_pu_bacteria 2721755819 2724089560 128
315 iso_pu_bacteria 2721755822 2724104038 128
316 iso_pu_bacteria 2721755823 2724109854 128
317 iso_pu_bacteria 2724679232 2725952350 128
318 iso_pu_bacteria 2728369352 2730107526 128
319 iso_pu_bacteria 2728369365 2730164033 128
320 iso_pu_bacteria 2728369397 2730298049 128
321 iso_pu_bacteria 2738541317 2738945512 128
322 iso_pu_bacteria 2738541333 2739038310 128
323 iso_pu_bacteria 2738543024 2739307934 128
324 iso_pu_bacteria 2738543031 2739350329 128
325 iso_pu_bacteria 2756170246 2756676990 128
326 iso_pu_bacteria 2765235942 2766067895 128
327 iso_pu_bacteria 2775507049 2776913332 128
328 iso_pu_bacteria 2775507266 2778176457 128
329 iso_pu_bacteria 2791355082 2792581205 128
330 iso_pu_bacteria 2791355091 2792623213 128
331 iso_pu_bacteria 2791355092 2792626977 128
332 iso_pu_bacteria 2791355094 2792642487 128
333 iso_pu_bacteria 2791355123 2792752930 128
334 iso_pu_bacteria 2791355256 2793299214 128
335 iso_pu_bacteria 2791355259 2793313851 128
336 iso_pu_bacteria 2791355260 2793321227 128
337 iso_pu_bacteria 2791355261 2793326358 128
338 iso_pu_bacteria 2791355262 2793336943 128
339 iso_pu_bacteria 2791355263 2793344842 128
340 iso_pu_bacteria 2791355264 2793347746 128
341 iso_pu_bacteria 2791355265 2793352292 128
342 iso_pu_bacteria 2791355266 2793360362 128
343 iso_pu_bacteria 2791355267 2793366430 128
344 iso_pu_bacteria 2802428858 2802718882 128
345 iso_pu_bacteria 2802428859 2802726493 128
346 iso_pu_bacteria 2802428860 2802733785 128
347 iso_pu_bacteria 2802428861 2802738391 128
348 iso_pu_bacteria 2802428862 2802744723 128
349 iso_pu_bacteria 2802428863 2802751071 128
350 iso_pu_bacteria 2802429268 2804751850 128
351 iso_pu_bacteria 2802429605 2805927619 128
352 iso_pu_bacteria 2802429606 2805936095 128
353 iso_pu_bacteria 2802429633 2806045514 128
354 iso_pu_bacteria 2802429634 2806051681 128
355 iso_pu_bacteria 2802429635 2806061725 128
356 iso_pu_bacteria 2802429636 2806067906 128
357 iso_pu_bacteria 2802429637 2806072742 128
358 iso_pu_bacteria 2818991272 2819241975 128
359 iso_pu_bacteria 2818991439 2819559995 128
360 iso_pu_bacteria 2818991448 2819610429 128
361 iso_pu_bacteria 2818991453 2819638164 128
362 iso_pu_bacteria 2818991461 2819687405 128
363 iso_pu_bacteria 2821123053 2821127710 128
364 iso_pu_bacteria 2838016132 2838018790 128
365 iso_pu_bacteria 2838022645 2838025504 128
366 iso_pu_bacteria 2838029111 2838034621 128
367 iso_pu_bacteria 2838042994 2838043097 128
368 iso_pu_bacteria 2838048938 2838052138 128
369 iso_pu_bacteria 2838061910 2838067251 128
370 iso_pu_bacteria 2838068647 2838071357 128
371 iso_pu_bacteria 2838668709 2838670061 128
372 iso_pu_bacteria 2838675328 2838676413 128
373 iso_pu_bacteria 2838680041 2838682589 128
374 iso_pu_bacteria 2838686498 2838689108 128
375 iso_pu_bacteria 2838694306 2838697168 128
376 iso_pu_bacteria 2838701080 2838702433 128
377 iso_pu_bacteria 2838707686 2838709599 128
378 iso_pu_bacteria 2838714209 2838715296 128
379 iso_pu_bacteria 2838719591 2838720904 128
380 iso_pu_bacteria 2838724970 2838726054 128
381 iso_pu_bacteria 2838729681 2838730443 128
382 iso_pu_bacteria 2838736955 2838738133 128
383 iso_pu_bacteria 2838742623 2838743384 128
384 iso_pu_bacteria 2841734538 2841740380 128
385 iso_pu_bacteria 2841840854 2841841498 128
386 iso_pu_bacteria 2841846520 2841847833 128
387 iso_pu_bacteria 2841851746 2841854929 128
388 iso_pu_bacteria 2841859092 2841859629 128
389 iso_pu_bacteria 2841864319 2841864927 128
390 iso_pu_bacteria 2842077413 2842077765 128
391 iso_pu_bacteria 2842110456 2842110906 128
392 iso_pu_bacteria 2842118031 2842119726 128
393 iso_pu_bacteria 2842124991 2842126137 128
394 iso_pu_bacteria 2842130223 2842131307 128
395 iso_pu_bacteria 2842140634 2842141276 128
396 iso_pu_bacteria 2842146304 2842147022 128
397 iso_pu_bacteria 2842152218 2842153523 128
398 iso_pu_bacteria 2842156927 2842157791 128
399 iso_pu_bacteria 2842163707 2842165004 128
400 iso_pu_bacteria 2842170452 2842171539 128
401 iso_pu_bacteria 2842175837 2842177143 128
402 iso_pu_bacteria 2842180545 2842180625 128
403 iso_pu_bacteria 2842187318 2842188404 128
404 iso_pu_bacteria 2842192696 2842197017 128
405 iso_pu_bacteria 2842198810 2842201073 128
406 iso_pu_bacteria 2842205361 2842206420 128
407 iso_pu_bacteria 2842211629 2842212715 128
408 iso_pu_bacteria 2842217011 2842220603 128
409 iso_pu_bacteria 2842224351 2842225666 128
410 iso_pu_bacteria 2842229732 2842231324 128
411 iso_pu_bacteria 2842237096 2842239012 128
412 iso_pu_bacteria 2842243621 2842244562 128
413 iso_pu_bacteria 2842250916 2842252087 128
414 iso_pu_bacteria 2842257432 2842258375 128
415 iso_pu_bacteria 2842264693 2842267536 128
416 iso_pu_bacteria 2842271015 2842273128 128
417 iso_pu_bacteria 2842278818 2842279877 128
418 iso_pu_bacteria 2842285085 2842287510 128
419 iso_pu_bacteria 2842291075 2842291427 128
420 iso_pu_bacteria 2842298080 2842301856 128
421 iso_pu_bacteria 2842304105 2842309389 128
422 iso_pu_bacteria 2842311132 2842315414 128
423 iso_pu_bacteria 2842317721 2842318268 128
424 iso_pu_bacteria 2842341865 2842347157 128
425 iso_pu_bacteria 2842357229 2842362346 128
426 iso_pu_bacteria 2842363717 2842366753 128
427 iso_pu_bacteria 2842370503 2842373164 128
428 iso_pu_bacteria 2842377471 2842377823 128
429 iso_pu_bacteria 2842384541 2842386236 128
430 iso_pu_bacteria 2842395702 2842397282 128
431 iso_pu_bacteria 2842402390 2842404961 128
432 iso_pu_bacteria 2842409023 2842411543 128
433 iso_pu_bacteria 2842415677 2842418006 128
434 iso_pu_bacteria 2842422224 2842424986 128
435 iso_pu_bacteria 2842428310 2842431886 128
436 iso_pu_bacteria 2842434925 2842437999 128
437 iso_pu_bacteria 2842441272 2842444813 128
438 iso_pu_bacteria 2842447887 2842451729 128
439 iso_pu_bacteria 2842462802 2842465810 128
440 iso_pu_bacteria 2842469257 2842472616 128
441 iso_pu_bacteria 2842475841 2842481368 128
442 iso_pu_bacteria 2842482326 2842487152 128
443 iso_pu_bacteria 2842489311 2842492751 128
444 iso_pu_bacteria 2842495871 2842496539 128
445 iso_pu_bacteria 2842502639 2842508268 128
446 iso_pu_bacteria 2842509118 2842510193 128
447 iso_pu_bacteria 2842515876 2842516414 128
448 iso_pu_bacteria 2842521101 2842525941 128
449 iso_pu_bacteria 2844002411 2844006718 128
450 iso_pu_bacteria 2844009547 2844014314 128
451 iso_pu_bacteria 2844454524 2844459538 128
452 iso_pu_bacteria 2847417321 2847418491 128
453 iso_pu_bacteria 2847670302 2847670858 128
454 iso_pu_bacteria 2847686936 2847687000 128
455 iso_pu_bacteria 2848992105 2848993469 128
456 iso_pu_bacteria 2850079185 2850080793 128
457 iso_pu_bacteria 2852387548 2852389601 128
458 iso_pu_bacteria 2854896431 2854899078 128
459 iso_pu_bacteria 2854916844 2854916966 128
460 iso_pu_bacteria 2855825444 2855825454 128
461 iso_pu_bacteria 2855839649 2855840831 128
462 iso_pu_bacteria 2855872281 2855873346 128
463 iso_pu_bacteria 2856314179 2856316315 128
464 iso_pu_bacteria 2856320880 2856323617 128
465 iso_pu_bacteria 2856328259 2856329082 128
466 iso_pu_bacteria 2856334872 2856335904 128
467 iso_pu_bacteria 2856342000 2856346780 128
468 iso_pu_bacteria 2856349417 2856353279 128
469 iso_pu_bacteria 2856356410 2856362202 128
470 iso_pu_bacteria 2856364286 2856369074 128
471 iso_pu_bacteria 2857349434 2857355658 128
472 iso_pu_bacteria 2857367948 2857371157 128
473 iso_pu_bacteria 2857516855 2857523700 128
474 iso_pu_bacteria 2857531043 2857534627 128
475 iso_pu_bacteria 2858800743 2858801376 128
476 iso_pu_bacteria 2869162929 2869167954 128
477 iso_pu_bacteria 2869169390 2869173877 128
478 iso_pu_bacteria 2869234852 2869236390 128
479 iso_pu_bacteria 2869242130 2869247899 128
480 iso_pu_bacteria 2869249662 2869251105 128
481 iso_pu_bacteria 2869256925 2869263503 128
482 iso_pu_bacteria 2869278585 2869278888 128
483 iso_pu_bacteria 2869285874 2869291592 128
484 iso_pu_bacteria 2871429161 2871433892 128
485 iso_pu_bacteria 2871444079 2871445827 128
486 iso_pu_bacteria 2871451962 2871455718 128
487 iso_pu_bacteria 2871466892 2871469784 128
488 iso_pu_bacteria 2871474448 2871477692 128
489 iso_pu_bacteria 2871481445 2871485584 128
490 iso_pu_bacteria 2871488783 2871495034 128
491 iso_pu_bacteria 2871495908 2871500530 128
492 iso_pu_bacteria 2874102143 2874108168 128
493 iso_pu_bacteria 2874109183 2874109389 128
494 iso_pu_bacteria 2874116593 2874119857 128
495 iso_pu_bacteria 2874123672 2874125775 128
496 iso_pu_bacteria 2874139085 2874145479 128
497 iso_pu_bacteria 2874146452 2874153451 128
498 iso_pu_bacteria 2874155637 2874160715 128
499 iso_pu_bacteria 2874168670 2874172642 128
500 iso_pu_bacteria 2876363079 2876368014 128
501 iso_pu_bacteria 2876377896 2876385116 128
502 iso_pu_bacteria 2876386047 2876387864 128
503 iso_pu_bacteria 2876399893 2876403318 128
504 iso_pu_bacteria 2876413966 2876419741 128
505 iso_pu_bacteria 2876420981 2876424923 128
506 iso_pu_bacteria 2878035449 2878041638 128
507 iso_pu_bacteria 2878730984 2878737340 128
508 iso_pu_bacteria 2878738818 2878743783 128
509 iso_pu_bacteria 2878745973 2878751504 128
510 iso_pu_bacteria 2878753008 2878758245 128
511 iso_pu_bacteria 2878760144 2878764619 128
512 iso_pu_bacteria 2878767105 2878771720 128
513 iso_pu_bacteria 2878781027 2878782230 128
514 iso_pu_bacteria 2878788777 2878793542 128
515 iso_pu_bacteria 2881147464 2881152629 128
516 iso_pu_bacteria 2881155292 2881156196 128
517 iso_pu_bacteria 2881161766 2881168557 128
518 iso_pu_bacteria 2881845957 2881848978 128
519 iso_pu_bacteria 2881853255 2881860820 128
520 iso_pu_bacteria 2881861095 2881861879 128
521 iso_pu_bacteria 2882632389 2882633137 128
522 iso_pu_bacteria 2882912400 2882917876 128
523 iso_pu_bacteria 2885305155 2885310605 128
524 iso_pu_bacteria 2885312484 2885317368 128
525 iso_pu_bacteria 2885318864 2885325726 128
526 iso_pu_bacteria 2885326080 2885329242 128
527 iso_pu_bacteria 2885334103 2885335103 128
528 iso_pu_bacteria 2885342637 2885346511 128
529 iso_pu_bacteria 2885350715 2885353975 128
530 iso_pu_bacteria 2888337043 2888340612 128
531 iso_pu_bacteria 2888350351 2888356817 128
532 iso_pu_bacteria 2889010040 2889011869 128
533 iso_pu_bacteria 2889016732 2889023202 128
534 iso_pu_bacteria 2891373044 2891375572 128
535 iso_pu_bacteria 2899792073 2899796386 128
536 iso_pu_bacteria 2899803654 2899808942 128
537 iso_pu_bacteria 2903448605 2903449775 128
538 iso_pu_bacteria 2903492973 2903495968 128
539 iso_pu_bacteria 2903492973 2903505488 128
540 iso_pu_bacteria 2903513507 2903521313 128
541 iso_pu_bacteria 2903521522 2903527010 128
542 iso_pu_bacteria 2903528002 2903533237 128
543 iso_pu_bacteria 2903540706 2903545343 128
544 iso_pu_bacteria 2904659560 2904661820 128
545 iso_pu_bacteria 2906308376 2906313402 128
546 iso_pu_bacteria 2906321335 2906326111 128
547 iso_pu_bacteria 2906328253 2906328427 128
548 iso_pu_bacteria 2906401398 2906404580 128
549 iso_pu_bacteria 2906414383 2906416452 128
550 iso_pu_bacteria 2909042592 2909048097 128
551 iso_pu_bacteria 2913295892 2913300405 128
552 iso_pu_bacteria 2913308742 2913310218 128
553 iso_pu_bacteria 2915980308 2915985197 128
554 iso_pu_bacteria 2915986958 2915987811 128
555 iso_pu_bacteria 2915993759 2915997475 128
556 iso_pu_bacteria 2916000859 2916003910 128
557 iso_pu_bacteria 2916007675 2916014445 128
558 iso_pu_bacteria 2916014648 2916015342 128
559 iso_pu_bacteria 2916021584 2916028369 128
560 iso_pu_bacteria 2916028427 2916034857 128
561 iso_pu_bacteria 2916035215 2916041164 128
562 iso_pu_bacteria 2916041962 2916046292 128
563 iso_pu_bacteria 2916048683 2916051080 128
564 iso_pu_bacteria 2916055098 2916060618 128
565 iso_pu_bacteria 2916061851 2916067396 128
566 iso_pu_bacteria 2916068649 2916070784 128
567 iso_pu_bacteria 2916076590 2916082843 128
568 iso_pu_bacteria 2919100787 2919107794 128
569 iso_pu_bacteria 2919114240 2919115389 128
570 iso_pu_bacteria 2919166419 2919167717 128
571 iso_pu_bacteria 2919171160 2919175332 128
572 iso_pu_bacteria 2919408235 2919409770 128
573 iso_pu_bacteria 2920822456 2920824204 128
574 iso_pu_bacteria 2921201388 2921207796 128
575 iso_pu_bacteria 2921208531 2921210224 128
576 iso_pu_bacteria 2921237296 2921243780 128
577 iso_pu_bacteria 2921244191 2921250336 128
578 iso_pu_bacteria 2921250672 2921253046 128
579 iso_pu_bacteria 2921257292 2921260462 128
580 iso_pu_bacteria 2921263974 2921270427 128
581 iso_pu_bacteria 2921282425 2921289136 128
582 iso_pu_bacteria 2921289301 2921293504 128
583 iso_pu_bacteria 2921296804 2921304616 128
584 iso_pu_bacteria 2922130491 2922136095 128
585 iso_pu_bacteria 2922151315 2922153788 128
586 iso_pu_bacteria 2922158528 2922165481 128
587 iso_pu_bacteria 2922172374 2922172411 128
588 iso_pu_bacteria 2922185730 2922192182 128
589 iso_pu_bacteria 2924144063 2924147583 128
590 iso_pu_bacteria 2924150972 2924156411 128
591 iso_pu_bacteria 2924158325 2924165137 128
592 iso_pu_bacteria 2924165586 2924172838 128
593 iso_pu_bacteria 2924172951 2924179339 128
594 iso_pu_bacteria 2924179722 2924183010 128
595 iso_pu_bacteria 2924186466 2924192764 128
596 iso_pu_bacteria 2924193448 2924197853 128
597 iso_pu_bacteria 2924200457 2924206429 128
598 iso_pu_bacteria 2924207177 2924211548 128
599 iso_pu_bacteria 2924214083 2924215555 128
600 iso_pu_bacteria 2924221636 2924223350 128
601 iso_pu_bacteria 2924228884 2924234677 128
602 iso_pu_bacteria 2924726620 2924726779 128
603 iso_pu_bacteria 2924733363 2924734640 128
604 iso_pu_bacteria 2924741084 2924745657 128
605 iso_pu_bacteria 2924754689 2924757085 128
606 iso_pu_bacteria 2924762789 2924763902 128
607 iso_pu_bacteria 2924776078 2924781596 128
608 iso_pu_bacteria 2924784321 2924789535 128
609 iso_pu_bacteria 2926754445 2926756439 128
610 iso_pu_bacteria 2933006813 2933008167 128
611 iso_pu_bacteria 2933011516 2933012946 128
612 iso_pu_bacteria 2933016740 2933019229 128
613 iso_pu_bacteria 2933570622 2933575837 128
614 iso_pu_bacteria 2933586486 2933586931 128
615 iso_pu_bacteria 2933594066 2933595465 128
616 iso_pu_bacteria 2933599457 2933602156 128
617 iso_pu_bacteria 2935894831 2935898975 128
618 iso_pu_bacteria 2935901341 2935904839 128
619 iso_pu_bacteria 2936367885 2936373135 128
620 iso_pu_bacteria 2936375103 2936381280 128
621 iso_pu_bacteria 2936381700 2936384552 128
622 iso_pu_bacteria 2937002841 2937007267 128
623 iso_pu_bacteria 2937009748 2937012428 128
624 iso_pu_bacteria 2937016420 2937022578 128
625 iso_pu_bacteria 2937023124 2937029203 128
626 iso_pu_bacteria 2937029754 2937031172 128
627 iso_pu_bacteria 2937036028 2937040882 128
628 iso_pu_bacteria 2937042894 2937049693 128
629 iso_pu_bacteria 2937049772 2937050089 128
630 iso_pu_bacteria 2937056579 2937059648 128
631 iso_pu_bacteria 2937063883 2937071211 128
632 iso_pu_bacteria 2937071275 2937075649 128
633 iso_pu_bacteria 2937078374 2937079966 128
634 iso_pu_bacteria 2937084907 2937089186 128
635 iso_pu_bacteria 2937091812 2937092271 128
636 iso_pu_bacteria 2937098957 2937105861 128
637 iso_pu_bacteria 2937106411 2937113121 128
638 iso_pu_bacteria 2937113482 2937117269 128
639 iso_pu_bacteria 2937119839 2937125326 128
640 iso_pu_bacteria 2937126314 2937130392 128
641 iso_pu_bacteria 2937813078 2937820448 128
642 iso_pu_bacteria 2937822353 2937827011 128
643 iso_pu_bacteria 2937836603 2937840066 128
644 iso_pu_bacteria 2937843397 2937846153 128
645 iso_pu_bacteria 2937848649 2937853703 128
646 iso_pu_bacteria 2937861824 2937862053 128
647 iso_pu_bacteria 2937868953 2937869549 128
648 iso_pu_bacteria 2937877337 2937879248 128
649 iso_pu_bacteria 2937891427 2937895071 128
650 iso_pu_bacteria 2937972304 2937975019 128
651 iso_pu_bacteria 2937980651 2937981721 128
652 iso_pu_bacteria 2937994558 2937999193 128
653 iso_pu_bacteria 2938014810 2938016190 128
654 iso_pu_bacteria 2941499720 2941499838 128
655 iso_pu_bacteria 2957375807 2957380852 128
656 iso_pu_bacteria 2957382221 2957388041 128
657 iso_pu_bacteria 2957388812 2957394233 128
658 iso_pu_bacteria 2957395598 2957399339 128
659 iso_pu_bacteria 2957402308 2957407896 128
660 iso_pu_bacteria 2957408893 2957412574 128
661 iso_pu_bacteria 2957415311 2957416080 128
662 iso_pu_bacteria 2957422303 2957422943 128
663 iso_pu_bacteria 2957430029 2957436769 128
664 iso_pu_bacteria 2957437181 2957439169 128
665 iso_pu_bacteria 2957443900 2957450055 128
666 iso_pu_bacteria 2957450854 2957456758 128
667 iso_pu_bacteria 2957457609 2957464636 128
668 iso_pu_bacteria 2957464669 2957470648 128
669 iso_pu_bacteria 2957471148 2957472317 128
670 iso_pu_bacteria 2957478035 2957483513 128
671 iso_pu_bacteria 2957484790 2957491520 128
672 iso_pu_bacteria 2957491536 2957494967 128
673 iso_pu_bacteria 2957498199 2957505075 128
674 iso_pu_bacteria 2957505466 2957505862 128
675 iso_pu_bacteria 2958034702 2958035003 128
676 iso_pu_bacteria 2958041894 2958042867 128
677 iso_pu_bacteria 2958064165 2958067202 128
678 iso_pu_bacteria 2958071322 2958072495 128
679 iso_pu_bacteria 2958084443 2958086423 128
680 iso_pu_bacteria 2958092219 2958100037 128
681 iso_pu_bacteria 2958100919 2958103289 128
682 iso_pu_bacteria 2958108152 2958113334 128
683 iso_pu_bacteria 2958115193 2958122562 128
684 iso_pu_bacteria 2958122699 2958126378 128
685 iso_pu_bacteria 2958130278 2958135993 128
686 iso_pu_bacteria 2958137437 2958139663 128
687 iso_pu_bacteria 2958158011 2958162085 128
688 iso_pu_bacteria 2958165035 2958169667 128
689 iso_pu_bacteria 2958172287 2958177688 128
690 iso_pu_bacteria 2958179912 2958185459 128
691 iso_pu_bacteria 2960584000 2960590900 128
692 iso_pu_bacteria 2960591022 2960596132 128
693 iso_pu_bacteria 2960597568 2960602832 128
694 iso_pu_bacteria 2960603979 2960607250 128
695 iso_pu_bacteria 2960610863 2960614985 128
696 iso_pu_bacteria 2960617483 2960623205 128
697 iso_pu_bacteria 2960624210 2960628864 128
698 iso_pu_bacteria 2960631154 2960634638 128
699 iso_pu_bacteria 2960637947 2960639208 128
700 iso_pu_bacteria 2960645483 2960652686 128
701 iso_pu_bacteria 2960652885 2960653107 128
702 iso_pu_bacteria 2960660292 2960666729 128
703 iso_pu_bacteria 2960667422 2960673339 128
704 iso_pu_bacteria 2960674078 2960680458 128
705 iso_pu_bacteria 2960680706 2960686828 128
706 iso_pu_bacteria 2960687367 2960693813 128
707 iso_pu_bacteria 2960693952 2960699779 128
708 iso_pu_bacteria 2961077736 2961083727 128
709 iso_pu_bacteria 2961114664 2961116973 128
710 iso_pu_bacteria 2961127735 2961136397 128
711 iso_pu_bacteria 2961136820 2961141197 128
712 iso_pu_bacteria 2961163497 2961168127 128
713 iso_pu_bacteria 2961170736 2961174875 128
714 iso_pu_bacteria 2961183825 2961187944 128
715 iso_pu_bacteria 2963644680 2963648587 128
716 iso_pu_bacteria 2964607997 2964611135 128
717 iso_pu_bacteria 2964615318 2964620755 128
718 iso_pu_bacteria 2964621998 2964628858 128
719 iso_pu_bacteria 2964628898 2964635920 128
720 iso_pu_bacteria 2964636051 2964637896 128
721 iso_pu_bacteria 2964643177 2964649140 128
722 iso_pu_bacteria 2964649959 2964655804 128
723 iso_pu_bacteria 2964656573 2964660217 128
724 iso_pu_bacteria 2964663802 2964666189 128
725 iso_pu_bacteria 2964670856 2964678092 128
726 iso_pu_bacteria 2964678106 2964679327 128
727 iso_pu_bacteria 2964685014 2964685368 128
728 iso_pu_bacteria 2964691889 2964698656 128
729 iso_pu_bacteria 2964698721 2964702085 128
730 iso_pu_bacteria 2964705432 2964709240 128
731 iso_pu_bacteria 2964712639 2964714672 128
732 iso_pu_bacteria 2964719344 2964719618 128
733 iso_pu_bacteria 2965018300 2965022946 128
734 iso_pu_bacteria 2965025482 2965029236 128
735 iso_pu_bacteria 2965040258 2965046192 128
736 iso_pu_bacteria 2965062239 2965067483 128
737 iso_pu_bacteria 2965089291 2965095016 128
738 iso_pu_bacteria 2965110997 2965111589 128
739 iso_pu_bacteria 2965119406 2965121026 128
740 iso_pu_bacteria 2967664464 2967668631 128
741 iso_pu_bacteria 2967671571 2967674553 128
742 iso_pu_bacteria 2967678726 2967685646 128
743 iso_pu_bacteria 2967686174 2967688762 128
744 iso_pu_bacteria 2967693043 2967699145 128
745 iso_pu_bacteria 2967699805 2967700002 128
746 iso_pu_bacteria 2967706974 2967714352 128
747 iso_pu_bacteria 2967714385 2967720569 128
748 iso_pu_bacteria 2967721400 2967728170 128
749 iso_pu_bacteria 2967728569 2967734269 128
750 iso_pu_bacteria 2967735183 2967741293 128
751 iso_pu_bacteria 2967742019 2967744958 128
752 iso_pu_bacteria 2967748971 2967753385 128
753 iso_pu_bacteria 2967755722 2967757999 128
754 iso_pu_bacteria 2967762386 2967769182 128
755 iso_pu_bacteria 2967769361 2967775282 128
756 iso_pu_bacteria 2967775926 2967782812 128
757 iso_pu_bacteria 2967996073 2968000811 128
758 iso_pu_bacteria 2968003550 2968009763 128
759 iso_pu_bacteria 2968016561 2968017534 128
760 iso_pu_bacteria 2968083720 2968083815 128
761 iso_pu_bacteria 2968091066 2968092438 128
762 iso_pu_bacteria 2968097103 2968100500 128
763 iso_pu_bacteria 2968110612 2968112881 128
764 iso_pu_bacteria 2968117919 2968122887 128
765 iso_pu_bacteria 2968128360 2968128832 128
766 iso_pu_bacteria 2968138860 2968143538 128
767 iso_pu_bacteria 2968171901 2968176527 128
768 iso_pu_bacteria 2970019648 2970026397 128
769 iso_pu_bacteria 2970026789 2970032693 128
770 iso_pu_bacteria 2970033650 2970038233 128
771 iso_pu_bacteria 2970040964 2970041711 128
772 iso_pu_bacteria 2970047711 2970054889 128
773 iso_pu_bacteria 2970054988 2970060861 128
774 iso_pu_bacteria 2970061556 2970061923 128
775 iso_pu_bacteria 2970068827 2970075929 128
776 iso_pu_bacteria 2970076120 2970081103 128
777 iso_pu_bacteria 2970082768 2970084820 128
778 iso_pu_bacteria 2970088815 2970095259 128
779 iso_pu_bacteria 2970095765 2970099392 128
780 iso_pu_bacteria 2970102677 2970103654 128
781 iso_pu_bacteria 2970109326 2970112186 128
782 iso_pu_bacteria 2970116247 2970121823 128
783 iso_pu_bacteria 2970122695 2970127057 128
784 iso_pu_bacteria 2970129317 2970135110 128
785 iso_pu_bacteria 2970136068 2970136592 128
786 iso_pu_bacteria 2970143518 2970145550 128
787 iso_pu_bacteria 2970149975 2970155273 128
788 iso_pu_bacteria 2970156795 2970158381 128
789 iso_pu_bacteria 2970164137 2970168128 128
790 iso_pu_bacteria 2970170962 2970174823 128
791 iso_pu_bacteria 2970177841 2970181736 128
792 iso_pu_bacteria 2970184632 2970187949 128
793 iso_pu_bacteria 2970191845 2970193543 128
794 iso_pu_bacteria 2970469710 2970472290 128
795 iso_pu_bacteria 2970489779 2970489785 128
796 iso_pu_bacteria 2970503327 2970507461 128
797 iso_pu_bacteria 2970510686 2970517950 128
798 iso_pu_bacteria 2970524798 2970530081 128
799 iso_pu_bacteria 2970532167 2970538621 128
800 iso_pu_bacteria 2970540015 2970545617 128
801 iso_pu_bacteria 2970547951 2970551938 128
802 iso_pu_bacteria 2970554993 2970559466 128
803 iso_pu_bacteria 2970593180 2970593483 128
804 iso_pu_bacteria 2970619444 2970625003 128
805 iso_pu_bacteria 2970627176 2970632416 128
806 iso_pu_bacteria 2977516862 2977520716 128
807 iso_pu_bacteria 2977523885 2977524397 128
808 iso_pu_bacteria 2977530762 2977533829 128
809 iso_pu_bacteria 2977537788 2977542210 128
810 iso_pu_bacteria 2977544691 2977547238 128
811 iso_pu_bacteria 2977551784 2977557412 128
812 iso_pu_bacteria 2977558990 2977565871 128
813 iso_pu_bacteria 2977565890 2977571970 128
814 iso_pu_bacteria 2977572785 2977579120 128
815 iso_pu_bacteria 2977579622 2977585325 128
816 iso_pu_bacteria 2977821940 2977828682 128
817 iso_pu_bacteria 2977828996 2977831583 128
818 iso_pu_bacteria 2977843712 2977848748 128
819 iso_pu_bacteria 2977851361 2977854143 128
820 iso_pu_bacteria 2977858184 2977860982 128
821 iso_pu_bacteria 2977864932 2977872031 128
822 iso_pu_bacteria 2977872689 2977879619 128
823 iso_pu_bacteria 2977898635 2977906559 128
824 iso_pu_bacteria 2977907340 2977907984 128
825 iso_pu_bacteria 2977915119 2977918761 128
826 iso_pu_bacteria 2977922695 2977929141 128
827 iso_pu_bacteria 2977935797 2977937520 128
828 iso_pu_bacteria 2977942078 2977946123 128
829 iso_pu_bacteria 2977950692 2977954017 128
830 iso_pu_bacteria 2977957713 2977958587 128
831 iso_pu_bacteria 2977986579 2977987535 128
832 iso_pu_bacteria 2978969890 2978974172 128
833 iso_pu_bacteria 2979100975 2979106070 128
834 iso_pu_bacteria 2979710463 2979713997 128
835 iso_pu_bacteria 2979764755 2979767352 128
836 iso_pu_bacteria 2979772303 2979775261 128
837 iso_pu_bacteria 2979779861 2979779954 128
838 iso_pu_bacteria 2979793036 2979795161 128
839 iso_pu_bacteria 2979808191 2979812657 128
840 iso_pu_bacteria 2984509177 2984512140 128
841 iso_pu_bacteria 2984518228 2984521499 128
842 iso_pu_bacteria 2984537506 2984540793 128
843 iso_pu_bacteria 2984587000 2984589500 128
844 iso_pu_bacteria 2984601300 2984603060 128
845 iso_pu_bacteria 2987636660 2987640792 128
846 iso_pu_bacteria 2987645492 2987645734 128
847 iso_pu_bacteria 2987652177 2987656292 128
848 iso_pu_bacteria 2987659509 2987664141 128
849 iso_pu_bacteria 2987666974 2987670370 128
850 iso_pu_bacteria 2987673487 2987680956 128
851 iso_pu_bacteria 2989349275 2989352911 128
852 iso_pu_bacteria 2989771324 2989773702 128
853 iso_pu_bacteria 2989776772 2989778751 128
854 iso_pu_bacteria 2996310559 2996311119 128
855 iso_pu_bacteria 2996336353 2996341809 128
856 iso_pu_bacteria 2996341866 2996348856 128
857 iso_pu_bacteria 2996348954 2996351161 128
858 iso_pu_bacteria 2996386984 2996388326 128
859 iso_pu_bacteria 2996887358 2996892435 128
860 iso_pu_bacteria 2996893221 2996898455 128
861 iso_pu_bacteria 3000135777 3000136244 128
862 iso_pu_bacteria 3003930520 3003933382 128
863 iso_pu_bacteria 3004167301 3004170113 128
864 iso_pu_bacteria 3004188549 3004193196 128
865 iso_pu_bacteria 3004203850 3004208989 128
866 iso_pu_bacteria 3004211236 3004212677 128
867 iso_pu_bacteria 3004218560 3004222746 128
868 iso_pu_bacteria 3004232784 3004236746 128
869 iso_pu_bacteria 3004239961 3004245527 128
870 iso_pu_bacteria 3004248173 3004255485 128
871 iso_pu_bacteria 3004268573 3004269792 128
872 iso_pu_bacteria 3004275668 3004277859 128
873 iso_pu_bacteria 3004289098 3004296652 128
874 iso_pu_bacteria 3004334049 3004340328 128
875 iso_pu_bacteria 3005409236 3005409651 128
876 iso_pu_bacteria 3005416602 3005420367 128
877 iso_pu_bacteria 3005445848 3005447243 128
878 iso_pu_bacteria 637000159 637073630 128
879 iso_pu_bacteria 639633055 639648136 128
880 iso_pu_bacteria 643692032 643825497 128
881 iso_pu_bacteria 648276728 648740128 128
882 iso_pu_bacteria 649633066 649873565 128
883 iso_pu_bacteria 8002285264 8002286149 128
884 iso_pu_bacteria 8003992118 8003993329 128
885 iso_pu_bacteria 8003999396 8004000585 128
886 iso_pu_bacteria 8004300914 8004306589 128
887 iso_pu_bacteria 8004312739 8004313777 128
888 iso_pu_bacteria 8004361976 8004364013 128
889 iso_pu_bacteria 8004374579 8004379756 128
890 iso_pu_bacteria 8004387939 8004393852 128
891 iso_pu_bacteria 8004395343 8004400035 128
892 iso_pu_bacteria 8004445564 8004450050 128
893 iso_pu_bacteria 8004633249 8004639214 128
894 iso_pu_bacteria 8004640170 8004643184 128
895 iso_pu_bacteria 8004695233 8004702742 128
896 iso_pu_bacteria 8004703790 8004714522 128
897 iso_pu_bacteria 8004714634 8004719656 128
898 iso_pu_bacteria 8004727605 8004729378 128
899 iso_pu_bacteria 8005246636 8005248303 128
900 iso_pu_bacteria 8005258706 8005259717 128
901 iso_pu_bacteria 8005275841 8005280206 128
902 iso_pu_bacteria 8005282627 8005288273 128
903 iso_pu_bacteria 8005289223 8005294799 128
904 iso_pu_bacteria 8005301065 8005307042 128
905 iso_pu_bacteria 8005307578 8005314557 128
906 iso_pu_bacteria 8005314921 8005317318 128
907 iso_pu_bacteria 8005321885 8005326962 128
908 iso_pu_bacteria 8005376324 8005378785 128
909 iso_pu_bacteria 8005382845 8005388007 128
910 iso_pu_bacteria 8005395548 8005397038 128
911 iso_pu_bacteria 8005430974 8005433245 128
912 iso_pu_bacteria 8005460587 8005462518 128
913 iso_pu_bacteria 8005484373 8005486618 128
914 iso_pu_bacteria 8005497431 8005499896 128
915 iso_pu_bacteria 8005556819 8005558113 128
916 iso_pu_bacteria 8005563573 8005569291 128
917 iso_pu_bacteria 8005570704 8005575432 128
918 iso_pu_bacteria 8005619151 8005621263 128
919 iso_pu_bacteria 8005626139 8005631437 128
920 iso_pu_bacteria 8005645114 8005646240 128
921 iso_pu_bacteria 8005658619 8005659419 128
922 iso_pu_bacteria 8005668836 8005671314 128
923 iso_pu_bacteria 8005682033 8005686374 128
924 iso_pu_bacteria 8005688590 8005694956 128
925 iso_pu_bacteria 8005695170 8005696156 128
926 iso_pu_bacteria 8018127388 8018129558 128
927 iso_pu_bacteria 8018163183 8018168099 128
928 iso_pu_bacteria 8018176218 8018177895 128
929 iso_pu_bacteria 8023680758 8023680973 128
930 iso_pu_bacteria 8024479707 8024485749 128
931 iso_pu_bacteria 8024486573 8024492566 128
932 iso_pu_bacteria 8024501048 8024505215 128
933 iso_pu_bacteria 8046767195 8046770326 128
934 iso_pu_bacteria 8049293176 8049294384 128
935 iso_pu_bacteria 8054558443 8054560808 128
936 iso_pu_bacteria 8055617313 8055621933 128
937 iso_pu_bacteria 8056375014 8056380142 128
938 iso_pu_bacteria 8056382006 8056387553 128
939 iso_pu_bacteria 8057575449 8057578256 128
940 iso_pu_bacteria 8057874678 8057875496 128
941 3300005262 Ga0065165_1005995 Ga0065165_10059955 130
942 3300005548 Ga0070665_100100274 Ga0070665_1001002744 130
943 3300031824 Ga0307413_10429669 Ga0307413_104296692 130
944 3300031901 Ga0307406_10459222 Ga0307406_104592222 130
945 3300031911 Ga0307412_11859820 Ga0307412_118598202 130
946 3300041451 Ga0451791_1489124 Ga0451791_1489124_59_505 130
947 3300044683 Ga0466965_0097468 Ga0466965_0097468_590_1039 130
948 3300048925 Ga0496122_0000025 Ga0496122_0000025_308668_309117 130
949 3300048926 Ga0496123_0000032 Ga0496123_0000032_55096_55545 130
950 3300048927 Ga0496124_0023770 Ga0496124_0023770_980_1429 130
951 3300005334 Ga0068869_101109938 Ga0068869_1011099382 131
952 3300005343 Ga0070687_100035726 Ga0070687_1000357262 131
953 3300005354 Ga0070675_100238243 Ga0070675_1002382433 131
954 3300005367 Ga0070667_101468578 Ga0070667_1014685782 131
955 3300005406 Ga0070703_10001607 Ga0070703_100016078 131
956 3300005434 Ga0070709_10145167 Ga0070709_101451672 131
957 3300005438 Ga0070701_10001368 Ga0070701_100013686 131
958 3300005440 Ga0070705_100000487 Ga0070705_1000004873 131
959 3300005441 Ga0070700_100003143 Ga0070700_1000031437 131
960 3300005444 Ga0070694_100023927 Ga0070694_1000239275 131
961 3300005445 Ga0070708_100029082 Ga0070708_1000290827 131
962 3300005455 Ga0070663_100004621 Ga0070663_10000462110 131
963 3300005455 Ga0070663_101228536 Ga0070663_1012285362 131
964 3300005457 Ga0070662_100411200 Ga0070662_1004112002 131
965 3300005457 Ga0070662_101332326 Ga0070662_1013323261 131
966 3300005458 Ga0070681_10171682 Ga0070681_101716822 131
967 3300005467 Ga0070706_100058590 Ga0070706_1000585906 131
968 3300005471 Ga0070698_100665481 Ga0070698_1006654811 131
969 3300005518 Ga0070699_100002474 Ga0070699_10000247414 131
970 3300005530 Ga0070679_100065325 Ga0070679_1000653252 131
971 3300005536 Ga0070697_100119415 Ga0070697_1001194153 131
972 3300005544 Ga0070686_100403550 Ga0070686_1004035502 131
973 3300005546 Ga0070696_100001714 Ga0070696_10000171417 131
974 3300005547 Ga0070693_100064714 Ga0070693_1000647142 131
975 3300005549 Ga0070704_100004568 Ga0070704_1000045685 131
976 3300005577 Ga0068857_100030653 Ga0068857_1000306532 131
977 3300005616 Ga0068852_101959714 Ga0068852_1019597141 131
978 3300005617 Ga0068859_100011400 Ga0068859_1000114003 131
979 3300005618 Ga0068864_100081043 Ga0068864_1000810435 131
980 3300005841 Ga0068863_100170600 Ga0068863_1001706003 131
981 3300005842 Ga0068858_100051707 Ga0068858_1000517073 131
982 3300005843 Ga0068860_100007101 Ga0068860_10000710110 131
983 3300005844 Ga0068862_100011359 Ga0068862_1000113594 131
984 3300006038 Ga0075365_10365111 Ga0075365_103651111 131
985 3300006186 Ga0075369_10086170 Ga0075369_100861701 131
986 3300006353 Ga0075370_10006155 Ga0075370_100061557 131
987 3300006844 Ga0075428_100157306 Ga0075428_1001573063 131
988 3300006846 Ga0075430_100013715 Ga0075430_1000137155 131
989 3300006847 Ga0075431_100001091 Ga0075431_10000109119 131
990 3300006880 Ga0075429_100764842 Ga0075429_1007648422 131
991 3300006931 Ga0097620_100011399 Ga0097620_1000113993 131
992 3300009098 Ga0105245_11155304 Ga0105245_111553042 131
993 3300009148 Ga0105243_10175176 Ga0105243_101751762 131
994 3300009553 Ga0105249_10000834 Ga0105249_1000083424 131
995 3300009553 Ga0105249_12837275 Ga0105249_128372751 131
996 3300010375 Ga0105239_10558827 Ga0105239_105588272 131
997 3300011119 Ga0105246_10016031 Ga0105246_100160313 131
998 3300014325 Ga0163163_11571178 Ga0163163_115711782 131
999 3300015265 Ga0182005_1003903 Ga0182005_10039035 131
1000 3300025291 Ga0209675_1061028 Ga0209675_10610282 131
1001 3300025885 Ga0207653_10001674 Ga0207653_100016748 131
1002 3300025912 Ga0207707_10027670 Ga0207707_100276707 131
1003 3300025921 Ga0207652_10040467 Ga0207652_100404677 131
1004 3300025927 Ga0207687_10734934 Ga0207687_107349342 131
1005 3300025933 Ga0207706_10039545 Ga0207706_100395455 131
1006 3300025933 Ga0207706_10967608 Ga0207706_109676081 131
1007 3300025935 Ga0207709_10114712 Ga0207709_101147122 131
1008 3300025961 Ga0207712_10003210 Ga0207712_100032105 131
1009 3300025961 Ga0207712_11567645 Ga0207712_115676451 131
1010 3300025986 Ga0207658_10549102 Ga0207658_105491021 131
1011 3300026067 Ga0207678_10015487 Ga0207678_100154872 131
1012 3300026075 Ga0207708_10002508 Ga0207708_1000250812 131
1013 3300026088 Ga0207641_10307664 Ga0207641_103076643 131
1014 3300026095 Ga0207676_10078838 Ga0207676_100788382 131
1015 3300026116 Ga0207674_10154489 Ga0207674_101544894 131
1016 3300028380 Ga0268265_10014314 Ga0268265_100143144 131
1017 3300028381 Ga0268264_10003917 Ga0268264_1000391710 131
1018 3300028794 Ga0307515_10767339 Ga0307515_107673392 131
1019 3300035092 Ga0373952_0071202 Ga0373952_0071202_361_843 131
1020 3300035114 Ga0373939_0115591 Ga0373939_0115591_45_527 131
1021 3300037312 Ga0395899_0000213 Ga0395899_0000213_78657_79118 131
1022 3300037418 Ga0395900_0000121 Ga0395900_0000121_130280_130741 131
1023 3300037466 Ga0395898_0000247 Ga0395898_0000247_4286_4747 131
1024 3300037471 Ga0395905_0000112 Ga0395905_0000112_4270_4731 131
1025 3300038443 Ga0395901_0000078 Ga0395901_0000078_130280_130741 131
1026 3300046459 Ga0495629_0091148 Ga0495629_0091148_901_1359 131
1027 3300047444 Ga0495675_0033960 Ga0495675_0033960_332_790 131
1028 3300048904 Ga0496101_0208502 Ga0496101_0208502_278_760 131
1029 3300048905 Ga0496102_0014003 Ga0496102_0014003_86_568 131
1030 3300048906 Ga0496103_0017556 Ga0496103_0017556_3371_3853 131
1031 3300048908 Ga0496105_0208925 Ga0496105_0208925_121_603 131
1032 3300048909 Ga0496106_0001217 Ga0496106_0001217_14391_14873 131
1033 3300048911 Ga0496108_0371611 Ga0496108_0371611_450_932 131
1034 3300048912 Ga0496109_0132401 Ga0496109_0132401_1114_1596 131
1035 3300048912 Ga0496109_0301457 Ga0496109_0301457_452_925 131
1036 3300048913 Ga0496110_0802990 Ga0496110_0802990_249_707 131
1037 3300048916 Ga0496113_0377285 Ga0496113_0377285_89_547 131
1038 3300048918 Ga0496115_0023828 Ga0496115_0023828_1298_1780 131
1039 3300048924 Ga0496121_0009248 Ga0496121_0009248_4634_5080 131
1040 3300048926 Ga0496123_0263882 Ga0496123_0263882_47_493 131
1041 3300048929 Ga0496126_0267396 Ga0496126_0267396_350_796 131
1042 3300049571 Ga0501034_0002078 Ga0501034_0002078_5294_5743 131
1043 3300049576 Ga0501040_0673642 Ga0501040_0673642_88_570 131
1044 3300049582 Ga0501048_0038065 Ga0501048_0038065_488_976 131
1045 3300049582 Ga0501048_1215189 Ga0501048_1215189_32_514 131
1046 3300049590 Ga0501074_0678614 Ga0501074_0678614_22_543 131
1047 3300049741 Ga0501079_1276381 Ga0501079_1276381_51_533 131
1048 3300049743 Ga0501081_0912448 Ga0501081_0912448_110_592 131
1049 3300050509 nmdc:mga0qj67_716_c1 nmdc:mga0qj67_716_c1_16244_16726 131
1050 3300050510 nmdc:mga06r32_538_c1 nmdc:mga06r32_538_c1_16069_16551 131
1051 3300053125 Ga0500618_001417 Ga0500618_001417_8730_9182 131
1052 3300053136 Ga0500559_0012609 Ga0500559_0012609_603_1070 131
1053 3300053139 Ga0500568_0000175 Ga0500568_0000175_41389_41865 131
1054 3300053153 Ga0500616_0011795 Ga0500616_0011795_428_895 131
1055 3300054114 Ga0501084_1159304 Ga0501084_1159304_48_530 131
1056 2209111006 2214702717 2213716880 132
1057 3300001979 JGI24740J21852_10024850 JGI24740J21852_100248502 132
1058 3300001989 JGI24739J22299_10085637 JGI24739J22299_100856372 132
1059 3300002067 JGI24735J21928_10045816 JGI24735J21928_100458162 132
1060 3300002704 JGI25155J39150_1000011 JGI25155J39150_1000011119 132
1061 3300002705 JGI25156J39149_1000027 JGI25156J39149_1000027119 132
1062 3300002705 JGI25156J39149_1000030 JGI25156J39149_100003033 132
1063 3300002705 JGI25156J39149_1004453 JGI25156J39149_10044533 132
1064 3300002738 JGI25154J39366_1000057 JGI25154J39366_100005746 132
1065 3300002741 JGI25157J39369_1000010 JGI25157J39369_100001092 132
1066 3300002741 JGI25157J39369_1000604 JGI25157J39369_10006048 132
1067 3300002773 JGI25152J39213_1002131 JGI25152J39213_10021316 132
1068 3300002774 JGI25150J39212_1004304 JGI25150J39212_10043044 132
1069 3300002987 JGI25159J45721_1000006 JGI25159J45721_100000679 132
1070 3300003187 JGI25151J46595_10000238 JGI25151J46595_1000023812 132
1071 3300003187 JGI25151J46595_10009568 JGI25151J46595_100095686 132
1072 3300003203 JGI25406J46586_10008536 JGI25406J46586_100085363 132
1073 3300003203 JGI25406J46586_10045653 JGI25406J46586_100456532 132
1074 3300003214 JGI25165J46597_1000033 JGI25165J46597_10000336 132
1075 3300003214 JGI25165J46597_1000777 JGI25165J46597_100077711 132
1076 3300003214 JGI25165J46597_1007469 JGI25165J46597_10074692 132
1077 3300003215 JGI25153J46596_10002466 JGI25153J46596_100024666 132
1078 3300003215 JGI25153J46596_10010613 JGI25153J46596_100106132 132
1079 3300003215 JGI25153J46596_10070545 JGI25153J46596_100705452 132
1080 3300003320 rootH2_10012004 rootH2_100120043 132
1081 3300003320 rootH2_10040546 rootH2_100405464 132
1082 3300003322 rootL2_10034778 rootL2_100347783 132
1083 3300003323 rootH1_10017647 rootH1_100176472 132
1084 3300003323 rootH1_10113295 rootH1_101132954 132
1085 3300003354 JGI25160J50197_1000004 JGI25160J50197_100000490 132
1086 3300003354 JGI25160J50197_1000019 JGI25160J50197_100001984 132
1087 3300003354 JGI25160J50197_1004387 JGI25160J50197_10043876 132
1088 3300003354 JGI25160J50197_1036036 JGI25160J50197_10360361 132
1089 3300003354 JGI25160J50197_1043041 JGI25160J50197_10430412 132
1090 3300003374 JGI25161J50226_1000003 JGI25161J50226_1000003338 132
1091 3300003374 JGI25161J50226_1000330 JGI25161J50226_100033019 132
1092 3300003374 JGI25161J50226_1001454 JGI25161J50226_10014546 132
1093 3300003374 JGI25161J50226_1008427 JGI25161J50226_10084272 132
1094 3300003762 Ga0055542_1000762 Ga0055542_10007627 132
1095 3300003763 Ga0055529_1002106 Ga0055529_10021064 132
1096 3300003771 Ga0055526_1000565 Ga0055526_100056513 132
1097 3300003771 Ga0055526_1000669 Ga0055526_100066914 132
1098 3300003771 Ga0055526_1002226 Ga0055526_100222613 132
1099 3300003771 Ga0055526_1040249 Ga0055526_10402492 132
1100 3300003775 Ga0055524_1004582 Ga0055524_10045824 132
1101 3300003775 Ga0055524_1006212 Ga0055524_10062124 132
1102 3300003775 Ga0055524_1007214 Ga0055524_10072143 132
1103 3300003775 Ga0055524_1010237 Ga0055524_10102373 132
1104 3300003775 Ga0055524_1035612 Ga0055524_10356122 132
1105 3300003781 Ga0055536_1000212 Ga0055536_100021240 132
1106 3300003781 Ga0055536_1004763 Ga0055536_10047633 132
1107 3300003784 Ga0055534_1047945 Ga0055534_10479451 132
1108 3300003790 Ga0055528_1000918 Ga0055528_100091811 132
1109 3300003790 Ga0055528_1005988 Ga0055528_10059882 132
1110 3300003790 Ga0055528_1008737 Ga0055528_10087371 132
1111 3300003790 Ga0055528_1015144 Ga0055528_10151442 132
1112 3300003790 Ga0055528_1020888 Ga0055528_10208882 132
1113 3300003791 Ga0055530_10015221 Ga0055530_100152213 132
1114 3300003791 Ga0055530_10068443 Ga0055530_100684432 132
1115 3300003792 Ga0055540_1000285 Ga0055540_100028525 132
1116 3300003792 Ga0055540_1001884 Ga0055540_10018844 132
1117 3300003792 Ga0055540_1002932 Ga0055540_10029323 132
1118 3300003792 Ga0055540_1023537 Ga0055540_10235372 132
1119 3300003792 Ga0055540_1026148 Ga0055540_10261481 132
1120 3300003792 Ga0055540_1059536 Ga0055540_10595361 132
1121 3300003792 Ga0055540_1059940 Ga0055540_10599402 132
1122 3300003794 Ga0055531_10001165 Ga0055531_100011658 132
1123 3300003794 Ga0055531_10014995 Ga0055531_100149952 132
1124 3300003794 Ga0055531_10069570 Ga0055531_100695701 132
1125 3300003856 Ga0058692_1004051 Ga0058692_10040515 132
1126 3300004625 Ga0055543_1000001 Ga0055543_1000001344 132
1127 3300004625 Ga0055543_1000019 Ga0055543_100001933 132
1128 3300004625 Ga0055543_1000147 Ga0055543_100014748 132
1129 3300004625 Ga0055543_1000808 Ga0055543_100080811 132
1130 3300005262 Ga0065165_1000049 Ga0065165_100004968 132
1131 3300005262 Ga0065165_1000180 Ga0065165_100018085 132
1132 3300005262 Ga0065165_1017852 Ga0065165_10178522 132
1133 3300005262 Ga0065165_1024195 Ga0065165_10241952 132
1134 3300005327 Ga0070658_10032973 Ga0070658_100329734 132
1135 3300005327 Ga0070658_11253983 Ga0070658_112539832 132
1136 3300005331 Ga0070670_100001443 Ga0070670_10000144310 132
1137 3300005344 Ga0070661_100680165 Ga0070661_1006801652 132
1138 3300005347 Ga0070668_100629226 Ga0070668_1006292262 132
1139 3300005355 Ga0070671_100310609 Ga0070671_1003106092 132
1140 3300005355 Ga0070671_100434568 Ga0070671_1004345682 132
1141 3300005356 Ga0070674_100319133 Ga0070674_1003191332 132
1142 3300005366 Ga0070659_100090030 Ga0070659_1000900303 132
1143 3300005457 Ga0070662_100910096 Ga0070662_1009100962 132
1144 3300005530 Ga0070679_100050610 Ga0070679_1000506105 132
1145 3300005536 Ga0070697_100000987 Ga0070697_1000009874 132
1146 3300005539 Ga0068853_100002083 Ga0068853_10000208312 132
1147 3300005539 Ga0068853_100320060 Ga0068853_1003200602 132
1148 3300005539 Ga0068853_101041001 Ga0068853_1010410011 132
1149 3300005545 Ga0070695_100004914 Ga0070695_1000049147 132
1150 3300005548 Ga0070665_100166889 Ga0070665_1001668892 132
1151 3300005548 Ga0070665_100244907 Ga0070665_1002449073 132
1152 3300005548 Ga0070665_100287216 Ga0070665_1002872163 132
1153 3300005548 Ga0070665_100464658 Ga0070665_1004646581 132
1154 3300005548 Ga0070665_100642398 Ga0070665_1006423982 132
1155 3300005548 Ga0070665_100715156 Ga0070665_1007151561 132
1156 3300005563 Ga0068855_100081541 Ga0068855_1000815413 132
1157 3300005563 Ga0068855_100147887 Ga0068855_1001478873 132
1158 3300005563 Ga0068855_101151476 Ga0068855_1011514762 132
1159 3300005577 Ga0068857_100057532 Ga0068857_1000575322 132
1160 3300005614 Ga0068856_100069999 Ga0068856_1000699993 132
1161 3300005614 Ga0068856_100108448 Ga0068856_1001084483 132
1162 3300005614 Ga0068856_100382539 Ga0068856_1003825392 132
1163 3300005614 Ga0068856_100523781 Ga0068856_1005237812 132
1164 3300005616 Ga0068852_100082239 Ga0068852_1000822392 132
1165 3300005617 Ga0068859_100051166 Ga0068859_1000511662 132
1166 3300005834 Ga0068851_10104616 Ga0068851_101046163 132
1167 3300005842 Ga0068858_100136804 Ga0068858_1001368042 132
1168 3300005843 Ga0068860_100877418 Ga0068860_1008774182 132
1169 3300005937 Ga0081455_10262695 Ga0081455_102626952 132
1170 3300005937 Ga0081455_10706243 Ga0081455_107062431 132
1171 3300005985 Ga0081539_10001354 Ga0081539_1000135417 132
1172 3300005985 Ga0081539_10002915 Ga0081539_100029159 132
1173 3300006038 Ga0075365_10000771 Ga0075365_100007717 132
1174 3300006038 Ga0075365_10019973 Ga0075365_100199733 132
1175 3300006038 Ga0075365_10028318 Ga0075365_100283184 132
1176 3300006038 Ga0075365_10049392 Ga0075365_100493923 132
1177 3300006038 Ga0075365_10055143 Ga0075365_100551433 132
1178 3300006038 Ga0075365_10253425 Ga0075365_102534252 132
1179 3300006038 Ga0075365_10536379 Ga0075365_105363792 132
1180 3300006042 Ga0075368_10058667 Ga0075368_100586672 132
1181 3300006042 Ga0075368_10063670 Ga0075368_100636702 132
1182 3300006042 Ga0075368_10119436 Ga0075368_101194362 132
1183 3300006048 Ga0075363_100012667 Ga0075363_1000126673 132
1184 3300006048 Ga0075363_100050250 Ga0075363_1000502502 132
1185 3300006048 Ga0075363_100099987 Ga0075363_1000999872 132
1186 3300006048 Ga0075363_100100272 Ga0075363_1001002723 132
1187 3300006048 Ga0075363_100133720 Ga0075363_1001337202 132
1188 3300006048 Ga0075363_100731597 Ga0075363_1007315971 132
1189 3300006051 Ga0075364_10008131 Ga0075364_100081315 132
1190 3300006051 Ga0075364_10120674 Ga0075364_101206742 132
1191 3300006051 Ga0075364_10148623 Ga0075364_101486233 132
1192 3300006051 Ga0075364_10920067 Ga0075364_109200671 132
1193 3300006177 Ga0075362_10051910 Ga0075362_100519102 132
1194 3300006177 Ga0075362_10224417 Ga0075362_102244172 132
1195 3300006178 Ga0075367_10026480 Ga0075367_100264803 132
1196 3300006178 Ga0075367_10050505 Ga0075367_100505054 132
1197 3300006178 Ga0075367_10087828 Ga0075367_100878282 132
1198 3300006178 Ga0075367_10184751 Ga0075367_101847511 132
1199 3300006178 Ga0075367_10197438 Ga0075367_101974381 132
1200 3300006178 Ga0075367_10279322 Ga0075367_102793222 132
1201 3300006178 Ga0075367_10516081 Ga0075367_105160812 132
1202 3300006186 Ga0075369_10002912 Ga0075369_100029122 132
1203 3300006186 Ga0075369_10004806 Ga0075369_100048065 132
1204 3300006186 Ga0075369_10019597 Ga0075369_100195972 132
1205 3300006186 Ga0075369_10097492 Ga0075369_100974922 132
1206 3300006186 Ga0075369_10316536 Ga0075369_103165362 132
1207 3300006195 Ga0075366_10003432 Ga0075366_100034324 132
1208 3300006195 Ga0075366_10365675 Ga0075366_103656752 132
1209 3300006353 Ga0075370_10041398 Ga0075370_100413982 132
1210 3300006353 Ga0075370_10070723 Ga0075370_100707233 132
1211 3300006353 Ga0075370_10165121 Ga0075370_101651212 132
1212 3300006353 Ga0075370_10208580 Ga0075370_102085802 132
1213 3300006353 Ga0075370_10619750 Ga0075370_106197502 132
1214 3300006881 Ga0068865_101490036 Ga0068865_1014900361 132
1215 3300006931 Ga0097620_100051168 Ga0097620_1000511682 132
1216 3300006946 Ga0079104_1000187 Ga0079104_100018742 132
1217 3300006946 Ga0079104_1001924 Ga0079104_100192410 132
1218 3300006948 Ga0099826_10004117 Ga0099826_1000411710 132
1219 3300007076 Ga0075435_100061966 Ga0075435_1000619662 132
1220 3300009011 Ga0105251_10011989 Ga0105251_100119895 132
1221 3300009093 Ga0105240_10000005 Ga0105240_10000005333 132
1222 3300009093 Ga0105240_10483353 Ga0105240_104833532 132
1223 3300009093 Ga0105240_10698477 Ga0105240_106984771 132
1224 3300009093 Ga0105240_10799296 Ga0105240_107992962 132
1225 3300009098 Ga0105245_10504020 Ga0105245_105040203 132
1226 3300009101 Ga0105247_10011923 Ga0105247_100119235 132
1227 3300009148 Ga0105243_10121413 Ga0105243_101214133 132
1228 3300009174 Ga0105241_10012824 Ga0105241_100128242 132
1229 3300009174 Ga0105241_10203860 Ga0105241_102038602 132
1230 3300009174 Ga0105241_10389862 Ga0105241_103898622 132
1231 3300009545 Ga0105237_10002240 Ga0105237_1000224025 132
1232 3300009551 Ga0105238_10038126 Ga0105238_100381264 132
1233 3300009551 Ga0105238_10605306 Ga0105238_106053062 132
1234 3300009551 Ga0105238_11301184 Ga0105238_113011842 132
1235 3300009765 Ga0123341_1000001 Ga0123341_100000137 132
1236 3300009766 Ga0123342_1008195 Ga0123342_10081957 132
1237 3300009766 Ga0123342_1028840 Ga0123342_10288402 132
1238 3300010375 Ga0105239_10000739 Ga0105239_1000073926 132
1239 3300010375 Ga0105239_10164100 Ga0105239_101641003 132
1240 3300010375 Ga0105239_10799707 Ga0105239_107997072 132
1241 3300010375 Ga0105239_11064602 Ga0105239_110646021 132
1242 3300011119 Ga0105246_11329567 Ga0105246_113295671 132
1243 3300012497 Ga0157319_1053546 Ga0157319_10535461 132
1244 3300013102 Ga0157371_10005765 Ga0157371_100057656 132
1245 3300013102 Ga0157371_10275070 Ga0157371_102750701 132
1246 3300013104 Ga0157370_10000284 Ga0157370_1000028415 132
1247 3300013104 Ga0157370_10337116 Ga0157370_103371162 132
1248 3300013105 Ga0157369_11347411 Ga0157369_113474112 132
1249 3300013249 Ga0171463_1011 Ga0171463_1011137 132
1250 3300013296 Ga0157374_10261982 Ga0157374_102619821 132
1251 3300013296 Ga0157374_10515065 Ga0157374_105150652 132
1252 3300013296 Ga0157374_11875973 Ga0157374_118759731 132
1253 3300013297 Ga0157378_10428295 Ga0157378_104282952 132
1254 3300013297 Ga0157378_10821988 Ga0157378_108219882 132
1255 3300013297 Ga0157378_10858029 Ga0157378_108580291 132
1256 3300013307 Ga0157372_10704181 Ga0157372_107041812 132
1257 3300013307 Ga0157372_11034046 Ga0157372_110340462 132
1258 3300013307 Ga0157372_11765158 Ga0157372_117651582 132
1259 3300013308 Ga0157375_11897175 Ga0157375_118971752 132
1260 3300013308 Ga0157375_12566204 Ga0157375_125662041 132
1261 3300014325 Ga0163163_11471464 Ga0163163_114714641 132
1262 3300014497 Ga0182008_10132875 Ga0182008_101328752 132
1263 3300014497 Ga0182008_10336259 Ga0182008_103362592 132
1264 3300015261 Ga0182006_1014407 Ga0182006_10144074 132
1265 3300015262 Ga0182007_10108824 Ga0182007_101088242 132
1266 3300015262 Ga0182007_10287558 Ga0182007_102875581 132
1267 3300015265 Ga0182005_1006191 Ga0182005_10061913 132
1268 3300015690 Ga0183363_1111 Ga0183363_111117 132
1269 3300017792 Ga0163161_10684764 Ga0163161_106847642 132
1270 3300017792 Ga0163161_11316251 Ga0163161_113162511 132
1271 3300021320 Ga0214544_1000265 Ga0214544_100026531 132
1272 3300021321 Ga0214542_1000015 Ga0214542_1000015192 132
1273 3300021327 Ga0214543_1000011 Ga0214543_1000011236 132
1274 3300021327 Ga0214543_1000032 Ga0214543_100003282 132
1275 3300022739 Ga0228711_1000012 Ga0228711_100001266 132
1276 3300022740 Ga0228710_1000006 Ga0228710_100000666 132
1277 3300025206 Ga0209435_100022 Ga0209435_10002290 132
1278 3300025208 Ga0209436_100038 Ga0209436_10003851 132
1279 3300025208 Ga0209436_100837 Ga0209436_1008379 132
1280 3300025208 Ga0209436_111465 Ga0209436_1114652 132
1281 3300025228 Ga0209672_111952 Ga0209672_1119522 132
1282 3300025233 Ga0209437_100160 Ga0209437_100160129 132
1283 3300025233 Ga0209437_100310 Ga0209437_10031042 132
1284 3300025245 Ga0207425_1011762 Ga0207425_10117622 132
1285 3300025245 Ga0207425_1017027 Ga0207425_10170273 132
1286 3300025245 Ga0207425_1021384 Ga0207425_10213842 132
1287 3300025245 Ga0207425_1032792 Ga0207425_10327922 132
1288 3300025245 Ga0207425_1046284 Ga0207425_10462842 132
1289 3300025246 Ga0209646_1000078 Ga0209646_100007890 132
1290 3300025250 Ga0209026_1000002 Ga0209026_1000002544 132
1291 3300025250 Ga0209026_1000065 Ga0209026_100006590 132
1292 3300025253 Ga0209677_101256 Ga0209677_1012567 132
1293 3300025254 Ga0209148_1000570 Ga0209148_100057028 132
1294 3300025256 Ga0209759_1000055 Ga0209759_100005590 132
1295 3300025256 Ga0209759_1000119 Ga0209759_100011982 132
1296 3300025256 Ga0209759_1012005 Ga0209759_10120052 132
1297 3300025258 Ga0209129_1000349 Ga0209129_100034936 132
1298 3300025258 Ga0209129_1000432 Ga0209129_100043226 132
1299 3300025258 Ga0209129_1000442 Ga0209129_10004426 132
1300 3300025258 Ga0209129_1002862 Ga0209129_10028627 132
1301 3300025258 Ga0209129_1012729 Ga0209129_10127292 132
1302 3300025261 Ga0209233_1000027 Ga0209233_1000027658 132
1303 3300025261 Ga0209233_1000168 Ga0209233_100016833 132
1304 3300025261 Ga0209233_1000269 Ga0209233_100026955 132
1305 3300025261 Ga0209233_1000303 Ga0209233_100030342 132
1306 3300025272 Ga0209455_1000204 Ga0209455_100020492 132
1307 3300025273 Ga0209673_1000068 Ga0209673_1000068182 132
1308 3300025273 Ga0209673_1000139 Ga0209673_1000139125 132
1309 3300025273 Ga0209673_1001538 Ga0209673_10015389 132
1310 3300025273 Ga0209673_1002227 Ga0209673_10022276 132
1311 3300025273 Ga0209673_1005579 Ga0209673_10055796 132
1312 3300025273 Ga0209673_1008099 Ga0209673_10080993 132
1313 3300025273 Ga0209673_1015353 Ga0209673_10153534 132
1314 3300025273 Ga0209673_1056305 Ga0209673_10563051 132
1315 3300025284 Ga0209130_1000007 Ga0209130_1000007437 132
1316 3300025284 Ga0209130_1000012 Ga0209130_100001290 132
1317 3300025284 Ga0209130_1000097 Ga0209130_100009755 132
1318 3300025284 Ga0209130_1015683 Ga0209130_10156833 132
1319 3300025284 Ga0209130_1029780 Ga0209130_10297802 132
1320 3300025291 Ga0209675_1050911 Ga0209675_10509112 132
1321 3300025292 Ga0209676_1000399 Ga0209676_100039914 132
1322 3300025292 Ga0209676_1006026 Ga0209676_10060264 132
1323 3300025294 Ga0209025_1000237 Ga0209025_100023739 132
1324 3300025294 Ga0209025_1000358 Ga0209025_10003583 132
1325 3300025294 Ga0209025_1000729 Ga0209025_100072926 132
1326 3300025294 Ga0209025_1000923 Ga0209025_100092343 132
1327 3300025294 Ga0209025_1000949 Ga0209025_100094933 132
1328 3300025294 Ga0209025_1004865 Ga0209025_10048659 132
1329 3300025294 Ga0209025_1005123 Ga0209025_100512312 132
1330 3300025294 Ga0209025_1058527 Ga0209025_10585272 132
1331 3300025294 Ga0209025_1071341 Ga0209025_10713412 132
1332 3300025294 Ga0209025_1099690 Ga0209025_10996902 132
1333 3300025294 Ga0209025_1131642 Ga0209025_11316422 132
1334 3300025295 Ga0209564_1000140 Ga0209564_100014060 132
1335 3300025295 Ga0209564_1000794 Ga0209564_100079433 132
1336 3300025295 Ga0209564_1000802 Ga0209564_100080231 132
1337 3300025295 Ga0209564_1000868 Ga0209564_100086825 132
1338 3300025295 Ga0209564_1001618 Ga0209564_100161813 132
1339 3300025295 Ga0209564_1005687 Ga0209564_10056873 132
1340 3300025295 Ga0209564_1014049 Ga0209564_10140492 132
1341 3300025295 Ga0209564_1041733 Ga0209564_10417332 132
1342 3300025297 Ga0209758_1000155 Ga0209758_100015586 132
1343 3300025297 Ga0209758_1000545 Ga0209758_100054533 132
1344 3300025297 Ga0209758_1000587 Ga0209758_100058731 132
1345 3300025297 Ga0209758_1001100 Ga0209758_100110031 132
1346 3300025297 Ga0209758_1002445 Ga0209758_10024459 132
1347 3300025297 Ga0209758_1007782 Ga0209758_10077825 132
1348 3300025297 Ga0209758_1019396 Ga0209758_10193965 132
1349 3300025297 Ga0209758_1026684 Ga0209758_10266842 132
1350 3300025297 Ga0209758_1100007 Ga0209758_11000072 132
1351 3300025298 Ga0209050_1000650 Ga0209050_100065034 132
1352 3300025298 Ga0209050_1005095 Ga0209050_10050955 132
1353 3300025298 Ga0209050_1021205 Ga0209050_10212053 132
1354 3300025299 Ga0209256_1000557 Ga0209256_100055724 132
1355 3300025299 Ga0209256_1000687 Ga0209256_100068736 132
1356 3300025299 Ga0209256_1001048 Ga0209256_100104822 132
1357 3300025299 Ga0209256_1001371 Ga0209256_10013719 132
1358 3300025299 Ga0209256_1004147 Ga0209256_10041474 132
1359 3300025299 Ga0209256_1004371 Ga0209256_10043719 132
1360 3300025299 Ga0209256_1010809 Ga0209256_10108096 132
1361 3300025299 Ga0209256_1023871 Ga0209256_10238713 132
1362 3300025299 Ga0209256_1048199 Ga0209256_10481991 132
1363 3300025302 Ga0207426_1000003 Ga0207426_1000003810 132
1364 3300025302 Ga0207426_1000010 Ga0207426_1000010449 132
1365 3300025302 Ga0207426_1000094 Ga0207426_10000942 132
1366 3300025302 Ga0207426_1000111 Ga0207426_100011178 132
1367 3300025302 Ga0207426_1001840 Ga0207426_100184011 132
1368 3300025303 Ga0209051_1000095 Ga0209051_1000095163 132
1369 3300025303 Ga0209051_1001031 Ga0209051_100103111 132
1370 3300025303 Ga0209051_1001191 Ga0209051_100119110 132
1371 3300025303 Ga0209051_1003503 Ga0209051_10035037 132
1372 3300025303 Ga0209051_1007144 Ga0209051_10071442 132
1373 3300025303 Ga0209051_1008543 Ga0209051_10085435 132
1374 3300025303 Ga0209051_1017165 Ga0209051_10171654 132
1375 3300025303 Ga0209051_1072572 Ga0209051_10725722 132
1376 3300025304 Ga0209257_1001962 Ga0209257_10019629 132
1377 3300025304 Ga0209257_1003296 Ga0209257_10032968 132
1378 3300025304 Ga0209257_1010294 Ga0209257_10102947 132
1379 3300025304 Ga0209257_1060930 Ga0209257_10609302 132
1380 3300025321 Ga0207656_10064226 Ga0207656_100642263 132
1381 3300025904 Ga0207647_10072033 Ga0207647_100720332 132
1382 3300025904 Ga0207647_10402909 Ga0207647_104029091 132
1383 3300025909 Ga0207705_10743623 Ga0207705_107436232 132
1384 3300025911 Ga0207654_10024617 Ga0207654_100246174 132
1385 3300025911 Ga0207654_10119520 Ga0207654_101195202 132
1386 3300025911 Ga0207654_10161375 Ga0207654_101613752 132
1387 3300025911 Ga0207654_10581839 Ga0207654_105818392 132
1388 3300025913 Ga0207695_10000011 Ga0207695_10000011581 132
1389 3300025913 Ga0207695_10116388 Ga0207695_101163883 132
1390 3300025913 Ga0207695_10416388 Ga0207695_104163882 132
1391 3300025913 Ga0207695_10881666 Ga0207695_108816661 132
1392 3300025914 Ga0207671_10001291 Ga0207671_100012913 132
1393 3300025914 Ga0207671_10057729 Ga0207671_100577294 132
1394 3300025914 Ga0207671_10068428 Ga0207671_100684284 132
1395 3300025917 Ga0207660_10113774 Ga0207660_101137743 132
1396 3300025918 Ga0207662_10084295 Ga0207662_100842952 132
1397 3300025919 Ga0207657_10208952 Ga0207657_102089522 132
1398 3300025923 Ga0207681_11041881 Ga0207681_110418812 132
1399 3300025924 Ga0207694_10018894 Ga0207694_100188944 132
1400 3300025925 Ga0207650_10002090 Ga0207650_100020906 132
1401 3300025925 Ga0207650_10101930 Ga0207650_101019302 132
1402 3300025927 Ga0207687_10068838 Ga0207687_100688382 132
1403 3300025927 Ga0207687_10449791 Ga0207687_104497912 132
1404 3300025931 Ga0207644_10136348 Ga0207644_101363482 132
1405 3300025932 Ga0207690_10022460 Ga0207690_100224603 132
1406 3300025935 Ga0207709_10323219 Ga0207709_103232191 132
1407 3300025935 Ga0207709_10324599 Ga0207709_103245992 132
1408 3300025937 Ga0207669_10229582 Ga0207669_102295821 132
1409 3300025938 Ga0207704_10877843 Ga0207704_108778432 132
1410 3300025949 Ga0207667_10060300 Ga0207667_100603004 132
1411 3300025949 Ga0207667_10375499 Ga0207667_103754993 132
1412 3300025949 Ga0207667_10888412 Ga0207667_108884122 132
1413 3300025972 Ga0207668_10454674 Ga0207668_104546743 132
1414 3300025972 Ga0207668_10488791 Ga0207668_104887912 132
1415 3300025972 Ga0207668_12083217 Ga0207668_120832171 132
1416 3300025981 Ga0207640_11271407 Ga0207640_112714072 132
1417 3300025986 Ga0207658_10195410 Ga0207658_101954103 132
1418 3300026035 Ga0207703_10281150 Ga0207703_102811502 132
1419 3300026041 Ga0207639_10032104 Ga0207639_100321045 132
1420 3300026041 Ga0207639_10290502 Ga0207639_102905022 132
1421 3300026067 Ga0207678_11150419 Ga0207678_111504192 132
1422 3300026078 Ga0207702_10055211 Ga0207702_100552113 132
1423 3300026078 Ga0207702_10076099 Ga0207702_100760994 132
1424 3300026078 Ga0207702_10222409 Ga0207702_102224092 132
1425 3300026089 Ga0207648_10166316 Ga0207648_101663162 132
1426 3300026116 Ga0207674_10071651 Ga0207674_100716512 132
1427 3300026116 Ga0207674_10244903 Ga0207674_102449033 132
1428 3300026121 Ga0207683_10197424 Ga0207683_101974242 132
1429 3300026142 Ga0207698_10391441 Ga0207698_103914412 132
1430 3300026142 Ga0207698_10750481 Ga0207698_107504812 132
1431 3300027111 Ga0209281_1000310 Ga0209281_100031042 132
1432 3300027111 Ga0209281_1000334 Ga0209281_100033463 132
1433 3300027111 Ga0209281_1000361 Ga0209281_100036164 132
1434 3300027312 Ga0209371_1000021 Ga0209371_1000021174 132
1435 3300027312 Ga0209371_1000469 Ga0209371_100046915 132
1436 3300027312 Ga0209371_1001465 Ga0209371_100146514 132
1437 3300027666 Ga0209282_1000073 Ga0209282_100007363 132
1438 3300027666 Ga0209282_1000162 Ga0209282_10001626 132
1439 3300027666 Ga0209282_1182870 Ga0209282_11828702 132
1440 3300027866 Ga0209813_10117222 Ga0209813_101172222 132
1441 3300028379 Ga0268266_10182102 Ga0268266_101821022 132
1442 3300028379 Ga0268266_10220018 Ga0268266_102200182 132
1443 3300028379 Ga0268266_10817448 Ga0268266_108174482 132
1444 3300028381 Ga0268264_10773687 Ga0268264_107736872 132
1445 3300028794 Ga0307515_10000844 Ga0307515_100008442 132
1446 3300028794 Ga0307515_10004389 Ga0307515_1000438918 132
1447 3300028794 Ga0307515_10013773 Ga0307515_1001377310 132
1448 3300028794 Ga0307515_10020621 Ga0307515_100206219 132
1449 3300030500 Ga0268256_1000020 Ga0268256_1000020180 132
1450 3300030500 Ga0268256_1001794 Ga0268256_100179410 132
1451 3300030500 Ga0268256_1003189 Ga0268256_10031899 132
1452 3300031456 Ga0307513_10002223 Ga0307513_1000222321 132
1453 3300031456 Ga0307513_10134632 Ga0307513_101346323 132
1454 3300031456 Ga0307513_10674661 Ga0307513_106746612 132
1455 3300031548 Ga0307408_100164938 Ga0307408_1001649383 132
1456 3300031548 Ga0307408_100731680 Ga0307408_1007316802 132
1457 3300031649 Ga0307514_10300077 Ga0307514_103000771 132
1458 3300031852 Ga0307410_10349349 Ga0307410_103493493 132
1459 3300031911 Ga0307412_10083096 Ga0307412_100830963 132
1460 3300031911 Ga0307412_10914255 Ga0307412_109142551 132
1461 3300031967 Ga0315914_1000008 Ga0315914_100000865 132
1462 3300031995 Ga0307409_100255774 Ga0307409_1002557743 132
1463 3300032002 Ga0307416_100266271 Ga0307416_1002662712 132
1464 3300032002 Ga0307416_100668926 Ga0307416_1006689263 132
1465 3300032004 Ga0307414_10072609 Ga0307414_100726093 132
1466 3300032005 Ga0307411_10544797 Ga0307411_105447971 132
1467 3300033180 Ga0307510_10380280 Ga0307510_103802802 132
1468 3300033430 Ga0315913_1000688 Ga0315913_100068813 132
1469 3300033464 Ga0315915_1000014 Ga0315915_1000014111 132
1470 3300035112 Ga0373932_0296923 Ga0373932_0296923_126_581 132
1471 3300035695 Ga0373927_0000055 Ga0373927_0000055_71094_71543 132
1472 3300037068 Ga0373925_0002979 Ga0373925_0002979_8370_8819 132
1473 3300037418 Ga0395900_0022761 Ga0395900_0022761_3970_4425 132
1474 3300037418 Ga0395900_0246642 Ga0395900_0246642_1089_1544 132
1475 3300037418 Ga0395900_0560544 Ga0395900_0560544_126_581 132
1476 3300037471 Ga0395905_0000325 Ga0395905_0000325_23961_24431 132
1477 3300037471 Ga0395905_0013938 Ga0395905_0013938_2083_2538 132
1478 3300037471 Ga0395905_0018905 Ga0395905_0018905_5274_5729 132
1479 3300037471 Ga0395905_0105392 Ga0395905_0105392_2123_2578 132
1480 3300037471 Ga0395905_0341137 Ga0395905_0341137_374_829 132
1481 3300038443 Ga0395901_0068865 Ga0395901_0068865_878_1333 132
1482 3300038443 Ga0395901_0108822 Ga0395901_0108822_1507_1962 132
1483 3300038443 Ga0395901_0659512 Ga0395901_0659512_565_1020 132
1484 3300041404 Ga0439436_0063219 Ga0439436_0063219_381_830 132
1485 3300041406 Ga0439439_0032082 Ga0439439_0032082_40_492 132
1486 3300041406 Ga0439439_0047680 Ga0439439_0047680_115_564 132
1487 3300041413 Ga0439465_0014361 Ga0439465_0014361_884_1333 132
1488 3300041413 Ga0439465_0016011 Ga0439465_0016011_1266_1718 132
1489 3300041413 Ga0439465_0019035 Ga0439465_0019035_1458_1979 132
1490 3300041413 Ga0439465_0074391 Ga0439465_0074391_243_695 132
1491 3300041413 Ga0439465_0143370 Ga0439465_0143370_35_487 132
1492 3300041452 Ga0451793_1791429 Ga0451793_1791429_312_770 132
1493 3300041456 Ga0451795_0456879 Ga0451795_0456879_34_480 132
1494 3300041463 Ga0451804_0736472 Ga0451804_0736472_543_995 132
1495 3300041491 Ga0451833_0281263 Ga0451833_0281263_401_856 132
1496 3300041492 Ga0451835_0487550 Ga0451835_0487550_239_691 132
1497 3300041494 Ga0451837_1680411 Ga0451837_1680411_32_484 132
1498 3300041497 Ga0451840_11095 Ga0451840_11095_20_472 132
1499 3300041498 Ga0451841_1014141 Ga0451841_1014141_266_718 132
1500 3300041501 Ga0451845_0513581 Ga0451845_0513581_1475_1927 132
1501 3300041502 Ga0451846_68000 Ga0451846_68000_34_486 132
1502 3300041503 Ga0451847_0867267 Ga0451847_0867267_709_1161 132
1503 3300041505 Ga0451849_1243659 Ga0451849_1243659_1086_1538 132
1504 3300041507 Ga0451851_0085356 Ga0451851_0085356_1045_1497 132
1505 3300041507 Ga0451851_0906446 Ga0451851_0906446_709_1161 132
1506 3300041509 Ga0451843_0556366 Ga0451843_0556366_754_1206 132
1507 3300041511 Ga0451855_0767112 Ga0451855_0767112_691_1143 132
1508 3300041512 Ga0451853_0114112 Ga0451853_0114112_245_700 132
1509 3300041512 Ga0451853_1600377 Ga0451853_1600377_920_1372 132
1510 3300041997 Ga0439431_0084742 Ga0439431_0084742_283_735 132
1511 3300042006 Ga0439432_035895 Ga0439432_035895_231_677 132
1512 3300042006 Ga0439432_091543 Ga0439432_091543_301_765 132
1513 3300042007 Ga0439449_0024497 Ga0439449_0024497_1351_1803 132
1514 3300042007 Ga0439449_0030648 Ga0439449_0030648_682_1131 132
1515 3300042007 Ga0439449_0113867 Ga0439449_0113867_63_512 132
1516 3300042012 Ga0439455_0113540 Ga0439455_0113540_247_708 132
1517 3300042122 Ga0450920_061976 Ga0450920_061976_158_679 132
1518 3300042435 Ga0439434_0136733 Ga0439434_0136733_148_594 132
1519 3300042531 Ga0450918_083669 Ga0450918_083669_35_544 132
1520 3300044658 Ga0466972_0066750 Ga0466972_0066750_155_610 132
1521 3300044684 Ga0466966_0037410 Ga0466966_0037410_2252_2698 132
1522 3300044694 Ga0466963_0014097 Ga0466963_0014097_1158_1604 132
1523 3300044735 Ga0466968_0298045 Ga0466968_0298045_220_675 132
1524 3300044765 Ga0466970_0005266 Ga0466970_0005266_2632_3078 132
1525 3300044901 Ga0466960_0196335 Ga0466960_0196335_310_765 132
1526 3300045976 Ga0466967_0358143 Ga0466967_0358143_241_687 132
1527 3300045976 Ga0466967_0536706 Ga0466967_0536706_278_724 132
1528 3300046457 Ga0495590_0338167 Ga0495590_0338167_62_520 132
1529 3300046460 Ga0495638_0011505 Ga0495638_0011505_5490_5948 132
1530 3300046460 Ga0495638_0112270 Ga0495638_0112270_978_1430 132
1531 3300046460 Ga0495638_0134219 Ga0495638_0134219_886_1338 132
1532 3300046471 Ga0495650_0170839 Ga0495650_0170839_211_663 132
1533 3300046492 Ga0495585_0030296 Ga0495585_0030296_680_1132 132
1534 3300046492 Ga0495585_0045607 Ga0495585_0045607_1837_2283 132
1535 3300046501 Ga0495607_0082802 Ga0495607_0082802_282_734 132
1536 3300046506 Ga0495583_0091176 Ga0495583_0091176_200_646 132
1537 3300046512 Ga0495610_0010608 Ga0495610_0010608_3037_3489 132
1538 3300046512 Ga0495610_0075657 Ga0495610_0075657_1049_1495 132
1539 3300046513 Ga0495616_0026034 Ga0495616_0026034_674_1126 132
1540 3300046513 Ga0495616_0287975 Ga0495616_0287975_83_535 132
1541 3300046515 Ga0495620_0031522 Ga0495620_0031522_48_494 132
1542 3300046515 Ga0495620_0062294 Ga0495620_0062294_616_1068 132
1543 3300046515 Ga0495620_0066156 Ga0495620_0066156_289_750 132
1544 3300046518 Ga0495631_0082915 Ga0495631_0082915_471_923 132
1545 3300046518 Ga0495631_0183483 Ga0495631_0183483_111_557 132
1546 3300046519 Ga0495632_0017000 Ga0495632_0017000_476_928 132
1547 3300046519 Ga0495632_0287786 Ga0495632_0287786_159_620 132
1548 3300046522 Ga0495643_0001636 Ga0495643_0001636_3841_4293 132
1549 3300046522 Ga0495643_0027496 Ga0495643_0027496_802_1248 132
1550 3300046524 Ga0495648_0076360 Ga0495648_0076360_1289_1741 132
1551 3300046529 Ga0495652_0151995 Ga0495652_0151995_305_751 132
1552 3300046530 Ga0495654_0006825 Ga0495654_0006825_1428_1886 132
1553 3300046530 Ga0495654_0047409 Ga0495654_0047409_77_523 132
1554 3300046530 Ga0495654_0056366 Ga0495654_0056366_180_632 132
1555 3300046538 Ga0495609_0025916 Ga0495609_0025916_1436_1882 132
1556 3300046558 Ga0495633_0058720 Ga0495633_0058720_1257_1709 132
1557 3300046615 Ga0495656_0166823 Ga0495656_0166823_433_885 132
1558 3300046616 Ga0495668_0038831 Ga0495668_0038831_1782_2228 132
1559 3300046616 Ga0495668_0101187 Ga0495668_0101187_608_1069 132
1560 3300046616 Ga0495668_0121572 Ga0495668_0121572_753_1211 132
1561 3300046616 Ga0495668_0133404 Ga0495668_0133404_387_839 132
1562 3300046648 Ga0495611_0009786 Ga0495611_0009786_1290_1736 132
1563 3300046660 Ga0495625_0022163 Ga0495625_0022163_4131_4583 132
1564 3300046660 Ga0495625_0044796 Ga0495625_0044796_2078_2530 132
1565 3300046660 Ga0495625_0056641 Ga0495625_0056641_1985_2440 132
1566 3300046674 Ga0495588_0370574 Ga0495588_0370574_208_660 132
1567 3300046691 Ga0495670_0031733 Ga0495670_0031733_1241_1687 132
1568 3300046691 Ga0495670_0363084 Ga0495670_0363084_38_490 132
1569 3300046692 Ga0495671_0310575 Ga0495671_0310575_154_606 132
1570 3300046694 Ga0495649_0122502 Ga0495649_0122502_675_1127 132
1571 3300046694 Ga0495649_0226196 Ga0495649_0226196_371_829 132
1572 3300046810 Ga0495660_0191214 Ga0495660_0191214_358_810 132
1573 3300047318 Ga0495636_0044906 Ga0495636_0044906_616_1068 132
1574 3300047318 Ga0495636_0160057 Ga0495636_0160057_352_816 132
1575 3300047320 Ga0495672_0021456 Ga0495672_0021456_512_958 132
1576 3300047321 Ga0495676_0917551 Ga0495676_0917551_25_483 132
1577 3300047443 Ga0495687_066877 Ga0495687_066877_644_1102 132
1578 3300047443 Ga0495687_227815 Ga0495687_227815_10_462 132
1579 3300047447 Ga0495685_062052 Ga0495685_062052_223_687 132
1580 3300047471 Ga0495684_1010807 Ga0495684_1010807_47_511 132
1581 3300047472 Ga0495686_0004865 Ga0495686_0004865_6036_6482 132
1582 3300047472 Ga0495686_0119407 Ga0495686_0119407_757_1203 132
1583 3300047472 Ga0495686_0157036 Ga0495686_0157036_169_615 132
1584 3300047472 Ga0495686_0180354 Ga0495686_0180354_148_609 132
1585 3300047472 Ga0495686_0221559 Ga0495686_0221559_604_1056 132
1586 3300047472 Ga0495686_0245842 Ga0495686_0245842_286_732 132
1587 3300047472 Ga0495686_0345242 Ga0495686_0345242_329_778 132
1588 3300048090 Ga0495615_0115979 Ga0495615_0115979_10_465 132
1589 3300048091 Ga0495626_0162717 Ga0495626_0162717_403_849 132
1590 3300048091 Ga0495626_0198657 Ga0495626_0198657_133_585 132
1591 3300048903 Ga0496100_0012838 Ga0496100_0012838_1948_2394 132
1592 3300048905 Ga0496102_0008570 Ga0496102_0008570_4528_4974 132
1593 3300048905 Ga0496102_0177393 Ga0496102_0177393_391_846 132
1594 3300048905 Ga0496102_0296643 Ga0496102_0296643_892_1350 132
1595 3300048905 Ga0496102_0766906 Ga0496102_0766906_149_604 132
1596 3300048906 Ga0496103_0010686 Ga0496103_0010686_2164_2610 132
1597 3300048907 Ga0496104_0066142 Ga0496104_0066142_826_1281 132
1598 3300048908 Ga0496105_0182249 Ga0496105_0182249_271_714 132
1599 3300048909 Ga0496106_0004921 Ga0496106_0004921_5346_5792 132
1600 3300048909 Ga0496106_0452007 Ga0496106_0452007_433_891 132
1601 3300048911 Ga0496108_0114926 Ga0496108_0114926_335_781 132
1602 3300048912 Ga0496109_1146305 Ga0496109_1146305_103_561 132
1603 3300048913 Ga0496110_0180740 Ga0496110_0180740_1089_1532 132
1604 3300048913 Ga0496110_1133930 Ga0496110_1133930_152_610 132
1605 3300048916 Ga0496113_0312317 Ga0496113_0312317_253_699 132
1606 3300048916 Ga0496113_0570148 Ga0496113_0570148_237_683 132
1607 3300048917 Ga0496114_0236430 Ga0496114_0236430_35_481 132
1608 3300048917 Ga0496114_0584059 Ga0496114_0584059_341_796 132
1609 3300048918 Ga0496115_0237130 Ga0496115_0237130_924_1382 132
1610 3300048918 Ga0496115_0653995 Ga0496115_0653995_236_691 132
1611 3300048919 Ga0496116_0000043 Ga0496116_0000043_242567_243016 132
1612 3300048919 Ga0496116_0008089 Ga0496116_0008089_4290_4736 132
1613 3300048919 Ga0496116_0043036 Ga0496116_0043036_1773_2216 132
1614 3300048919 Ga0496116_0103446 Ga0496116_0103446_233_679 132
1615 3300048920 Ga0496117_0000338 Ga0496117_0000338_51096_51542 132
1616 3300048920 Ga0496117_0089281 Ga0496117_0089281_1167_1619 132
1617 3300048920 Ga0496117_0109558 Ga0496117_0109558_1102_1551 132
1618 3300048920 Ga0496117_0109935 Ga0496117_0109935_440_886 132
1619 3300048921 Ga0496118_0000958 Ga0496118_0000958_31159_31605 132
1620 3300048921 Ga0496118_0019045 Ga0496118_0019045_1711_2163 132
1621 3300048921 Ga0496118_0225279 Ga0496118_0225279_388_846 132
1622 3300048921 Ga0496118_0428829 Ga0496118_0428829_21_470 132
1623 3300048921 Ga0496118_0566227 Ga0496118_0566227_63_518 132
1624 3300048922 Ga0496119_0004440 Ga0496119_0004440_11656_12102 132
1625 3300048922 Ga0496119_0111222 Ga0496119_0111222_1025_1489 132
1626 3300048922 Ga0496119_0163672 Ga0496119_0163672_266_724 132
1627 3300048922 Ga0496119_0193562 Ga0496119_0193562_447_896 132
1628 3300048922 Ga0496119_0243093 Ga0496119_0243093_217_675 132
1629 3300048923 Ga0496120_0000589 Ga0496120_0000589_1727_2182 132
1630 3300048923 Ga0496120_0001472 Ga0496120_0001472_11199_11645 132
1631 3300048923 Ga0496120_0069230 Ga0496120_0069230_801_1259 132
1632 3300048923 Ga0496120_0187793 Ga0496120_0187793_551_997 132
1633 3300048924 Ga0496121_0002723 Ga0496121_0002723_12016_12462 132
1634 3300048924 Ga0496121_0009941 Ga0496121_0009941_5912_6370 132
1635 3300048924 Ga0496121_0027323 Ga0496121_0027323_1355_1801 132
1636 3300048924 Ga0496121_0038973 Ga0496121_0038973_2745_3188 132
1637 3300048924 Ga0496121_0074244 Ga0496121_0074244_355_801 132
1638 3300048924 Ga0496121_0082726 Ga0496121_0082726_401_847 132
1639 3300048924 Ga0496121_0088329 Ga0496121_0088329_1334_1780 132
1640 3300048924 Ga0496121_0206430 Ga0496121_0206430_401_847 132
1641 3300048924 Ga0496121_0229266 Ga0496121_0229266_594_1049 132
1642 3300048924 Ga0496121_0879236 Ga0496121_0879236_43_501 132
1643 3300048925 Ga0496122_0016499 Ga0496122_0016499_925_1389 132
1644 3300048925 Ga0496122_0018139 Ga0496122_0018139_2651_3097 132
1645 3300048925 Ga0496122_0055102 Ga0496122_0055102_2144_2590 132
1646 3300048925 Ga0496122_0062877 Ga0496122_0062877_1729_2172 132
1647 3300048925 Ga0496122_0093482 Ga0496122_0093482_545_1003 132
1648 3300048925 Ga0496122_0246008 Ga0496122_0246008_105_554 132
1649 3300048926 Ga0496123_0000043 Ga0496123_0000043_252392_252856 132
1650 3300048926 Ga0496123_0012797 Ga0496123_0012797_2103_2549 132
1651 3300048926 Ga0496123_0016748 Ga0496123_0016748_1763_2209 132
1652 3300048926 Ga0496123_0064778 Ga0496123_0064778_1408_1854 132
1653 3300048926 Ga0496123_0079012 Ga0496123_0079012_780_1238 132
1654 3300048926 Ga0496123_0422272 Ga0496123_0422272_141_590 132
1655 3300048927 Ga0496124_0017870 Ga0496124_0017870_4240_4704 132
1656 3300048927 Ga0496124_0025733 Ga0496124_0025733_897_1343 132
1657 3300048927 Ga0496124_0061282 Ga0496124_0061282_775_1218 132
1658 3300048927 Ga0496124_0274378 Ga0496124_0274378_556_1014 132
1659 3300048927 Ga0496124_0298730 Ga0496124_0298730_635_1081 132
1660 3300048928 Ga0496125_0000946 Ga0496125_0000946_43556_44020 132
1661 3300048928 Ga0496125_0025175 Ga0496125_0025175_829_1284 132
1662 3300048928 Ga0496125_0027520 Ga0496125_0027520_2591_3037 132
1663 3300048928 Ga0496125_0066860 Ga0496125_0066860_1112_1567 132
1664 3300048928 Ga0496125_0141564 Ga0496125_0141564_285_728 132
1665 3300048928 Ga0496125_0169920 Ga0496125_0169920_508_954 132
1666 3300048928 Ga0496125_0283632 Ga0496125_0283632_461_907 132
1667 3300048928 Ga0496125_0310552 Ga0496125_0310552_155_610 132
1668 3300048929 Ga0496126_0000362 Ga0496126_0000362_4543_4992 132
1669 3300048929 Ga0496126_0034554 Ga0496126_0034554_1323_1769 132
1670 3300048929 Ga0496126_0047224 Ga0496126_0047224_1816_2274 132
1671 3300048929 Ga0496126_0244916 Ga0496126_0244916_708_1163 132
1672 3300048929 Ga0496126_0266039 Ga0496126_0266039_207_650 132
1673 3300048929 Ga0496126_0340153 Ga0496126_0340153_89_535 132
1674 3300048929 Ga0496126_0756347 Ga0496126_0756347_34_489 132
1675 3300049568 Ga0501031_0000095 Ga0501031_0000095_4426_4878 132
1676 3300049568 Ga0501031_0418336 Ga0501031_0418336_354_818 132
1677 3300049569 Ga0501032_0000064 Ga0501032_0000064_34844_35299 132
1678 3300049569 Ga0501032_0000084 Ga0501032_0000084_76984_77436 132
1679 3300049569 Ga0501032_0002338 Ga0501032_0002338_1542_2006 132
1680 3300049569 Ga0501032_0048602 Ga0501032_0048602_2054_2521 132
1681 3300049569 Ga0501032_1008883 Ga0501032_1008883_36_485 132
1682 3300049570 Ga0501033_0000102 Ga0501033_0000102_4130_4582 132
1683 3300049570 Ga0501033_0000286 Ga0501033_0000286_128_583 132
1684 3300049570 Ga0501033_0007597 Ga0501033_0007597_6886_7350 132
1685 3300049570 Ga0501033_0020657 Ga0501033_0020657_2659_3108 132
1686 3300049570 Ga0501033_0029534 Ga0501033_0029534_2223_2672 132
1687 3300049570 Ga0501033_0050740 Ga0501033_0050740_1180_1629 132
1688 3300049570 Ga0501033_0083256 Ga0501033_0083256_1193_1657 132
1689 3300049570 Ga0501033_0528873 Ga0501033_0528873_95_565 132
1690 3300049570 Ga0501033_0904293 Ga0501033_0904293_128_574 132
1691 3300049571 Ga0501034_0000174 Ga0501034_0000174_39438_39893 132
1692 3300049571 Ga0501034_0001404 Ga0501034_0001404_27791_28243 132
1693 3300049571 Ga0501034_0090803 Ga0501034_0090803_1448_1897 132
1694 3300049571 Ga0501034_0202154 Ga0501034_0202154_372_836 132
1695 3300049571 Ga0501034_0240027 Ga0501034_0240027_486_938 132
1696 3300049571 Ga0501034_0339786 Ga0501034_0339786_510_956 132
1697 3300049571 Ga0501034_0655917 Ga0501034_0655917_382_837 132
1698 3300049571 Ga0501034_0831896 Ga0501034_0831896_350_799 132
1699 3300049572 Ga0501036_0000040 Ga0501036_0000040_4130_4582 132
1700 3300049572 Ga0501036_0011420 Ga0501036_0011420_6822_7277 132
1701 3300049572 Ga0501036_0064582 Ga0501036_0064582_1448_1912 132
1702 3300049572 Ga0501036_0122760 Ga0501036_0122760_282_731 132
1703 3300049572 Ga0501036_0160163 Ga0501036_0160163_117_566 132
1704 3300049573 Ga0501037_0000098 Ga0501037_0000098_4130_4582 132
1705 3300049573 Ga0501037_0009152 Ga0501037_0009152_82_537 132
1706 3300049573 Ga0501037_0095169 Ga0501037_0095169_1012_1464 132
1707 3300049573 Ga0501037_0127415 Ga0501037_0127415_765_1232 132
1708 3300049573 Ga0501037_0403344 Ga0501037_0403344_347_811 132
1709 3300049573 Ga0501037_0456452 Ga0501037_0456452_79_549 132
1710 3300049574 Ga0501038_0000002 Ga0501038_0000002_271054_271506 132
1711 3300049574 Ga0501038_0000031 Ga0501038_0000031_116621_117076 132
1712 3300049574 Ga0501038_0022666 Ga0501038_0022666_400_864 132
1713 3300049574 Ga0501038_0031557 Ga0501038_0031557_2202_2669 132
1714 3300049574 Ga0501038_0117560 Ga0501038_0117560_890_1336 132
1715 3300049574 Ga0501038_0272214 Ga0501038_0272214_775_1239 132
1716 3300049574 Ga0501038_1112264 Ga0501038_1112264_97_549 132
1717 3300049575 Ga0501039_0000002 Ga0501039_0000002_77007_77459 132
1718 3300049575 Ga0501039_0000057 Ga0501039_0000057_32629_33084 132
1719 3300049575 Ga0501039_0227793 Ga0501039_0227793_76_522 132
1720 3300049576 Ga0501040_0043172 Ga0501040_0043172_788_1240 132
1721 3300049576 Ga0501040_0117786 Ga0501040_0117786_1093_1542 132
1722 3300049577 Ga0501041_0160634 Ga0501041_0160634_827_1282 132
1723 3300049578 Ga0501042_0137759 Ga0501042_0137759_916_1365 132
1724 3300049579 Ga0501043_0000048 Ga0501043_0000048_39438_39893 132
1725 3300049579 Ga0501043_0000104 Ga0501043_0000104_77821_78285 132
1726 3300049579 Ga0501043_0006479 Ga0501043_0006479_4108_4560 132
1727 3300049579 Ga0501043_0074629 Ga0501043_0074629_543_1007 132
1728 3300049579 Ga0501043_0128235 Ga0501043_0128235_1316_1762 132
1729 3300049579 Ga0501043_0130374 Ga0501043_0130374_692_1153 132
1730 3300049579 Ga0501043_0230438 Ga0501043_0230438_358_804 132
1731 3300049579 Ga0501043_0674507 Ga0501043_0674507_52_519 132
1732 3300049580 Ga0501046_0059772 Ga0501046_0059772_313_762 132
1733 3300049580 Ga0501046_0175337 Ga0501046_0175337_1127_1579 132
1734 3300049580 Ga0501046_0193784 Ga0501046_0193784_416_880 132
1735 3300049580 Ga0501046_0200778 Ga0501046_0200778_407_853 132
1736 3300049581 Ga0501047_0002237 Ga0501047_0002237_15621_16073 132
1737 3300049581 Ga0501047_0027746 Ga0501047_0027746_2683_3150 132
1738 3300049581 Ga0501047_0036169 Ga0501047_0036169_375_827 132
1739 3300049581 Ga0501047_0140440 Ga0501047_0140440_998_1444 132
1740 3300049581 Ga0501047_0187248 Ga0501047_0187248_152_601 132
1741 3300049581 Ga0501047_0292240 Ga0501047_0292240_543_1007 132
1742 3300049581 Ga0501047_0716479 Ga0501047_0716479_258_719 132
1743 3300049582 Ga0501048_0022955 Ga0501048_0022955_4089_4538 132
1744 3300049583 Ga0501067_0042887 Ga0501067_0042887_540_1004 132
1745 3300049584 Ga0501068_0182523 Ga0501068_0182523_338_802 132
1746 3300049584 Ga0501068_0316121 Ga0501068_0316121_521_982 132
1747 3300049584 Ga0501068_0319333 Ga0501068_0319333_287_733 132
1748 3300049584 Ga0501068_0365952 Ga0501068_0365952_17_466 132
1749 3300049585 Ga0501069_0000018 Ga0501069_0000018_11315_11779 132
1750 3300049585 Ga0501069_0015350 Ga0501069_0015350_2968_3420 132
1751 3300049585 Ga0501069_0159953 Ga0501069_0159953_111_560 132
1752 3300049585 Ga0501069_0551510 Ga0501069_0551510_17_487 132
1753 3300049586 Ga0501070_0000048 Ga0501070_0000048_13402_13866 132
1754 3300049586 Ga0501070_0000420 Ga0501070_0000420_10558_11010 132
1755 3300049586 Ga0501070_0002333 Ga0501070_0002333_12895_13362 132
1756 3300049586 Ga0501070_0041003 Ga0501070_0041003_47_502 132
1757 3300049586 Ga0501070_0053889 Ga0501070_0053889_2565_3035 132
1758 3300049586 Ga0501070_0086815 Ga0501070_0086815_1737_2189 132
1759 3300049586 Ga0501070_0113114 Ga0501070_0113114_1413_1862 132
1760 3300049586 Ga0501070_0271796 Ga0501070_0271796_542_994 132
1761 3300049586 Ga0501070_0297951 Ga0501070_0297951_703_1161 132
1762 3300049586 Ga0501070_0338762 Ga0501070_0338762_393_851 132
1763 3300049587 Ga0501071_0017994 Ga0501071_0017994_441_905 132
1764 3300049587 Ga0501071_0094533 Ga0501071_0094533_1465_1932 132
1765 3300049587 Ga0501071_0150442 Ga0501071_0150442_469_918 132
1766 3300049588 Ga0501072_0069505 Ga0501072_0069505_1827_2276 132
1767 3300049589 Ga0501073_0006660 Ga0501073_0006660_2491_2955 132
1768 3300049589 Ga0501073_0072808 Ga0501073_0072808_256_723 132
1769 3300049589 Ga0501073_0127897 Ga0501073_0127897_1119_1571 132
1770 3300049589 Ga0501073_0161074 Ga0501073_0161074_690_1154 132
1771 3300049590 Ga0501074_0000001 Ga0501074_0000001_56481_56945 132
1772 3300049590 Ga0501074_0054142 Ga0501074_0054142_2121_2573 132
1773 3300049590 Ga0501074_0059274 Ga0501074_0059274_1788_2255 132
1774 3300049590 Ga0501074_0079423 Ga0501074_0079423_588_1037 132
1775 3300049590 Ga0501074_0266406 Ga0501074_0266406_706_1161 132
1776 3300049590 Ga0501074_0452599 Ga0501074_0452599_341_799 132
1777 3300049592 Ga0501076_0786847 Ga0501076_0786847_105_551 132
1778 3300049592 Ga0501076_1727592 Ga0501076_1727592_43_501 132
1779 3300049741 Ga0501079_0807143 Ga0501079_0807143_255_704 132
1780 3300049742 Ga0501080_0000197 Ga0501080_0000197_29127_29591 132
1781 3300049742 Ga0501080_0000413 Ga0501080_0000413_31241_31693 132
1782 3300049742 Ga0501080_0015859 Ga0501080_0015859_544_1008 132
1783 3300049742 Ga0501080_0133094 Ga0501080_0133094_1105_1551 132
1784 3300049742 Ga0501080_0243232 Ga0501080_0243232_419_874 132
1785 3300049742 Ga0501080_0245976 Ga0501080_0245976_889_1338 132
1786 3300049744 Ga0501083_0005530 Ga0501083_0005530_6441_6905 132
1787 3300049744 Ga0501083_0008060 Ga0501083_0008060_1814_2260 132
1788 3300049744 Ga0501083_0502426 Ga0501083_0502426_171_635 132
1789 3300049744 Ga0501083_0659780 Ga0501083_0659780_178_627 132
1790 3300049744 Ga0501083_0820992 Ga0501083_0820992_78_527 132
1791 3300049776 Ga0501280_012617 Ga0501280_012617_705_1157 132
1792 3300049822 Ga0501035_0000048 Ga0501035_0000048_25159_25623 132
1793 3300049822 Ga0501035_0000163 Ga0501035_0000163_4440_4892 132
1794 3300049822 Ga0501035_0001343 Ga0501035_0001343_14452_14919 132
1795 3300049822 Ga0501035_0004746 Ga0501035_0004746_8776_9246 132
1796 3300049822 Ga0501035_0007944 Ga0501035_0007944_6536_6988 132
1797 3300049822 Ga0501035_0063455 Ga0501035_0063455_1160_1609 132
1798 3300049822 Ga0501035_0094218 Ga0501035_0094218_606_1055 132
1799 3300049822 Ga0501035_0130236 Ga0501035_0130236_1638_2093 132
1800 3300049822 Ga0501035_0273987 Ga0501035_0273987_442_894 132
1801 3300049822 Ga0501035_0307036 Ga0501035_0307036_615_1076 132
1802 3300049822 Ga0501035_0336768 Ga0501035_0336768_556_1026 132
1803 3300049822 Ga0501035_0632845 Ga0501035_0632845_253_708 132
1804 3300049823 Ga0501044_0000002 Ga0501044_0000002_297694_298146 132
1805 3300049823 Ga0501044_0000003 Ga0501044_0000003_228355_228819 132
1806 3300049823 Ga0501044_0002384 Ga0501044_0002384_3804_4271 132
1807 3300049823 Ga0501044_0010560 Ga0501044_0010560_4460_4915 132
1808 3300049823 Ga0501044_0020100 Ga0501044_0020100_2002_2454 132
1809 3300049823 Ga0501044_0021489 Ga0501044_0021489_4587_5051 132
1810 3300049823 Ga0501044_0049943 Ga0501044_0049943_3267_3716 132
1811 3300049823 Ga0501044_0057802 Ga0501044_0057802_159_629 132
1812 3300049823 Ga0501044_0187627 Ga0501044_0187627_1052_1501 132
1813 3300049823 Ga0501044_0219738 Ga0501044_0219738_1033_1479 132
1814 3300049823 Ga0501044_0239744 Ga0501044_0239744_39_500 132
1815 3300049823 Ga0501044_0550038 Ga0501044_0550038_481_936 132
1816 3300049823 Ga0501044_0590090 Ga0501044_0590090_297_764 132
1817 3300049824 Ga0501045_0154648 Ga0501045_0154648_207_656 132
1818 3300049824 Ga0501045_0688966 Ga0501045_0688966_101_553 132
1819 3300050489 nmdc:mga03683_86913_c1 nmdc:mga03683_86913_c1_170_628 132
1820 3300050490 nmdc:mga03n38_3751_c1 nmdc:mga03n38_3751_c1_3587_4039 132
1821 3300050490 nmdc:mga03n38_65686_c1 nmdc:mga03n38_65686_c1_82_534 132
1822 3300050490 nmdc:mga03n38_90093_c1 nmdc:mga03n38_90093_c1_683_1135 132
1823 3300050491 nmdc:mga00v17_111801_c1 nmdc:mga00v17_111801_c1_328_783 132
1824 3300050491 nmdc:mga00v17_29610_c1 nmdc:mga00v17_29610_c1_924_1379 132
1825 3300050491 nmdc:mga00v17_498650_c1 nmdc:mga00v17_498650_c1_201_659 132
1826 3300050492 nmdc:mga0yw44_13733_c1 nmdc:mga0yw44_13733_c1_103_561 132
1827 3300050492 nmdc:mga0yw44_17832_c1 nmdc:mga0yw44_17832_c1_2624_3082 132
1828 3300050492 nmdc:mga0yw44_2486_c2 nmdc:mga0yw44_2486_c2_605_1060 132
1829 3300050492 nmdc:mga0yw44_3537_c1 nmdc:mga0yw44_3537_c1_652_1107 132
1830 3300050492 nmdc:mga0yw44_354317_c1 nmdc:mga0yw44_354317_c1_151_606 132
1831 3300050492 nmdc:mga0yw44_44196_c1 nmdc:mga0yw44_44196_c1_796_1251 132
1832 3300050492 nmdc:mga0yw44_47949_c1 nmdc:mga0yw44_47949_c1_1978_2433 132
1833 3300050492 nmdc:mga0yw44_94644_c1 nmdc:mga0yw44_94644_c1_557_1009 132
1834 3300050493 nmdc:mga0k408_126867_c1 nmdc:mga0k408_126867_c1_886_1338 132
1835 3300050493 nmdc:mga0k408_127554_c1 nmdc:mga0k408_127554_c1_145_597 132
1836 3300050493 nmdc:mga0k408_544382_c1 nmdc:mga0k408_544382_c1_211_666 132
1837 3300050494 nmdc:mga06z11_18343_c1 nmdc:mga06z11_18343_c1_783_1238 132
1838 3300050494 nmdc:mga06z11_255289_c1 nmdc:mga06z11_255289_c1_21_476 132
1839 3300050494 nmdc:mga06z11_320891_c1 nmdc:mga06z11_320891_c1_63_518 132
1840 3300050494 nmdc:mga06z11_41928_c1 nmdc:mga06z11_41928_c1_623_1075 132
1841 3300050494 nmdc:mga06z11_72589_c1 nmdc:mga06z11_72589_c1_276_728 132
1842 3300050495 nmdc:mga04h51_362632_c1 nmdc:mga04h51_362632_c1_95_550 132
1843 3300050496 nmdc:mga07m45_10513_c1 nmdc:mga07m45_10513_c1_718_1170 132
1844 3300050496 nmdc:mga07m45_200148_c1 nmdc:mga07m45_200148_c1_34_486 132
1845 3300050496 nmdc:mga07m45_213173_c1 nmdc:mga07m45_213173_c1_61_519 132
1846 3300050496 nmdc:mga07m45_28645_c1 nmdc:mga07m45_28645_c1_704_1159 132
1847 3300050513 nmdc:mga0rr50_53176_c1 nmdc:mga0rr50_53176_c1_635_1096 132
1848 3300050514 nmdc:mga08x19_14_c1 nmdc:mga08x19_14_c1_286261_286722 132
1849 3300050516 nmdc:mga0sz30_15908_c1 nmdc:mga0sz30_15908_c1_2286_2741 132
1850 3300050516 nmdc:mga0sz30_173779_c1 nmdc:mga0sz30_173779_c1_93_548 132
1851 3300050516 nmdc:mga0sz30_55470_c1 nmdc:mga0sz30_55470_c1_146_589 132
1852 3300050516 nmdc:mga0sz30_7864_c1 nmdc:mga0sz30_7864_c1_633_1085 132
1853 3300050516 nmdc:mga0sz30_85576_c1 nmdc:mga0sz30_85576_c1_642_1097 132
1854 3300053079 Ga0500610_0019111 Ga0500610_0019111_373_831 132
1855 3300053079 Ga0500610_0045559 Ga0500610_0045559_738_1184 132
1856 3300053083 Ga0495655_0098817 Ga0495655_0098817_22_474 132
1857 3300053086 Ga0500578_0108162 Ga0500578_0108162_1109_1561 132
1858 3300053088 Ga0500644_0195949 Ga0500644_0195949_271_729 132
1859 3300053093 Ga0500651_0208329 Ga0500651_0208329_75_527 132
1860 3300053108 Ga0500562_045885 Ga0500562_045885_488_934 132
1861 3300053118 Ga0500594_0101165 Ga0500594_0101165_344_796 132
1862 3300053119 Ga0500595_079905 Ga0500595_079905_23_481 132
1863 3300053122 Ga0500608_002494 Ga0500608_002494_4473_4946 132
1864 3300053125 Ga0500618_005279 Ga0500618_005279_2415_2864 132
1865 3300053134 Ga0500658_0001009 Ga0500658_0001009_4282_4734 132
1866 3300053134 Ga0500658_0015794 Ga0500658_0015794_1674_2120 132
1867 3300053134 Ga0500658_0357987 Ga0500658_0357987_73_531 132
1868 3300053136 Ga0500559_0031862 Ga0500559_0031862_461_919 132
1869 3300053139 Ga0500568_0005268 Ga0500568_0005268_1874_2320 132
1870 3300053139 Ga0500568_0016433 Ga0500568_0016433_1841_2287 132
1871 3300053142 Ga0500577_0068985 Ga0500577_0068985_266_739 132
1872 3300053151 Ga0500604_0021875 Ga0500604_0021875_539_985 132
1873 3300053153 Ga0500616_0000417 Ga0500616_0000417_9196_9642 132
1874 3300053153 Ga0500616_0043680 Ga0500616_0043680_740_1192 132
1875 3300053153 Ga0500616_0165368 Ga0500616_0165368_451_903 132
1876 3300053153 Ga0500616_0217736 Ga0500616_0217736_91_552 132
1877 3300053155 Ga0500620_000455 Ga0500620_000455_6567_7028 132
1878 3300053156 Ga0500622_0000168 Ga0500622_0000168_37415_37888 132
1879 3300053156 Ga0500622_0002307 Ga0500622_0002307_11416_11862 132
1880 3300053158 Ga0500627_0231349 Ga0500627_0231349_149_607 132
1881 3300053160 Ga0500633_0001613 Ga0500633_0001613_861_1307 132
1882 3300053160 Ga0500633_0148991 Ga0500633_0148991_393_839 132
1883 3300053177 Ga0500636_0027374 Ga0500636_0027374_1122_1568 132
1884 3300054114 Ga0501084_0193881 Ga0501084_0193881_982_1446 132
1885 3300059510 Ga0587090_026434 Ga0587090_026434_69_527 132
1886 3300059512 Ga0587092_088796 Ga0587092_088796_63_521 132
1887 3300060353 Ga0501082_0385991 Ga0501082_0385991_757_1203 132
1888 3300060353 Ga0501082_0424074 Ga0501082_0424074_618_1082 132
1889 3300060353 Ga0501082_0473178 Ga0501082_0473178_367_828 132
1890 3300060353 Ga0501082_0925755 Ga0501082_0925755_227_706 132
1891 iso_pu_bacteria 2513237159 2514000272 132
1892 iso_pu_bacteria 2515154107 2515611499 132
1893 iso_pu_bacteria 2936996657 2936997721 132

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03364

Polyketide_cyc

Polyketide cyclase / dehydrase and lipid transport

36

166

0.97

PF10604

Polyketide_cyc2

Polyketide cyclase / dehydrase and lipid transport

27

170

0.67

Structural Annotation

Top 5 Hits

ID Description Score Start End
2d4r-assembly1.cif.gz_A crystal structure of ttha0849 from thermus thermophilus hb8 0.8516 2 131
1t17-assembly1.cif.gz_A solution structure of the 18 kda protein cc1736 from caulobacter crescentus: the northeast structural genomics consortium target ccr19 0.8288 1 130
6w3d-assembly1.cif.gz_A rd1ntf2_05 with long sheet 0.8129 32 79
1t17-assembly1.cif.gz_A solution structure of the 18 kda protein cc1736 from caulobacter crescentus: the northeast structural genomics consortium target ccr19 0.8126 1 130
2d4r-assembly1.cif.gz_A crystal structure of ttha0849 from thermus thermophilus hb8 0.811 2 131
ID Description Score Start End Superfamily
af_Q556V1_54_199_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9053 4 131 3.30.530.20
af_P0AGL5_15_157_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9011 2 130 3.30.530.20
af_Q8MLL3_83_228_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8962 2 130 3.30.530.20
af_A0A1D6NAC7_96_241_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8866 2 131 3.30.530.20
af_Q9USM9_11_156_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8816 2 125 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A256GYQ5-F1-model_v4 Polyketide cyclase / dehydrase and lipid transport family protein 0.9933 17 131 GO:0045333
GO:0048039
AF-A0A5J4E2I0-F1-model_v4 Persistence and stress-resistance toxin PasT 0.9909 1 130 GO:0045333
GO:0048039
AF-A0A101VI81-F1-model_v4 Cyclase 0.9896 1 131 GO:0045333
GO:0048039
AF-A0A528LFB2-F1-model_v4 Type II toxin-antitoxin system RatA family toxin 0.9883 1 120 GO:0045333
GO:0048039
AF-A0A125NW27-F1-model_v4 Putative oligoketide cyclase/dehydratase or lipid transport protein YfjG 0.9862 1 132 GO:0045333
GO:0048039

Feature Viewer

pLDDT pTM Quality
91.4 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map