F495995
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1893 | 1275 | 1075 | 148 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2515154107|2515611499 |
| Length | 175 |
| Sequence | RDPQREAGHKCAASLIFSRCSLNSQSMPHFETNHVVKHSAEQMFALVADVERYPEFLPLCEALSVRSRKERDGKVLLLADMTVGYKAIRETFTTQVLLKREERIIDVNYIEGPFKYLDNVWRFEPVNDNQSIVHFCIDYEFKSRLLGALMGSMFDRAFRMFSEAFEKRADVIYGA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 2 | 2503198000 | Mesorhizobium opportunistum WSM2075 | Isolate | Nodule |
| 3 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 4 | 2508501123 | Mesorhizobium sp. WSM3626 | Isolate | Nodule |
| 5 | 2508501127 | Mesorhizobium sp. WSM2561 | Isolate | Nodule |
| 6 | 2509276018 | Mesorhizobium ciceri CMG6 | Isolate | Nodule |
| 7 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 8 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 9 | 2509276022 | Mesorhizobium australicum WSM2073 | Isolate | Nodule |
| 10 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 11 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 12 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 13 | 2510065059 | Mesorhizobium ciceri WSM4083 | Isolate | Nodule |
| 14 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 15 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 16 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 17 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 18 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 19 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 20 | 2512875016 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 21 | 2512875024 | Mesorhizobium loti R88b | Isolate | Nodule |
| 22 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 23 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 24 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 25 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 26 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 27 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 28 | 2513237090 | Mesorhizobium sp. WSM3224 | Isolate | Nodule |
| 29 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 30 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 31 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 32 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 33 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 34 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 35 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 36 | 2513237159 | Rhizobium giardinii bv. giardinii H152 | Isolate | Nodule |
| 37 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 38 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 39 | 2513237164 | Mesorhizobium loti CJ3sym | Isolate | Nodule |
| 40 | 2513237305 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 41 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 42 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 43 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 44 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 45 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 46 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 47 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 48 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 49 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 50 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 51 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 52 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 53 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 54 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 55 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 56 | 2523231067 | Pleomorphomonas oryzae DSM 16300 | Isolate | Unclassified |
| 57 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 58 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 59 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 60 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 61 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 62 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 63 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 64 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 65 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 66 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 67 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 68 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 69 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 70 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 71 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 72 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 73 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 74 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 75 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 76 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 77 | 2582581306 | Rhizobium sp. YR295 | Isolate | Rhizosphere |
| 78 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 79 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 80 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 81 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 82 | 2582581865 | Rhizobium sp. CF258 | Isolate | Rhizosphere |
| 83 | 2582581866 | Rhizobium sp. CF097 | Isolate | Rhizosphere |
| 84 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 85 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 86 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 87 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 88 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 89 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 90 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 91 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 92 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 93 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 94 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 95 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 96 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 97 | 2588253730 | Mesorhizobium huakuii 7653R | Isolate | Rhizosphere |
| 98 | 2597489875 | Mesorhizobium ciceri ca181 | Isolate | Unclassified |
| 99 | 2599185156 | Rhizobium sp. NFR03 | Isolate | Rhizoplane |
| 100 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 101 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 102 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 103 | 2599185352 | Sinorhizobium sp. NFACC03 | Isolate | Rhizoplane |
| 104 | 2600254933 | Rhizobium sp. NFR12 | Isolate | Rhizoplane |
| 105 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 106 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 107 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 108 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 109 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 110 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 111 | 2643221551 | Mesorhizobium sp. Root1471 | Isolate | Unclassified |
| 112 | 2643221555 | Mesorhizobium sp. Root554 | Isolate | Unclassified |
| 113 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 114 | 2643221564 | Mesorhizobium sp. Root157 | Isolate | Unclassified |
| 115 | 2643221568 | Rhizobium sp. Root564 | Isolate | Unclassified |
| 116 | 2643221595 | Mesorhizobium sp. Root695 | Isolate | Unclassified |
| 117 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 118 | 2643221607 | Rhizobium sp. Root73 | Isolate | Unclassified |
| 119 | 2643221610 | Ensifer sp. Root74 | Isolate | Unclassified |
| 120 | 2643221623 | Aminobacter sp. DSM 101952 Root100 | Isolate | Unclassified |
| 121 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 122 | 2643221627 | Mesorhizobium sp. Root102 | Isolate | Unclassified |
| 123 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 124 | 2643221636 | Rhizobium sp. Root1204 | Isolate | Unclassified |
| 125 | 2643221637 | Rhizobium sp. Root1212 | Isolate | Unclassified |
| 126 | 2643221653 | Rhizobium sp. Root1240 | Isolate | Unclassified |
| 127 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 128 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 129 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 130 | 2643221675 | Ensifer sp. Root1298 | Isolate | Unclassified |
| 131 | 2643221680 | Ensifer sp. Root1312 | Isolate | Unclassified |
| 132 | 2643221686 | Rhizobium sp. Root1334 | Isolate | Unclassified |
| 133 | 2643221688 | Rhizobium sp. Root482 | Isolate | Unclassified |
| 134 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 135 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 136 | 2643221718 | Rhizobium sp. Root268 | Isolate | Unclassified |
| 137 | 2643221719 | Rhizobium sp. Root274 | Isolate | Unclassified |
| 138 | 2643221723 | Ensifer sp. Root278 | Isolate | Unclassified |
| 139 | 2643221726 | Ensifer sp. Root954 | Isolate | Unclassified |
| 140 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 141 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 142 | 2687453392 | Mesorhizobium ciceri biserrulae WSM1284 | Isolate | Unclassified |
| 143 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 144 | 2693429783 | Mesorhizobium sp. LCM 4577 | Isolate | Rhizosphere |
| 145 | 2693429784 | Mesorhizobium sp. LCM 4576 | Isolate | Rhizosphere |
| 146 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 147 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 148 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 149 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 150 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 151 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 152 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 153 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 154 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 155 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 156 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 157 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 158 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 159 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 160 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 161 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 162 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 163 | 2721755686 | Mesorhizobium amorphae CCNWGS0123 | Isolate | Nodule |
| 164 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 165 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 166 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 167 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 168 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 169 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 170 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 171 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 172 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 173 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 174 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 175 | 2738543024 | Aminobacter sp. AP02 | Isolate | Unclassified |
| 176 | 2738543031 | Pleomorphomonas sp. CF100 | Isolate | Unclassified |
| 177 | 2756170246 | Mesorhizobium loti DSM 2626 | Isolate | Nodule |
| 178 | 2757320392 | Phyllobacterium leguminum ORS 1419 | Isolate | Nodule |
| 179 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 180 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 181 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 182 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 183 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 184 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 185 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 186 | 2791355123 | Mesorhizobium sophorae ICMP 19535 | Isolate | Unclassified |
| 187 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 188 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 189 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 190 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 191 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 192 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 193 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 194 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 195 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 196 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 197 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 198 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 199 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 200 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 201 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 202 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 203 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 204 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 205 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 206 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 207 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 208 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 209 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 210 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 211 | 2818991272 | Rhizobium sp. SLBN-4 | Isolate | Unclassified |
| 212 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 213 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 214 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 215 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 216 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 217 | 2837651117 | Pseudohoeflea suaedae YC6898 | Isolate | Unclassified |
| 218 | 2837678835 | Jiella endophytica CBS5Q-3 | Isolate | Unclassified |
| 219 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 220 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 221 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 222 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 223 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 224 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 225 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 226 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 227 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 228 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 229 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 230 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 231 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 232 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 233 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 234 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 235 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 236 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 237 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 238 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 239 | 2841734538 | Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 | Isolate | Nodule |
| 240 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 241 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 242 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 243 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 244 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 245 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 246 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 247 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 248 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 249 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 250 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 251 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 252 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 253 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 254 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 255 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 256 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 257 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 258 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 259 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 260 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 261 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 262 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 263 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 264 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 265 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 266 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 267 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 268 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 269 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 270 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 271 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 272 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 273 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 274 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 275 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 276 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 277 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 278 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 279 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 280 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 281 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 282 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 283 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 284 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 285 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 286 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 287 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 288 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 289 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 290 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 291 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 292 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 293 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 294 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 295 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 296 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 297 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 298 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 299 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 300 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 301 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 302 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 303 | 2842521101 | Rhizobium giardinii SEMIA 4084 | Isolate | Nodule |
| 304 | 2844002411 | Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 | Isolate | Nodule |
| 305 | 2844009547 | Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 | Isolate | Nodule |
| 306 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 307 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 308 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 309 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 310 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 311 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 312 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 313 | 2854896431 | Neorhizobium alkalisoli DSM 21826 | Isolate | Unclassified |
| 314 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 315 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 316 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 317 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 318 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 319 | 2856320880 | Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 | Isolate | Nodule |
| 320 | 2856328259 | Mesorhizobium sp. Primo-B | Isolate | Nodule |
| 321 | 2856334872 | Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 | Isolate | Nodule |
| 322 | 2856342000 | Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 | Isolate | Nodule |
| 323 | 2856349417 | Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 | Isolate | Nodule |
| 324 | 2856356410 | Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 | Isolate | Nodule |
| 325 | 2856364286 | Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 | Isolate | Nodule |
| 326 | 2857349434 | Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 | Isolate | Nodule |
| 327 | 2857367948 | Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 | Isolate | Nodule |
| 328 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 329 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 330 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 331 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 332 | 2869169390 | Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 | Isolate | Nodule |
| 333 | 2869234852 | Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 | Isolate | Nodule |
| 334 | 2869242130 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 | Isolate | Nodule |
| 335 | 2869249662 | Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 | Isolate | Nodule |
| 336 | 2869256925 | Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 | Isolate | Nodule |
| 337 | 2869264136 | Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 | Isolate | Nodule |
| 338 | 2869271264 | Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 | Isolate | Nodule |
| 339 | 2869278585 | Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 | Isolate | Nodule |
| 340 | 2869285874 | Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 | Isolate | Nodule |
| 341 | 2871429161 | Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 | Isolate | Nodule |
| 342 | 2871435913 | Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 | Isolate | Nodule |
| 343 | 2871444079 | Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 | Isolate | Nodule |
| 344 | 2871451962 | Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 | Isolate | Nodule |
| 345 | 2871459585 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 | Isolate | Nodule |
| 346 | 2871466892 | Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 | Isolate | Nodule |
| 347 | 2871474448 | Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 | Isolate | Nodule |
| 348 | 2871481445 | Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 | Isolate | Nodule |
| 349 | 2871488783 | Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 | Isolate | Nodule |
| 350 | 2871495908 | Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 | Isolate | Nodule |
| 351 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 352 | 2874109183 | Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 | Isolate | Nodule |
| 353 | 2874116593 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 | Isolate | Nodule |
| 354 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 355 | 2874131515 | Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 | Isolate | Nodule |
| 356 | 2874139085 | Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 | Isolate | Nodule |
| 357 | 2874146452 | Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 | Isolate | Nodule |
| 358 | 2874155637 | Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 | Isolate | Nodule |
| 359 | 2874162495 | Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 | Isolate | Nodule |
| 360 | 2874168670 | Mesorhizobium kowhaii Ach-343 | Isolate | Nodule |
| 361 | 2876363079 | Mesorhizobium loti R7ANS::ICEMlSym2042 | Isolate | Nodule |
| 362 | 2876377896 | Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 | Isolate | Nodule |
| 363 | 2876386047 | Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 | Isolate | Nodule |
| 364 | 2876399893 | Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 | Isolate | Nodule |
| 365 | 2876406927 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 | Isolate | Nodule |
| 366 | 2876413966 | Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 | Isolate | Nodule |
| 367 | 2876420981 | Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 | Isolate | Nodule |
| 368 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 369 | 2878730984 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 | Isolate | Nodule |
| 370 | 2878738818 | Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 | Isolate | Nodule |
| 371 | 2878745973 | Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 | Isolate | Nodule |
| 372 | 2878753008 | Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 | Isolate | Nodule |
| 373 | 2878760144 | Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 | Isolate | Nodule |
| 374 | 2878767105 | Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 | Isolate | Nodule |
| 375 | 2878774303 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 | Isolate | Nodule |
| 376 | 2878781027 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 | Isolate | Nodule |
| 377 | 2878788777 | Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 | Isolate | Nodule |
| 378 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 379 | 2881155292 | Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 | Isolate | Nodule |
| 380 | 2881161766 | Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 | Isolate | Nodule |
| 381 | 2881845957 | Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 | Isolate | Nodule |
| 382 | 2881853255 | Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 | Isolate | Nodule |
| 383 | 2881861095 | Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 | Isolate | Nodule |
| 384 | 2882632389 | Mesorhizobium waimense ICMP19557 | Isolate | Unclassified |
| 385 | 2882912400 | Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 | Isolate | Nodule |
| 386 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 387 | 2885312484 | Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 | Isolate | Nodule |
| 388 | 2885318864 | Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 | Isolate | Nodule |
| 389 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 390 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 391 | 2885342637 | Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 | Isolate | Nodule |
| 392 | 2885350715 | Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 | Isolate | Nodule |
| 393 | 2888337043 | Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 | Isolate | Nodule |
| 394 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 395 | 2889010040 | Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 | Isolate | Nodule |
| 396 | 2889016732 | Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 | Isolate | Nodule |
| 397 | 2891048133 | Martelella lutilitoris GH2-6 | Isolate | Rhizosphere |
| 398 | 2891373044 | Shinella sp. AETb1-6 | Isolate | Rhizosphere |
| 399 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 400 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 401 | 2903448605 | Mesorhizobium japonicum Opo-235 | Isolate | Nodule |
| 402 | 2903492973 | Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 | Isolate | Nodule |
| 403 | 2903513507 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 | Isolate | Nodule |
| 404 | 2903521522 | Mesorhizobium loti R7ANS::ICEMlSym2014 | Isolate | Nodule |
| 405 | 2903528002 | Mesorhizobium loti R7ANS::ICEMlSym2037 | Isolate | Nodule |
| 406 | 2903540706 | Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 | Isolate | Nodule |
| 407 | 2904659560 | Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 | Isolate | Nodule |
| 408 | 2906308376 | Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 | Isolate | Nodule |
| 409 | 2906321335 | Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 | Isolate | Nodule |
| 410 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 411 | 2906363423 | Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 | Isolate | Nodule |
| 412 | 2906370794 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 | Isolate | Nodule |
| 413 | 2906386501 | Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 | Isolate | Nodule |
| 414 | 2906393657 | Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 | Isolate | Nodule |
| 415 | 2906401398 | Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 | Isolate | Nodule |
| 416 | 2906408224 | Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 | Isolate | Nodule |
| 417 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 418 | 2909042592 | Labrys sp. LIt4 | Isolate | Nodule |
| 419 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 420 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 421 | 2915650412 | Ochrobactrum sp. CM-21-5 | Isolate | Rhizosphere |
| 422 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 423 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 424 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 425 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 426 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 427 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 428 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 429 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 430 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 431 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 432 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 433 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 434 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 435 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 436 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 437 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 438 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 439 | 2919166419 | Agrobacterium cavarae 2074 | Isolate | Unclassified |
| 440 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 441 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 442 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 443 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 444 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 445 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 446 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 447 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 448 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 449 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 450 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 451 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 452 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 453 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 454 | 2922151315 | Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 | Isolate | Nodule |
| 455 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 456 | 2922172374 | Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 | Isolate | Nodule |
| 457 | 2922185730 | Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 | Isolate | Nodule |
| 458 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 459 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 460 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 461 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 462 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 463 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 464 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 465 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 466 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 467 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 468 | 2924214083 | Sinorhizobium meliloti USDA1702 | Isolate | Nodule |
| 469 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 470 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 471 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 472 | 2924733363 | Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 | Isolate | Nodule |
| 473 | 2924741084 | Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 | Isolate | Nodule |
| 474 | 2924748358 | Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 | Isolate | Nodule |
| 475 | 2924754689 | Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 | Isolate | Nodule |
| 476 | 2924762789 | Mesorhizobium sp. WSM4303 | Isolate | Unclassified |
| 477 | 2924776078 | Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 | Isolate | Nodule |
| 478 | 2924784321 | Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 | Isolate | Nodule |
| 479 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 480 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 481 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 482 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 483 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 484 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 485 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 486 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 487 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 488 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 489 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 490 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 491 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 492 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 493 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 494 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 495 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 496 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 497 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 498 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 499 | 2937042894 | Sinorhizobium meliloti USDA1687 | Isolate | Nodule |
| 500 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 501 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 502 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 503 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 504 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 505 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 506 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 507 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 508 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 509 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 510 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 511 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 512 | 2937813078 | Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 | Isolate | Nodule |
| 513 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 514 | 2937836603 | Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 | Isolate | Nodule |
| 515 | 2937843397 | Mesorhizobium xinjiangense lm94 | Isolate | Rhizosphere |
| 516 | 2937848649 | Mesorhizobium sp. WSM4310 | Isolate | Unclassified |
| 517 | 2937861824 | Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 | Isolate | Nodule |
| 518 | 2937868953 | Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 | Isolate | Nodule |
| 519 | 2937877337 | Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 | Isolate | Nodule |
| 520 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 521 | 2937972304 | Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 | Isolate | Nodule |
| 522 | 2937980651 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 | Isolate | Nodule |
| 523 | 2937994558 | Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 | Isolate | Nodule |
| 524 | 2938014810 | Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 | Isolate | Nodule |
| 525 | 2939669807 | Kaistia defluvii 3207 | Isolate | Rhizosphere |
| 526 | 2941499720 | Ensifer sp. 4252 | Isolate | Rhizosphere |
| 527 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 528 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 529 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 530 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 531 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 532 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 533 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 534 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 535 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 536 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 537 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 538 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 539 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 540 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 541 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 542 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 543 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 544 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 545 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 546 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 547 | 2958034702 | Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 | Isolate | Nodule |
| 548 | 2958041894 | Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 | Isolate | Nodule |
| 549 | 2958064165 | Mesorhizobium sp. SARCC-RB16n | Isolate | Unclassified |
| 550 | 2958071322 | Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 | Isolate | Nodule |
| 551 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 552 | 2958092219 | Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 | Isolate | Nodule |
| 553 | 2958100919 | Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 | Isolate | Nodule |
| 554 | 2958108152 | Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 | Isolate | Nodule |
| 555 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 556 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 557 | 2958130278 | Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 | Isolate | Nodule |
| 558 | 2958137437 | Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 | Isolate | Nodule |
| 559 | 2958158011 | Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 | Isolate | Nodule |
| 560 | 2958165035 | Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 | Isolate | Nodule |
| 561 | 2958172287 | Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 | Isolate | Nodule |
| 562 | 2958179912 | Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 | Isolate | Nodule |
| 563 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 564 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 565 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 566 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 567 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 568 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 569 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 570 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 571 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 572 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 573 | 2960652885 | Sinorhizobium meliloti USDA1199 | Isolate | Nodule |
| 574 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 575 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 576 | 2960674078 | Sinorhizobium meliloti USDA1666 | Isolate | Nodule |
| 577 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 578 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 579 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 580 | 2961077736 | Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 | Isolate | Nodule |
| 581 | 2961114664 | Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 | Isolate | Nodule |
| 582 | 2961127735 | Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 | Isolate | Nodule |
| 583 | 2961136820 | Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 | Isolate | Nodule |
| 584 | 2961163497 | Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 | Isolate | Nodule |
| 585 | 2961170736 | Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 | Isolate | Nodule |
| 586 | 2961183825 | Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 | Isolate | Nodule |
| 587 | 2963644680 | Mesorhizobium japonicum R7A | Isolate | Nodule |
| 588 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 589 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 590 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 591 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 592 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 593 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 594 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 595 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 596 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 597 | 2964670856 | Sinorhizobium meliloti USDA1211 | Isolate | Nodule |
| 598 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 599 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 600 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 601 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 602 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 603 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 604 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 605 | 2965018300 | Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 | Isolate | Nodule |
| 606 | 2965025482 | Mesorhizobium sp. Primo-A | Isolate | Nodule |
| 607 | 2965032056 | Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 | Isolate | Nodule |
| 608 | 2965040258 | Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 | Isolate | Nodule |
| 609 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 610 | 2965089291 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 | Isolate | Nodule |
| 611 | 2965102966 | Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 | Isolate | Nodule |
| 612 | 2965110997 | Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 | Isolate | Nodule |
| 613 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 614 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 615 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 616 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 617 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 618 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 619 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 620 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 621 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 622 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 623 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 624 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 625 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 626 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 627 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 628 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 629 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 630 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 631 | 2967996073 | Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 | Isolate | Nodule |
| 632 | 2968003550 | Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 | Isolate | Nodule |
| 633 | 2968016561 | Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 | Isolate | Nodule |
| 634 | 2968083720 | Mesorhizobium erdmanii Opo-242 | Isolate | Unclassified |
| 635 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 636 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 637 | 2968110612 | Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 | Isolate | Nodule |
| 638 | 2968117919 | Mesorhizobium atlanticum CNPSo 3140 | Isolate | Unclassified |
| 639 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 640 | 2968138860 | Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 | Isolate | Nodule |
| 641 | 2968171901 | Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 | Isolate | Nodule |
| 642 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 643 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 644 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 645 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 646 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 647 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 648 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 649 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 650 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 651 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 652 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 653 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 654 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 655 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 656 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 657 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 658 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 659 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 660 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 661 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 662 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 663 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 664 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 665 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 666 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 667 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 668 | 2970469710 | Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 | Isolate | Nodule |
| 669 | 2970489779 | Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 | Isolate | Nodule |
| 670 | 2970503327 | Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 | Isolate | Nodule |
| 671 | 2970510686 | Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 | Isolate | Nodule |
| 672 | 2970524798 | Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 | Isolate | Nodule |
| 673 | 2970532167 | Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 | Isolate | Nodule |
| 674 | 2970540015 | Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 | Isolate | Nodule |
| 675 | 2970547951 | Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 | Isolate | Nodule |
| 676 | 2970554993 | Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 | Isolate | Nodule |
| 677 | 2970593180 | Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 | Isolate | Nodule |
| 678 | 2970619444 | Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 | Isolate | Nodule |
| 679 | 2970627176 | Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 | Isolate | Nodule |
| 680 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 681 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 682 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 683 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 684 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 685 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 686 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 687 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 688 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 689 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 690 | 2977821940 | Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 | Isolate | Nodule |
| 691 | 2977828996 | Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 | Isolate | Nodule |
| 692 | 2977843712 | Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 | Isolate | Nodule |
| 693 | 2977851361 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 | Isolate | Nodule |
| 694 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 695 | 2977864932 | Mesorhizobium tamadayense DSM 28320 | Isolate | Nodule |
| 696 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 697 | 2977898635 | Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 | Isolate | Nodule |
| 698 | 2977907340 | Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 | Isolate | Nodule |
| 699 | 2977915119 | Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 | Isolate | Nodule |
| 700 | 2977922695 | Mesorhizobium sp. WSM4305 | Isolate | Unclassified |
| 701 | 2977935797 | Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 | Isolate | Nodule |
| 702 | 2977942078 | Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 | Isolate | Nodule |
| 703 | 2977950692 | Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 | Isolate | Nodule |
| 704 | 2977957713 | Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 | Isolate | Nodule |
| 705 | 2977986579 | Mesorhizobium intechi BD68 | Isolate | Unclassified |
| 706 | 2978969890 | Agrobacterium sp. SORGH_AS 787 | Isolate | Unclassified |
| 707 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 708 | 2979710463 | Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 | Isolate | Nodule |
| 709 | 2979742915 | Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 | Isolate | Nodule |
| 710 | 2979764755 | Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 | Isolate | Nodule |
| 711 | 2979772303 | Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 | Isolate | Nodule |
| 712 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 713 | 2979793036 | Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 | Isolate | Nodule |
| 714 | 2979808191 | Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 | Isolate | Nodule |
| 715 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 716 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 717 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 718 | 2984587000 | Agrobacterium larrymoorei SORGH_AS974 | Isolate | Aerial Root |
| 719 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 720 | 2987636660 | Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 | Isolate | Nodule |
| 721 | 2987645492 | Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 | Isolate | Nodule |
| 722 | 2987652177 | Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 | Isolate | Nodule |
| 723 | 2987659509 | Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 | Isolate | Nodule |
| 724 | 2987666974 | Mesorhizobium sp. WSM4306 | Isolate | Unclassified |
| 725 | 2987673487 | Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 | Isolate | Nodule |
| 726 | 2989349275 | Shinella kummerowiae CCBAU 25048 | Isolate | Unclassified |
| 727 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 728 | 2989776772 | Rhizobium glycinendophyticum CL12 | Isolate | Unclassified |
| 729 | 2996310559 | Mesorhizobium zhangyense CGMCC 1.15528 | Isolate | Unclassified |
| 730 | 2996336353 | Mesorhizobium sp. YM1C-6-2 | Isolate | Unclassified |
| 731 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 732 | 2996348954 | Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 | Isolate | Nodule |
| 733 | 2996386984 | Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 | Isolate | Nodule |
| 734 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 735 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 736 | 3000135777 | Unclassified bacterium M00.F.Ca.ET.205.01.1.1 | Isolate | Unclassified |
| 737 | 3003930520 | Sinorhizobium sp. BG8 | Isolate | Unclassified |
| 738 | 3004167301 | Mesorhizobium loti 582 | Isolate | Unclassified |
| 739 | 3004188549 | Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 | Isolate | Nodule |
| 740 | 3004203850 | Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 | Isolate | Nodule |
| 741 | 3004211236 | Mesorhizobium sp. WSM4307 | Isolate | Unclassified |
| 742 | 3004218560 | Mesorhizobium sp. WSM4315 | Isolate | Unclassified |
| 743 | 3004232784 | Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 | Isolate | Nodule |
| 744 | 3004239961 | Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 | Isolate | Nodule |
| 745 | 3004248173 | Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 | Isolate | Nodule |
| 746 | 3004268573 | Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 | Isolate | Nodule |
| 747 | 3004275668 | Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 | Isolate | Nodule |
| 748 | 3004289098 | Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 | Isolate | Nodule |
| 749 | 3004334049 | Mesorhizobium huakuii 583 | Isolate | Unclassified |
| 750 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 751 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 752 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 753 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 754 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 755 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 756 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 757 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 758 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 759 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 760 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 761 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 762 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 763 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 764 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 765 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 766 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 767 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 768 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 769 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 770 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 771 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 772 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 773 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 774 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 775 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 776 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 777 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 778 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 779 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 780 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 781 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 782 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 783 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 784 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 785 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 786 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 787 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 788 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 789 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 790 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 791 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 792 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 793 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 794 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 795 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 796 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 797 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 798 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 799 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 800 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 801 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 802 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 803 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 804 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 805 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 806 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 807 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 808 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 809 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 810 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 811 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 812 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 813 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 814 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 815 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 816 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 817 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 818 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 819 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 820 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 821 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 822 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 823 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 824 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 825 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 826 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 827 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 828 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 829 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 830 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 831 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 832 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 833 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 834 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 835 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 836 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 837 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 838 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 839 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 840 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 841 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 842 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 843 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 844 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 845 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 846 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 847 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 848 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 849 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 850 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 851 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 852 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 853 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 854 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 855 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 856 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 857 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 858 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 859 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 860 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 861 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 862 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 863 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 864 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 865 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 866 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 867 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 868 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 869 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 870 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 871 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 872 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 873 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 874 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 875 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 876 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 877 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 878 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 879 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 880 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 881 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 882 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 883 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 884 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 885 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 886 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 887 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 888 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 889 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 890 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 891 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 892 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 893 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 894 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 895 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 896 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 897 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 898 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 899 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 900 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 901 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 902 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 903 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 904 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 905 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 906 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 907 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 908 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 909 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 910 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 911 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 912 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 913 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 914 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 915 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 916 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 917 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 918 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 919 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 920 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 921 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 922 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 923 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 924 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 925 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 926 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 927 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 928 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 929 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 930 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 931 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 932 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 933 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 934 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 935 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 936 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 937 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 938 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 939 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 940 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 941 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 942 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 943 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 944 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 945 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 946 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 947 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 948 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 949 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 950 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 951 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 952 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 953 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 954 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 955 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 956 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 957 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 958 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 959 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 960 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 961 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 962 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 963 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 964 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 965 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 966 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 967 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 968 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 969 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 970 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 971 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 972 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 973 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 974 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 975 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 976 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 977 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 978 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 979 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 980 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 981 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 982 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 983 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 984 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 985 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 986 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 987 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 988 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 989 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 990 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 991 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 992 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 993 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 994 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 995 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 996 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 997 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 998 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 999 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 1000 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 1001 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 1002 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 1003 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 1004 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 1005 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 1006 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 1007 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 1008 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 1009 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 1010 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 1011 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 1012 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 1013 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 1014 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 1015 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 1016 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 1017 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 1018 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 1019 | 3300041497 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT | Metatranscriptome | Unclassified |
| 1020 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 1021 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 1022 | 3300041502 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT | Metatranscriptome | Unclassified |
| 1023 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 1024 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 1025 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 1026 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 1027 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 1028 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 1029 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 1030 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 1031 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 1032 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 1033 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 1034 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 1035 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 1036 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 1037 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 1038 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 1039 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 1040 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 1041 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 1042 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 1043 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 1044 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 1045 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 1046 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 1047 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 1048 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 1049 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 1050 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 1051 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 1052 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 1053 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 1054 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 1055 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 1056 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 1057 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 1058 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 1059 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 1060 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 1061 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 1062 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 1063 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 1064 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 1065 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 1066 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 1067 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 1068 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 1069 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 1070 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 1071 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 1072 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 1073 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 1074 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 1075 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 1076 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 1077 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 1078 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 1079 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 1080 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 1081 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 1082 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 1083 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 1084 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 1085 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 1086 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 1087 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 1088 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 1089 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 1090 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 1091 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 1092 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 1093 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 1094 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 1095 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 1096 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 1097 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 1098 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 1099 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 1100 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 1101 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 1102 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 1103 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 1104 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 1105 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 1106 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 1107 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 1108 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 1109 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 1110 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 1111 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 1112 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 1113 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 1114 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 1115 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 1116 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 1117 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 1118 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 1119 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 1120 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 1121 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 1122 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 1123 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 1124 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 1125 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 1126 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 1127 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 1128 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 1129 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 1130 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 1131 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 1132 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 1133 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 1134 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 1135 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 1136 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1137 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1138 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1139 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1140 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1141 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1142 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1143 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1144 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1145 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1146 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1147 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1148 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 1149 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1150 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1151 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1152 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1153 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 1154 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1155 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1156 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 1157 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1158 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1159 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 1160 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1161 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1162 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1163 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 1164 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 1165 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 1166 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1167 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 1168 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 1169 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 1170 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 1171 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 1172 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 1173 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 1174 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 1175 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 1176 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 1177 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 1178 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 1179 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 1180 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 1181 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 1182 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 1183 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 1184 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 1185 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 1186 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 1187 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 1188 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 1189 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 1190 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 1191 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 1192 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 1193 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 1194 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 1195 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 1196 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 1197 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 1198 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 1199 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 1200 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 1201 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 1202 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 1203 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 1204 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 1205 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 1206 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 1207 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 1208 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 1209 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1210 | 3300059512 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 1211 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 1212 | 637000159 | Mesorhizobium japonicum MAFF 303099 | Isolate | Unclassified |
| 1213 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 1214 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 1215 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 1216 | 649633066 | Mesorhizobium ciceri bv. biserrulae WSM1271 | Isolate | Nodule |
| 1217 | 8002285264 | Aminobacter anthyllidis LMG 26462 | Isolate | Nodule |
| 1218 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 1219 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 1220 | 8004300914 | Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 | Isolate | Nodule |
| 1221 | 8004312739 | Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 | Isolate | Nodule |
| 1222 | 8004361976 | Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 | Isolate | Nodule |
| 1223 | 8004374579 | Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 | Isolate | Nodule |
| 1224 | 8004387939 | Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 | Isolate | Nodule |
| 1225 | 8004395343 | Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 | Isolate | Nodule |
| 1226 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 1227 | 8004633249 | Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 | Isolate | Nodule |
| 1228 | 8004640170 | Mesorhizobium sp. GbtcB19 | Isolate | Unclassified |
| 1229 | 8004695233 | Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 | Isolate | Nodule |
| 1230 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 1231 | 8004714634 | Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 | Isolate | Nodule |
| 1232 | 8004727605 | Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 | Isolate | Nodule |
| 1233 | 8005246636 | Rhizobium wuzhouense W44 | Isolate | Rhizosphere |
| 1234 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 1235 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 1236 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 1237 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 1238 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 1239 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 1240 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 1241 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 1242 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 1243 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 1244 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 1245 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 1246 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 1247 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 1248 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 1249 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 1250 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 1251 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 1252 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 1253 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 1254 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 1255 | 8005658619 | Rhizobium terrae CC-HIH110 | Isolate | Unclassified |
| 1256 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 1257 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 1258 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 1259 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 1260 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 1261 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 1262 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 1263 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 1264 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 1265 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 1266 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 1267 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 1268 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 1269 | 8054558443 | Rhizobium alarense TRM95111 | Isolate | Nodule |
| 1270 | 8055431914 | Allorhizobium sonneratiae BGMRC 0089 | Isolate | Unclassified |
| 1271 | 8055617313 | Mesorhizobium onobrychidis OM4 | Isolate | Nodule |
| 1272 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 1273 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 1274 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
| 1275 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 56.52 |
| Metatranscriptomes | 0.26 |
| Isolates | 43.21 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.26 |
| Bulb | 0 |
| Endosphere | 14.26 |
| Nodule | 35.55 |
| Rhizoplane | 2.32 |
| Rhizosphere | 35.82 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.78 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | 2214702717 | 2209111006 | Bacteria | 511 |
| 2 | JGI24740J21852_10024850 | 3300001979 | Bacteria | 2026 |
| 3 | JGI24739J22299_10085637 | 3300001989 | Bacteria | 963 |
| 4 | JGI24735J21928_10045816 | 3300002067 | Bacteria | 1269 |
| 5 | JGI25155J39150_1000011 | 3300002704 | Bacteria | 207685 |
| 6 | JGI25156J39149_1000027 | 3300002705 | Bacteria | 127396 |
| 7 | JGI25156J39149_1000030 | 3300002705 | Bacteria | 126029 |
| 8 | JGI25156J39149_1004453 | 3300002705 | Bacteria | 4265 |
| 9 | JGI25154J39366_1000057 | 3300002738 | Bacteria | 110584 |
| 10 | JGI25157J39369_1000010 | 3300002741 | Bacteria | 207685 |
| 11 | JGI25157J39369_1000604 | 3300002741 | Bacteria | 20770 |
| 12 | JGI25152J39213_1002131 | 3300002773 | Bacteria | 7762 |
| 13 | JGI25150J39212_1004304 | 3300002774 | Bacteria | 3185 |
| 14 | JGI25159J45721_1000006 | 3300002987 | Bacteria | 188201 |
| 15 | JGI25151J46595_10000238 | 3300003187 | Bacteria | 64884 |
| 16 | JGI25151J46595_10009568 | 3300003187 | Bacteria | 4573 |
| 17 | JGI25406J46586_10008536 | 3300003203 | Bacteria | 4633 |
| 18 | JGI25406J46586_10045653 | 3300003203 | Bacteria | 1506 |
| 19 | JGI25165J46597_1000033 | 3300003214 | Bacteria | 293030 |
| 20 | JGI25165J46597_1000777 | 3300003214 | Bacteria | 24294 |
| 21 | JGI25165J46597_1007469 | 3300003214 | Bacteria | 1811 |
| 22 | JGI25153J46596_10002466 | 3300003215 | Bacteria | 10638 |
| 23 | JGI25153J46596_10010613 | 3300003215 | Bacteria | 4148 |
| 24 | JGI25153J46596_10070545 | 3300003215 | Bacteria | 906 |
| 25 | rootH2_10012004 | 3300003320 | Bacteria | 1765 |
| 26 | rootH2_10040546 | 3300003320 | Bacteria | 5255 |
| 27 | rootL2_10034778 | 3300003322 | Bacteria | 2514 |
| 28 | rootH1_10017647 | 3300003323 | Bacteria | 1657 |
| 29 | rootH1_10113295 | 3300003323 | Bacteria | 2515 |
| 30 | JGI25160J50197_1000004 | 3300003354 | Bacteria | 419797 |
| 31 | JGI25160J50197_1000019 | 3300003354 | Bacteria | 233980 |
| 32 | JGI25160J50197_1004387 | 3300003354 | Bacteria | 6112 |
| 33 | JGI25160J50197_1036036 | 3300003354 | Bacteria | 1206 |
| 34 | JGI25160J50197_1043041 | 3300003354 | Bacteria | 1021 |
| 35 | JGI25161J50226_1000003 | 3300003374 | Bacteria | 413345 |
| 36 | JGI25161J50226_1000330 | 3300003374 | Bacteria | 25735 |
| 37 | JGI25161J50226_1001454 | 3300003374 | Bacteria | 7115 |
| 38 | JGI25161J50226_1008427 | 3300003374 | Bacteria | 1589 |
| 39 | Ga0055542_1000762 | 3300003762 | Bacteria | 24410 |
| 40 | Ga0055529_1002106 | 3300003763 | Bacteria | 4232 |
| 41 | Ga0055526_1000565 | 3300003771 | Bacteria | 29180 |
| 42 | Ga0055526_1000669 | 3300003771 | Bacteria | 26309 |
| 43 | Ga0055526_1002226 | 3300003771 | Bacteria | 13285 |
| 44 | Ga0055526_1040249 | 3300003771 | Bacteria | 1180 |
| 45 | Ga0055524_1004582 | 3300003775 | Bacteria | 6358 |
| 46 | Ga0055524_1006212 | 3300003775 | Bacteria | 5213 |
| 47 | Ga0055524_1007214 | 3300003775 | Bacteria | 4752 |
| 48 | Ga0055524_1010237 | 3300003775 | Bacteria | 3747 |
| 49 | Ga0055524_1035612 | 3300003775 | Bacteria | 1354 |
| 50 | Ga0055536_1000212 | 3300003781 | Bacteria | 47611 |
| 51 | Ga0055536_1004763 | 3300003781 | Bacteria | 6809 |
| 52 | Ga0055534_1047945 | 3300003784 | Bacteria | 613 |
| 53 | Ga0055528_1000918 | 3300003790 | Bacteria | 19824 |
| 54 | Ga0055528_1005988 | 3300003790 | Bacteria | 5570 |
| 55 | Ga0055528_1008737 | 3300003790 | Bacteria | 4297 |
| 56 | Ga0055528_1015144 | 3300003790 | Bacteria | 2802 |
| 57 | Ga0055528_1020888 | 3300003790 | Bacteria | 2102 |
| 58 | Ga0055530_10015221 | 3300003791 | Bacteria | 2523 |
| 59 | Ga0055530_10068443 | 3300003791 | Bacteria | 772 |
| 60 | Ga0055540_1000285 | 3300003792 | Bacteria | 45310 |
| 61 | Ga0055540_1001884 | 3300003792 | Bacteria | 11760 |
| 62 | Ga0055540_1002932 | 3300003792 | Bacteria | 8600 |
| 63 | Ga0055540_1023537 | 3300003792 | Bacteria | 1549 |
| 64 | Ga0055540_1026148 | 3300003792 | Bacteria | 1416 |
| 65 | Ga0055540_1059536 | 3300003792 | Bacteria | 766 |
| 66 | Ga0055540_1059940 | 3300003792 | Bacteria | 763 |
| 67 | Ga0055531_10001165 | 3300003794 | Bacteria | 20245 |
| 68 | Ga0055531_10014995 | 3300003794 | Bacteria | 3448 |
| 69 | Ga0055531_10069570 | 3300003794 | Bacteria | 818 |
| 70 | Ga0058692_1004051 | 3300003856 | Bacteria | 4402 |
| 71 | Ga0055543_1000001 | 3300004625 | Bacteria | 419949 |
| 72 | Ga0055543_1000019 | 3300004625 | Bacteria | 161035 |
| 73 | Ga0055543_1000147 | 3300004625 | Bacteria | 58621 |
| 74 | Ga0055543_1000808 | 3300004625 | Bacteria | 15443 |
| 75 | Ga0065165_1000049 | 3300005262 | Bacteria | 195588 |
| 76 | Ga0065165_1000180 | 3300005262 | Bacteria | 111768 |
| 77 | Ga0065165_1005995 | 3300005262 | Bacteria | 6555 |
| 78 | Ga0065165_1017852 | 3300005262 | Bacteria | 2595 |
| 79 | Ga0065165_1024195 | 3300005262 | Bacteria | 2044 |
| 80 | Ga0070658_10032973 | 3300005327 | Bacteria | 4165 |
| 81 | Ga0070658_11253983 | 3300005327 | Bacteria | 644 |
| 82 | Ga0070670_100001443 | 3300005331 | Bacteria | 19089 |
| 83 | Ga0068869_101109938 | 3300005334 | Bacteria | 692 |
| 84 | Ga0070687_100035726 | 3300005343 | Bacteria | 2470 |
| 85 | Ga0070661_100680165 | 3300005344 | Bacteria | 837 |
| 86 | Ga0070668_100629226 | 3300005347 | Bacteria | 941 |
| 87 | Ga0070675_100238243 | 3300005354 | Bacteria | 1589 |
| 88 | Ga0070671_100310609 | 3300005355 | Bacteria | 1343 |
| 89 | Ga0070671_100434568 | 3300005355 | Bacteria | 1125 |
| 90 | Ga0070674_100319133 | 3300005356 | Bacteria | 1245 |
| 91 | Ga0070659_100090030 | 3300005366 | Bacteria | 2459 |
| 92 | Ga0070667_101468578 | 3300005367 | Bacteria | 640 |
| 93 | Ga0070703_10001607 | 3300005406 | Bacteria | 6715 |
| 94 | Ga0070709_10145167 | 3300005434 | Bacteria | 1634 |
| 95 | Ga0070701_10001368 | 3300005438 | Bacteria | 8996 |
| 96 | Ga0070711_100859884 | 3300005439 | Bacteria | 772 |
| 97 | Ga0070705_100000487 | 3300005440 | Bacteria | 22874 |
| 98 | Ga0070700_100003143 | 3300005441 | Bacteria | 8482 |
| 99 | Ga0070694_100023927 | 3300005444 | Bacteria | 3936 |
| 100 | Ga0070708_100029082 | 3300005445 | Bacteria | 4763 |
| 101 | Ga0070663_100004621 | 3300005455 | Bacteria | 8109 |
| 102 | Ga0070663_101228536 | 3300005455 | Bacteria | 659 |
| 103 | Ga0070662_100411200 | 3300005457 | Bacteria | 1118 |
| 104 | Ga0070662_100910096 | 3300005457 | Bacteria | 751 |
| 105 | Ga0070662_101332326 | 3300005457 | Bacteria | 618 |
| 106 | Ga0070681_10171682 | 3300005458 | Bacteria | 2090 |
| 107 | Ga0070706_100058590 | 3300005467 | Bacteria | 3554 |
| 108 | Ga0070698_100665481 | 3300005471 | Bacteria | 983 |
| 109 | Ga0070699_100002474 | 3300005518 | Bacteria | 16609 |
| 110 | Ga0070679_100050610 | 3300005530 | Bacteria | 4138 |
| 111 | Ga0070679_100065325 | 3300005530 | Bacteria | 3627 |
| 112 | Ga0070697_100000987 | 3300005536 | Bacteria | 21511 |
| 113 | Ga0070697_100119415 | 3300005536 | Bacteria | 2204 |
| 114 | Ga0068853_100002083 | 3300005539 | Bacteria | 14829 |
| 115 | Ga0068853_100320060 | 3300005539 | Bacteria | 1438 |
| 116 | Ga0068853_101041001 | 3300005539 | Bacteria | 788 |
| 117 | Ga0070686_100403550 | 3300005544 | Bacteria | 1040 |
| 118 | Ga0070695_100004914 | 3300005545 | Bacteria | 7882 |
| 119 | Ga0070696_100001714 | 3300005546 | Bacteria | 14378 |
| 120 | Ga0070693_100064714 | 3300005547 | Bacteria | 2135 |
| 121 | Ga0070665_100100274 | 3300005548 | Bacteria | 2900 |
| 122 | Ga0070665_100166889 | 3300005548 | Bacteria | 2204 |
| 123 | Ga0070665_100244907 | 3300005548 | Bacteria | 1793 |
| 124 | Ga0070665_100287216 | 3300005548 | Bacteria | 1647 |
| 125 | Ga0070665_100464658 | 3300005548 | Bacteria | 1276 |
| 126 | Ga0070665_100642398 | 3300005548 | Bacteria | 1074 |
| 127 | Ga0070665_100715156 | 3300005548 | Bacteria | 1015 |
| 128 | Ga0070704_100004568 | 3300005549 | Bacteria | 7999 |
| 129 | Ga0068855_100081541 | 3300005563 | Bacteria | 3749 |
| 130 | Ga0068855_100147887 | 3300005563 | Bacteria | 2673 |
| 131 | Ga0068855_101151476 | 3300005563 | Bacteria | 808 |
| 132 | Ga0068857_100030653 | 3300005577 | Bacteria | 4750 |
| 133 | Ga0068857_100057532 | 3300005577 | Bacteria | 3451 |
| 134 | Ga0068856_100069999 | 3300005614 | Bacteria | 3470 |
| 135 | Ga0068856_100108448 | 3300005614 | Bacteria | 2773 |
| 136 | Ga0068856_100382539 | 3300005614 | Bacteria | 1427 |
| 137 | Ga0068856_100523781 | 3300005614 | Bacteria | 1207 |
| 138 | Ga0068852_100082239 | 3300005616 | Bacteria | 2861 |
| 139 | Ga0068852_101959714 | 3300005616 | Bacteria | 608 |
| 140 | Ga0068859_100011400 | 3300005617 | Bacteria | 8936 |
| 141 | Ga0068859_100051166 | 3300005617 | Bacteria | 4151 |
| 142 | Ga0068864_100081043 | 3300005618 | Bacteria | 2845 |
| 143 | Ga0068851_10104616 | 3300005834 | Bacteria | 1505 |
| 144 | Ga0068863_100170600 | 3300005841 | Bacteria | 2087 |
| 145 | Ga0068858_100051707 | 3300005842 | Bacteria | 3802 |
| 146 | Ga0068858_100136804 | 3300005842 | Bacteria | 2299 |
| 147 | Ga0068860_100007101 | 3300005843 | Bacteria | 11206 |
| 148 | Ga0068860_100877418 | 3300005843 | Bacteria | 913 |
| 149 | Ga0068862_100011359 | 3300005844 | Bacteria | 7353 |
| 150 | Ga0081455_10262695 | 3300005937 | Bacteria | 1257 |
| 151 | Ga0081455_10706243 | 3300005937 | Bacteria | 642 |
| 152 | Ga0081539_10001354 | 3300005985 | Bacteria | 42654 |
| 153 | Ga0081539_10002915 | 3300005985 | Bacteria | 22591 |
| 154 | Ga0075365_10000771 | 3300006038 | Bacteria | 13047 |
| 155 | Ga0075365_10019973 | 3300006038 | Bacteria | 4145 |
| 156 | Ga0075365_10028318 | 3300006038 | Bacteria | 3573 |
| 157 | Ga0075365_10049392 | 3300006038 | Bacteria | 2772 |
| 158 | Ga0075365_10055143 | 3300006038 | Bacteria | 2637 |
| 159 | Ga0075365_10253425 | 3300006038 | Bacteria | 1237 |
| 160 | Ga0075365_10365111 | 3300006038 | Bacteria | 1018 |
| 161 | Ga0075365_10536379 | 3300006038 | Bacteria | 827 |
| 162 | Ga0075368_10058667 | 3300006042 | Bacteria | 1538 |
| 163 | Ga0075368_10063670 | 3300006042 | Bacteria | 1480 |
| 164 | Ga0075368_10119436 | 3300006042 | Bacteria | 1091 |
| 165 | Ga0075363_100012667 | 3300006048 | Bacteria | 4068 |
| 166 | Ga0075363_100050250 | 3300006048 | Bacteria | 2221 |
| 167 | Ga0075363_100099987 | 3300006048 | Bacteria | 1604 |
| 168 | Ga0075363_100100272 | 3300006048 | Bacteria | 1602 |
| 169 | Ga0075363_100133720 | 3300006048 | Bacteria | 1392 |
| 170 | Ga0075363_100731597 | 3300006048 | Bacteria | 599 |
| 171 | Ga0075364_10008131 | 3300006051 | Bacteria | 6257 |
| 172 | Ga0075364_10120674 | 3300006051 | Bacteria | 1754 |
| 173 | Ga0075364_10148623 | 3300006051 | Bacteria | 1578 |
| 174 | Ga0075364_10920067 | 3300006051 | Bacteria | 595 |
| 175 | Ga0070715_10383836 | 3300006163 | Bacteria | 776 |
| 176 | Ga0075362_10051910 | 3300006177 | Bacteria | 1836 |
| 177 | Ga0075362_10224417 | 3300006177 | Bacteria | 919 |
| 178 | Ga0075367_10026480 | 3300006178 | Bacteria | 3290 |
| 179 | Ga0075367_10050505 | 3300006178 | Bacteria | 2456 |
| 180 | Ga0075367_10087828 | 3300006178 | Bacteria | 1889 |
| 181 | Ga0075367_10184751 | 3300006178 | Bacteria | 1300 |
| 182 | Ga0075367_10197438 | 3300006178 | Bacteria | 1257 |
| 183 | Ga0075367_10279322 | 3300006178 | Bacteria | 1050 |
| 184 | Ga0075367_10516081 | 3300006178 | Bacteria | 758 |
| 185 | Ga0075369_10002912 | 3300006186 | Bacteria | 6173 |
| 186 | Ga0075369_10004806 | 3300006186 | Bacteria | 5024 |
| 187 | Ga0075369_10019597 | 3300006186 | Bacteria | 2763 |
| 188 | Ga0075369_10086170 | 3300006186 | Bacteria | 1398 |
| 189 | Ga0075369_10097492 | 3300006186 | Bacteria | 1317 |
| 190 | Ga0075369_10316536 | 3300006186 | Bacteria | 730 |
| 191 | Ga0075366_10003432 | 3300006195 | Bacteria | 8356 |
| 192 | Ga0075366_10365675 | 3300006195 | Bacteria | 886 |
| 193 | Ga0075370_10006155 | 3300006353 | Bacteria | 6019 |
| 194 | Ga0075370_10041398 | 3300006353 | Bacteria | 2601 |
| 195 | Ga0075370_10070723 | 3300006353 | Bacteria | 1996 |
| 196 | Ga0075370_10165121 | 3300006353 | Bacteria | 1300 |
| 197 | Ga0075370_10208580 | 3300006353 | Bacteria | 1153 |
| 198 | Ga0075370_10619750 | 3300006353 | Bacteria | 656 |
| 199 | Ga0075428_100157306 | 3300006844 | Bacteria | 2468 |
| 200 | Ga0075430_100013715 | 3300006846 | Bacteria | 6908 |
| 201 | Ga0075431_100001091 | 3300006847 | Bacteria | 24310 |
| 202 | Ga0075433_10445911 | 3300006852 | Bacteria | 1141 |
| 203 | Ga0075429_100764842 | 3300006880 | Unclassified | 846 |
| 204 | Ga0068865_101490036 | 3300006881 | Bacteria | 606 |
| 205 | Ga0097620_100011399 | 3300006931 | Bacteria | 8936 |
| 206 | Ga0097620_100051168 | 3300006931 | Bacteria | 4151 |
| 207 | Ga0079104_1000187 | 3300006946 | Bacteria | 86957 |
| 208 | Ga0079104_1001924 | 3300006946 | Bacteria | 12460 |
| 209 | Ga0099826_10004117 | 3300006948 | Bacteria | 10107 |
| 210 | Ga0075435_100061966 | 3300007076 | Bacteria | 3035 |
| 211 | Ga0099794_10068986 | 3300007265 | Unclassified | 1729 |
| 212 | Ga0099794_10384984 | 3300007265 | Unclassified | 732 |
| 213 | Ga0099795_10321821 | 3300007788 | Unclassified | 685 |
| 214 | Ga0105251_10011989 | 3300009011 | Bacteria | 4921 |
| 215 | Ga0105240_10000005 | 3300009093 | Bacteria | 702630 |
| 216 | Ga0105240_10483353 | 3300009093 | Bacteria | 1380 |
| 217 | Ga0105240_10698477 | 3300009093 | Bacteria | 1107 |
| 218 | Ga0105240_10799296 | 3300009093 | Bacteria | 1022 |
| 219 | Ga0105245_10504020 | 3300009098 | Bacteria | 1227 |
| 220 | Ga0105245_11155304 | 3300009098 | Bacteria | 821 |
| 221 | Ga0105247_10011923 | 3300009101 | Bacteria | 5225 |
| 222 | Ga0105247_11150484 | 3300009101 | Bacteria | 615 |
| 223 | Ga0105243_10121413 | 3300009148 | Bacteria | 2203 |
| 224 | Ga0105243_10175176 | 3300009148 | Bacteria | 1861 |
| 225 | Ga0105241_10012824 | 3300009174 | Bacteria | 6153 |
| 226 | Ga0105241_10203860 | 3300009174 | Bacteria | 1654 |
| 227 | Ga0105241_10389862 | 3300009174 | Bacteria | 1219 |
| 228 | Ga0105237_10002240 | 3300009545 | Bacteria | 24098 |
| 229 | Ga0105238_10038126 | 3300009551 | Bacteria | 4882 |
| 230 | Ga0105238_10605306 | 3300009551 | Bacteria | 1104 |
| 231 | Ga0105238_11301184 | 3300009551 | Bacteria | 753 |
| 232 | Ga0105249_10000834 | 3300009553 | Bacteria | 27750 |
| 233 | Ga0105249_12837275 | 3300009553 | Bacteria | 556 |
| 234 | Ga0123341_1000001 | 3300009765 | Bacteria | 314908 |
| 235 | Ga0123342_1008195 | 3300009766 | Bacteria | 13325 |
| 236 | Ga0123342_1028840 | 3300009766 | Bacteria | 2947 |
| 237 | Ga0099796_10020084 | 3300010159 | Bacteria | 2036 |
| 238 | Ga0105239_10000739 | 3300010375 | Bacteria | 46483 |
| 239 | Ga0105239_10164100 | 3300010375 | Bacteria | 2483 |
| 240 | Ga0105239_10558827 | 3300010375 | Bacteria | 1304 |
| 241 | Ga0105239_10799707 | 3300010375 | Bacteria | 1080 |
| 242 | Ga0105239_11064602 | 3300010375 | Bacteria | 931 |
| 243 | Ga0105246_10016031 | 3300011119 | Bacteria | 4741 |
| 244 | Ga0105246_11329567 | 3300011119 | Bacteria | 667 |
| 245 | Ga0157319_1053546 | 3300012497 | Bacteria | 508 |
| 246 | Ga0157371_10005765 | 3300013102 | Bacteria | 10378 |
| 247 | Ga0157371_10275070 | 3300013102 | Bacteria | 1216 |
| 248 | Ga0157370_10000284 | 3300013104 | Bacteria | 64323 |
| 249 | Ga0157370_10337116 | 3300013104 | Bacteria | 1390 |
| 250 | Ga0157369_11347411 | 3300013105 | Bacteria | 727 |
| 251 | Ga0171463_1011 | 3300013249 | Bacteria | 230603 |
| 252 | Ga0157374_10261982 | 3300013296 | Bacteria | 1703 |
| 253 | Ga0157374_10515065 | 3300013296 | Bacteria | 1202 |
| 254 | Ga0157374_11875973 | 3300013296 | Bacteria | 625 |
| 255 | Ga0157378_10428295 | 3300013297 | Bacteria | 1309 |
| 256 | Ga0157378_10821988 | 3300013297 | Bacteria | 956 |
| 257 | Ga0157378_10858029 | 3300013297 | Bacteria | 937 |
| 258 | Ga0157372_10704181 | 3300013307 | Bacteria | 1175 |
| 259 | Ga0157372_11034046 | 3300013307 | Bacteria | 951 |
| 260 | Ga0157372_11765158 | 3300013307 | Bacteria | 712 |
| 261 | Ga0157375_11897175 | 3300013308 | Bacteria | 707 |
| 262 | Ga0157375_12566204 | 3300013308 | Bacteria | 609 |
| 263 | Ga0163163_11471464 | 3300014325 | Bacteria | 743 |
| 264 | Ga0163163_11571178 | 3300014325 | Bacteria | 719 |
| 265 | Ga0182008_10132875 | 3300014497 | Bacteria | 1242 |
| 266 | Ga0182008_10336259 | 3300014497 | Bacteria | 798 |
| 267 | Ga0182006_1014407 | 3300015261 | Bacteria | 3410 |
| 268 | Ga0182007_10108824 | 3300015262 | Bacteria | 921 |
| 269 | Ga0182007_10287558 | 3300015262 | Bacteria | 600 |
| 270 | Ga0182005_1003903 | 3300015265 | Bacteria | 4936 |
| 271 | Ga0182005_1006191 | 3300015265 | Bacteria | 3676 |
| 272 | Ga0183363_1111 | 3300015690 | Bacteria | 22277 |
| 273 | Ga0163161_10684764 | 3300017792 | Bacteria | 852 |
| 274 | Ga0163161_11316251 | 3300017792 | Bacteria | 628 |
| 275 | Ga0214544_1000265 | 3300021320 | Bacteria | 87060 |
| 276 | Ga0214542_1000015 | 3300021321 | Bacteria | 227912 |
| 277 | Ga0214543_1000011 | 3300021327 | Bacteria | 344093 |
| 278 | Ga0214543_1000032 | 3300021327 | Bacteria | 200766 |
| 279 | Ga0228711_1000012 | 3300022739 | Bacteria | 132594 |
| 280 | Ga0228710_1000006 | 3300022740 | Bacteria | 209134 |
| 281 | Ga0209435_100022 | 3300025206 | Bacteria | 207766 |
| 282 | Ga0209436_100038 | 3300025208 | Bacteria | 76733 |
| 283 | Ga0209436_100837 | 3300025208 | Bacteria | 12443 |
| 284 | Ga0209436_111465 | 3300025208 | Bacteria | 1556 |
| 285 | Ga0209672_111952 | 3300025228 | Bacteria | 1097 |
| 286 | Ga0209437_100160 | 3300025233 | Bacteria | 149451 |
| 287 | Ga0209437_100310 | 3300025233 | Bacteria | 65905 |
| 288 | Ga0207425_1011762 | 3300025245 | Bacteria | 2073 |
| 289 | Ga0207425_1017027 | 3300025245 | Bacteria | 1605 |
| 290 | Ga0207425_1021384 | 3300025245 | Bacteria | 1372 |
| 291 | Ga0207425_1032792 | 3300025245 | Bacteria | 1027 |
| 292 | Ga0207425_1046284 | 3300025245 | Bacteria | 811 |
| 293 | Ga0209646_1000078 | 3300025246 | Bacteria | 207766 |
| 294 | Ga0209026_1000002 | 3300025250 | Bacteria | 1136158 |
| 295 | Ga0209026_1000065 | 3300025250 | Bacteria | 207766 |
| 296 | Ga0209677_101256 | 3300025253 | Bacteria | 11408 |
| 297 | Ga0209148_1000570 | 3300025254 | Bacteria | 34441 |
| 298 | Ga0209759_1000055 | 3300025256 | Bacteria | 207766 |
| 299 | Ga0209759_1000119 | 3300025256 | Bacteria | 141051 |
| 300 | Ga0209759_1012005 | 3300025256 | Bacteria | 2425 |
| 301 | Ga0209129_1000349 | 3300025258 | Bacteria | 38942 |
| 302 | Ga0209129_1000432 | 3300025258 | Bacteria | 31411 |
| 303 | Ga0209129_1000442 | 3300025258 | Bacteria | 30980 |
| 304 | Ga0209129_1002862 | 3300025258 | Bacteria | 7972 |
| 305 | Ga0209129_1012729 | 3300025258 | Bacteria | 1904 |
| 306 | Ga0209233_1000027 | 3300025261 | Bacteria | 652089 |
| 307 | Ga0209233_1000168 | 3300025261 | Bacteria | 149312 |
| 308 | Ga0209233_1000269 | 3300025261 | Bacteria | 74071 |
| 309 | Ga0209233_1000303 | 3300025261 | Bacteria | 59138 |
| 310 | Ga0209455_1000204 | 3300025272 | Bacteria | 85420 |
| 311 | Ga0209673_1000068 | 3300025273 | Bacteria | 245891 |
| 312 | Ga0209673_1000139 | 3300025273 | Bacteria | 157765 |
| 313 | Ga0209673_1001538 | 3300025273 | Bacteria | 20946 |
| 314 | Ga0209673_1002227 | 3300025273 | Bacteria | 14064 |
| 315 | Ga0209673_1005579 | 3300025273 | Bacteria | 6290 |
| 316 | Ga0209673_1008099 | 3300025273 | Bacteria | 4725 |
| 317 | Ga0209673_1015353 | 3300025273 | Bacteria | 2915 |
| 318 | Ga0209673_1056305 | 3300025273 | Bacteria | 1007 |
| 319 | Ga0209130_1000007 | 3300025284 | Bacteria | 591584 |
| 320 | Ga0209130_1000012 | 3300025284 | Bacteria | 421329 |
| 321 | Ga0209130_1000097 | 3300025284 | Bacteria | 143750 |
| 322 | Ga0209130_1015683 | 3300025284 | Bacteria | 1858 |
| 323 | Ga0209130_1029780 | 3300025284 | Bacteria | 1134 |
| 324 | Ga0209675_1050911 | 3300025291 | Bacteria | 855 |
| 325 | Ga0209675_1061028 | 3300025291 | Bacteria | 745 |
| 326 | Ga0209676_1000399 | 3300025292 | Bacteria | 79312 |
| 327 | Ga0209676_1006026 | 3300025292 | Bacteria | 6116 |
| 328 | Ga0209025_1000237 | 3300025294 | Bacteria | 128553 |
| 329 | Ga0209025_1000358 | 3300025294 | Bacteria | 97655 |
| 330 | Ga0209025_1000729 | 3300025294 | Bacteria | 55773 |
| 331 | Ga0209025_1000923 | 3300025294 | Bacteria | 45012 |
| 332 | Ga0209025_1000949 | 3300025294 | Bacteria | 43938 |
| 333 | Ga0209025_1004865 | 3300025294 | Bacteria | 11329 |
| 334 | Ga0209025_1005123 | 3300025294 | Bacteria | 10878 |
| 335 | Ga0209025_1058527 | 3300025294 | Bacteria | 1463 |
| 336 | Ga0209025_1071341 | 3300025294 | Bacteria | 1231 |
| 337 | Ga0209025_1099690 | 3300025294 | Bacteria | 923 |
| 338 | Ga0209025_1131642 | 3300025294 | Bacteria | 726 |
| 339 | Ga0209564_1000140 | 3300025295 | Bacteria | 179856 |
| 340 | Ga0209564_1000794 | 3300025295 | Bacteria | 43506 |
| 341 | Ga0209564_1000802 | 3300025295 | Bacteria | 43078 |
| 342 | Ga0209564_1000868 | 3300025295 | Bacteria | 40261 |
| 343 | Ga0209564_1001618 | 3300025295 | Bacteria | 21851 |
| 344 | Ga0209564_1005687 | 3300025295 | Bacteria | 6993 |
| 345 | Ga0209564_1014049 | 3300025295 | Bacteria | 3356 |
| 346 | Ga0209564_1041733 | 3300025295 | Bacteria | 1227 |
| 347 | Ga0209758_1000155 | 3300025297 | Bacteria | 160455 |
| 348 | Ga0209758_1000545 | 3300025297 | Bacteria | 59830 |
| 349 | Ga0209758_1000587 | 3300025297 | Bacteria | 56803 |
| 350 | Ga0209758_1001100 | 3300025297 | Bacteria | 34985 |
| 351 | Ga0209758_1002445 | 3300025297 | Bacteria | 18964 |
| 352 | Ga0209758_1007782 | 3300025297 | Bacteria | 7170 |
| 353 | Ga0209758_1019396 | 3300025297 | Bacteria | 3280 |
| 354 | Ga0209758_1026684 | 3300025297 | Bacteria | 2492 |
| 355 | Ga0209758_1100007 | 3300025297 | Bacteria | 827 |
| 356 | Ga0209050_1000650 | 3300025298 | Bacteria | 53753 |
| 357 | Ga0209050_1005095 | 3300025298 | Bacteria | 8471 |
| 358 | Ga0209050_1021205 | 3300025298 | Bacteria | 2378 |
| 359 | Ga0209256_1000557 | 3300025299 | Bacteria | 53444 |
| 360 | Ga0209256_1000687 | 3300025299 | Bacteria | 45327 |
| 361 | Ga0209256_1001048 | 3300025299 | Bacteria | 32169 |
| 362 | Ga0209256_1001371 | 3300025299 | Bacteria | 25602 |
| 363 | Ga0209256_1004147 | 3300025299 | Bacteria | 9357 |
| 364 | Ga0209256_1004371 | 3300025299 | Bacteria | 8941 |
| 365 | Ga0209256_1010809 | 3300025299 | Bacteria | 3756 |
| 366 | Ga0209256_1023871 | 3300025299 | Bacteria | 1814 |
| 367 | Ga0209256_1048199 | 3300025299 | Bacteria | 1044 |
| 368 | Ga0207426_1000003 | 3300025302 | Bacteria | 1063212 |
| 369 | Ga0207426_1000010 | 3300025302 | Bacteria | 796003 |
| 370 | Ga0207426_1000094 | 3300025302 | Bacteria | 275293 |
| 371 | Ga0207426_1000111 | 3300025302 | Bacteria | 234032 |
| 372 | Ga0207426_1001840 | 3300025302 | Bacteria | 15628 |
| 373 | Ga0209051_1000095 | 3300025303 | Bacteria | 167840 |
| 374 | Ga0209051_1001031 | 3300025303 | Bacteria | 26450 |
| 375 | Ga0209051_1001191 | 3300025303 | Bacteria | 23500 |
| 376 | Ga0209051_1003503 | 3300025303 | Bacteria | 10260 |
| 377 | Ga0209051_1007144 | 3300025303 | Bacteria | 6154 |
| 378 | Ga0209051_1008543 | 3300025303 | Bacteria | 5410 |
| 379 | Ga0209051_1017165 | 3300025303 | Bacteria | 3243 |
| 380 | Ga0209051_1072572 | 3300025303 | Bacteria | 1029 |
| 381 | Ga0209257_1001962 | 3300025304 | Bacteria | 22185 |
| 382 | Ga0209257_1003296 | 3300025304 | Bacteria | 14065 |
| 383 | Ga0209257_1010294 | 3300025304 | Bacteria | 4766 |
| 384 | Ga0209257_1060930 | 3300025304 | Bacteria | 1025 |
| 385 | Ga0207656_10064226 | 3300025321 | Bacteria | 1618 |
| 386 | Ga0207653_10001674 | 3300025885 | Bacteria | 7097 |
| 387 | Ga0207647_10072033 | 3300025904 | Bacteria | 2084 |
| 388 | Ga0207647_10402909 | 3300025904 | Bacteria | 771 |
| 389 | Ga0207685_10391020 | 3300025905 | Bacteria | 711 |
| 390 | Ga0207705_10743623 | 3300025909 | Bacteria | 762 |
| 391 | Ga0207654_10024617 | 3300025911 | Bacteria | 3238 |
| 392 | Ga0207654_10119520 | 3300025911 | Bacteria | 1652 |
| 393 | Ga0207654_10161375 | 3300025911 | Bacteria | 1448 |
| 394 | Ga0207654_10581839 | 3300025911 | Bacteria | 797 |
| 395 | Ga0207707_10027670 | 3300025912 | Bacteria | 4958 |
| 396 | Ga0207695_10000011 | 3300025913 | Bacteria | 910221 |
| 397 | Ga0207695_10116388 | 3300025913 | Bacteria | 2647 |
| 398 | Ga0207695_10416388 | 3300025913 | Bacteria | 1228 |
| 399 | Ga0207695_10881666 | 3300025913 | Bacteria | 774 |
| 400 | Ga0207671_10001291 | 3300025914 | Bacteria | 29425 |
| 401 | Ga0207671_10057729 | 3300025914 | Bacteria | 2877 |
| 402 | Ga0207671_10068428 | 3300025914 | Bacteria | 2646 |
| 403 | Ga0207660_10113774 | 3300025917 | Bacteria | 2040 |
| 404 | Ga0207662_10084295 | 3300025918 | Bacteria | 1944 |
| 405 | Ga0207657_10208952 | 3300025919 | Bacteria | 1567 |
| 406 | Ga0207652_10040467 | 3300025921 | Bacteria | 3958 |
| 407 | Ga0207681_11041881 | 3300025923 | Bacteria | 687 |
| 408 | Ga0207694_10018894 | 3300025924 | Bacteria | 5211 |
| 409 | Ga0207650_10002090 | 3300025925 | Bacteria | 13962 |
| 410 | Ga0207650_10101930 | 3300025925 | Bacteria | 2211 |
| 411 | Ga0207687_10068838 | 3300025927 | Bacteria | 2522 |
| 412 | Ga0207687_10449791 | 3300025927 | Bacteria | 1068 |
| 413 | Ga0207687_10734934 | 3300025927 | Bacteria | 839 |
| 414 | Ga0207644_10136348 | 3300025931 | Bacteria | 1885 |
| 415 | Ga0207690_10022460 | 3300025932 | Bacteria | 3926 |
| 416 | Ga0207706_10039545 | 3300025933 | Bacteria | 4182 |
| 417 | Ga0207706_10967608 | 3300025933 | Bacteria | 716 |
| 418 | Ga0207709_10114712 | 3300025935 | Bacteria | 1808 |
| 419 | Ga0207709_10323219 | 3300025935 | Bacteria | 1156 |
| 420 | Ga0207709_10324599 | 3300025935 | Bacteria | 1153 |
| 421 | Ga0207669_10229582 | 3300025937 | Bacteria | 1368 |
| 422 | Ga0207704_10877843 | 3300025938 | Bacteria | 753 |
| 423 | Ga0207665_10065871 | 3300025939 | Bacteria | 2464 |
| 424 | Ga0207667_10060300 | 3300025949 | Bacteria | 3971 |
| 425 | Ga0207667_10375499 | 3300025949 | Bacteria | 1449 |
| 426 | Ga0207667_10888412 | 3300025949 | Bacteria | 883 |
| 427 | Ga0207712_10003210 | 3300025961 | Bacteria | 10390 |
| 428 | Ga0207712_11567645 | 3300025961 | Bacteria | 590 |
| 429 | Ga0207668_10454674 | 3300025972 | Bacteria | 1094 |
| 430 | Ga0207668_10488791 | 3300025972 | Bacteria | 1057 |
| 431 | Ga0207668_12083217 | 3300025972 | Bacteria | 511 |
| 432 | Ga0207640_11271407 | 3300025981 | Unclassified | 656 |
| 433 | Ga0207658_10195410 | 3300025986 | Bacteria | 1685 |
| 434 | Ga0207658_10549102 | 3300025986 | Bacteria | 1034 |
| 435 | Ga0207703_10281150 | 3300026035 | Bacteria | 1511 |
| 436 | Ga0207639_10032104 | 3300026041 | Bacteria | 3863 |
| 437 | Ga0207639_10290502 | 3300026041 | Bacteria | 1441 |
| 438 | Ga0207678_10015487 | 3300026067 | Bacteria | 6703 |
| 439 | Ga0207678_11150419 | 3300026067 | Unclassified | 687 |
| 440 | Ga0207708_10002508 | 3300026075 | Bacteria | 13503 |
| 441 | Ga0207702_10055211 | 3300026078 | Bacteria | 3368 |
| 442 | Ga0207702_10076099 | 3300026078 | Bacteria | 2901 |
| 443 | Ga0207702_10222409 | 3300026078 | Bacteria | 1759 |
| 444 | Ga0207641_10307664 | 3300026088 | Bacteria | 1499 |
| 445 | Ga0207648_10166316 | 3300026089 | Bacteria | 1949 |
| 446 | Ga0207676_10078838 | 3300026095 | Bacteria | 2669 |
| 447 | Ga0207674_10071651 | 3300026116 | Bacteria | 3481 |
| 448 | Ga0207674_10154489 | 3300026116 | Bacteria | 2250 |
| 449 | Ga0207674_10244903 | 3300026116 | Bacteria | 1740 |
| 450 | Ga0207675_101058742 | 3300026118 | Bacteria | 830 |
| 451 | Ga0207683_10197424 | 3300026121 | Bacteria | 1828 |
| 452 | Ga0207698_10391441 | 3300026142 | Bacteria | 1325 |
| 453 | Ga0207698_10750481 | 3300026142 | Bacteria | 975 |
| 454 | Ga0209281_1000310 | 3300027111 | Bacteria | 87212 |
| 455 | Ga0209281_1000334 | 3300027111 | Bacteria | 81109 |
| 456 | Ga0209281_1000361 | 3300027111 | Bacteria | 74287 |
| 457 | Ga0209371_1000021 | 3300027312 | Bacteria | 555864 |
| 458 | Ga0209371_1000469 | 3300027312 | Bacteria | 39757 |
| 459 | Ga0209371_1001465 | 3300027312 | Bacteria | 15917 |
| 460 | Ga0209282_1000073 | 3300027666 | Bacteria | 81125 |
| 461 | Ga0209282_1000162 | 3300027666 | Bacteria | 38224 |
| 462 | Ga0209282_1182870 | 3300027666 | Bacteria | 981 |
| 463 | Ga0209588_1004150 | 3300027671 | Bacteria | 4064 |
| 464 | Ga0209588_1123431 | 3300027671 | Unclassified | 828 |
| 465 | Ga0209813_10117222 | 3300027866 | Bacteria | 923 |
| 466 | Ga0268266_10182102 | 3300028379 | Bacteria | 1913 |
| 467 | Ga0268266_10220018 | 3300028379 | Bacteria | 1745 |
| 468 | Ga0268266_10817448 | 3300028379 | Bacteria | 900 |
| 469 | Ga0268265_10014314 | 3300028380 | Bacteria | 5402 |
| 470 | Ga0268264_10003917 | 3300028381 | Bacteria | 12744 |
| 471 | Ga0268264_10773687 | 3300028381 | Bacteria | 958 |
| 472 | Ga0307515_10000844 | 3300028794 | Bacteria | 70375 |
| 473 | Ga0307515_10004389 | 3300028794 | Bacteria | 29220 |
| 474 | Ga0307515_10013773 | 3300028794 | Bacteria | 15073 |
| 475 | Ga0307515_10020621 | 3300028794 | Bacteria | 11742 |
| 476 | Ga0307515_10767339 | 3300028794 | Bacteria | 584 |
| 477 | Ga0268256_1000020 | 3300030500 | Bacteria | 557873 |
| 478 | Ga0268256_1001794 | 3300030500 | Bacteria | 12086 |
| 479 | Ga0268256_1003189 | 3300030500 | Bacteria | 7611 |
| 480 | Ga0307513_10002223 | 3300031456 | Bacteria | 27113 |
| 481 | Ga0307513_10134632 | 3300031456 | Bacteria | 2409 |
| 482 | Ga0307513_10674661 | 3300031456 | Bacteria | 740 |
| 483 | Ga0307408_100164938 | 3300031548 | Bacteria | 1763 |
| 484 | Ga0307408_100731680 | 3300031548 | Bacteria | 892 |
| 485 | Ga0307514_10300077 | 3300031649 | Bacteria | 901 |
| 486 | Ga0307413_10429669 | 3300031824 | Bacteria | 1043 |
| 487 | Ga0307410_10349349 | 3300031852 | Bacteria | 1181 |
| 488 | Ga0307406_10459222 | 3300031901 | Bacteria | 1024 |
| 489 | Ga0307412_10083096 | 3300031911 | Bacteria | 2219 |
| 490 | Ga0307412_10914255 | 3300031911 | Bacteria | 770 |
| 491 | Ga0307412_11859820 | 3300031911 | Bacteria | 555 |
| 492 | Ga0315914_1000008 | 3300031967 | Bacteria | 209133 |
| 493 | Ga0307409_100255774 | 3300031995 | Bacteria | 1604 |
| 494 | Ga0307416_100266271 | 3300032002 | Bacteria | 1679 |
| 495 | Ga0307416_100668926 | 3300032002 | Bacteria | 1125 |
| 496 | Ga0307414_10072609 | 3300032004 | Bacteria | 2486 |
| 497 | Ga0307411_10544797 | 3300032005 | Bacteria | 989 |
| 498 | Ga0316593_10129338 | 3300032168 | Bacteria | 910 |
| 499 | Ga0307510_10380280 | 3300033180 | Bacteria | 857 |
| 500 | Ga0315913_1000688 | 3300033430 | Bacteria | 32300 |
| 501 | Ga0315915_1000014 | 3300033464 | Bacteria | 171068 |
| 502 | Ga0373934_0000226 | 3300035086 | Bacteria | 20517 |
| 503 | Ga0373934_0004407 | 3300035086 | Bacteria | 5200 |
| 504 | Ga0373952_0071202 | 3300035092 | Bacteria | 870 |
| 505 | Ga0373923_0004582 | 3300035111 | Bacteria | 4600 |
| 506 | Ga0373923_0068921 | 3300035111 | Bacteria | 1516 |
| 507 | Ga0373923_0257184 | 3300035111 | Bacteria | 818 |
| 508 | Ga0373932_0296923 | 3300035112 | Bacteria | 602 |
| 509 | Ga0373936_0007633 | 3300035113 | Bacteria | 4064 |
| 510 | Ga0373939_0115591 | 3300035114 | Bacteria | 940 |
| 511 | Ga0373953_0002165 | 3300035117 | Bacteria | 5877 |
| 512 | Ga0373953_0086933 | 3300035117 | Bacteria | 1305 |
| 513 | Ga0373953_0201701 | 3300035117 | Bacteria | 860 |
| 514 | Ga0373954_0007204 | 3300035118 | Bacteria | 4858 |
| 515 | Ga0373954_0014860 | 3300035118 | Bacteria | 3474 |
| 516 | Ga0373956_0000177 | 3300035119 | Bacteria | 24286 |
| 517 | Ga0373956_0002563 | 3300035119 | Bacteria | 7384 |
| 518 | Ga0373957_0012200 | 3300035120 | Bacteria | 2887 |
| 519 | Ga0373943_0011672 | 3300035170 | Bacteria | 3955 |
| 520 | Ga0373946_0369115 | 3300035171 | Bacteria | 720 |
| 521 | Ga0373955_0161588 | 3300035172 | Unclassified | 1322 |
| 522 | Ga0373955_0182539 | 3300035172 | Bacteria | 1245 |
| 523 | Ga0373955_0951468 | 3300035172 | Unclassified | 529 |
| 524 | Ga0316574_0038897 | 3300035398 | Bacteria | 2922 |
| 525 | Ga0316574_0167518 | 3300035398 | Bacteria | 1415 |
| 526 | Ga0373924_0012475 | 3300035410 | Bacteria | 3175 |
| 527 | Ga0373935_0059231 | 3300035692 | Bacteria | 2447 |
| 528 | Ga0373927_0000055 | 3300035695 | Bacteria | 81098 |
| 529 | Ga0373933_0000312 | 3300035724 | Bacteria | 31477 |
| 530 | Ga0373933_0052360 | 3300035724 | Bacteria | 2442 |
| 531 | Ga0373933_0445669 | 3300035724 | Bacteria | 846 |
| 532 | Ga0373947_0318717 | 3300035725 | Bacteria | 1039 |
| 533 | Ga0373937_0000096 | 3300036401 | Bacteria | 81963 |
| 534 | Ga0373937_0155279 | 3300036401 | Bacteria | 2144 |
| 535 | Ga0373937_0482522 | 3300036401 | Bacteria | 1177 |
| 536 | Ga0316582_0060645 | 3300036647 | Bacteria | 2426 |
| 537 | Ga0316584_0016744 | 3300036712 | Bacteria | 5260 |
| 538 | Ga0373925_0002979 | 3300037068 | Bacteria | 13365 |
| 539 | Ga0373925_0054502 | 3300037068 | Bacteria | 2991 |
| 540 | Ga0395899_0000213 | 3300037312 | Bacteria | 83403 |
| 541 | Ga0395900_0000121 | 3300037418 | Bacteria | 135026 |
| 542 | Ga0395900_0022761 | 3300037418 | Bacteria | 6413 |
| 543 | Ga0395900_0246642 | 3300037418 | Bacteria | 1789 |
| 544 | Ga0395900_0560544 | 3300037418 | Bacteria | 1086 |
| 545 | Ga0395898_0000247 | 3300037466 | Bacteria | 135026 |
| 546 | Ga0395905_0000112 | 3300037471 | Bacteria | 135010 |
| 547 | Ga0395905_0000325 | 3300037471 | Bacteria | 68813 |
| 548 | Ga0395905_0013938 | 3300037471 | Bacteria | 7688 |
| 549 | Ga0395905_0018905 | 3300037471 | Bacteria | 6534 |
| 550 | Ga0395905_0105392 | 3300037471 | Bacteria | 2647 |
| 551 | Ga0395905_0341137 | 3300037471 | Bacteria | 1389 |
| 552 | Ga0395901_0000078 | 3300038443 | Bacteria | 135026 |
| 553 | Ga0395901_0068865 | 3300038443 | Bacteria | 3686 |
| 554 | Ga0395901_0108822 | 3300038443 | Bacteria | 2909 |
| 555 | Ga0395901_0659512 | 3300038443 | Bacteria | 1048 |
| 556 | Ga0439436_0063219 | 3300041404 | Bacteria | 1034 |
| 557 | Ga0439439_0032082 | 3300041406 | Bacteria | 1341 |
| 558 | Ga0439439_0047680 | 3300041406 | Bacteria | 1120 |
| 559 | Ga0439465_0014361 | 3300041413 | Bacteria | 2468 |
| 560 | Ga0439465_0016011 | 3300041413 | Bacteria | 2338 |
| 561 | Ga0439465_0019035 | 3300041413 | Bacteria | 2146 |
| 562 | Ga0439465_0074391 | 3300041413 | Bacteria | 1143 |
| 563 | Ga0439465_0143370 | 3300041413 | Bacteria | 850 |
| 564 | Ga0451791_1489124 | 3300041451 | Bacteria | 590 |
| 565 | Ga0451793_1791429 | 3300041452 | Bacteria | 1552 |
| 566 | Ga0451795_0456879 | 3300041456 | Bacteria | 756 |
| 567 | Ga0451804_0736472 | 3300041463 | Bacteria | 1023 |
| 568 | Ga0451833_0281263 | 3300041491 | Bacteria | 1433 |
| 569 | Ga0451835_0487550 | 3300041492 | Bacteria | 917 |
| 570 | Ga0451837_1680411 | 3300041494 | Bacteria | 647 |
| 571 | Ga0451840_11095 | 3300041497 | Bacteria | 756 |
| 572 | Ga0451841_1014141 | 3300041498 | Bacteria | 1841 |
| 573 | Ga0451845_0513581 | 3300041501 | Bacteria | 2368 |
| 574 | Ga0451846_68000 | 3300041502 | Bacteria | 565 |
| 575 | Ga0451847_0867267 | 3300041503 | Bacteria | 1815 |
| 576 | Ga0451849_1243659 | 3300041505 | Bacteria | 1587 |
| 577 | Ga0451851_0085356 | 3300041507 | Bacteria | 2421 |
| 578 | Ga0451851_0906446 | 3300041507 | Bacteria | 1180 |
| 579 | Ga0451843_0556366 | 3300041509 | Bacteria | 3307 |
| 580 | Ga0451855_0767112 | 3300041511 | Bacteria | 1369 |
| 581 | Ga0451855_1623492 | 3300041511 | Bacteria | 537 |
| 582 | Ga0451853_0114112 | 3300041512 | Bacteria | 3097 |
| 583 | Ga0451853_1600377 | 3300041512 | Bacteria | 1441 |
| 584 | Ga0439431_0084742 | 3300041997 | Bacteria | 858 |
| 585 | Ga0439437_031430 | 3300042000 | Bacteria | 668 |
| 586 | Ga0439432_035895 | 3300042006 | Bacteria | 1588 |
| 587 | Ga0439432_091543 | 3300042006 | Bacteria | 915 |
| 588 | Ga0439449_0024497 | 3300042007 | Bacteria | 2256 |
| 589 | Ga0439449_0030648 | 3300042007 | Bacteria | 2005 |
| 590 | Ga0439449_0113867 | 3300042007 | Bacteria | 1002 |
| 591 | Ga0439455_0113540 | 3300042012 | Bacteria | 755 |
| 592 | Ga0450920_061976 | 3300042122 | Bacteria | 756 |
| 593 | Ga0439458_0151510 | 3300042157 | Bacteria | 621 |
| 594 | Ga0439434_0136733 | 3300042435 | Bacteria | 806 |
| 595 | Ga0450918_083669 | 3300042531 | Bacteria | 611 |
| 596 | Ga0466972_0066750 | 3300044658 | Bacteria | 1720 |
| 597 | Ga0466965_0097468 | 3300044683 | Bacteria | 1501 |
| 598 | Ga0466966_0037410 | 3300044684 | Bacteria | 3130 |
| 599 | Ga0466963_0014097 | 3300044694 | Bacteria | 4925 |
| 600 | Ga0466968_0298045 | 3300044735 | Bacteria | 775 |
| 601 | Ga0466970_0005266 | 3300044765 | Bacteria | 6405 |
| 602 | Ga0466960_0196335 | 3300044901 | Bacteria | 1100 |
| 603 | Ga0466967_0358143 | 3300045976 | Bacteria | 1413 |
| 604 | Ga0466967_0536706 | 3300045976 | Bacteria | 1150 |
| 605 | Ga0495592_0000886 | 3300046454 | Bacteria | 20768 |
| 606 | Ga0495592_0111349 | 3300046454 | Bacteria | 1937 |
| 607 | Ga0495592_0152555 | 3300046454 | Bacteria | 1596 |
| 608 | Ga0495603_0783841 | 3300046455 | Unclassified | 544 |
| 609 | Ga0495590_0338167 | 3300046457 | Bacteria | 571 |
| 610 | Ga0495629_0037247 | 3300046459 | Bacteria | 3428 |
| 611 | Ga0495629_0091148 | 3300046459 | Bacteria | 2127 |
| 612 | Ga0495629_0108595 | 3300046459 | Bacteria | 1935 |
| 613 | Ga0495638_0011505 | 3300046460 | Bacteria | 6094 |
| 614 | Ga0495638_0112270 | 3300046460 | Bacteria | 1617 |
| 615 | Ga0495638_0134219 | 3300046460 | Bacteria | 1451 |
| 616 | Ga0495641_0007023 | 3300046461 | Bacteria | 7144 |
| 617 | Ga0495651_0001037 | 3300046462 | Bacteria | 21470 |
| 618 | Ga0495651_0012125 | 3300046462 | Bacteria | 6633 |
| 619 | Ga0495653_0006555 | 3300046463 | Bacteria | 9552 |
| 620 | Ga0495650_0170839 | 3300046471 | Bacteria | 770 |
| 621 | Ga0495639_0002333 | 3300046475 | Bacteria | 8294 |
| 622 | Ga0495662_0011759 | 3300046476 | Bacteria | 4278 |
| 623 | Ga0495662_0049854 | 3300046476 | Bacteria | 2021 |
| 624 | Ga0495664_0022744 | 3300046477 | Bacteria | 3636 |
| 625 | Ga0495585_0030296 | 3300046492 | Bacteria | 3078 |
| 626 | Ga0495585_0045607 | 3300046492 | Bacteria | 2446 |
| 627 | Ga0495607_0082802 | 3300046501 | Bacteria | 1759 |
| 628 | Ga0495583_0091176 | 3300046506 | Bacteria | 1312 |
| 629 | Ga0495610_0010608 | 3300046512 | Bacteria | 5711 |
| 630 | Ga0495610_0075657 | 3300046512 | Bacteria | 1558 |
| 631 | Ga0495616_0026034 | 3300046513 | Bacteria | 3118 |
| 632 | Ga0495616_0287975 | 3300046513 | Bacteria | 697 |
| 633 | Ga0495618_0010612 | 3300046514 | Bacteria | 5574 |
| 634 | Ga0495618_0202102 | 3300046514 | Bacteria | 1257 |
| 635 | Ga0495620_0031522 | 3300046515 | Bacteria | 2429 |
| 636 | Ga0495620_0062294 | 3300046515 | Bacteria | 1549 |
| 637 | Ga0495620_0066156 | 3300046515 | Bacteria | 1490 |
| 638 | Ga0495628_0060049 | 3300046516 | Bacteria | 2984 |
| 639 | Ga0495628_0200303 | 3300046516 | Bacteria | 1504 |
| 640 | Ga0495630_0001439 | 3300046517 | Bacteria | 16463 |
| 641 | Ga0495631_0082915 | 3300046518 | Bacteria | 1382 |
| 642 | Ga0495631_0183483 | 3300046518 | Bacteria | 896 |
| 643 | Ga0495632_0017000 | 3300046519 | Bacteria | 4029 |
| 644 | Ga0495632_0287786 | 3300046519 | Bacteria | 731 |
| 645 | Ga0495643_0001636 | 3300046522 | Bacteria | 19772 |
| 646 | Ga0495643_0027496 | 3300046522 | Bacteria | 3195 |
| 647 | Ga0495648_0076360 | 3300046524 | Bacteria | 1924 |
| 648 | Ga0495666_0017744 | 3300046526 | Bacteria | 3543 |
| 649 | Ga0495652_0149866 | 3300046529 | Bacteria | 1824 |
| 650 | Ga0495652_0151995 | 3300046529 | Bacteria | 1808 |
| 651 | Ga0495652_0652893 | 3300046529 | Bacteria | 712 |
| 652 | Ga0495654_0006825 | 3300046530 | Bacteria | 6442 |
| 653 | Ga0495654_0047409 | 3300046530 | Bacteria | 2112 |
| 654 | Ga0495654_0056366 | 3300046530 | Bacteria | 1900 |
| 655 | Ga0495640_0008228 | 3300046533 | Bacteria | 8184 |
| 656 | Ga0495586_0010436 | 3300046535 | Bacteria | 4936 |
| 657 | Ga0495587_0069446 | 3300046536 | Bacteria | 2051 |
| 658 | Ga0495587_0317009 | 3300046536 | Bacteria | 871 |
| 659 | Ga0495609_0025916 | 3300046538 | Bacteria | 2686 |
| 660 | Ga0495633_0058720 | 3300046558 | Bacteria | 1805 |
| 661 | Ga0495667_0086244 | 3300046559 | Bacteria | 2036 |
| 662 | Ga0495667_0114995 | 3300046559 | Bacteria | 1738 |
| 663 | Ga0495667_0154021 | 3300046559 | Bacteria | 1479 |
| 664 | Ga0495656_0166823 | 3300046615 | Bacteria | 1074 |
| 665 | Ga0495668_0038831 | 3300046616 | Bacteria | 2659 |
| 666 | Ga0495668_0101187 | 3300046616 | Bacteria | 1577 |
| 667 | Ga0495668_0121572 | 3300046616 | Bacteria | 1428 |
| 668 | Ga0495668_0133404 | 3300046616 | Bacteria | 1359 |
| 669 | Ga0495634_0026780 | 3300046642 | Bacteria | 4019 |
| 670 | Ga0495634_0133055 | 3300046642 | Bacteria | 1584 |
| 671 | Ga0495611_0009786 | 3300046648 | Bacteria | 4053 |
| 672 | Ga0495625_0022163 | 3300046660 | Bacteria | 4874 |
| 673 | Ga0495625_0044796 | 3300046660 | Bacteria | 3201 |
| 674 | Ga0495625_0056641 | 3300046660 | Bacteria | 2789 |
| 675 | Ga0495635_0086793 | 3300046663 | Bacteria | 2141 |
| 676 | Ga0495635_0161182 | 3300046663 | Bacteria | 1526 |
| 677 | Ga0495588_0048733 | 3300046674 | Bacteria | 2177 |
| 678 | Ga0495588_0370574 | 3300046674 | Bacteria | 752 |
| 679 | Ga0495657_0014287 | 3300046675 | Bacteria | 5832 |
| 680 | Ga0495657_0085419 | 3300046675 | Bacteria | 2034 |
| 681 | Ga0495657_0091190 | 3300046675 | Bacteria | 1955 |
| 682 | Ga0495599_0032502 | 3300046678 | Bacteria | 3275 |
| 683 | Ga0495658_0004331 | 3300046683 | Bacteria | 6991 |
| 684 | Ga0495624_0113855 | 3300046690 | Bacteria | 1663 |
| 685 | Ga0495624_0319834 | 3300046690 | Bacteria | 935 |
| 686 | Ga0495670_0031733 | 3300046691 | Bacteria | 2626 |
| 687 | Ga0495670_0363084 | 3300046691 | Bacteria | 780 |
| 688 | Ga0495671_0310575 | 3300046692 | Bacteria | 758 |
| 689 | Ga0495649_0122502 | 3300046694 | Bacteria | 1374 |
| 690 | Ga0495649_0226196 | 3300046694 | Bacteria | 967 |
| 691 | Ga0495600_0000925 | 3300046809 | Bacteria | 15753 |
| 692 | Ga0495600_0036061 | 3300046809 | Bacteria | 3213 |
| 693 | Ga0495660_0191214 | 3300046810 | Bacteria | 983 |
| 694 | Ga0495604_0021238 | 3300047317 | Bacteria | 5182 |
| 695 | Ga0495604_0024264 | 3300047317 | Bacteria | 4839 |
| 696 | Ga0495636_0044906 | 3300047318 | Bacteria | 1841 |
| 697 | Ga0495636_0080229 | 3300047318 | Bacteria | 1404 |
| 698 | Ga0495636_0160057 | 3300047318 | Bacteria | 1014 |
| 699 | Ga0495674_0005040 | 3300047319 | Bacteria | 12704 |
| 700 | Ga0495672_0021456 | 3300047320 | Bacteria | 4213 |
| 701 | Ga0495676_0917551 | 3300047321 | Bacteria | 561 |
| 702 | Ga0495680_0012165 | 3300047322 | Bacteria | 7593 |
| 703 | Ga0495680_0232488 | 3300047322 | Bacteria | 1312 |
| 704 | Ga0495680_0468693 | 3300047322 | Bacteria | 859 |
| 705 | Ga0495683_0398430 | 3300047323 | Bacteria | 573 |
| 706 | Ga0495687_066877 | 3300047443 | Bacteria | 1457 |
| 707 | Ga0495687_227815 | 3300047443 | Bacteria | 571 |
| 708 | Ga0495675_0003423 | 3300047444 | Bacteria | 9556 |
| 709 | Ga0495675_0033960 | 3300047444 | Bacteria | 3257 |
| 710 | Ga0495675_0175941 | 3300047444 | Bacteria | 1312 |
| 711 | Ga0495675_0580147 | 3300047444 | Bacteria | 637 |
| 712 | Ga0495685_062052 | 3300047447 | Bacteria | 1259 |
| 713 | Ga0495684_0062577 | 3300047471 | Bacteria | 2830 |
| 714 | Ga0495684_0107115 | 3300047471 | Bacteria | 2111 |
| 715 | Ga0495684_1010807 | 3300047471 | Bacteria | 528 |
| 716 | Ga0495686_0004865 | 3300047472 | Bacteria | 10832 |
| 717 | Ga0495686_0119407 | 3300047472 | Bacteria | 1573 |
| 718 | Ga0495686_0157036 | 3300047472 | Bacteria | 1332 |
| 719 | Ga0495686_0180354 | 3300047472 | Bacteria | 1224 |
| 720 | Ga0495686_0221559 | 3300047472 | Bacteria | 1076 |
| 721 | Ga0495686_0245842 | 3300047472 | Bacteria | 1007 |
| 722 | Ga0495686_0345242 | 3300047472 | Bacteria | 810 |
| 723 | Ga0495593_0529683 | 3300047673 | Bacteria | 591 |
| 724 | Ga0495614_0035261 | 3300048089 | Bacteria | 2150 |
| 725 | Ga0495615_0115979 | 3300048090 | Bacteria | 770 |
| 726 | Ga0495626_0162717 | 3300048091 | Bacteria | 935 |
| 727 | Ga0495626_0198657 | 3300048091 | Bacteria | 823 |
| 728 | Ga0496100_0012838 | 3300048903 | Bacteria | 4815 |
| 729 | Ga0496101_0208502 | 3300048904 | Bacteria | 1513 |
| 730 | Ga0496102_0008570 | 3300048905 | Bacteria | 8769 |
| 731 | Ga0496102_0014003 | 3300048905 | Bacteria | 6964 |
| 732 | Ga0496102_0177393 | 3300048905 | Bacteria | 2007 |
| 733 | Ga0496102_0296643 | 3300048905 | Bacteria | 1524 |
| 734 | Ga0496102_0766906 | 3300048905 | Bacteria | 887 |
| 735 | Ga0496103_0010686 | 3300048906 | Bacteria | 5431 |
| 736 | Ga0496103_0017556 | 3300048906 | Bacteria | 4283 |
| 737 | Ga0496104_0066142 | 3300048907 | Bacteria | 3432 |
| 738 | Ga0496105_0182249 | 3300048908 | Bacteria | 1719 |
| 739 | Ga0496105_0208925 | 3300048908 | Bacteria | 1592 |
| 740 | Ga0496106_0001217 | 3300048909 | Bacteria | 19264 |
| 741 | Ga0496106_0004921 | 3300048909 | Bacteria | 9886 |
| 742 | Ga0496106_0452007 | 3300048909 | Bacteria | 1032 |
| 743 | Ga0496108_0114926 | 3300048911 | Bacteria | 2305 |
| 744 | Ga0496108_0371611 | 3300048911 | Bacteria | 1248 |
| 745 | Ga0496109_0132401 | 3300048912 | Bacteria | 2328 |
| 746 | Ga0496109_0301457 | 3300048912 | Bacteria | 1511 |
| 747 | Ga0496109_1146305 | 3300048912 | Bacteria | 714 |
| 748 | Ga0496110_0180740 | 3300048913 | Bacteria | 1915 |
| 749 | Ga0496110_0802990 | 3300048913 | Bacteria | 845 |
| 750 | Ga0496110_1133930 | 3300048913 | Bacteria | 690 |
| 751 | Ga0496113_0312317 | 3300048916 | Bacteria | 1259 |
| 752 | Ga0496113_0377285 | 3300048916 | Bacteria | 1138 |
| 753 | Ga0496113_0570148 | 3300048916 | Bacteria | 907 |
| 754 | Ga0496114_0236430 | 3300048917 | Bacteria | 1606 |
| 755 | Ga0496114_0584059 | 3300048917 | Bacteria | 986 |
| 756 | Ga0496115_0023828 | 3300048918 | Bacteria | 4753 |
| 757 | Ga0496115_0237130 | 3300048918 | Bacteria | 1504 |
| 758 | Ga0496115_0653995 | 3300048918 | Bacteria | 830 |
| 759 | Ga0496116_0000043 | 3300048919 | Bacteria | 328085 |
| 760 | Ga0496116_0008089 | 3300048919 | Bacteria | 9192 |
| 761 | Ga0496116_0043036 | 3300048919 | Bacteria | 3080 |
| 762 | Ga0496116_0103446 | 3300048919 | Bacteria | 1694 |
| 763 | Ga0496117_0000338 | 3300048920 | Bacteria | 82688 |
| 764 | Ga0496117_0089281 | 3300048920 | Bacteria | 1991 |
| 765 | Ga0496117_0109558 | 3300048920 | Bacteria | 1724 |
| 766 | Ga0496117_0109935 | 3300048920 | Bacteria | 1720 |
| 767 | Ga0496118_0000958 | 3300048921 | Bacteria | 45054 |
| 768 | Ga0496118_0019045 | 3300048921 | Bacteria | 6152 |
| 769 | Ga0496118_0225279 | 3300048921 | Bacteria | 1087 |
| 770 | Ga0496118_0428829 | 3300048921 | Bacteria | 678 |
| 771 | Ga0496118_0497471 | 3300048921 | Bacteria | 607 |
| 772 | Ga0496118_0566227 | 3300048921 | Bacteria | 551 |
| 773 | Ga0496119_0004440 | 3300048922 | Bacteria | 13967 |
| 774 | Ga0496119_0111222 | 3300048922 | Bacteria | 1520 |
| 775 | Ga0496119_0163672 | 3300048922 | Bacteria | 1180 |
| 776 | Ga0496119_0193562 | 3300048922 | Bacteria | 1058 |
| 777 | Ga0496119_0243093 | 3300048922 | Bacteria | 911 |
| 778 | Ga0496120_0000589 | 3300048923 | Bacteria | 55133 |
| 779 | Ga0496120_0001472 | 3300048923 | Bacteria | 28063 |
| 780 | Ga0496120_0069230 | 3300048923 | Bacteria | 1944 |
| 781 | Ga0496120_0187793 | 3300048923 | Bacteria | 1010 |
| 782 | Ga0496121_0002723 | 3300048924 | Bacteria | 26365 |
| 783 | Ga0496121_0009248 | 3300048924 | Bacteria | 11379 |
| 784 | Ga0496121_0009941 | 3300048924 | Bacteria | 10830 |
| 785 | Ga0496121_0027323 | 3300048924 | Bacteria | 5341 |
| 786 | Ga0496121_0038973 | 3300048924 | Bacteria | 4197 |
| 787 | Ga0496121_0074244 | 3300048924 | Bacteria | 2721 |
| 788 | Ga0496121_0082726 | 3300048924 | Bacteria | 2536 |
| 789 | Ga0496121_0088329 | 3300048924 | Bacteria | 2430 |
| 790 | Ga0496121_0206430 | 3300048924 | Bacteria | 1395 |
| 791 | Ga0496121_0229266 | 3300048924 | Bacteria | 1302 |
| 792 | Ga0496121_0879236 | 3300048924 | Bacteria | 518 |
| 793 | Ga0496122_0000025 | 3300048925 | Bacteria | 362915 |
| 794 | Ga0496122_0016499 | 3300048925 | Bacteria | 6981 |
| 795 | Ga0496122_0018139 | 3300048925 | Bacteria | 6519 |
| 796 | Ga0496122_0055102 | 3300048925 | Bacteria | 2978 |
| 797 | Ga0496122_0062877 | 3300048925 | Bacteria | 2714 |
| 798 | Ga0496122_0093482 | 3300048925 | Bacteria | 2039 |
| 799 | Ga0496122_0246008 | 3300048925 | Bacteria | 1004 |
| 800 | Ga0496123_0000032 | 3300048926 | Bacteria | 285282 |
| 801 | Ga0496123_0000043 | 3300048926 | Bacteria | 253752 |
| 802 | Ga0496123_0012797 | 3300048926 | Bacteria | 7114 |
| 803 | Ga0496123_0016748 | 3300048926 | Bacteria | 5931 |
| 804 | Ga0496123_0064778 | 3300048926 | Bacteria | 2327 |
| 805 | Ga0496123_0079012 | 3300048926 | Bacteria | 2012 |
| 806 | Ga0496123_0263882 | 3300048926 | Bacteria | 842 |
| 807 | Ga0496123_0422272 | 3300048926 | Bacteria | 601 |
| 808 | Ga0496124_0017870 | 3300048927 | Bacteria | 6667 |
| 809 | Ga0496124_0023770 | 3300048927 | Bacteria | 5586 |
| 810 | Ga0496124_0025733 | 3300048927 | Bacteria | 5322 |
| 811 | Ga0496124_0061282 | 3300048927 | Bacteria | 3153 |
| 812 | Ga0496124_0274378 | 3300048927 | Bacteria | 1233 |
| 813 | Ga0496124_0298730 | 3300048927 | Bacteria | 1164 |
| 814 | Ga0496125_0000946 | 3300048928 | Bacteria | 45578 |
| 815 | Ga0496125_0025175 | 3300048928 | Bacteria | 5456 |
| 816 | Ga0496125_0027520 | 3300048928 | Bacteria | 5152 |
| 817 | Ga0496125_0066860 | 3300048928 | Bacteria | 2837 |
| 818 | Ga0496125_0141564 | 3300048928 | Bacteria | 1671 |
| 819 | Ga0496125_0169920 | 3300048928 | Bacteria | 1467 |
| 820 | Ga0496125_0283632 | 3300048928 | Bacteria | 1024 |
| 821 | Ga0496125_0310552 | 3300048928 | Bacteria | 961 |
| 822 | Ga0496126_0000362 | 3300048929 | Bacteria | 94734 |
| 823 | Ga0496126_0034554 | 3300048929 | Bacteria | 4747 |
| 824 | Ga0496126_0047224 | 3300048929 | Bacteria | 3943 |
| 825 | Ga0496126_0244916 | 3300048929 | Bacteria | 1496 |
| 826 | Ga0496126_0266039 | 3300048929 | Bacteria | 1424 |
| 827 | Ga0496126_0267396 | 3300048929 | Bacteria | 1420 |
| 828 | Ga0496126_0340153 | 3300048929 | Bacteria | 1229 |
| 829 | Ga0496126_0445237 | 3300048929 | Bacteria | 1043 |
| 830 | Ga0496126_0756347 | 3300048929 | Bacteria | 750 |
| 831 | Ga0501031_0000095 | 3300049568 | Bacteria | 47538 |
| 832 | Ga0501031_0418336 | 3300049568 | Bacteria | 866 |
| 833 | Ga0501032_0000064 | 3300049569 | Bacteria | 91971 |
| 834 | Ga0501032_0000084 | 3300049569 | Bacteria | 82148 |
| 835 | Ga0501032_0002338 | 3300049569 | Bacteria | 14870 |
| 836 | Ga0501032_0048602 | 3300049569 | Bacteria | 2864 |
| 837 | Ga0501032_1008883 | 3300049569 | Bacteria | 523 |
| 838 | Ga0501033_0000102 | 3300049570 | Bacteria | 81583 |
| 839 | Ga0501033_0000286 | 3300049570 | Bacteria | 48628 |
| 840 | Ga0501033_0007597 | 3300049570 | Bacteria | 8429 |
| 841 | Ga0501033_0020657 | 3300049570 | Bacteria | 4975 |
| 842 | Ga0501033_0029534 | 3300049570 | Bacteria | 4119 |
| 843 | Ga0501033_0050740 | 3300049570 | Bacteria | 3076 |
| 844 | Ga0501033_0083256 | 3300049570 | Bacteria | 2345 |
| 845 | Ga0501033_0528873 | 3300049570 | Bacteria | 814 |
| 846 | Ga0501033_0904293 | 3300049570 | Bacteria | 593 |
| 847 | Ga0501034_0000174 | 3300049571 | Bacteria | 119615 |
| 848 | Ga0501034_0001404 | 3300049571 | Bacteria | 32372 |
| 849 | Ga0501034_0002078 | 3300049571 | Bacteria | 24998 |
| 850 | Ga0501034_0090803 | 3300049571 | Bacteria | 3051 |
| 851 | Ga0501034_0125398 | 3300049571 | Bacteria | 2553 |
| 852 | Ga0501034_0202154 | 3300049571 | Bacteria | 1944 |
| 853 | Ga0501034_0240027 | 3300049571 | Bacteria | 1759 |
| 854 | Ga0501034_0339786 | 3300049571 | Bacteria | 1431 |
| 855 | Ga0501034_0655917 | 3300049571 | Bacteria | 951 |
| 856 | Ga0501034_0831896 | 3300049571 | Bacteria | 814 |
| 857 | Ga0501036_0000040 | 3300049572 | Bacteria | 81588 |
| 858 | Ga0501036_0011420 | 3300049572 | Bacteria | 7352 |
| 859 | Ga0501036_0064582 | 3300049572 | Bacteria | 3098 |
| 860 | Ga0501036_0122760 | 3300049572 | Bacteria | 2193 |
| 861 | Ga0501036_0160163 | 3300049572 | Bacteria | 1897 |
| 862 | Ga0501037_0000098 | 3300049573 | Bacteria | 81588 |
| 863 | Ga0501037_0009152 | 3300049573 | Bacteria | 7255 |
| 864 | Ga0501037_0095169 | 3300049573 | Bacteria | 2153 |
| 865 | Ga0501037_0127415 | 3300049573 | Bacteria | 1827 |
| 866 | Ga0501037_0403344 | 3300049573 | Bacteria | 937 |
| 867 | Ga0501037_0456452 | 3300049573 | Bacteria | 871 |
| 868 | Ga0501038_0000002 | 3300049574 | Bacteria | 330446 |
| 869 | Ga0501038_0000031 | 3300049574 | Bacteria | 132231 |
| 870 | Ga0501038_0022666 | 3300049574 | Bacteria | 5622 |
| 871 | Ga0501038_0031557 | 3300049574 | Bacteria | 4682 |
| 872 | Ga0501038_0117560 | 3300049574 | Bacteria | 2196 |
| 873 | Ga0501038_0272214 | 3300049574 | Bacteria | 1335 |
| 874 | Ga0501038_1112264 | 3300049574 | Bacteria | 576 |
| 875 | Ga0501039_0000002 | 3300049575 | Bacteria | 375152 |
| 876 | Ga0501039_0000057 | 3300049575 | Bacteria | 89756 |
| 877 | Ga0501039_0227793 | 3300049575 | Bacteria | 1465 |
| 878 | Ga0501039_0639444 | 3300049575 | Bacteria | 833 |
| 879 | Ga0501040_0043172 | 3300049576 | Bacteria | 3072 |
| 880 | Ga0501040_0117786 | 3300049576 | Bacteria | 1862 |
| 881 | Ga0501040_0450861 | 3300049576 | Bacteria | 926 |
| 882 | Ga0501040_0673642 | 3300049576 | Bacteria | 748 |
| 883 | Ga0501041_0160634 | 3300049577 | Bacteria | 1405 |
| 884 | Ga0501042_0137759 | 3300049578 | Bacteria | 1759 |
| 885 | Ga0501043_0000048 | 3300049579 | Bacteria | 109146 |
| 886 | Ga0501043_0000104 | 3300049579 | Bacteria | 78808 |
| 887 | Ga0501043_0006479 | 3300049579 | Bacteria | 9399 |
| 888 | Ga0501043_0074629 | 3300049579 | Bacteria | 2664 |
| 889 | Ga0501043_0128235 | 3300049579 | Bacteria | 1989 |
| 890 | Ga0501043_0130374 | 3300049579 | Bacteria | 1970 |
| 891 | Ga0501043_0230438 | 3300049579 | Bacteria | 1431 |
| 892 | Ga0501043_0674507 | 3300049579 | Bacteria | 757 |
| 893 | Ga0501046_0000023 | 3300049580 | Bacteria | 213965 |
| 894 | Ga0501046_0059772 | 3300049580 | Bacteria | 2984 |
| 895 | Ga0501046_0175337 | 3300049580 | Bacteria | 1606 |
| 896 | Ga0501046_0193784 | 3300049580 | Bacteria | 1515 |
| 897 | Ga0501046_0200778 | 3300049580 | Bacteria | 1484 |
| 898 | Ga0501047_0002237 | 3300049581 | Bacteria | 18521 |
| 899 | Ga0501047_0027746 | 3300049581 | Bacteria | 5455 |
| 900 | Ga0501047_0036169 | 3300049581 | Bacteria | 4771 |
| 901 | Ga0501047_0140440 | 3300049581 | Bacteria | 2294 |
| 902 | Ga0501047_0187248 | 3300049581 | Bacteria | 1934 |
| 903 | Ga0501047_0292240 | 3300049581 | Bacteria | 1473 |
| 904 | Ga0501047_0716479 | 3300049581 | Bacteria | 818 |
| 905 | Ga0501048_0022955 | 3300049582 | Bacteria | 4560 |
| 906 | Ga0501048_0038065 | 3300049582 | Bacteria | 3453 |
| 907 | Ga0501048_1215189 | 3300049582 | Bacteria | 542 |
| 908 | Ga0501067_0042887 | 3300049583 | Bacteria | 2513 |
| 909 | Ga0501067_0271062 | 3300049583 | Bacteria | 945 |
| 910 | Ga0501068_0182523 | 3300049584 | Bacteria | 1327 |
| 911 | Ga0501068_0316121 | 3300049584 | Bacteria | 1001 |
| 912 | Ga0501068_0319333 | 3300049584 | Bacteria | 995 |
| 913 | Ga0501068_0365952 | 3300049584 | Bacteria | 927 |
| 914 | Ga0501069_0000018 | 3300049585 | Bacteria | 133550 |
| 915 | Ga0501069_0015350 | 3300049585 | Bacteria | 4104 |
| 916 | Ga0501069_0159953 | 3300049585 | Bacteria | 1297 |
| 917 | Ga0501069_0551510 | 3300049585 | Bacteria | 690 |
| 918 | Ga0501070_0000048 | 3300049586 | Bacteria | 105951 |
| 919 | Ga0501070_0000420 | 3300049586 | Bacteria | 38500 |
| 920 | Ga0501070_0002333 | 3300049586 | Bacteria | 16663 |
| 921 | Ga0501070_0041003 | 3300049586 | Bacteria | 3857 |
| 922 | Ga0501070_0053889 | 3300049586 | Bacteria | 3335 |
| 923 | Ga0501070_0086815 | 3300049586 | Bacteria | 2590 |
| 924 | Ga0501070_0113114 | 3300049586 | Bacteria | 2243 |
| 925 | Ga0501070_0271796 | 3300049586 | Bacteria | 1384 |
| 926 | Ga0501070_0297951 | 3300049586 | Bacteria | 1314 |
| 927 | Ga0501070_0338762 | 3300049586 | Bacteria | 1222 |
| 928 | Ga0501071_0017994 | 3300049587 | Bacteria | 4886 |
| 929 | Ga0501071_0094533 | 3300049587 | Bacteria | 2199 |
| 930 | Ga0501071_0150442 | 3300049587 | Bacteria | 1736 |
| 931 | Ga0501072_0069505 | 3300049588 | Bacteria | 2781 |
| 932 | Ga0501073_0006660 | 3300049589 | Bacteria | 8605 |
| 933 | Ga0501073_0072808 | 3300049589 | Bacteria | 2393 |
| 934 | Ga0501073_0127897 | 3300049589 | Bacteria | 1761 |
| 935 | Ga0501073_0161074 | 3300049589 | Bacteria | 1554 |
| 936 | Ga0501074_0000001 | 3300049590 | Bacteria | 123588 |
| 937 | Ga0501074_0054142 | 3300049590 | Bacteria | 2894 |
| 938 | Ga0501074_0059274 | 3300049590 | Bacteria | 2758 |
| 939 | Ga0501074_0079423 | 3300049590 | Bacteria | 2354 |
| 940 | Ga0501074_0266406 | 3300049590 | Bacteria | 1218 |
| 941 | Ga0501074_0452599 | 3300049590 | Bacteria | 910 |
| 942 | Ga0501074_0678614 | 3300049590 | Bacteria | 727 |
| 943 | Ga0501075_0181324 | 3300049591 | Bacteria | 1606 |
| 944 | Ga0501076_0786847 | 3300049592 | Bacteria | 785 |
| 945 | Ga0501076_1727592 | 3300049592 | Bacteria | 513 |
| 946 | Ga0501079_0807143 | 3300049741 | Bacteria | 739 |
| 947 | Ga0501079_1276381 | 3300049741 | Bacteria | 578 |
| 948 | Ga0501080_0000197 | 3300049742 | Bacteria | 44169 |
| 949 | Ga0501080_0000413 | 3300049742 | Bacteria | 32813 |
| 950 | Ga0501080_0015859 | 3300049742 | Bacteria | 6951 |
| 951 | Ga0501080_0133094 | 3300049742 | Bacteria | 2302 |
| 952 | Ga0501080_0243232 | 3300049742 | Bacteria | 1642 |
| 953 | Ga0501080_0245976 | 3300049742 | Bacteria | 1631 |
| 954 | Ga0501081_0912448 | 3300049743 | Bacteria | 663 |
| 955 | Ga0501083_0005530 | 3300049744 | Bacteria | 8955 |
| 956 | Ga0501083_0008060 | 3300049744 | Bacteria | 7452 |
| 957 | Ga0501083_0502426 | 3300049744 | Bacteria | 789 |
| 958 | Ga0501083_0659780 | 3300049744 | Bacteria | 680 |
| 959 | Ga0501083_0820992 | 3300049744 | Bacteria | 605 |
| 960 | Ga0501280_012617 | 3300049776 | Bacteria | 1188 |
| 961 | Ga0501035_0000048 | 3300049822 | Bacteria | 146466 |
| 962 | Ga0501035_0000163 | 3300049822 | Bacteria | 81898 |
| 963 | Ga0501035_0001343 | 3300049822 | Bacteria | 25356 |
| 964 | Ga0501035_0004746 | 3300049822 | Bacteria | 12904 |
| 965 | Ga0501035_0007944 | 3300049822 | Bacteria | 9902 |
| 966 | Ga0501035_0063455 | 3300049822 | Bacteria | 3286 |
| 967 | Ga0501035_0094218 | 3300049822 | Bacteria | 2633 |
| 968 | Ga0501035_0130236 | 3300049822 | Bacteria | 2194 |
| 969 | Ga0501035_0273987 | 3300049822 | Bacteria | 1428 |
| 970 | Ga0501035_0307036 | 3300049822 | Bacteria | 1335 |
| 971 | Ga0501035_0336768 | 3300049822 | Bacteria | 1265 |
| 972 | Ga0501035_0632845 | 3300049822 | Bacteria | 869 |
| 973 | Ga0501044_0000002 | 3300049823 | Bacteria | 375152 |
| 974 | Ga0501044_0000003 | 3300049823 | Bacteria | 345647 |
| 975 | Ga0501044_0002384 | 3300049823 | Bacteria | 21412 |
| 976 | Ga0501044_0010560 | 3300049823 | Bacteria | 10015 |
| 977 | Ga0501044_0020100 | 3300049823 | Bacteria | 7129 |
| 978 | Ga0501044_0021489 | 3300049823 | Bacteria | 6882 |
| 979 | Ga0501044_0049943 | 3300049823 | Bacteria | 4318 |
| 980 | Ga0501044_0057802 | 3300049823 | Bacteria | 3979 |
| 981 | Ga0501044_0187627 | 3300049823 | Bacteria | 2031 |
| 982 | Ga0501044_0219738 | 3300049823 | Bacteria | 1851 |
| 983 | Ga0501044_0239744 | 3300049823 | Bacteria | 1757 |
| 984 | Ga0501044_0550038 | 3300049823 | Bacteria | 1051 |
| 985 | Ga0501044_0590090 | 3300049823 | Bacteria | 1005 |
| 986 | Ga0501045_0154648 | 3300049824 | Bacteria | 1706 |
| 987 | Ga0501045_0688966 | 3300049824 | Bacteria | 754 |
| 988 | nmdc:mga03683_86913_c1 | 3300050489 | Bacteria | 1358 |
| 989 | nmdc:mga03n38_3751_c1 | 3300050490 | Bacteria | 4924 |
| 990 | nmdc:mga03n38_65686_c1 | 3300050490 | Bacteria | 1664 |
| 991 | nmdc:mga03n38_90093_c1 | 3300050490 | Bacteria | 1458 |
| 992 | nmdc:mga00v17_111801_c1 | 3300050491 | Bacteria | 1733 |
| 993 | nmdc:mga00v17_29610_c1 | 3300050491 | Bacteria | 3214 |
| 994 | nmdc:mga00v17_498650_c1 | 3300050491 | Bacteria | 789 |
| 995 | nmdc:mga0yw44_13733_c1 | 3300050492 | Bacteria | 4275 |
| 996 | nmdc:mga0yw44_17832_c1 | 3300050492 | Bacteria | 3873 |
| 997 | nmdc:mga0yw44_2486_c2 | 3300050492 | Bacteria | 7320 |
| 998 | nmdc:mga0yw44_3537_c1 | 3300050492 | Bacteria | 5906 |
| 999 | nmdc:mga0yw44_354317_c1 | 3300050492 | Bacteria | 988 |
| 1000 | nmdc:mga0yw44_44196_c1 | 3300050492 | Bacteria | 2664 |
| 1001 | nmdc:mga0yw44_47949_c1 | 3300050492 | Bacteria | 2574 |
| 1002 | nmdc:mga0yw44_94644_c1 | 3300050492 | Bacteria | 1894 |
| 1003 | nmdc:mga0k408_126867_c1 | 3300050493 | Bacteria | 1514 |
| 1004 | nmdc:mga0k408_127554_c1 | 3300050493 | Bacteria | 1509 |
| 1005 | nmdc:mga0k408_544382_c1 | 3300050493 | Bacteria | 686 |
| 1006 | nmdc:mga06z11_18343_c1 | 3300050494 | Bacteria | 3195 |
| 1007 | nmdc:mga06z11_255289_c1 | 3300050494 | Bacteria | 1033 |
| 1008 | nmdc:mga06z11_320891_c1 | 3300050494 | Bacteria | 924 |
| 1009 | nmdc:mga06z11_41928_c1 | 3300050494 | Bacteria | 2293 |
| 1010 | nmdc:mga06z11_72589_c1 | 3300050494 | Bacteria | 1825 |
| 1011 | nmdc:mga04h51_362632_c1 | 3300050495 | Bacteria | 601 |
| 1012 | nmdc:mga07m45_10513_c1 | 3300050496 | Bacteria | 4836 |
| 1013 | nmdc:mga07m45_200148_c1 | 3300050496 | Bacteria | 1162 |
| 1014 | nmdc:mga07m45_213173_c1 | 3300050496 | Bacteria | 633 |
| 1015 | nmdc:mga07m45_28645_c1 | 3300050496 | Bacteria | 3074 |
| 1016 | nmdc:mga0qj67_716_c1 | 3300050509 | Bacteria | 22579 |
| 1017 | nmdc:mga06r32_538_c1 | 3300050510 | Bacteria | 32874 |
| 1018 | nmdc:mga08y16_1475345_c1 | 3300050511 | Bacteria | 641 |
| 1019 | nmdc:mga0rr50_53176_c1 | 3300050513 | Bacteria | 3012 |
| 1020 | nmdc:mga08x19_14_c1 | 3300050514 | Bacteria | 365567 |
| 1021 | nmdc:mga0a205_655192_c1 | 3300050515 | Bacteria | 901 |
| 1022 | nmdc:mga0sz30_15908_c1 | 3300050516 | Bacteria | 2978 |
| 1023 | nmdc:mga0sz30_173779_c1 | 3300050516 | Bacteria | 955 |
| 1024 | nmdc:mga0sz30_55470_c1 | 3300050516 | Bacteria | 1686 |
| 1025 | nmdc:mga0sz30_7864_c1 | 3300050516 | Bacteria | 4012 |
| 1026 | nmdc:mga0sz30_85576_c1 | 3300050516 | Bacteria | 1368 |
| 1027 | Ga0495601_0011073 | 3300053077 | Bacteria | 5388 |
| 1028 | Ga0495601_0148381 | 3300053077 | Bacteria | 1531 |
| 1029 | Ga0500610_0019111 | 3300053079 | Bacteria | 3325 |
| 1030 | Ga0500610_0045559 | 3300053079 | Bacteria | 2276 |
| 1031 | Ga0495655_0098817 | 3300053083 | Bacteria | 861 |
| 1032 | Ga0495595_0026834 | 3300053084 | Bacteria | 2561 |
| 1033 | Ga0495619_0009507 | 3300053085 | Bacteria | 6133 |
| 1034 | Ga0495619_0262729 | 3300053085 | Bacteria | 1196 |
| 1035 | Ga0500578_0108162 | 3300053086 | Bacteria | 1754 |
| 1036 | Ga0500644_0195949 | 3300053088 | Bacteria | 833 |
| 1037 | Ga0500651_0208329 | 3300053093 | Bacteria | 1151 |
| 1038 | Ga0500562_045885 | 3300053108 | Bacteria | 1165 |
| 1039 | Ga0500594_0101165 | 3300053118 | Bacteria | 887 |
| 1040 | Ga0500595_079905 | 3300053119 | Bacteria | 959 |
| 1041 | Ga0500608_002494 | 3300053122 | Bacteria | 6706 |
| 1042 | Ga0500618_001230 | 3300053125 | Bacteria | 11999 |
| 1043 | Ga0500618_001417 | 3300053125 | Bacteria | 10714 |
| 1044 | Ga0500618_005279 | 3300053125 | Bacteria | 3959 |
| 1045 | Ga0500658_0001009 | 3300053134 | Bacteria | 11474 |
| 1046 | Ga0500658_0015794 | 3300053134 | Bacteria | 2808 |
| 1047 | Ga0500658_0357987 | 3300053134 | Bacteria | 669 |
| 1048 | Ga0500559_0012609 | 3300053136 | Bacteria | 3589 |
| 1049 | Ga0500559_0031862 | 3300053136 | Bacteria | 2262 |
| 1050 | Ga0500568_0000175 | 3300053139 | Bacteria | 56086 |
| 1051 | Ga0500568_0005268 | 3300053139 | Bacteria | 6725 |
| 1052 | Ga0500568_0016433 | 3300053139 | Bacteria | 3291 |
| 1053 | Ga0500577_0068985 | 3300053142 | Bacteria | 1382 |
| 1054 | Ga0500604_0021875 | 3300053151 | Bacteria | 1811 |
| 1055 | Ga0500616_0000417 | 3300053153 | Bacteria | 57047 |
| 1056 | Ga0500616_0011795 | 3300053153 | Bacteria | 5142 |
| 1057 | Ga0500616_0043680 | 3300053153 | Bacteria | 2394 |
| 1058 | Ga0500616_0165368 | 3300053153 | Bacteria | 1010 |
| 1059 | Ga0500616_0217736 | 3300053153 | Bacteria | 835 |
| 1060 | Ga0500620_000455 | 3300053155 | Bacteria | 7365 |
| 1061 | Ga0500622_0000168 | 3300053156 | Bacteria | 70303 |
| 1062 | Ga0500622_0002307 | 3300053156 | Bacteria | 13947 |
| 1063 | Ga0500627_0231349 | 3300053158 | Bacteria | 822 |
| 1064 | Ga0500633_0001613 | 3300053160 | Bacteria | 4343 |
| 1065 | Ga0500633_0148991 | 3300053160 | Bacteria | 877 |
| 1066 | Ga0500636_0027374 | 3300053177 | Bacteria | 3368 |
| 1067 | Ga0500636_0326033 | 3300053177 | Bacteria | 744 |
| 1068 | Ga0501084_0193881 | 3300054114 | Bacteria | 1714 |
| 1069 | Ga0501084_1159304 | 3300054114 | Bacteria | 648 |
| 1070 | Ga0587090_026434 | 3300059510 | Bacteria | 944 |
| 1071 | Ga0587092_088796 | 3300059512 | Bacteria | 621 |
| 1072 | Ga0501082_0385991 | 3300060353 | Bacteria | 1222 |
| 1073 | Ga0501082_0424074 | 3300060353 | Bacteria | 1162 |
| 1074 | Ga0501082_0473178 | 3300060353 | Bacteria | 1095 |
| 1075 | Ga0501082_0925755 | 3300060353 | Bacteria | 762 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300047323 | Ga0495683_0398430 | Ga0495683_0398430_139_549 | 103 |
| 2 | 3300046454 | Ga0495592_0111349 | Ga0495592_0111349_1516_1914 | 107 |
| 3 | 3300046674 | Ga0495588_0048733 | Ga0495588_0048733_1567_1965 | 107 |
| 4 | 3300049575 | Ga0501039_0639444 | Ga0501039_0639444_392_820 | 108 |
| 5 | 3300007265 | Ga0099794_10068986 | Ga0099794_100689862 | 110 |
| 6 | 3300027671 | Ga0209588_1123431 | Ga0209588_11234312 | 110 |
| 7 | 3300032168 | Ga0316593_10129338 | Ga0316593_101293382 | 110 |
| 8 | 3300035111 | Ga0373923_0068921 | Ga0373923_0068921_1109_1498 | 110 |
| 9 | 3300035172 | Ga0373955_0161588 | Ga0373955_0161588_22_411 | 110 |
| 10 | 3300035172 | Ga0373955_0951468 | Ga0373955_0951468_120_509 | 110 |
| 11 | iso_pu_bacteria | 2869264136 | 2869268067 | 112 |
| 12 | iso_pu_bacteria | 2869271264 | 2869272290 | 112 |
| 13 | iso_pu_bacteria | 2871435913 | 2871443336 | 112 |
| 14 | iso_pu_bacteria | 2871459585 | 2871463096 | 112 |
| 15 | iso_pu_bacteria | 2874131515 | 2874138158 | 112 |
| 16 | iso_pu_bacteria | 2874162495 | 2874167887 | 112 |
| 17 | iso_pu_bacteria | 2876406927 | 2876411169 | 112 |
| 18 | iso_pu_bacteria | 2878774303 | 2878780088 | 112 |
| 19 | iso_pu_bacteria | 2906363423 | 2906367053 | 112 |
| 20 | iso_pu_bacteria | 2906370794 | 2906375307 | 112 |
| 21 | iso_pu_bacteria | 2906386501 | 2906390081 | 112 |
| 22 | iso_pu_bacteria | 2906393657 | 2906399185 | 112 |
| 23 | iso_pu_bacteria | 2906408224 | 2906414376 | 112 |
| 24 | iso_pu_bacteria | 2924748358 | 2924749311 | 112 |
| 25 | 3300050511 | nmdc:mga08y16_1475345_c1 | nmdc:mga08y16_1475345_c1_29_454 | 115 |
| 26 | 3300009101 | Ga0105247_11150484 | Ga0105247_111504842 | 116 |
| 27 | 3300041511 | Ga0451855_1623492 | Ga0451855_1623492_36_449 | 116 |
| 28 | 3300042157 | Ga0439458_0151510 | Ga0439458_0151510_177_587 | 116 |
| 29 | 3300048921 | Ga0496118_0497471 | Ga0496118_0497471_10_408 | 116 |
| 30 | 3300048929 | Ga0496126_0445237 | Ga0496126_0445237_21_431 | 116 |
| 31 | 3300049583 | Ga0501067_0271062 | Ga0501067_0271062_22_420 | 116 |
| 32 | 3300053125 | Ga0500618_001230 | Ga0500618_001230_2275_2679 | 116 |
| 33 | 3300026118 | Ga0207675_101058742 | Ga0207675_1010587422 | 118 |
| 34 | iso_pu_bacteria | 2979742915 | 2979747198 | 118 |
| 35 | iso_pu_bacteria | 2965032056 | 2965036369 | 120 |
| 36 | 3300049576 | Ga0501040_0450861 | Ga0501040_0450861_439_900 | 122 |
| 37 | 3300049591 | Ga0501075_0181324 | Ga0501075_0181324_1133_1594 | 122 |
| 38 | iso_pu_bacteria | 2965102966 | 2965104648 | 122 |
| 39 | 3300046459 | Ga0495629_0037247 | Ga0495629_0037247_1241_1687 | 123 |
| 40 | 3300046476 | Ga0495662_0049854 | Ga0495662_0049854_245_691 | 123 |
| 41 | 3300046642 | Ga0495634_0133055 | Ga0495634_0133055_873_1319 | 123 |
| 42 | 3300046663 | Ga0495635_0086793 | Ga0495635_0086793_793_1239 | 123 |
| 43 | 3300046675 | Ga0495657_0091190 | Ga0495657_0091190_45_491 | 123 |
| 44 | 3300046690 | Ga0495624_0113855 | Ga0495624_0113855_144_590 | 123 |
| 45 | 3300046809 | Ga0495600_0036061 | Ga0495600_0036061_640_1086 | 123 |
| 46 | 3300047317 | Ga0495604_0024264 | Ga0495604_0024264_3481_3927 | 123 |
| 47 | 3300053077 | Ga0495601_0148381 | Ga0495601_0148381_998_1444 | 123 |
| 48 | 3300053085 | Ga0495619_0262729 | Ga0495619_0262729_479_925 | 123 |
| 49 | 3300053177 | Ga0500636_0326033 | Ga0500636_0326033_261_707 | 123 |
| 50 | 3300049571 | Ga0501034_0125398 | Ga0501034_0125398_495_971 | 124 |
| 51 | 3300005439 | Ga0070711_100859884 | Ga0070711_1008598842 | 126 |
| 52 | 3300006163 | Ga0070715_10383836 | Ga0070715_103838362 | 126 |
| 53 | 3300006852 | Ga0075433_10445911 | Ga0075433_104459112 | 126 |
| 54 | 3300007265 | Ga0099794_10384984 | Ga0099794_103849842 | 126 |
| 55 | 3300007788 | Ga0099795_10321821 | Ga0099795_103218212 | 126 |
| 56 | 3300010159 | Ga0099796_10020084 | Ga0099796_100200843 | 126 |
| 57 | 3300025905 | Ga0207685_10391020 | Ga0207685_103910202 | 126 |
| 58 | 3300025939 | Ga0207665_10065871 | Ga0207665_100658713 | 126 |
| 59 | 3300027671 | Ga0209588_1004150 | Ga0209588_10041504 | 126 |
| 60 | 3300035086 | Ga0373934_0000226 | Ga0373934_0000226_5975_6412 | 126 |
| 61 | 3300035086 | Ga0373934_0004407 | Ga0373934_0004407_703_1140 | 126 |
| 62 | 3300035111 | Ga0373923_0004582 | Ga0373923_0004582_1542_1979 | 126 |
| 63 | 3300035111 | Ga0373923_0257184 | Ga0373923_0257184_330_767 | 126 |
| 64 | 3300035113 | Ga0373936_0007633 | Ga0373936_0007633_2049_2486 | 126 |
| 65 | 3300035117 | Ga0373953_0002165 | Ga0373953_0002165_2982_3419 | 126 |
| 66 | 3300035117 | Ga0373953_0086933 | Ga0373953_0086933_798_1235 | 126 |
| 67 | 3300035117 | Ga0373953_0201701 | Ga0373953_0201701_47_484 | 126 |
| 68 | 3300035118 | Ga0373954_0007204 | Ga0373954_0007204_3265_3702 | 126 |
| 69 | 3300035118 | Ga0373954_0014860 | Ga0373954_0014860_169_606 | 126 |
| 70 | 3300035119 | Ga0373956_0000177 | Ga0373956_0000177_7069_7506 | 126 |
| 71 | 3300035119 | Ga0373956_0002563 | Ga0373956_0002563_912_1349 | 126 |
| 72 | 3300035120 | Ga0373957_0012200 | Ga0373957_0012200_748_1185 | 126 |
| 73 | 3300035170 | Ga0373943_0011672 | Ga0373943_0011672_282_719 | 126 |
| 74 | 3300035171 | Ga0373946_0369115 | Ga0373946_0369115_94_531 | 126 |
| 75 | 3300035172 | Ga0373955_0182539 | Ga0373955_0182539_570_1007 | 126 |
| 76 | 3300035398 | Ga0316574_0038897 | Ga0316574_0038897_669_1112 | 126 |
| 77 | 3300035398 | Ga0316574_0167518 | Ga0316574_0167518_585_1028 | 126 |
| 78 | 3300035410 | Ga0373924_0012475 | Ga0373924_0012475_714_1151 | 126 |
| 79 | 3300035692 | Ga0373935_0059231 | Ga0373935_0059231_1483_1920 | 126 |
| 80 | 3300035724 | Ga0373933_0000312 | Ga0373933_0000312_22798_23235 | 126 |
| 81 | 3300035724 | Ga0373933_0052360 | Ga0373933_0052360_1548_1985 | 126 |
| 82 | 3300035724 | Ga0373933_0445669 | Ga0373933_0445669_356_793 | 126 |
| 83 | 3300035725 | Ga0373947_0318717 | Ga0373947_0318717_10_447 | 126 |
| 84 | 3300036401 | Ga0373937_0000096 | Ga0373937_0000096_49919_50356 | 126 |
| 85 | 3300036401 | Ga0373937_0155279 | Ga0373937_0155279_1548_1985 | 126 |
| 86 | 3300036401 | Ga0373937_0482522 | Ga0373937_0482522_701_1138 | 126 |
| 87 | 3300036647 | Ga0316582_0060645 | Ga0316582_0060645_1008_1445 | 126 |
| 88 | 3300036712 | Ga0316584_0016744 | Ga0316584_0016744_4239_4676 | 126 |
| 89 | 3300037068 | Ga0373925_0054502 | Ga0373925_0054502_1643_2080 | 126 |
| 90 | 3300042000 | Ga0439437_031430 | Ga0439437_031430_149_586 | 126 |
| 91 | 3300046454 | Ga0495592_0000886 | Ga0495592_0000886_11227_11664 | 126 |
| 92 | 3300046454 | Ga0495592_0152555 | Ga0495592_0152555_192_629 | 126 |
| 93 | 3300046455 | Ga0495603_0783841 | Ga0495603_0783841_96_533 | 126 |
| 94 | 3300046459 | Ga0495629_0108595 | Ga0495629_0108595_745_1182 | 126 |
| 95 | 3300046461 | Ga0495641_0007023 | Ga0495641_0007023_4173_4610 | 126 |
| 96 | 3300046462 | Ga0495651_0001037 | Ga0495651_0001037_5761_6198 | 126 |
| 97 | 3300046462 | Ga0495651_0012125 | Ga0495651_0012125_169_606 | 126 |
| 98 | 3300046463 | Ga0495653_0006555 | Ga0495653_0006555_4079_4516 | 126 |
| 99 | 3300046475 | Ga0495639_0002333 | Ga0495639_0002333_7202_7639 | 126 |
| 100 | 3300046476 | Ga0495662_0011759 | Ga0495662_0011759_3202_3639 | 126 |
| 101 | 3300046477 | Ga0495664_0022744 | Ga0495664_0022744_1130_1567 | 126 |
| 102 | 3300046514 | Ga0495618_0010612 | Ga0495618_0010612_101_538 | 126 |
| 103 | 3300046514 | Ga0495618_0202102 | Ga0495618_0202102_164_601 | 126 |
| 104 | 3300046516 | Ga0495628_0060049 | Ga0495628_0060049_1162_1599 | 126 |
| 105 | 3300046516 | Ga0495628_0200303 | Ga0495628_0200303_958_1395 | 126 |
| 106 | 3300046517 | Ga0495630_0001439 | Ga0495630_0001439_2986_3423 | 126 |
| 107 | 3300046526 | Ga0495666_0017744 | Ga0495666_0017744_1092_1529 | 126 |
| 108 | 3300046529 | Ga0495652_0149866 | Ga0495652_0149866_79_516 | 126 |
| 109 | 3300046529 | Ga0495652_0652893 | Ga0495652_0652893_113_550 | 126 |
| 110 | 3300046533 | Ga0495640_0008228 | Ga0495640_0008228_4351_4788 | 126 |
| 111 | 3300046535 | Ga0495586_0010436 | Ga0495586_0010436_703_1140 | 126 |
| 112 | 3300046536 | Ga0495587_0069446 | Ga0495587_0069446_765_1202 | 126 |
| 113 | 3300046536 | Ga0495587_0317009 | Ga0495587_0317009_72_509 | 126 |
| 114 | 3300046559 | Ga0495667_0086244 | Ga0495667_0086244_508_945 | 126 |
| 115 | 3300046559 | Ga0495667_0114995 | Ga0495667_0114995_691_1128 | 126 |
| 116 | 3300046559 | Ga0495667_0154021 | Ga0495667_0154021_908_1345 | 126 |
| 117 | 3300046642 | Ga0495634_0026780 | Ga0495634_0026780_586_1023 | 126 |
| 118 | 3300046663 | Ga0495635_0161182 | Ga0495635_0161182_240_677 | 126 |
| 119 | 3300046675 | Ga0495657_0014287 | Ga0495657_0014287_1999_2436 | 126 |
| 120 | 3300046675 | Ga0495657_0085419 | Ga0495657_0085419_1518_1955 | 126 |
| 121 | 3300046678 | Ga0495599_0032502 | Ga0495599_0032502_1019_1456 | 126 |
| 122 | 3300046683 | Ga0495658_0004331 | Ga0495658_0004331_909_1346 | 126 |
| 123 | 3300046690 | Ga0495624_0319834 | Ga0495624_0319834_351_788 | 126 |
| 124 | 3300046809 | Ga0495600_0000925 | Ga0495600_0000925_11094_11531 | 126 |
| 125 | 3300047317 | Ga0495604_0021238 | Ga0495604_0021238_2223_2660 | 126 |
| 126 | 3300047318 | Ga0495636_0080229 | Ga0495636_0080229_252_689 | 126 |
| 127 | 3300047319 | Ga0495674_0005040 | Ga0495674_0005040_6822_7259 | 126 |
| 128 | 3300047322 | Ga0495680_0012165 | Ga0495680_0012165_4078_4515 | 126 |
| 129 | 3300047322 | Ga0495680_0232488 | Ga0495680_0232488_755_1192 | 126 |
| 130 | 3300047322 | Ga0495680_0468693 | Ga0495680_0468693_144_581 | 126 |
| 131 | 3300047444 | Ga0495675_0003423 | Ga0495675_0003423_8464_8901 | 126 |
| 132 | 3300047444 | Ga0495675_0175941 | Ga0495675_0175941_432_869 | 126 |
| 133 | 3300047444 | Ga0495675_0580147 | Ga0495675_0580147_165_602 | 126 |
| 134 | 3300047471 | Ga0495684_0062577 | Ga0495684_0062577_458_895 | 126 |
| 135 | 3300047471 | Ga0495684_0107115 | Ga0495684_0107115_502_939 | 126 |
| 136 | 3300047673 | Ga0495593_0529683 | Ga0495593_0529683_101_538 | 126 |
| 137 | 3300048089 | Ga0495614_0035261 | Ga0495614_0035261_1604_2041 | 126 |
| 138 | 3300050515 | nmdc:mga0a205_655192_c1 | nmdc:mga0a205_655192_c1_230_667 | 126 |
| 139 | 3300053077 | Ga0495601_0011073 | Ga0495601_0011073_1049_1486 | 126 |
| 140 | 3300053084 | Ga0495595_0026834 | Ga0495595_0026834_110_547 | 126 |
| 141 | 3300053085 | Ga0495619_0009507 | Ga0495619_0009507_2711_3148 | 126 |
| 142 | iso_pu_bacteria | 2837678835 | 2837679460 | 126 |
| 143 | iso_pu_bacteria | 2837678835 | 2837682938 | 126 |
| 144 | iso_pu_bacteria | 2891048133 | 2891051563 | 126 |
| 145 | 3300049580 | Ga0501046_0000023 | Ga0501046_0000023_113138_113593 | 127 |
| 146 | iso_pu_bacteria | 2510917022 | 2511133710 | 127 |
| 147 | iso_pu_bacteria | 2582581307 | 2585270600 | 127 |
| 148 | iso_pu_bacteria | 2585427531 | 2585558305 | 127 |
| 149 | iso_pu_bacteria | 2585427608 | 2585897697 | 127 |
| 150 | iso_pu_bacteria | 2585427609 | 2585904707 | 127 |
| 151 | iso_pu_bacteria | 2585427634 | 2586000229 | 127 |
| 152 | iso_pu_bacteria | 2585428125 | 2587980177 | 127 |
| 153 | iso_pu_bacteria | 2757320392 | 2757572399 | 127 |
| 154 | iso_pu_bacteria | 2837651117 | 2837653798 | 127 |
| 155 | iso_pu_bacteria | 2915650412 | 2915651813 | 127 |
| 156 | iso_pu_bacteria | 2939669807 | 2939670879 | 127 |
| 157 | iso_pu_bacteria | 8055431914 | 8055435049 | 127 |
| 158 | iso_pu_bacteria | 2503198000 | 2503202584 | 128 |
| 159 | iso_pu_bacteria | 2508501122 | 2509107870 | 128 |
| 160 | iso_pu_bacteria | 2508501123 | 2509114391 | 128 |
| 161 | iso_pu_bacteria | 2508501127 | 2509143520 | 128 |
| 162 | iso_pu_bacteria | 2509276018 | 2509373171 | 128 |
| 163 | iso_pu_bacteria | 2509276019 | 2509376267 | 128 |
| 164 | iso_pu_bacteria | 2509276021 | 2509387057 | 128 |
| 165 | iso_pu_bacteria | 2509276022 | 2509397098 | 128 |
| 166 | iso_pu_bacteria | 2509276033 | 2509442553 | 128 |
| 167 | iso_pu_bacteria | 2510065019 | 2510132906 | 128 |
| 168 | iso_pu_bacteria | 2510065057 | 2510307044 | 128 |
| 169 | iso_pu_bacteria | 2510065059 | 2510317133 | 128 |
| 170 | iso_pu_bacteria | 2510461076 | 2510894278 | 128 |
| 171 | iso_pu_bacteria | 2510461076 | 2510899303 | 128 |
| 172 | iso_pu_bacteria | 2510917028 | 2511182766 | 128 |
| 173 | iso_pu_bacteria | 2510917030 | 2511198270 | 128 |
| 174 | iso_pu_bacteria | 2511231052 | 2511501363 | 128 |
| 175 | iso_pu_bacteria | 2512047086 | 2512532782 | 128 |
| 176 | iso_pu_bacteria | 2512875016 | 2512930639 | 128 |
| 177 | iso_pu_bacteria | 2512875024 | 2512958386 | 128 |
| 178 | iso_pu_bacteria | 2512875026 | 2512971886 | 128 |
| 179 | iso_pu_bacteria | 2513237084 | 2513570007 | 128 |
| 180 | iso_pu_bacteria | 2513237085 | 2513575262 | 128 |
| 181 | iso_pu_bacteria | 2513237086 | 2513587774 | 128 |
| 182 | iso_pu_bacteria | 2513237088 | 2513598987 | 128 |
| 183 | iso_pu_bacteria | 2513237089 | 2513606288 | 128 |
| 184 | iso_pu_bacteria | 2513237090 | 2513614324 | 128 |
| 185 | iso_pu_bacteria | 2513237091 | 2513617806 | 128 |
| 186 | iso_pu_bacteria | 2513237093 | 2513633050 | 128 |
| 187 | iso_pu_bacteria | 2513237103 | 2513710229 | 128 |
| 188 | iso_pu_bacteria | 2513237140 | 2513886243 | 128 |
| 189 | iso_pu_bacteria | 2513237143 | 2513906298 | 128 |
| 190 | iso_pu_bacteria | 2513237144 | 2513909791 | 128 |
| 191 | iso_pu_bacteria | 2513237156 | 2513987427 | 128 |
| 192 | iso_pu_bacteria | 2513237160 | 2514005437 | 128 |
| 193 | iso_pu_bacteria | 2513237162 | 2514019901 | 128 |
| 194 | iso_pu_bacteria | 2513237164 | 2514038351 | 128 |
| 195 | iso_pu_bacteria | 2513237305 | 2514419076 | 128 |
| 196 | iso_pu_bacteria | 2513237351 | 2514590244 | 128 |
| 197 | iso_pu_bacteria | 2515075009 | 2515111858 | 128 |
| 198 | iso_pu_bacteria | 2515154113 | 2515633643 | 128 |
| 199 | iso_pu_bacteria | 2515154114 | 2515642186 | 128 |
| 200 | iso_pu_bacteria | 2515154116 | 2515656241 | 128 |
| 201 | iso_pu_bacteria | 2515154134 | 2515738960 | 128 |
| 202 | iso_pu_bacteria | 2516143018 | 2516209237 | 128 |
| 203 | iso_pu_bacteria | 2516653046 | 2516892641 | 128 |
| 204 | iso_pu_bacteria | 2516653077 | 2517035576 | 128 |
| 205 | iso_pu_bacteria | 2516653085 | 2517076035 | 128 |
| 206 | iso_pu_bacteria | 2517093000 | 2517094775 | 128 |
| 207 | iso_pu_bacteria | 2517287029 | 2517406402 | 128 |
| 208 | iso_pu_bacteria | 2517487022 | 2517569456 | 128 |
| 209 | iso_pu_bacteria | 2519899620 | 2520376179 | 128 |
| 210 | iso_pu_bacteria | 2523231067 | 2523470292 | 128 |
| 211 | iso_pu_bacteria | 2524023207 | 2524452869 | 128 |
| 212 | iso_pu_bacteria | 2524023209 | 2524460391 | 128 |
| 213 | iso_pu_bacteria | 2529292951 | 2530645158 | 128 |
| 214 | iso_pu_bacteria | 2534681796 | 2535516175 | 128 |
| 215 | iso_pu_bacteria | 2537561587 | 2537874647 | 128 |
| 216 | iso_pu_bacteria | 2551306084 | 2551682275 | 128 |
| 217 | iso_pu_bacteria | 2551306085 | 2551684598 | 128 |
| 218 | iso_pu_bacteria | 2551306086 | 2551693596 | 128 |
| 219 | iso_pu_bacteria | 2551306087 | 2551703236 | 128 |
| 220 | iso_pu_bacteria | 2551306089 | 2551708978 | 128 |
| 221 | iso_pu_bacteria | 2551306090 | 2551719091 | 128 |
| 222 | iso_pu_bacteria | 2551306091 | 2551728214 | 128 |
| 223 | iso_pu_bacteria | 2551306092 | 2551734100 | 128 |
| 224 | iso_pu_bacteria | 2551306093 | 2551740120 | 128 |
| 225 | iso_pu_bacteria | 2558860100 | 2558863135 | 128 |
| 226 | iso_pu_bacteria | 2582581283 | 2585168289 | 128 |
| 227 | iso_pu_bacteria | 2582581294 | 2585199895 | 128 |
| 228 | iso_pu_bacteria | 2582581298 | 2585225878 | 128 |
| 229 | iso_pu_bacteria | 2582581299 | 2585230118 | 128 |
| 230 | iso_pu_bacteria | 2582581304 | 2585254382 | 128 |
| 231 | iso_pu_bacteria | 2582581306 | 2585268916 | 128 |
| 232 | iso_pu_bacteria | 2582581308 | 2585276947 | 128 |
| 233 | iso_pu_bacteria | 2582581315 | 2585324053 | 128 |
| 234 | iso_pu_bacteria | 2582581316 | 2585333554 | 128 |
| 235 | iso_pu_bacteria | 2582581865 | 2585389441 | 128 |
| 236 | iso_pu_bacteria | 2582581866 | 2585393948 | 128 |
| 237 | iso_pu_bacteria | 2582581867 | 2585400733 | 128 |
| 238 | iso_pu_bacteria | 2585427526 | 2585528177 | 128 |
| 239 | iso_pu_bacteria | 2585427527 | 2585534747 | 128 |
| 240 | iso_pu_bacteria | 2585427528 | 2585540385 | 128 |
| 241 | iso_pu_bacteria | 2585427529 | 2585546838 | 128 |
| 242 | iso_pu_bacteria | 2585427530 | 2585551808 | 128 |
| 243 | iso_pu_bacteria | 2585427590 | 2585819707 | 128 |
| 244 | iso_pu_bacteria | 2585427593 | 2585838584 | 128 |
| 245 | iso_pu_bacteria | 2588253730 | 2588516289 | 128 |
| 246 | iso_pu_bacteria | 2597489875 | 2597813753 | 128 |
| 247 | iso_pu_bacteria | 2599185156 | 2599333427 | 128 |
| 248 | iso_pu_bacteria | 2599185210 | 2599602214 | 128 |
| 249 | iso_pu_bacteria | 2599185236 | 2599721199 | 128 |
| 250 | iso_pu_bacteria | 2599185301 | 2599939609 | 128 |
| 251 | iso_pu_bacteria | 2599185352 | 2600192318 | 128 |
| 252 | iso_pu_bacteria | 2600254933 | 2600374446 | 128 |
| 253 | iso_pu_bacteria | 2600255279 | 2601608343 | 128 |
| 254 | iso_pu_bacteria | 2600255308 | 2601745117 | 128 |
| 255 | iso_pu_bacteria | 2615840624 | 2616292793 | 128 |
| 256 | iso_pu_bacteria | 2615840626 | 2616308320 | 128 |
| 257 | iso_pu_bacteria | 2615840698 | 2616556620 | 128 |
| 258 | iso_pu_bacteria | 2617270742 | 2617381670 | 128 |
| 259 | iso_pu_bacteria | 2643221551 | 2643775649 | 128 |
| 260 | iso_pu_bacteria | 2643221555 | 2643794096 | 128 |
| 261 | iso_pu_bacteria | 2643221557 | 2643808399 | 128 |
| 262 | iso_pu_bacteria | 2643221564 | 2643837880 | 128 |
| 263 | iso_pu_bacteria | 2643221568 | 2643855522 | 128 |
| 264 | iso_pu_bacteria | 2643221595 | 2643987147 | 128 |
| 265 | iso_pu_bacteria | 2643221599 | 2644005865 | 128 |
| 266 | iso_pu_bacteria | 2643221607 | 2644049573 | 128 |
| 267 | iso_pu_bacteria | 2643221610 | 2644066507 | 128 |
| 268 | iso_pu_bacteria | 2643221623 | 2644132121 | 128 |
| 269 | iso_pu_bacteria | 2643221626 | 2644145223 | 128 |
| 270 | iso_pu_bacteria | 2643221627 | 2644155698 | 128 |
| 271 | iso_pu_bacteria | 2643221634 | 2644193089 | 128 |
| 272 | iso_pu_bacteria | 2643221636 | 2644204019 | 128 |
| 273 | iso_pu_bacteria | 2643221637 | 2644207616 | 128 |
| 274 | iso_pu_bacteria | 2643221653 | 2644300407 | 128 |
| 275 | iso_pu_bacteria | 2643221655 | 2644307804 | 128 |
| 276 | iso_pu_bacteria | 2643221659 | 2644332580 | 128 |
| 277 | iso_pu_bacteria | 2643221668 | 2644378096 | 128 |
| 278 | iso_pu_bacteria | 2643221675 | 2644415280 | 128 |
| 279 | iso_pu_bacteria | 2643221680 | 2644450319 | 128 |
| 280 | iso_pu_bacteria | 2643221686 | 2644482607 | 128 |
| 281 | iso_pu_bacteria | 2643221688 | 2644494724 | 128 |
| 282 | iso_pu_bacteria | 2643221698 | 2644544326 | 128 |
| 283 | iso_pu_bacteria | 2643221712 | 2644613893 | 128 |
| 284 | iso_pu_bacteria | 2643221718 | 2644654577 | 128 |
| 285 | iso_pu_bacteria | 2643221719 | 2644658631 | 128 |
| 286 | iso_pu_bacteria | 2643221723 | 2644677894 | 128 |
| 287 | iso_pu_bacteria | 2643221726 | 2644687871 | 128 |
| 288 | iso_pu_bacteria | 2657244999 | 2657683713 | 128 |
| 289 | iso_pu_bacteria | 2667528174 | 2671115716 | 128 |
| 290 | iso_pu_bacteria | 2687453392 | 2688599134 | 128 |
| 291 | iso_pu_bacteria | 2690316117 | 2692316441 | 128 |
| 292 | iso_pu_bacteria | 2693429783 | 2694631980 | 128 |
| 293 | iso_pu_bacteria | 2693429784 | 2694634599 | 128 |
| 294 | iso_pu_bacteria | 2718217882 | 2719180796 | 128 |
| 295 | iso_pu_bacteria | 2718217927 | 2719385435 | 128 |
| 296 | iso_pu_bacteria | 2718217997 | 2719665262 | 128 |
| 297 | iso_pu_bacteria | 2718218009 | 2719731545 | 128 |
| 298 | iso_pu_bacteria | 2718218199 | 2720491682 | 128 |
| 299 | iso_pu_bacteria | 2718218232 | 2720612936 | 128 |
| 300 | iso_pu_bacteria | 2718218233 | 2720619795 | 128 |
| 301 | iso_pu_bacteria | 2718218235 | 2720631226 | 128 |
| 302 | iso_pu_bacteria | 2718218269 | 2720774953 | 128 |
| 303 | iso_pu_bacteria | 2718218363 | 2721146890 | 128 |
| 304 | iso_pu_bacteria | 2718218365 | 2721158417 | 128 |
| 305 | iso_pu_bacteria | 2718218366 | 2721163769 | 128 |
| 306 | iso_pu_bacteria | 2718218423 | 2721399184 | 128 |
| 307 | iso_pu_bacteria | 2721755514 | 2722839939 | 128 |
| 308 | iso_pu_bacteria | 2721755556 | 2723026590 | 128 |
| 309 | iso_pu_bacteria | 2721755684 | 2723560194 | 128 |
| 310 | iso_pu_bacteria | 2721755685 | 2723566773 | 128 |
| 311 | iso_pu_bacteria | 2721755686 | 2723576139 | 128 |
| 312 | iso_pu_bacteria | 2721755809 | 2724037997 | 128 |
| 313 | iso_pu_bacteria | 2721755810 | 2724044301 | 128 |
| 314 | iso_pu_bacteria | 2721755819 | 2724089560 | 128 |
| 315 | iso_pu_bacteria | 2721755822 | 2724104038 | 128 |
| 316 | iso_pu_bacteria | 2721755823 | 2724109854 | 128 |
| 317 | iso_pu_bacteria | 2724679232 | 2725952350 | 128 |
| 318 | iso_pu_bacteria | 2728369352 | 2730107526 | 128 |
| 319 | iso_pu_bacteria | 2728369365 | 2730164033 | 128 |
| 320 | iso_pu_bacteria | 2728369397 | 2730298049 | 128 |
| 321 | iso_pu_bacteria | 2738541317 | 2738945512 | 128 |
| 322 | iso_pu_bacteria | 2738541333 | 2739038310 | 128 |
| 323 | iso_pu_bacteria | 2738543024 | 2739307934 | 128 |
| 324 | iso_pu_bacteria | 2738543031 | 2739350329 | 128 |
| 325 | iso_pu_bacteria | 2756170246 | 2756676990 | 128 |
| 326 | iso_pu_bacteria | 2765235942 | 2766067895 | 128 |
| 327 | iso_pu_bacteria | 2775507049 | 2776913332 | 128 |
| 328 | iso_pu_bacteria | 2775507266 | 2778176457 | 128 |
| 329 | iso_pu_bacteria | 2791355082 | 2792581205 | 128 |
| 330 | iso_pu_bacteria | 2791355091 | 2792623213 | 128 |
| 331 | iso_pu_bacteria | 2791355092 | 2792626977 | 128 |
| 332 | iso_pu_bacteria | 2791355094 | 2792642487 | 128 |
| 333 | iso_pu_bacteria | 2791355123 | 2792752930 | 128 |
| 334 | iso_pu_bacteria | 2791355256 | 2793299214 | 128 |
| 335 | iso_pu_bacteria | 2791355259 | 2793313851 | 128 |
| 336 | iso_pu_bacteria | 2791355260 | 2793321227 | 128 |
| 337 | iso_pu_bacteria | 2791355261 | 2793326358 | 128 |
| 338 | iso_pu_bacteria | 2791355262 | 2793336943 | 128 |
| 339 | iso_pu_bacteria | 2791355263 | 2793344842 | 128 |
| 340 | iso_pu_bacteria | 2791355264 | 2793347746 | 128 |
| 341 | iso_pu_bacteria | 2791355265 | 2793352292 | 128 |
| 342 | iso_pu_bacteria | 2791355266 | 2793360362 | 128 |
| 343 | iso_pu_bacteria | 2791355267 | 2793366430 | 128 |
| 344 | iso_pu_bacteria | 2802428858 | 2802718882 | 128 |
| 345 | iso_pu_bacteria | 2802428859 | 2802726493 | 128 |
| 346 | iso_pu_bacteria | 2802428860 | 2802733785 | 128 |
| 347 | iso_pu_bacteria | 2802428861 | 2802738391 | 128 |
| 348 | iso_pu_bacteria | 2802428862 | 2802744723 | 128 |
| 349 | iso_pu_bacteria | 2802428863 | 2802751071 | 128 |
| 350 | iso_pu_bacteria | 2802429268 | 2804751850 | 128 |
| 351 | iso_pu_bacteria | 2802429605 | 2805927619 | 128 |
| 352 | iso_pu_bacteria | 2802429606 | 2805936095 | 128 |
| 353 | iso_pu_bacteria | 2802429633 | 2806045514 | 128 |
| 354 | iso_pu_bacteria | 2802429634 | 2806051681 | 128 |
| 355 | iso_pu_bacteria | 2802429635 | 2806061725 | 128 |
| 356 | iso_pu_bacteria | 2802429636 | 2806067906 | 128 |
| 357 | iso_pu_bacteria | 2802429637 | 2806072742 | 128 |
| 358 | iso_pu_bacteria | 2818991272 | 2819241975 | 128 |
| 359 | iso_pu_bacteria | 2818991439 | 2819559995 | 128 |
| 360 | iso_pu_bacteria | 2818991448 | 2819610429 | 128 |
| 361 | iso_pu_bacteria | 2818991453 | 2819638164 | 128 |
| 362 | iso_pu_bacteria | 2818991461 | 2819687405 | 128 |
| 363 | iso_pu_bacteria | 2821123053 | 2821127710 | 128 |
| 364 | iso_pu_bacteria | 2838016132 | 2838018790 | 128 |
| 365 | iso_pu_bacteria | 2838022645 | 2838025504 | 128 |
| 366 | iso_pu_bacteria | 2838029111 | 2838034621 | 128 |
| 367 | iso_pu_bacteria | 2838042994 | 2838043097 | 128 |
| 368 | iso_pu_bacteria | 2838048938 | 2838052138 | 128 |
| 369 | iso_pu_bacteria | 2838061910 | 2838067251 | 128 |
| 370 | iso_pu_bacteria | 2838068647 | 2838071357 | 128 |
| 371 | iso_pu_bacteria | 2838668709 | 2838670061 | 128 |
| 372 | iso_pu_bacteria | 2838675328 | 2838676413 | 128 |
| 373 | iso_pu_bacteria | 2838680041 | 2838682589 | 128 |
| 374 | iso_pu_bacteria | 2838686498 | 2838689108 | 128 |
| 375 | iso_pu_bacteria | 2838694306 | 2838697168 | 128 |
| 376 | iso_pu_bacteria | 2838701080 | 2838702433 | 128 |
| 377 | iso_pu_bacteria | 2838707686 | 2838709599 | 128 |
| 378 | iso_pu_bacteria | 2838714209 | 2838715296 | 128 |
| 379 | iso_pu_bacteria | 2838719591 | 2838720904 | 128 |
| 380 | iso_pu_bacteria | 2838724970 | 2838726054 | 128 |
| 381 | iso_pu_bacteria | 2838729681 | 2838730443 | 128 |
| 382 | iso_pu_bacteria | 2838736955 | 2838738133 | 128 |
| 383 | iso_pu_bacteria | 2838742623 | 2838743384 | 128 |
| 384 | iso_pu_bacteria | 2841734538 | 2841740380 | 128 |
| 385 | iso_pu_bacteria | 2841840854 | 2841841498 | 128 |
| 386 | iso_pu_bacteria | 2841846520 | 2841847833 | 128 |
| 387 | iso_pu_bacteria | 2841851746 | 2841854929 | 128 |
| 388 | iso_pu_bacteria | 2841859092 | 2841859629 | 128 |
| 389 | iso_pu_bacteria | 2841864319 | 2841864927 | 128 |
| 390 | iso_pu_bacteria | 2842077413 | 2842077765 | 128 |
| 391 | iso_pu_bacteria | 2842110456 | 2842110906 | 128 |
| 392 | iso_pu_bacteria | 2842118031 | 2842119726 | 128 |
| 393 | iso_pu_bacteria | 2842124991 | 2842126137 | 128 |
| 394 | iso_pu_bacteria | 2842130223 | 2842131307 | 128 |
| 395 | iso_pu_bacteria | 2842140634 | 2842141276 | 128 |
| 396 | iso_pu_bacteria | 2842146304 | 2842147022 | 128 |
| 397 | iso_pu_bacteria | 2842152218 | 2842153523 | 128 |
| 398 | iso_pu_bacteria | 2842156927 | 2842157791 | 128 |
| 399 | iso_pu_bacteria | 2842163707 | 2842165004 | 128 |
| 400 | iso_pu_bacteria | 2842170452 | 2842171539 | 128 |
| 401 | iso_pu_bacteria | 2842175837 | 2842177143 | 128 |
| 402 | iso_pu_bacteria | 2842180545 | 2842180625 | 128 |
| 403 | iso_pu_bacteria | 2842187318 | 2842188404 | 128 |
| 404 | iso_pu_bacteria | 2842192696 | 2842197017 | 128 |
| 405 | iso_pu_bacteria | 2842198810 | 2842201073 | 128 |
| 406 | iso_pu_bacteria | 2842205361 | 2842206420 | 128 |
| 407 | iso_pu_bacteria | 2842211629 | 2842212715 | 128 |
| 408 | iso_pu_bacteria | 2842217011 | 2842220603 | 128 |
| 409 | iso_pu_bacteria | 2842224351 | 2842225666 | 128 |
| 410 | iso_pu_bacteria | 2842229732 | 2842231324 | 128 |
| 411 | iso_pu_bacteria | 2842237096 | 2842239012 | 128 |
| 412 | iso_pu_bacteria | 2842243621 | 2842244562 | 128 |
| 413 | iso_pu_bacteria | 2842250916 | 2842252087 | 128 |
| 414 | iso_pu_bacteria | 2842257432 | 2842258375 | 128 |
| 415 | iso_pu_bacteria | 2842264693 | 2842267536 | 128 |
| 416 | iso_pu_bacteria | 2842271015 | 2842273128 | 128 |
| 417 | iso_pu_bacteria | 2842278818 | 2842279877 | 128 |
| 418 | iso_pu_bacteria | 2842285085 | 2842287510 | 128 |
| 419 | iso_pu_bacteria | 2842291075 | 2842291427 | 128 |
| 420 | iso_pu_bacteria | 2842298080 | 2842301856 | 128 |
| 421 | iso_pu_bacteria | 2842304105 | 2842309389 | 128 |
| 422 | iso_pu_bacteria | 2842311132 | 2842315414 | 128 |
| 423 | iso_pu_bacteria | 2842317721 | 2842318268 | 128 |
| 424 | iso_pu_bacteria | 2842341865 | 2842347157 | 128 |
| 425 | iso_pu_bacteria | 2842357229 | 2842362346 | 128 |
| 426 | iso_pu_bacteria | 2842363717 | 2842366753 | 128 |
| 427 | iso_pu_bacteria | 2842370503 | 2842373164 | 128 |
| 428 | iso_pu_bacteria | 2842377471 | 2842377823 | 128 |
| 429 | iso_pu_bacteria | 2842384541 | 2842386236 | 128 |
| 430 | iso_pu_bacteria | 2842395702 | 2842397282 | 128 |
| 431 | iso_pu_bacteria | 2842402390 | 2842404961 | 128 |
| 432 | iso_pu_bacteria | 2842409023 | 2842411543 | 128 |
| 433 | iso_pu_bacteria | 2842415677 | 2842418006 | 128 |
| 434 | iso_pu_bacteria | 2842422224 | 2842424986 | 128 |
| 435 | iso_pu_bacteria | 2842428310 | 2842431886 | 128 |
| 436 | iso_pu_bacteria | 2842434925 | 2842437999 | 128 |
| 437 | iso_pu_bacteria | 2842441272 | 2842444813 | 128 |
| 438 | iso_pu_bacteria | 2842447887 | 2842451729 | 128 |
| 439 | iso_pu_bacteria | 2842462802 | 2842465810 | 128 |
| 440 | iso_pu_bacteria | 2842469257 | 2842472616 | 128 |
| 441 | iso_pu_bacteria | 2842475841 | 2842481368 | 128 |
| 442 | iso_pu_bacteria | 2842482326 | 2842487152 | 128 |
| 443 | iso_pu_bacteria | 2842489311 | 2842492751 | 128 |
| 444 | iso_pu_bacteria | 2842495871 | 2842496539 | 128 |
| 445 | iso_pu_bacteria | 2842502639 | 2842508268 | 128 |
| 446 | iso_pu_bacteria | 2842509118 | 2842510193 | 128 |
| 447 | iso_pu_bacteria | 2842515876 | 2842516414 | 128 |
| 448 | iso_pu_bacteria | 2842521101 | 2842525941 | 128 |
| 449 | iso_pu_bacteria | 2844002411 | 2844006718 | 128 |
| 450 | iso_pu_bacteria | 2844009547 | 2844014314 | 128 |
| 451 | iso_pu_bacteria | 2844454524 | 2844459538 | 128 |
| 452 | iso_pu_bacteria | 2847417321 | 2847418491 | 128 |
| 453 | iso_pu_bacteria | 2847670302 | 2847670858 | 128 |
| 454 | iso_pu_bacteria | 2847686936 | 2847687000 | 128 |
| 455 | iso_pu_bacteria | 2848992105 | 2848993469 | 128 |
| 456 | iso_pu_bacteria | 2850079185 | 2850080793 | 128 |
| 457 | iso_pu_bacteria | 2852387548 | 2852389601 | 128 |
| 458 | iso_pu_bacteria | 2854896431 | 2854899078 | 128 |
| 459 | iso_pu_bacteria | 2854916844 | 2854916966 | 128 |
| 460 | iso_pu_bacteria | 2855825444 | 2855825454 | 128 |
| 461 | iso_pu_bacteria | 2855839649 | 2855840831 | 128 |
| 462 | iso_pu_bacteria | 2855872281 | 2855873346 | 128 |
| 463 | iso_pu_bacteria | 2856314179 | 2856316315 | 128 |
| 464 | iso_pu_bacteria | 2856320880 | 2856323617 | 128 |
| 465 | iso_pu_bacteria | 2856328259 | 2856329082 | 128 |
| 466 | iso_pu_bacteria | 2856334872 | 2856335904 | 128 |
| 467 | iso_pu_bacteria | 2856342000 | 2856346780 | 128 |
| 468 | iso_pu_bacteria | 2856349417 | 2856353279 | 128 |
| 469 | iso_pu_bacteria | 2856356410 | 2856362202 | 128 |
| 470 | iso_pu_bacteria | 2856364286 | 2856369074 | 128 |
| 471 | iso_pu_bacteria | 2857349434 | 2857355658 | 128 |
| 472 | iso_pu_bacteria | 2857367948 | 2857371157 | 128 |
| 473 | iso_pu_bacteria | 2857516855 | 2857523700 | 128 |
| 474 | iso_pu_bacteria | 2857531043 | 2857534627 | 128 |
| 475 | iso_pu_bacteria | 2858800743 | 2858801376 | 128 |
| 476 | iso_pu_bacteria | 2869162929 | 2869167954 | 128 |
| 477 | iso_pu_bacteria | 2869169390 | 2869173877 | 128 |
| 478 | iso_pu_bacteria | 2869234852 | 2869236390 | 128 |
| 479 | iso_pu_bacteria | 2869242130 | 2869247899 | 128 |
| 480 | iso_pu_bacteria | 2869249662 | 2869251105 | 128 |
| 481 | iso_pu_bacteria | 2869256925 | 2869263503 | 128 |
| 482 | iso_pu_bacteria | 2869278585 | 2869278888 | 128 |
| 483 | iso_pu_bacteria | 2869285874 | 2869291592 | 128 |
| 484 | iso_pu_bacteria | 2871429161 | 2871433892 | 128 |
| 485 | iso_pu_bacteria | 2871444079 | 2871445827 | 128 |
| 486 | iso_pu_bacteria | 2871451962 | 2871455718 | 128 |
| 487 | iso_pu_bacteria | 2871466892 | 2871469784 | 128 |
| 488 | iso_pu_bacteria | 2871474448 | 2871477692 | 128 |
| 489 | iso_pu_bacteria | 2871481445 | 2871485584 | 128 |
| 490 | iso_pu_bacteria | 2871488783 | 2871495034 | 128 |
| 491 | iso_pu_bacteria | 2871495908 | 2871500530 | 128 |
| 492 | iso_pu_bacteria | 2874102143 | 2874108168 | 128 |
| 493 | iso_pu_bacteria | 2874109183 | 2874109389 | 128 |
| 494 | iso_pu_bacteria | 2874116593 | 2874119857 | 128 |
| 495 | iso_pu_bacteria | 2874123672 | 2874125775 | 128 |
| 496 | iso_pu_bacteria | 2874139085 | 2874145479 | 128 |
| 497 | iso_pu_bacteria | 2874146452 | 2874153451 | 128 |
| 498 | iso_pu_bacteria | 2874155637 | 2874160715 | 128 |
| 499 | iso_pu_bacteria | 2874168670 | 2874172642 | 128 |
| 500 | iso_pu_bacteria | 2876363079 | 2876368014 | 128 |
| 501 | iso_pu_bacteria | 2876377896 | 2876385116 | 128 |
| 502 | iso_pu_bacteria | 2876386047 | 2876387864 | 128 |
| 503 | iso_pu_bacteria | 2876399893 | 2876403318 | 128 |
| 504 | iso_pu_bacteria | 2876413966 | 2876419741 | 128 |
| 505 | iso_pu_bacteria | 2876420981 | 2876424923 | 128 |
| 506 | iso_pu_bacteria | 2878035449 | 2878041638 | 128 |
| 507 | iso_pu_bacteria | 2878730984 | 2878737340 | 128 |
| 508 | iso_pu_bacteria | 2878738818 | 2878743783 | 128 |
| 509 | iso_pu_bacteria | 2878745973 | 2878751504 | 128 |
| 510 | iso_pu_bacteria | 2878753008 | 2878758245 | 128 |
| 511 | iso_pu_bacteria | 2878760144 | 2878764619 | 128 |
| 512 | iso_pu_bacteria | 2878767105 | 2878771720 | 128 |
| 513 | iso_pu_bacteria | 2878781027 | 2878782230 | 128 |
| 514 | iso_pu_bacteria | 2878788777 | 2878793542 | 128 |
| 515 | iso_pu_bacteria | 2881147464 | 2881152629 | 128 |
| 516 | iso_pu_bacteria | 2881155292 | 2881156196 | 128 |
| 517 | iso_pu_bacteria | 2881161766 | 2881168557 | 128 |
| 518 | iso_pu_bacteria | 2881845957 | 2881848978 | 128 |
| 519 | iso_pu_bacteria | 2881853255 | 2881860820 | 128 |
| 520 | iso_pu_bacteria | 2881861095 | 2881861879 | 128 |
| 521 | iso_pu_bacteria | 2882632389 | 2882633137 | 128 |
| 522 | iso_pu_bacteria | 2882912400 | 2882917876 | 128 |
| 523 | iso_pu_bacteria | 2885305155 | 2885310605 | 128 |
| 524 | iso_pu_bacteria | 2885312484 | 2885317368 | 128 |
| 525 | iso_pu_bacteria | 2885318864 | 2885325726 | 128 |
| 526 | iso_pu_bacteria | 2885326080 | 2885329242 | 128 |
| 527 | iso_pu_bacteria | 2885334103 | 2885335103 | 128 |
| 528 | iso_pu_bacteria | 2885342637 | 2885346511 | 128 |
| 529 | iso_pu_bacteria | 2885350715 | 2885353975 | 128 |
| 530 | iso_pu_bacteria | 2888337043 | 2888340612 | 128 |
| 531 | iso_pu_bacteria | 2888350351 | 2888356817 | 128 |
| 532 | iso_pu_bacteria | 2889010040 | 2889011869 | 128 |
| 533 | iso_pu_bacteria | 2889016732 | 2889023202 | 128 |
| 534 | iso_pu_bacteria | 2891373044 | 2891375572 | 128 |
| 535 | iso_pu_bacteria | 2899792073 | 2899796386 | 128 |
| 536 | iso_pu_bacteria | 2899803654 | 2899808942 | 128 |
| 537 | iso_pu_bacteria | 2903448605 | 2903449775 | 128 |
| 538 | iso_pu_bacteria | 2903492973 | 2903495968 | 128 |
| 539 | iso_pu_bacteria | 2903492973 | 2903505488 | 128 |
| 540 | iso_pu_bacteria | 2903513507 | 2903521313 | 128 |
| 541 | iso_pu_bacteria | 2903521522 | 2903527010 | 128 |
| 542 | iso_pu_bacteria | 2903528002 | 2903533237 | 128 |
| 543 | iso_pu_bacteria | 2903540706 | 2903545343 | 128 |
| 544 | iso_pu_bacteria | 2904659560 | 2904661820 | 128 |
| 545 | iso_pu_bacteria | 2906308376 | 2906313402 | 128 |
| 546 | iso_pu_bacteria | 2906321335 | 2906326111 | 128 |
| 547 | iso_pu_bacteria | 2906328253 | 2906328427 | 128 |
| 548 | iso_pu_bacteria | 2906401398 | 2906404580 | 128 |
| 549 | iso_pu_bacteria | 2906414383 | 2906416452 | 128 |
| 550 | iso_pu_bacteria | 2909042592 | 2909048097 | 128 |
| 551 | iso_pu_bacteria | 2913295892 | 2913300405 | 128 |
| 552 | iso_pu_bacteria | 2913308742 | 2913310218 | 128 |
| 553 | iso_pu_bacteria | 2915980308 | 2915985197 | 128 |
| 554 | iso_pu_bacteria | 2915986958 | 2915987811 | 128 |
| 555 | iso_pu_bacteria | 2915993759 | 2915997475 | 128 |
| 556 | iso_pu_bacteria | 2916000859 | 2916003910 | 128 |
| 557 | iso_pu_bacteria | 2916007675 | 2916014445 | 128 |
| 558 | iso_pu_bacteria | 2916014648 | 2916015342 | 128 |
| 559 | iso_pu_bacteria | 2916021584 | 2916028369 | 128 |
| 560 | iso_pu_bacteria | 2916028427 | 2916034857 | 128 |
| 561 | iso_pu_bacteria | 2916035215 | 2916041164 | 128 |
| 562 | iso_pu_bacteria | 2916041962 | 2916046292 | 128 |
| 563 | iso_pu_bacteria | 2916048683 | 2916051080 | 128 |
| 564 | iso_pu_bacteria | 2916055098 | 2916060618 | 128 |
| 565 | iso_pu_bacteria | 2916061851 | 2916067396 | 128 |
| 566 | iso_pu_bacteria | 2916068649 | 2916070784 | 128 |
| 567 | iso_pu_bacteria | 2916076590 | 2916082843 | 128 |
| 568 | iso_pu_bacteria | 2919100787 | 2919107794 | 128 |
| 569 | iso_pu_bacteria | 2919114240 | 2919115389 | 128 |
| 570 | iso_pu_bacteria | 2919166419 | 2919167717 | 128 |
| 571 | iso_pu_bacteria | 2919171160 | 2919175332 | 128 |
| 572 | iso_pu_bacteria | 2919408235 | 2919409770 | 128 |
| 573 | iso_pu_bacteria | 2920822456 | 2920824204 | 128 |
| 574 | iso_pu_bacteria | 2921201388 | 2921207796 | 128 |
| 575 | iso_pu_bacteria | 2921208531 | 2921210224 | 128 |
| 576 | iso_pu_bacteria | 2921237296 | 2921243780 | 128 |
| 577 | iso_pu_bacteria | 2921244191 | 2921250336 | 128 |
| 578 | iso_pu_bacteria | 2921250672 | 2921253046 | 128 |
| 579 | iso_pu_bacteria | 2921257292 | 2921260462 | 128 |
| 580 | iso_pu_bacteria | 2921263974 | 2921270427 | 128 |
| 581 | iso_pu_bacteria | 2921282425 | 2921289136 | 128 |
| 582 | iso_pu_bacteria | 2921289301 | 2921293504 | 128 |
| 583 | iso_pu_bacteria | 2921296804 | 2921304616 | 128 |
| 584 | iso_pu_bacteria | 2922130491 | 2922136095 | 128 |
| 585 | iso_pu_bacteria | 2922151315 | 2922153788 | 128 |
| 586 | iso_pu_bacteria | 2922158528 | 2922165481 | 128 |
| 587 | iso_pu_bacteria | 2922172374 | 2922172411 | 128 |
| 588 | iso_pu_bacteria | 2922185730 | 2922192182 | 128 |
| 589 | iso_pu_bacteria | 2924144063 | 2924147583 | 128 |
| 590 | iso_pu_bacteria | 2924150972 | 2924156411 | 128 |
| 591 | iso_pu_bacteria | 2924158325 | 2924165137 | 128 |
| 592 | iso_pu_bacteria | 2924165586 | 2924172838 | 128 |
| 593 | iso_pu_bacteria | 2924172951 | 2924179339 | 128 |
| 594 | iso_pu_bacteria | 2924179722 | 2924183010 | 128 |
| 595 | iso_pu_bacteria | 2924186466 | 2924192764 | 128 |
| 596 | iso_pu_bacteria | 2924193448 | 2924197853 | 128 |
| 597 | iso_pu_bacteria | 2924200457 | 2924206429 | 128 |
| 598 | iso_pu_bacteria | 2924207177 | 2924211548 | 128 |
| 599 | iso_pu_bacteria | 2924214083 | 2924215555 | 128 |
| 600 | iso_pu_bacteria | 2924221636 | 2924223350 | 128 |
| 601 | iso_pu_bacteria | 2924228884 | 2924234677 | 128 |
| 602 | iso_pu_bacteria | 2924726620 | 2924726779 | 128 |
| 603 | iso_pu_bacteria | 2924733363 | 2924734640 | 128 |
| 604 | iso_pu_bacteria | 2924741084 | 2924745657 | 128 |
| 605 | iso_pu_bacteria | 2924754689 | 2924757085 | 128 |
| 606 | iso_pu_bacteria | 2924762789 | 2924763902 | 128 |
| 607 | iso_pu_bacteria | 2924776078 | 2924781596 | 128 |
| 608 | iso_pu_bacteria | 2924784321 | 2924789535 | 128 |
| 609 | iso_pu_bacteria | 2926754445 | 2926756439 | 128 |
| 610 | iso_pu_bacteria | 2933006813 | 2933008167 | 128 |
| 611 | iso_pu_bacteria | 2933011516 | 2933012946 | 128 |
| 612 | iso_pu_bacteria | 2933016740 | 2933019229 | 128 |
| 613 | iso_pu_bacteria | 2933570622 | 2933575837 | 128 |
| 614 | iso_pu_bacteria | 2933586486 | 2933586931 | 128 |
| 615 | iso_pu_bacteria | 2933594066 | 2933595465 | 128 |
| 616 | iso_pu_bacteria | 2933599457 | 2933602156 | 128 |
| 617 | iso_pu_bacteria | 2935894831 | 2935898975 | 128 |
| 618 | iso_pu_bacteria | 2935901341 | 2935904839 | 128 |
| 619 | iso_pu_bacteria | 2936367885 | 2936373135 | 128 |
| 620 | iso_pu_bacteria | 2936375103 | 2936381280 | 128 |
| 621 | iso_pu_bacteria | 2936381700 | 2936384552 | 128 |
| 622 | iso_pu_bacteria | 2937002841 | 2937007267 | 128 |
| 623 | iso_pu_bacteria | 2937009748 | 2937012428 | 128 |
| 624 | iso_pu_bacteria | 2937016420 | 2937022578 | 128 |
| 625 | iso_pu_bacteria | 2937023124 | 2937029203 | 128 |
| 626 | iso_pu_bacteria | 2937029754 | 2937031172 | 128 |
| 627 | iso_pu_bacteria | 2937036028 | 2937040882 | 128 |
| 628 | iso_pu_bacteria | 2937042894 | 2937049693 | 128 |
| 629 | iso_pu_bacteria | 2937049772 | 2937050089 | 128 |
| 630 | iso_pu_bacteria | 2937056579 | 2937059648 | 128 |
| 631 | iso_pu_bacteria | 2937063883 | 2937071211 | 128 |
| 632 | iso_pu_bacteria | 2937071275 | 2937075649 | 128 |
| 633 | iso_pu_bacteria | 2937078374 | 2937079966 | 128 |
| 634 | iso_pu_bacteria | 2937084907 | 2937089186 | 128 |
| 635 | iso_pu_bacteria | 2937091812 | 2937092271 | 128 |
| 636 | iso_pu_bacteria | 2937098957 | 2937105861 | 128 |
| 637 | iso_pu_bacteria | 2937106411 | 2937113121 | 128 |
| 638 | iso_pu_bacteria | 2937113482 | 2937117269 | 128 |
| 639 | iso_pu_bacteria | 2937119839 | 2937125326 | 128 |
| 640 | iso_pu_bacteria | 2937126314 | 2937130392 | 128 |
| 641 | iso_pu_bacteria | 2937813078 | 2937820448 | 128 |
| 642 | iso_pu_bacteria | 2937822353 | 2937827011 | 128 |
| 643 | iso_pu_bacteria | 2937836603 | 2937840066 | 128 |
| 644 | iso_pu_bacteria | 2937843397 | 2937846153 | 128 |
| 645 | iso_pu_bacteria | 2937848649 | 2937853703 | 128 |
| 646 | iso_pu_bacteria | 2937861824 | 2937862053 | 128 |
| 647 | iso_pu_bacteria | 2937868953 | 2937869549 | 128 |
| 648 | iso_pu_bacteria | 2937877337 | 2937879248 | 128 |
| 649 | iso_pu_bacteria | 2937891427 | 2937895071 | 128 |
| 650 | iso_pu_bacteria | 2937972304 | 2937975019 | 128 |
| 651 | iso_pu_bacteria | 2937980651 | 2937981721 | 128 |
| 652 | iso_pu_bacteria | 2937994558 | 2937999193 | 128 |
| 653 | iso_pu_bacteria | 2938014810 | 2938016190 | 128 |
| 654 | iso_pu_bacteria | 2941499720 | 2941499838 | 128 |
| 655 | iso_pu_bacteria | 2957375807 | 2957380852 | 128 |
| 656 | iso_pu_bacteria | 2957382221 | 2957388041 | 128 |
| 657 | iso_pu_bacteria | 2957388812 | 2957394233 | 128 |
| 658 | iso_pu_bacteria | 2957395598 | 2957399339 | 128 |
| 659 | iso_pu_bacteria | 2957402308 | 2957407896 | 128 |
| 660 | iso_pu_bacteria | 2957408893 | 2957412574 | 128 |
| 661 | iso_pu_bacteria | 2957415311 | 2957416080 | 128 |
| 662 | iso_pu_bacteria | 2957422303 | 2957422943 | 128 |
| 663 | iso_pu_bacteria | 2957430029 | 2957436769 | 128 |
| 664 | iso_pu_bacteria | 2957437181 | 2957439169 | 128 |
| 665 | iso_pu_bacteria | 2957443900 | 2957450055 | 128 |
| 666 | iso_pu_bacteria | 2957450854 | 2957456758 | 128 |
| 667 | iso_pu_bacteria | 2957457609 | 2957464636 | 128 |
| 668 | iso_pu_bacteria | 2957464669 | 2957470648 | 128 |
| 669 | iso_pu_bacteria | 2957471148 | 2957472317 | 128 |
| 670 | iso_pu_bacteria | 2957478035 | 2957483513 | 128 |
| 671 | iso_pu_bacteria | 2957484790 | 2957491520 | 128 |
| 672 | iso_pu_bacteria | 2957491536 | 2957494967 | 128 |
| 673 | iso_pu_bacteria | 2957498199 | 2957505075 | 128 |
| 674 | iso_pu_bacteria | 2957505466 | 2957505862 | 128 |
| 675 | iso_pu_bacteria | 2958034702 | 2958035003 | 128 |
| 676 | iso_pu_bacteria | 2958041894 | 2958042867 | 128 |
| 677 | iso_pu_bacteria | 2958064165 | 2958067202 | 128 |
| 678 | iso_pu_bacteria | 2958071322 | 2958072495 | 128 |
| 679 | iso_pu_bacteria | 2958084443 | 2958086423 | 128 |
| 680 | iso_pu_bacteria | 2958092219 | 2958100037 | 128 |
| 681 | iso_pu_bacteria | 2958100919 | 2958103289 | 128 |
| 682 | iso_pu_bacteria | 2958108152 | 2958113334 | 128 |
| 683 | iso_pu_bacteria | 2958115193 | 2958122562 | 128 |
| 684 | iso_pu_bacteria | 2958122699 | 2958126378 | 128 |
| 685 | iso_pu_bacteria | 2958130278 | 2958135993 | 128 |
| 686 | iso_pu_bacteria | 2958137437 | 2958139663 | 128 |
| 687 | iso_pu_bacteria | 2958158011 | 2958162085 | 128 |
| 688 | iso_pu_bacteria | 2958165035 | 2958169667 | 128 |
| 689 | iso_pu_bacteria | 2958172287 | 2958177688 | 128 |
| 690 | iso_pu_bacteria | 2958179912 | 2958185459 | 128 |
| 691 | iso_pu_bacteria | 2960584000 | 2960590900 | 128 |
| 692 | iso_pu_bacteria | 2960591022 | 2960596132 | 128 |
| 693 | iso_pu_bacteria | 2960597568 | 2960602832 | 128 |
| 694 | iso_pu_bacteria | 2960603979 | 2960607250 | 128 |
| 695 | iso_pu_bacteria | 2960610863 | 2960614985 | 128 |
| 696 | iso_pu_bacteria | 2960617483 | 2960623205 | 128 |
| 697 | iso_pu_bacteria | 2960624210 | 2960628864 | 128 |
| 698 | iso_pu_bacteria | 2960631154 | 2960634638 | 128 |
| 699 | iso_pu_bacteria | 2960637947 | 2960639208 | 128 |
| 700 | iso_pu_bacteria | 2960645483 | 2960652686 | 128 |
| 701 | iso_pu_bacteria | 2960652885 | 2960653107 | 128 |
| 702 | iso_pu_bacteria | 2960660292 | 2960666729 | 128 |
| 703 | iso_pu_bacteria | 2960667422 | 2960673339 | 128 |
| 704 | iso_pu_bacteria | 2960674078 | 2960680458 | 128 |
| 705 | iso_pu_bacteria | 2960680706 | 2960686828 | 128 |
| 706 | iso_pu_bacteria | 2960687367 | 2960693813 | 128 |
| 707 | iso_pu_bacteria | 2960693952 | 2960699779 | 128 |
| 708 | iso_pu_bacteria | 2961077736 | 2961083727 | 128 |
| 709 | iso_pu_bacteria | 2961114664 | 2961116973 | 128 |
| 710 | iso_pu_bacteria | 2961127735 | 2961136397 | 128 |
| 711 | iso_pu_bacteria | 2961136820 | 2961141197 | 128 |
| 712 | iso_pu_bacteria | 2961163497 | 2961168127 | 128 |
| 713 | iso_pu_bacteria | 2961170736 | 2961174875 | 128 |
| 714 | iso_pu_bacteria | 2961183825 | 2961187944 | 128 |
| 715 | iso_pu_bacteria | 2963644680 | 2963648587 | 128 |
| 716 | iso_pu_bacteria | 2964607997 | 2964611135 | 128 |
| 717 | iso_pu_bacteria | 2964615318 | 2964620755 | 128 |
| 718 | iso_pu_bacteria | 2964621998 | 2964628858 | 128 |
| 719 | iso_pu_bacteria | 2964628898 | 2964635920 | 128 |
| 720 | iso_pu_bacteria | 2964636051 | 2964637896 | 128 |
| 721 | iso_pu_bacteria | 2964643177 | 2964649140 | 128 |
| 722 | iso_pu_bacteria | 2964649959 | 2964655804 | 128 |
| 723 | iso_pu_bacteria | 2964656573 | 2964660217 | 128 |
| 724 | iso_pu_bacteria | 2964663802 | 2964666189 | 128 |
| 725 | iso_pu_bacteria | 2964670856 | 2964678092 | 128 |
| 726 | iso_pu_bacteria | 2964678106 | 2964679327 | 128 |
| 727 | iso_pu_bacteria | 2964685014 | 2964685368 | 128 |
| 728 | iso_pu_bacteria | 2964691889 | 2964698656 | 128 |
| 729 | iso_pu_bacteria | 2964698721 | 2964702085 | 128 |
| 730 | iso_pu_bacteria | 2964705432 | 2964709240 | 128 |
| 731 | iso_pu_bacteria | 2964712639 | 2964714672 | 128 |
| 732 | iso_pu_bacteria | 2964719344 | 2964719618 | 128 |
| 733 | iso_pu_bacteria | 2965018300 | 2965022946 | 128 |
| 734 | iso_pu_bacteria | 2965025482 | 2965029236 | 128 |
| 735 | iso_pu_bacteria | 2965040258 | 2965046192 | 128 |
| 736 | iso_pu_bacteria | 2965062239 | 2965067483 | 128 |
| 737 | iso_pu_bacteria | 2965089291 | 2965095016 | 128 |
| 738 | iso_pu_bacteria | 2965110997 | 2965111589 | 128 |
| 739 | iso_pu_bacteria | 2965119406 | 2965121026 | 128 |
| 740 | iso_pu_bacteria | 2967664464 | 2967668631 | 128 |
| 741 | iso_pu_bacteria | 2967671571 | 2967674553 | 128 |
| 742 | iso_pu_bacteria | 2967678726 | 2967685646 | 128 |
| 743 | iso_pu_bacteria | 2967686174 | 2967688762 | 128 |
| 744 | iso_pu_bacteria | 2967693043 | 2967699145 | 128 |
| 745 | iso_pu_bacteria | 2967699805 | 2967700002 | 128 |
| 746 | iso_pu_bacteria | 2967706974 | 2967714352 | 128 |
| 747 | iso_pu_bacteria | 2967714385 | 2967720569 | 128 |
| 748 | iso_pu_bacteria | 2967721400 | 2967728170 | 128 |
| 749 | iso_pu_bacteria | 2967728569 | 2967734269 | 128 |
| 750 | iso_pu_bacteria | 2967735183 | 2967741293 | 128 |
| 751 | iso_pu_bacteria | 2967742019 | 2967744958 | 128 |
| 752 | iso_pu_bacteria | 2967748971 | 2967753385 | 128 |
| 753 | iso_pu_bacteria | 2967755722 | 2967757999 | 128 |
| 754 | iso_pu_bacteria | 2967762386 | 2967769182 | 128 |
| 755 | iso_pu_bacteria | 2967769361 | 2967775282 | 128 |
| 756 | iso_pu_bacteria | 2967775926 | 2967782812 | 128 |
| 757 | iso_pu_bacteria | 2967996073 | 2968000811 | 128 |
| 758 | iso_pu_bacteria | 2968003550 | 2968009763 | 128 |
| 759 | iso_pu_bacteria | 2968016561 | 2968017534 | 128 |
| 760 | iso_pu_bacteria | 2968083720 | 2968083815 | 128 |
| 761 | iso_pu_bacteria | 2968091066 | 2968092438 | 128 |
| 762 | iso_pu_bacteria | 2968097103 | 2968100500 | 128 |
| 763 | iso_pu_bacteria | 2968110612 | 2968112881 | 128 |
| 764 | iso_pu_bacteria | 2968117919 | 2968122887 | 128 |
| 765 | iso_pu_bacteria | 2968128360 | 2968128832 | 128 |
| 766 | iso_pu_bacteria | 2968138860 | 2968143538 | 128 |
| 767 | iso_pu_bacteria | 2968171901 | 2968176527 | 128 |
| 768 | iso_pu_bacteria | 2970019648 | 2970026397 | 128 |
| 769 | iso_pu_bacteria | 2970026789 | 2970032693 | 128 |
| 770 | iso_pu_bacteria | 2970033650 | 2970038233 | 128 |
| 771 | iso_pu_bacteria | 2970040964 | 2970041711 | 128 |
| 772 | iso_pu_bacteria | 2970047711 | 2970054889 | 128 |
| 773 | iso_pu_bacteria | 2970054988 | 2970060861 | 128 |
| 774 | iso_pu_bacteria | 2970061556 | 2970061923 | 128 |
| 775 | iso_pu_bacteria | 2970068827 | 2970075929 | 128 |
| 776 | iso_pu_bacteria | 2970076120 | 2970081103 | 128 |
| 777 | iso_pu_bacteria | 2970082768 | 2970084820 | 128 |
| 778 | iso_pu_bacteria | 2970088815 | 2970095259 | 128 |
| 779 | iso_pu_bacteria | 2970095765 | 2970099392 | 128 |
| 780 | iso_pu_bacteria | 2970102677 | 2970103654 | 128 |
| 781 | iso_pu_bacteria | 2970109326 | 2970112186 | 128 |
| 782 | iso_pu_bacteria | 2970116247 | 2970121823 | 128 |
| 783 | iso_pu_bacteria | 2970122695 | 2970127057 | 128 |
| 784 | iso_pu_bacteria | 2970129317 | 2970135110 | 128 |
| 785 | iso_pu_bacteria | 2970136068 | 2970136592 | 128 |
| 786 | iso_pu_bacteria | 2970143518 | 2970145550 | 128 |
| 787 | iso_pu_bacteria | 2970149975 | 2970155273 | 128 |
| 788 | iso_pu_bacteria | 2970156795 | 2970158381 | 128 |
| 789 | iso_pu_bacteria | 2970164137 | 2970168128 | 128 |
| 790 | iso_pu_bacteria | 2970170962 | 2970174823 | 128 |
| 791 | iso_pu_bacteria | 2970177841 | 2970181736 | 128 |
| 792 | iso_pu_bacteria | 2970184632 | 2970187949 | 128 |
| 793 | iso_pu_bacteria | 2970191845 | 2970193543 | 128 |
| 794 | iso_pu_bacteria | 2970469710 | 2970472290 | 128 |
| 795 | iso_pu_bacteria | 2970489779 | 2970489785 | 128 |
| 796 | iso_pu_bacteria | 2970503327 | 2970507461 | 128 |
| 797 | iso_pu_bacteria | 2970510686 | 2970517950 | 128 |
| 798 | iso_pu_bacteria | 2970524798 | 2970530081 | 128 |
| 799 | iso_pu_bacteria | 2970532167 | 2970538621 | 128 |
| 800 | iso_pu_bacteria | 2970540015 | 2970545617 | 128 |
| 801 | iso_pu_bacteria | 2970547951 | 2970551938 | 128 |
| 802 | iso_pu_bacteria | 2970554993 | 2970559466 | 128 |
| 803 | iso_pu_bacteria | 2970593180 | 2970593483 | 128 |
| 804 | iso_pu_bacteria | 2970619444 | 2970625003 | 128 |
| 805 | iso_pu_bacteria | 2970627176 | 2970632416 | 128 |
| 806 | iso_pu_bacteria | 2977516862 | 2977520716 | 128 |
| 807 | iso_pu_bacteria | 2977523885 | 2977524397 | 128 |
| 808 | iso_pu_bacteria | 2977530762 | 2977533829 | 128 |
| 809 | iso_pu_bacteria | 2977537788 | 2977542210 | 128 |
| 810 | iso_pu_bacteria | 2977544691 | 2977547238 | 128 |
| 811 | iso_pu_bacteria | 2977551784 | 2977557412 | 128 |
| 812 | iso_pu_bacteria | 2977558990 | 2977565871 | 128 |
| 813 | iso_pu_bacteria | 2977565890 | 2977571970 | 128 |
| 814 | iso_pu_bacteria | 2977572785 | 2977579120 | 128 |
| 815 | iso_pu_bacteria | 2977579622 | 2977585325 | 128 |
| 816 | iso_pu_bacteria | 2977821940 | 2977828682 | 128 |
| 817 | iso_pu_bacteria | 2977828996 | 2977831583 | 128 |
| 818 | iso_pu_bacteria | 2977843712 | 2977848748 | 128 |
| 819 | iso_pu_bacteria | 2977851361 | 2977854143 | 128 |
| 820 | iso_pu_bacteria | 2977858184 | 2977860982 | 128 |
| 821 | iso_pu_bacteria | 2977864932 | 2977872031 | 128 |
| 822 | iso_pu_bacteria | 2977872689 | 2977879619 | 128 |
| 823 | iso_pu_bacteria | 2977898635 | 2977906559 | 128 |
| 824 | iso_pu_bacteria | 2977907340 | 2977907984 | 128 |
| 825 | iso_pu_bacteria | 2977915119 | 2977918761 | 128 |
| 826 | iso_pu_bacteria | 2977922695 | 2977929141 | 128 |
| 827 | iso_pu_bacteria | 2977935797 | 2977937520 | 128 |
| 828 | iso_pu_bacteria | 2977942078 | 2977946123 | 128 |
| 829 | iso_pu_bacteria | 2977950692 | 2977954017 | 128 |
| 830 | iso_pu_bacteria | 2977957713 | 2977958587 | 128 |
| 831 | iso_pu_bacteria | 2977986579 | 2977987535 | 128 |
| 832 | iso_pu_bacteria | 2978969890 | 2978974172 | 128 |
| 833 | iso_pu_bacteria | 2979100975 | 2979106070 | 128 |
| 834 | iso_pu_bacteria | 2979710463 | 2979713997 | 128 |
| 835 | iso_pu_bacteria | 2979764755 | 2979767352 | 128 |
| 836 | iso_pu_bacteria | 2979772303 | 2979775261 | 128 |
| 837 | iso_pu_bacteria | 2979779861 | 2979779954 | 128 |
| 838 | iso_pu_bacteria | 2979793036 | 2979795161 | 128 |
| 839 | iso_pu_bacteria | 2979808191 | 2979812657 | 128 |
| 840 | iso_pu_bacteria | 2984509177 | 2984512140 | 128 |
| 841 | iso_pu_bacteria | 2984518228 | 2984521499 | 128 |
| 842 | iso_pu_bacteria | 2984537506 | 2984540793 | 128 |
| 843 | iso_pu_bacteria | 2984587000 | 2984589500 | 128 |
| 844 | iso_pu_bacteria | 2984601300 | 2984603060 | 128 |
| 845 | iso_pu_bacteria | 2987636660 | 2987640792 | 128 |
| 846 | iso_pu_bacteria | 2987645492 | 2987645734 | 128 |
| 847 | iso_pu_bacteria | 2987652177 | 2987656292 | 128 |
| 848 | iso_pu_bacteria | 2987659509 | 2987664141 | 128 |
| 849 | iso_pu_bacteria | 2987666974 | 2987670370 | 128 |
| 850 | iso_pu_bacteria | 2987673487 | 2987680956 | 128 |
| 851 | iso_pu_bacteria | 2989349275 | 2989352911 | 128 |
| 852 | iso_pu_bacteria | 2989771324 | 2989773702 | 128 |
| 853 | iso_pu_bacteria | 2989776772 | 2989778751 | 128 |
| 854 | iso_pu_bacteria | 2996310559 | 2996311119 | 128 |
| 855 | iso_pu_bacteria | 2996336353 | 2996341809 | 128 |
| 856 | iso_pu_bacteria | 2996341866 | 2996348856 | 128 |
| 857 | iso_pu_bacteria | 2996348954 | 2996351161 | 128 |
| 858 | iso_pu_bacteria | 2996386984 | 2996388326 | 128 |
| 859 | iso_pu_bacteria | 2996887358 | 2996892435 | 128 |
| 860 | iso_pu_bacteria | 2996893221 | 2996898455 | 128 |
| 861 | iso_pu_bacteria | 3000135777 | 3000136244 | 128 |
| 862 | iso_pu_bacteria | 3003930520 | 3003933382 | 128 |
| 863 | iso_pu_bacteria | 3004167301 | 3004170113 | 128 |
| 864 | iso_pu_bacteria | 3004188549 | 3004193196 | 128 |
| 865 | iso_pu_bacteria | 3004203850 | 3004208989 | 128 |
| 866 | iso_pu_bacteria | 3004211236 | 3004212677 | 128 |
| 867 | iso_pu_bacteria | 3004218560 | 3004222746 | 128 |
| 868 | iso_pu_bacteria | 3004232784 | 3004236746 | 128 |
| 869 | iso_pu_bacteria | 3004239961 | 3004245527 | 128 |
| 870 | iso_pu_bacteria | 3004248173 | 3004255485 | 128 |
| 871 | iso_pu_bacteria | 3004268573 | 3004269792 | 128 |
| 872 | iso_pu_bacteria | 3004275668 | 3004277859 | 128 |
| 873 | iso_pu_bacteria | 3004289098 | 3004296652 | 128 |
| 874 | iso_pu_bacteria | 3004334049 | 3004340328 | 128 |
| 875 | iso_pu_bacteria | 3005409236 | 3005409651 | 128 |
| 876 | iso_pu_bacteria | 3005416602 | 3005420367 | 128 |
| 877 | iso_pu_bacteria | 3005445848 | 3005447243 | 128 |
| 878 | iso_pu_bacteria | 637000159 | 637073630 | 128 |
| 879 | iso_pu_bacteria | 639633055 | 639648136 | 128 |
| 880 | iso_pu_bacteria | 643692032 | 643825497 | 128 |
| 881 | iso_pu_bacteria | 648276728 | 648740128 | 128 |
| 882 | iso_pu_bacteria | 649633066 | 649873565 | 128 |
| 883 | iso_pu_bacteria | 8002285264 | 8002286149 | 128 |
| 884 | iso_pu_bacteria | 8003992118 | 8003993329 | 128 |
| 885 | iso_pu_bacteria | 8003999396 | 8004000585 | 128 |
| 886 | iso_pu_bacteria | 8004300914 | 8004306589 | 128 |
| 887 | iso_pu_bacteria | 8004312739 | 8004313777 | 128 |
| 888 | iso_pu_bacteria | 8004361976 | 8004364013 | 128 |
| 889 | iso_pu_bacteria | 8004374579 | 8004379756 | 128 |
| 890 | iso_pu_bacteria | 8004387939 | 8004393852 | 128 |
| 891 | iso_pu_bacteria | 8004395343 | 8004400035 | 128 |
| 892 | iso_pu_bacteria | 8004445564 | 8004450050 | 128 |
| 893 | iso_pu_bacteria | 8004633249 | 8004639214 | 128 |
| 894 | iso_pu_bacteria | 8004640170 | 8004643184 | 128 |
| 895 | iso_pu_bacteria | 8004695233 | 8004702742 | 128 |
| 896 | iso_pu_bacteria | 8004703790 | 8004714522 | 128 |
| 897 | iso_pu_bacteria | 8004714634 | 8004719656 | 128 |
| 898 | iso_pu_bacteria | 8004727605 | 8004729378 | 128 |
| 899 | iso_pu_bacteria | 8005246636 | 8005248303 | 128 |
| 900 | iso_pu_bacteria | 8005258706 | 8005259717 | 128 |
| 901 | iso_pu_bacteria | 8005275841 | 8005280206 | 128 |
| 902 | iso_pu_bacteria | 8005282627 | 8005288273 | 128 |
| 903 | iso_pu_bacteria | 8005289223 | 8005294799 | 128 |
| 904 | iso_pu_bacteria | 8005301065 | 8005307042 | 128 |
| 905 | iso_pu_bacteria | 8005307578 | 8005314557 | 128 |
| 906 | iso_pu_bacteria | 8005314921 | 8005317318 | 128 |
| 907 | iso_pu_bacteria | 8005321885 | 8005326962 | 128 |
| 908 | iso_pu_bacteria | 8005376324 | 8005378785 | 128 |
| 909 | iso_pu_bacteria | 8005382845 | 8005388007 | 128 |
| 910 | iso_pu_bacteria | 8005395548 | 8005397038 | 128 |
| 911 | iso_pu_bacteria | 8005430974 | 8005433245 | 128 |
| 912 | iso_pu_bacteria | 8005460587 | 8005462518 | 128 |
| 913 | iso_pu_bacteria | 8005484373 | 8005486618 | 128 |
| 914 | iso_pu_bacteria | 8005497431 | 8005499896 | 128 |
| 915 | iso_pu_bacteria | 8005556819 | 8005558113 | 128 |
| 916 | iso_pu_bacteria | 8005563573 | 8005569291 | 128 |
| 917 | iso_pu_bacteria | 8005570704 | 8005575432 | 128 |
| 918 | iso_pu_bacteria | 8005619151 | 8005621263 | 128 |
| 919 | iso_pu_bacteria | 8005626139 | 8005631437 | 128 |
| 920 | iso_pu_bacteria | 8005645114 | 8005646240 | 128 |
| 921 | iso_pu_bacteria | 8005658619 | 8005659419 | 128 |
| 922 | iso_pu_bacteria | 8005668836 | 8005671314 | 128 |
| 923 | iso_pu_bacteria | 8005682033 | 8005686374 | 128 |
| 924 | iso_pu_bacteria | 8005688590 | 8005694956 | 128 |
| 925 | iso_pu_bacteria | 8005695170 | 8005696156 | 128 |
| 926 | iso_pu_bacteria | 8018127388 | 8018129558 | 128 |
| 927 | iso_pu_bacteria | 8018163183 | 8018168099 | 128 |
| 928 | iso_pu_bacteria | 8018176218 | 8018177895 | 128 |
| 929 | iso_pu_bacteria | 8023680758 | 8023680973 | 128 |
| 930 | iso_pu_bacteria | 8024479707 | 8024485749 | 128 |
| 931 | iso_pu_bacteria | 8024486573 | 8024492566 | 128 |
| 932 | iso_pu_bacteria | 8024501048 | 8024505215 | 128 |
| 933 | iso_pu_bacteria | 8046767195 | 8046770326 | 128 |
| 934 | iso_pu_bacteria | 8049293176 | 8049294384 | 128 |
| 935 | iso_pu_bacteria | 8054558443 | 8054560808 | 128 |
| 936 | iso_pu_bacteria | 8055617313 | 8055621933 | 128 |
| 937 | iso_pu_bacteria | 8056375014 | 8056380142 | 128 |
| 938 | iso_pu_bacteria | 8056382006 | 8056387553 | 128 |
| 939 | iso_pu_bacteria | 8057575449 | 8057578256 | 128 |
| 940 | iso_pu_bacteria | 8057874678 | 8057875496 | 128 |
| 941 | 3300005262 | Ga0065165_1005995 | Ga0065165_10059955 | 130 |
| 942 | 3300005548 | Ga0070665_100100274 | Ga0070665_1001002744 | 130 |
| 943 | 3300031824 | Ga0307413_10429669 | Ga0307413_104296692 | 130 |
| 944 | 3300031901 | Ga0307406_10459222 | Ga0307406_104592222 | 130 |
| 945 | 3300031911 | Ga0307412_11859820 | Ga0307412_118598202 | 130 |
| 946 | 3300041451 | Ga0451791_1489124 | Ga0451791_1489124_59_505 | 130 |
| 947 | 3300044683 | Ga0466965_0097468 | Ga0466965_0097468_590_1039 | 130 |
| 948 | 3300048925 | Ga0496122_0000025 | Ga0496122_0000025_308668_309117 | 130 |
| 949 | 3300048926 | Ga0496123_0000032 | Ga0496123_0000032_55096_55545 | 130 |
| 950 | 3300048927 | Ga0496124_0023770 | Ga0496124_0023770_980_1429 | 130 |
| 951 | 3300005334 | Ga0068869_101109938 | Ga0068869_1011099382 | 131 |
| 952 | 3300005343 | Ga0070687_100035726 | Ga0070687_1000357262 | 131 |
| 953 | 3300005354 | Ga0070675_100238243 | Ga0070675_1002382433 | 131 |
| 954 | 3300005367 | Ga0070667_101468578 | Ga0070667_1014685782 | 131 |
| 955 | 3300005406 | Ga0070703_10001607 | Ga0070703_100016078 | 131 |
| 956 | 3300005434 | Ga0070709_10145167 | Ga0070709_101451672 | 131 |
| 957 | 3300005438 | Ga0070701_10001368 | Ga0070701_100013686 | 131 |
| 958 | 3300005440 | Ga0070705_100000487 | Ga0070705_1000004873 | 131 |
| 959 | 3300005441 | Ga0070700_100003143 | Ga0070700_1000031437 | 131 |
| 960 | 3300005444 | Ga0070694_100023927 | Ga0070694_1000239275 | 131 |
| 961 | 3300005445 | Ga0070708_100029082 | Ga0070708_1000290827 | 131 |
| 962 | 3300005455 | Ga0070663_100004621 | Ga0070663_10000462110 | 131 |
| 963 | 3300005455 | Ga0070663_101228536 | Ga0070663_1012285362 | 131 |
| 964 | 3300005457 | Ga0070662_100411200 | Ga0070662_1004112002 | 131 |
| 965 | 3300005457 | Ga0070662_101332326 | Ga0070662_1013323261 | 131 |
| 966 | 3300005458 | Ga0070681_10171682 | Ga0070681_101716822 | 131 |
| 967 | 3300005467 | Ga0070706_100058590 | Ga0070706_1000585906 | 131 |
| 968 | 3300005471 | Ga0070698_100665481 | Ga0070698_1006654811 | 131 |
| 969 | 3300005518 | Ga0070699_100002474 | Ga0070699_10000247414 | 131 |
| 970 | 3300005530 | Ga0070679_100065325 | Ga0070679_1000653252 | 131 |
| 971 | 3300005536 | Ga0070697_100119415 | Ga0070697_1001194153 | 131 |
| 972 | 3300005544 | Ga0070686_100403550 | Ga0070686_1004035502 | 131 |
| 973 | 3300005546 | Ga0070696_100001714 | Ga0070696_10000171417 | 131 |
| 974 | 3300005547 | Ga0070693_100064714 | Ga0070693_1000647142 | 131 |
| 975 | 3300005549 | Ga0070704_100004568 | Ga0070704_1000045685 | 131 |
| 976 | 3300005577 | Ga0068857_100030653 | Ga0068857_1000306532 | 131 |
| 977 | 3300005616 | Ga0068852_101959714 | Ga0068852_1019597141 | 131 |
| 978 | 3300005617 | Ga0068859_100011400 | Ga0068859_1000114003 | 131 |
| 979 | 3300005618 | Ga0068864_100081043 | Ga0068864_1000810435 | 131 |
| 980 | 3300005841 | Ga0068863_100170600 | Ga0068863_1001706003 | 131 |
| 981 | 3300005842 | Ga0068858_100051707 | Ga0068858_1000517073 | 131 |
| 982 | 3300005843 | Ga0068860_100007101 | Ga0068860_10000710110 | 131 |
| 983 | 3300005844 | Ga0068862_100011359 | Ga0068862_1000113594 | 131 |
| 984 | 3300006038 | Ga0075365_10365111 | Ga0075365_103651111 | 131 |
| 985 | 3300006186 | Ga0075369_10086170 | Ga0075369_100861701 | 131 |
| 986 | 3300006353 | Ga0075370_10006155 | Ga0075370_100061557 | 131 |
| 987 | 3300006844 | Ga0075428_100157306 | Ga0075428_1001573063 | 131 |
| 988 | 3300006846 | Ga0075430_100013715 | Ga0075430_1000137155 | 131 |
| 989 | 3300006847 | Ga0075431_100001091 | Ga0075431_10000109119 | 131 |
| 990 | 3300006880 | Ga0075429_100764842 | Ga0075429_1007648422 | 131 |
| 991 | 3300006931 | Ga0097620_100011399 | Ga0097620_1000113993 | 131 |
| 992 | 3300009098 | Ga0105245_11155304 | Ga0105245_111553042 | 131 |
| 993 | 3300009148 | Ga0105243_10175176 | Ga0105243_101751762 | 131 |
| 994 | 3300009553 | Ga0105249_10000834 | Ga0105249_1000083424 | 131 |
| 995 | 3300009553 | Ga0105249_12837275 | Ga0105249_128372751 | 131 |
| 996 | 3300010375 | Ga0105239_10558827 | Ga0105239_105588272 | 131 |
| 997 | 3300011119 | Ga0105246_10016031 | Ga0105246_100160313 | 131 |
| 998 | 3300014325 | Ga0163163_11571178 | Ga0163163_115711782 | 131 |
| 999 | 3300015265 | Ga0182005_1003903 | Ga0182005_10039035 | 131 |
| 1000 | 3300025291 | Ga0209675_1061028 | Ga0209675_10610282 | 131 |
| 1001 | 3300025885 | Ga0207653_10001674 | Ga0207653_100016748 | 131 |
| 1002 | 3300025912 | Ga0207707_10027670 | Ga0207707_100276707 | 131 |
| 1003 | 3300025921 | Ga0207652_10040467 | Ga0207652_100404677 | 131 |
| 1004 | 3300025927 | Ga0207687_10734934 | Ga0207687_107349342 | 131 |
| 1005 | 3300025933 | Ga0207706_10039545 | Ga0207706_100395455 | 131 |
| 1006 | 3300025933 | Ga0207706_10967608 | Ga0207706_109676081 | 131 |
| 1007 | 3300025935 | Ga0207709_10114712 | Ga0207709_101147122 | 131 |
| 1008 | 3300025961 | Ga0207712_10003210 | Ga0207712_100032105 | 131 |
| 1009 | 3300025961 | Ga0207712_11567645 | Ga0207712_115676451 | 131 |
| 1010 | 3300025986 | Ga0207658_10549102 | Ga0207658_105491021 | 131 |
| 1011 | 3300026067 | Ga0207678_10015487 | Ga0207678_100154872 | 131 |
| 1012 | 3300026075 | Ga0207708_10002508 | Ga0207708_1000250812 | 131 |
| 1013 | 3300026088 | Ga0207641_10307664 | Ga0207641_103076643 | 131 |
| 1014 | 3300026095 | Ga0207676_10078838 | Ga0207676_100788382 | 131 |
| 1015 | 3300026116 | Ga0207674_10154489 | Ga0207674_101544894 | 131 |
| 1016 | 3300028380 | Ga0268265_10014314 | Ga0268265_100143144 | 131 |
| 1017 | 3300028381 | Ga0268264_10003917 | Ga0268264_1000391710 | 131 |
| 1018 | 3300028794 | Ga0307515_10767339 | Ga0307515_107673392 | 131 |
| 1019 | 3300035092 | Ga0373952_0071202 | Ga0373952_0071202_361_843 | 131 |
| 1020 | 3300035114 | Ga0373939_0115591 | Ga0373939_0115591_45_527 | 131 |
| 1021 | 3300037312 | Ga0395899_0000213 | Ga0395899_0000213_78657_79118 | 131 |
| 1022 | 3300037418 | Ga0395900_0000121 | Ga0395900_0000121_130280_130741 | 131 |
| 1023 | 3300037466 | Ga0395898_0000247 | Ga0395898_0000247_4286_4747 | 131 |
| 1024 | 3300037471 | Ga0395905_0000112 | Ga0395905_0000112_4270_4731 | 131 |
| 1025 | 3300038443 | Ga0395901_0000078 | Ga0395901_0000078_130280_130741 | 131 |
| 1026 | 3300046459 | Ga0495629_0091148 | Ga0495629_0091148_901_1359 | 131 |
| 1027 | 3300047444 | Ga0495675_0033960 | Ga0495675_0033960_332_790 | 131 |
| 1028 | 3300048904 | Ga0496101_0208502 | Ga0496101_0208502_278_760 | 131 |
| 1029 | 3300048905 | Ga0496102_0014003 | Ga0496102_0014003_86_568 | 131 |
| 1030 | 3300048906 | Ga0496103_0017556 | Ga0496103_0017556_3371_3853 | 131 |
| 1031 | 3300048908 | Ga0496105_0208925 | Ga0496105_0208925_121_603 | 131 |
| 1032 | 3300048909 | Ga0496106_0001217 | Ga0496106_0001217_14391_14873 | 131 |
| 1033 | 3300048911 | Ga0496108_0371611 | Ga0496108_0371611_450_932 | 131 |
| 1034 | 3300048912 | Ga0496109_0132401 | Ga0496109_0132401_1114_1596 | 131 |
| 1035 | 3300048912 | Ga0496109_0301457 | Ga0496109_0301457_452_925 | 131 |
| 1036 | 3300048913 | Ga0496110_0802990 | Ga0496110_0802990_249_707 | 131 |
| 1037 | 3300048916 | Ga0496113_0377285 | Ga0496113_0377285_89_547 | 131 |
| 1038 | 3300048918 | Ga0496115_0023828 | Ga0496115_0023828_1298_1780 | 131 |
| 1039 | 3300048924 | Ga0496121_0009248 | Ga0496121_0009248_4634_5080 | 131 |
| 1040 | 3300048926 | Ga0496123_0263882 | Ga0496123_0263882_47_493 | 131 |
| 1041 | 3300048929 | Ga0496126_0267396 | Ga0496126_0267396_350_796 | 131 |
| 1042 | 3300049571 | Ga0501034_0002078 | Ga0501034_0002078_5294_5743 | 131 |
| 1043 | 3300049576 | Ga0501040_0673642 | Ga0501040_0673642_88_570 | 131 |
| 1044 | 3300049582 | Ga0501048_0038065 | Ga0501048_0038065_488_976 | 131 |
| 1045 | 3300049582 | Ga0501048_1215189 | Ga0501048_1215189_32_514 | 131 |
| 1046 | 3300049590 | Ga0501074_0678614 | Ga0501074_0678614_22_543 | 131 |
| 1047 | 3300049741 | Ga0501079_1276381 | Ga0501079_1276381_51_533 | 131 |
| 1048 | 3300049743 | Ga0501081_0912448 | Ga0501081_0912448_110_592 | 131 |
| 1049 | 3300050509 | nmdc:mga0qj67_716_c1 | nmdc:mga0qj67_716_c1_16244_16726 | 131 |
| 1050 | 3300050510 | nmdc:mga06r32_538_c1 | nmdc:mga06r32_538_c1_16069_16551 | 131 |
| 1051 | 3300053125 | Ga0500618_001417 | Ga0500618_001417_8730_9182 | 131 |
| 1052 | 3300053136 | Ga0500559_0012609 | Ga0500559_0012609_603_1070 | 131 |
| 1053 | 3300053139 | Ga0500568_0000175 | Ga0500568_0000175_41389_41865 | 131 |
| 1054 | 3300053153 | Ga0500616_0011795 | Ga0500616_0011795_428_895 | 131 |
| 1055 | 3300054114 | Ga0501084_1159304 | Ga0501084_1159304_48_530 | 131 |
| 1056 | 2209111006 | 2214702717 | 2213716880 | 132 |
| 1057 | 3300001979 | JGI24740J21852_10024850 | JGI24740J21852_100248502 | 132 |
| 1058 | 3300001989 | JGI24739J22299_10085637 | JGI24739J22299_100856372 | 132 |
| 1059 | 3300002067 | JGI24735J21928_10045816 | JGI24735J21928_100458162 | 132 |
| 1060 | 3300002704 | JGI25155J39150_1000011 | JGI25155J39150_1000011119 | 132 |
| 1061 | 3300002705 | JGI25156J39149_1000027 | JGI25156J39149_1000027119 | 132 |
| 1062 | 3300002705 | JGI25156J39149_1000030 | JGI25156J39149_100003033 | 132 |
| 1063 | 3300002705 | JGI25156J39149_1004453 | JGI25156J39149_10044533 | 132 |
| 1064 | 3300002738 | JGI25154J39366_1000057 | JGI25154J39366_100005746 | 132 |
| 1065 | 3300002741 | JGI25157J39369_1000010 | JGI25157J39369_100001092 | 132 |
| 1066 | 3300002741 | JGI25157J39369_1000604 | JGI25157J39369_10006048 | 132 |
| 1067 | 3300002773 | JGI25152J39213_1002131 | JGI25152J39213_10021316 | 132 |
| 1068 | 3300002774 | JGI25150J39212_1004304 | JGI25150J39212_10043044 | 132 |
| 1069 | 3300002987 | JGI25159J45721_1000006 | JGI25159J45721_100000679 | 132 |
| 1070 | 3300003187 | JGI25151J46595_10000238 | JGI25151J46595_1000023812 | 132 |
| 1071 | 3300003187 | JGI25151J46595_10009568 | JGI25151J46595_100095686 | 132 |
| 1072 | 3300003203 | JGI25406J46586_10008536 | JGI25406J46586_100085363 | 132 |
| 1073 | 3300003203 | JGI25406J46586_10045653 | JGI25406J46586_100456532 | 132 |
| 1074 | 3300003214 | JGI25165J46597_1000033 | JGI25165J46597_10000336 | 132 |
| 1075 | 3300003214 | JGI25165J46597_1000777 | JGI25165J46597_100077711 | 132 |
| 1076 | 3300003214 | JGI25165J46597_1007469 | JGI25165J46597_10074692 | 132 |
| 1077 | 3300003215 | JGI25153J46596_10002466 | JGI25153J46596_100024666 | 132 |
| 1078 | 3300003215 | JGI25153J46596_10010613 | JGI25153J46596_100106132 | 132 |
| 1079 | 3300003215 | JGI25153J46596_10070545 | JGI25153J46596_100705452 | 132 |
| 1080 | 3300003320 | rootH2_10012004 | rootH2_100120043 | 132 |
| 1081 | 3300003320 | rootH2_10040546 | rootH2_100405464 | 132 |
| 1082 | 3300003322 | rootL2_10034778 | rootL2_100347783 | 132 |
| 1083 | 3300003323 | rootH1_10017647 | rootH1_100176472 | 132 |
| 1084 | 3300003323 | rootH1_10113295 | rootH1_101132954 | 132 |
| 1085 | 3300003354 | JGI25160J50197_1000004 | JGI25160J50197_100000490 | 132 |
| 1086 | 3300003354 | JGI25160J50197_1000019 | JGI25160J50197_100001984 | 132 |
| 1087 | 3300003354 | JGI25160J50197_1004387 | JGI25160J50197_10043876 | 132 |
| 1088 | 3300003354 | JGI25160J50197_1036036 | JGI25160J50197_10360361 | 132 |
| 1089 | 3300003354 | JGI25160J50197_1043041 | JGI25160J50197_10430412 | 132 |
| 1090 | 3300003374 | JGI25161J50226_1000003 | JGI25161J50226_1000003338 | 132 |
| 1091 | 3300003374 | JGI25161J50226_1000330 | JGI25161J50226_100033019 | 132 |
| 1092 | 3300003374 | JGI25161J50226_1001454 | JGI25161J50226_10014546 | 132 |
| 1093 | 3300003374 | JGI25161J50226_1008427 | JGI25161J50226_10084272 | 132 |
| 1094 | 3300003762 | Ga0055542_1000762 | Ga0055542_10007627 | 132 |
| 1095 | 3300003763 | Ga0055529_1002106 | Ga0055529_10021064 | 132 |
| 1096 | 3300003771 | Ga0055526_1000565 | Ga0055526_100056513 | 132 |
| 1097 | 3300003771 | Ga0055526_1000669 | Ga0055526_100066914 | 132 |
| 1098 | 3300003771 | Ga0055526_1002226 | Ga0055526_100222613 | 132 |
| 1099 | 3300003771 | Ga0055526_1040249 | Ga0055526_10402492 | 132 |
| 1100 | 3300003775 | Ga0055524_1004582 | Ga0055524_10045824 | 132 |
| 1101 | 3300003775 | Ga0055524_1006212 | Ga0055524_10062124 | 132 |
| 1102 | 3300003775 | Ga0055524_1007214 | Ga0055524_10072143 | 132 |
| 1103 | 3300003775 | Ga0055524_1010237 | Ga0055524_10102373 | 132 |
| 1104 | 3300003775 | Ga0055524_1035612 | Ga0055524_10356122 | 132 |
| 1105 | 3300003781 | Ga0055536_1000212 | Ga0055536_100021240 | 132 |
| 1106 | 3300003781 | Ga0055536_1004763 | Ga0055536_10047633 | 132 |
| 1107 | 3300003784 | Ga0055534_1047945 | Ga0055534_10479451 | 132 |
| 1108 | 3300003790 | Ga0055528_1000918 | Ga0055528_100091811 | 132 |
| 1109 | 3300003790 | Ga0055528_1005988 | Ga0055528_10059882 | 132 |
| 1110 | 3300003790 | Ga0055528_1008737 | Ga0055528_10087371 | 132 |
| 1111 | 3300003790 | Ga0055528_1015144 | Ga0055528_10151442 | 132 |
| 1112 | 3300003790 | Ga0055528_1020888 | Ga0055528_10208882 | 132 |
| 1113 | 3300003791 | Ga0055530_10015221 | Ga0055530_100152213 | 132 |
| 1114 | 3300003791 | Ga0055530_10068443 | Ga0055530_100684432 | 132 |
| 1115 | 3300003792 | Ga0055540_1000285 | Ga0055540_100028525 | 132 |
| 1116 | 3300003792 | Ga0055540_1001884 | Ga0055540_10018844 | 132 |
| 1117 | 3300003792 | Ga0055540_1002932 | Ga0055540_10029323 | 132 |
| 1118 | 3300003792 | Ga0055540_1023537 | Ga0055540_10235372 | 132 |
| 1119 | 3300003792 | Ga0055540_1026148 | Ga0055540_10261481 | 132 |
| 1120 | 3300003792 | Ga0055540_1059536 | Ga0055540_10595361 | 132 |
| 1121 | 3300003792 | Ga0055540_1059940 | Ga0055540_10599402 | 132 |
| 1122 | 3300003794 | Ga0055531_10001165 | Ga0055531_100011658 | 132 |
| 1123 | 3300003794 | Ga0055531_10014995 | Ga0055531_100149952 | 132 |
| 1124 | 3300003794 | Ga0055531_10069570 | Ga0055531_100695701 | 132 |
| 1125 | 3300003856 | Ga0058692_1004051 | Ga0058692_10040515 | 132 |
| 1126 | 3300004625 | Ga0055543_1000001 | Ga0055543_1000001344 | 132 |
| 1127 | 3300004625 | Ga0055543_1000019 | Ga0055543_100001933 | 132 |
| 1128 | 3300004625 | Ga0055543_1000147 | Ga0055543_100014748 | 132 |
| 1129 | 3300004625 | Ga0055543_1000808 | Ga0055543_100080811 | 132 |
| 1130 | 3300005262 | Ga0065165_1000049 | Ga0065165_100004968 | 132 |
| 1131 | 3300005262 | Ga0065165_1000180 | Ga0065165_100018085 | 132 |
| 1132 | 3300005262 | Ga0065165_1017852 | Ga0065165_10178522 | 132 |
| 1133 | 3300005262 | Ga0065165_1024195 | Ga0065165_10241952 | 132 |
| 1134 | 3300005327 | Ga0070658_10032973 | Ga0070658_100329734 | 132 |
| 1135 | 3300005327 | Ga0070658_11253983 | Ga0070658_112539832 | 132 |
| 1136 | 3300005331 | Ga0070670_100001443 | Ga0070670_10000144310 | 132 |
| 1137 | 3300005344 | Ga0070661_100680165 | Ga0070661_1006801652 | 132 |
| 1138 | 3300005347 | Ga0070668_100629226 | Ga0070668_1006292262 | 132 |
| 1139 | 3300005355 | Ga0070671_100310609 | Ga0070671_1003106092 | 132 |
| 1140 | 3300005355 | Ga0070671_100434568 | Ga0070671_1004345682 | 132 |
| 1141 | 3300005356 | Ga0070674_100319133 | Ga0070674_1003191332 | 132 |
| 1142 | 3300005366 | Ga0070659_100090030 | Ga0070659_1000900303 | 132 |
| 1143 | 3300005457 | Ga0070662_100910096 | Ga0070662_1009100962 | 132 |
| 1144 | 3300005530 | Ga0070679_100050610 | Ga0070679_1000506105 | 132 |
| 1145 | 3300005536 | Ga0070697_100000987 | Ga0070697_1000009874 | 132 |
| 1146 | 3300005539 | Ga0068853_100002083 | Ga0068853_10000208312 | 132 |
| 1147 | 3300005539 | Ga0068853_100320060 | Ga0068853_1003200602 | 132 |
| 1148 | 3300005539 | Ga0068853_101041001 | Ga0068853_1010410011 | 132 |
| 1149 | 3300005545 | Ga0070695_100004914 | Ga0070695_1000049147 | 132 |
| 1150 | 3300005548 | Ga0070665_100166889 | Ga0070665_1001668892 | 132 |
| 1151 | 3300005548 | Ga0070665_100244907 | Ga0070665_1002449073 | 132 |
| 1152 | 3300005548 | Ga0070665_100287216 | Ga0070665_1002872163 | 132 |
| 1153 | 3300005548 | Ga0070665_100464658 | Ga0070665_1004646581 | 132 |
| 1154 | 3300005548 | Ga0070665_100642398 | Ga0070665_1006423982 | 132 |
| 1155 | 3300005548 | Ga0070665_100715156 | Ga0070665_1007151561 | 132 |
| 1156 | 3300005563 | Ga0068855_100081541 | Ga0068855_1000815413 | 132 |
| 1157 | 3300005563 | Ga0068855_100147887 | Ga0068855_1001478873 | 132 |
| 1158 | 3300005563 | Ga0068855_101151476 | Ga0068855_1011514762 | 132 |
| 1159 | 3300005577 | Ga0068857_100057532 | Ga0068857_1000575322 | 132 |
| 1160 | 3300005614 | Ga0068856_100069999 | Ga0068856_1000699993 | 132 |
| 1161 | 3300005614 | Ga0068856_100108448 | Ga0068856_1001084483 | 132 |
| 1162 | 3300005614 | Ga0068856_100382539 | Ga0068856_1003825392 | 132 |
| 1163 | 3300005614 | Ga0068856_100523781 | Ga0068856_1005237812 | 132 |
| 1164 | 3300005616 | Ga0068852_100082239 | Ga0068852_1000822392 | 132 |
| 1165 | 3300005617 | Ga0068859_100051166 | Ga0068859_1000511662 | 132 |
| 1166 | 3300005834 | Ga0068851_10104616 | Ga0068851_101046163 | 132 |
| 1167 | 3300005842 | Ga0068858_100136804 | Ga0068858_1001368042 | 132 |
| 1168 | 3300005843 | Ga0068860_100877418 | Ga0068860_1008774182 | 132 |
| 1169 | 3300005937 | Ga0081455_10262695 | Ga0081455_102626952 | 132 |
| 1170 | 3300005937 | Ga0081455_10706243 | Ga0081455_107062431 | 132 |
| 1171 | 3300005985 | Ga0081539_10001354 | Ga0081539_1000135417 | 132 |
| 1172 | 3300005985 | Ga0081539_10002915 | Ga0081539_100029159 | 132 |
| 1173 | 3300006038 | Ga0075365_10000771 | Ga0075365_100007717 | 132 |
| 1174 | 3300006038 | Ga0075365_10019973 | Ga0075365_100199733 | 132 |
| 1175 | 3300006038 | Ga0075365_10028318 | Ga0075365_100283184 | 132 |
| 1176 | 3300006038 | Ga0075365_10049392 | Ga0075365_100493923 | 132 |
| 1177 | 3300006038 | Ga0075365_10055143 | Ga0075365_100551433 | 132 |
| 1178 | 3300006038 | Ga0075365_10253425 | Ga0075365_102534252 | 132 |
| 1179 | 3300006038 | Ga0075365_10536379 | Ga0075365_105363792 | 132 |
| 1180 | 3300006042 | Ga0075368_10058667 | Ga0075368_100586672 | 132 |
| 1181 | 3300006042 | Ga0075368_10063670 | Ga0075368_100636702 | 132 |
| 1182 | 3300006042 | Ga0075368_10119436 | Ga0075368_101194362 | 132 |
| 1183 | 3300006048 | Ga0075363_100012667 | Ga0075363_1000126673 | 132 |
| 1184 | 3300006048 | Ga0075363_100050250 | Ga0075363_1000502502 | 132 |
| 1185 | 3300006048 | Ga0075363_100099987 | Ga0075363_1000999872 | 132 |
| 1186 | 3300006048 | Ga0075363_100100272 | Ga0075363_1001002723 | 132 |
| 1187 | 3300006048 | Ga0075363_100133720 | Ga0075363_1001337202 | 132 |
| 1188 | 3300006048 | Ga0075363_100731597 | Ga0075363_1007315971 | 132 |
| 1189 | 3300006051 | Ga0075364_10008131 | Ga0075364_100081315 | 132 |
| 1190 | 3300006051 | Ga0075364_10120674 | Ga0075364_101206742 | 132 |
| 1191 | 3300006051 | Ga0075364_10148623 | Ga0075364_101486233 | 132 |
| 1192 | 3300006051 | Ga0075364_10920067 | Ga0075364_109200671 | 132 |
| 1193 | 3300006177 | Ga0075362_10051910 | Ga0075362_100519102 | 132 |
| 1194 | 3300006177 | Ga0075362_10224417 | Ga0075362_102244172 | 132 |
| 1195 | 3300006178 | Ga0075367_10026480 | Ga0075367_100264803 | 132 |
| 1196 | 3300006178 | Ga0075367_10050505 | Ga0075367_100505054 | 132 |
| 1197 | 3300006178 | Ga0075367_10087828 | Ga0075367_100878282 | 132 |
| 1198 | 3300006178 | Ga0075367_10184751 | Ga0075367_101847511 | 132 |
| 1199 | 3300006178 | Ga0075367_10197438 | Ga0075367_101974381 | 132 |
| 1200 | 3300006178 | Ga0075367_10279322 | Ga0075367_102793222 | 132 |
| 1201 | 3300006178 | Ga0075367_10516081 | Ga0075367_105160812 | 132 |
| 1202 | 3300006186 | Ga0075369_10002912 | Ga0075369_100029122 | 132 |
| 1203 | 3300006186 | Ga0075369_10004806 | Ga0075369_100048065 | 132 |
| 1204 | 3300006186 | Ga0075369_10019597 | Ga0075369_100195972 | 132 |
| 1205 | 3300006186 | Ga0075369_10097492 | Ga0075369_100974922 | 132 |
| 1206 | 3300006186 | Ga0075369_10316536 | Ga0075369_103165362 | 132 |
| 1207 | 3300006195 | Ga0075366_10003432 | Ga0075366_100034324 | 132 |
| 1208 | 3300006195 | Ga0075366_10365675 | Ga0075366_103656752 | 132 |
| 1209 | 3300006353 | Ga0075370_10041398 | Ga0075370_100413982 | 132 |
| 1210 | 3300006353 | Ga0075370_10070723 | Ga0075370_100707233 | 132 |
| 1211 | 3300006353 | Ga0075370_10165121 | Ga0075370_101651212 | 132 |
| 1212 | 3300006353 | Ga0075370_10208580 | Ga0075370_102085802 | 132 |
| 1213 | 3300006353 | Ga0075370_10619750 | Ga0075370_106197502 | 132 |
| 1214 | 3300006881 | Ga0068865_101490036 | Ga0068865_1014900361 | 132 |
| 1215 | 3300006931 | Ga0097620_100051168 | Ga0097620_1000511682 | 132 |
| 1216 | 3300006946 | Ga0079104_1000187 | Ga0079104_100018742 | 132 |
| 1217 | 3300006946 | Ga0079104_1001924 | Ga0079104_100192410 | 132 |
| 1218 | 3300006948 | Ga0099826_10004117 | Ga0099826_1000411710 | 132 |
| 1219 | 3300007076 | Ga0075435_100061966 | Ga0075435_1000619662 | 132 |
| 1220 | 3300009011 | Ga0105251_10011989 | Ga0105251_100119895 | 132 |
| 1221 | 3300009093 | Ga0105240_10000005 | Ga0105240_10000005333 | 132 |
| 1222 | 3300009093 | Ga0105240_10483353 | Ga0105240_104833532 | 132 |
| 1223 | 3300009093 | Ga0105240_10698477 | Ga0105240_106984771 | 132 |
| 1224 | 3300009093 | Ga0105240_10799296 | Ga0105240_107992962 | 132 |
| 1225 | 3300009098 | Ga0105245_10504020 | Ga0105245_105040203 | 132 |
| 1226 | 3300009101 | Ga0105247_10011923 | Ga0105247_100119235 | 132 |
| 1227 | 3300009148 | Ga0105243_10121413 | Ga0105243_101214133 | 132 |
| 1228 | 3300009174 | Ga0105241_10012824 | Ga0105241_100128242 | 132 |
| 1229 | 3300009174 | Ga0105241_10203860 | Ga0105241_102038602 | 132 |
| 1230 | 3300009174 | Ga0105241_10389862 | Ga0105241_103898622 | 132 |
| 1231 | 3300009545 | Ga0105237_10002240 | Ga0105237_1000224025 | 132 |
| 1232 | 3300009551 | Ga0105238_10038126 | Ga0105238_100381264 | 132 |
| 1233 | 3300009551 | Ga0105238_10605306 | Ga0105238_106053062 | 132 |
| 1234 | 3300009551 | Ga0105238_11301184 | Ga0105238_113011842 | 132 |
| 1235 | 3300009765 | Ga0123341_1000001 | Ga0123341_100000137 | 132 |
| 1236 | 3300009766 | Ga0123342_1008195 | Ga0123342_10081957 | 132 |
| 1237 | 3300009766 | Ga0123342_1028840 | Ga0123342_10288402 | 132 |
| 1238 | 3300010375 | Ga0105239_10000739 | Ga0105239_1000073926 | 132 |
| 1239 | 3300010375 | Ga0105239_10164100 | Ga0105239_101641003 | 132 |
| 1240 | 3300010375 | Ga0105239_10799707 | Ga0105239_107997072 | 132 |
| 1241 | 3300010375 | Ga0105239_11064602 | Ga0105239_110646021 | 132 |
| 1242 | 3300011119 | Ga0105246_11329567 | Ga0105246_113295671 | 132 |
| 1243 | 3300012497 | Ga0157319_1053546 | Ga0157319_10535461 | 132 |
| 1244 | 3300013102 | Ga0157371_10005765 | Ga0157371_100057656 | 132 |
| 1245 | 3300013102 | Ga0157371_10275070 | Ga0157371_102750701 | 132 |
| 1246 | 3300013104 | Ga0157370_10000284 | Ga0157370_1000028415 | 132 |
| 1247 | 3300013104 | Ga0157370_10337116 | Ga0157370_103371162 | 132 |
| 1248 | 3300013105 | Ga0157369_11347411 | Ga0157369_113474112 | 132 |
| 1249 | 3300013249 | Ga0171463_1011 | Ga0171463_1011137 | 132 |
| 1250 | 3300013296 | Ga0157374_10261982 | Ga0157374_102619821 | 132 |
| 1251 | 3300013296 | Ga0157374_10515065 | Ga0157374_105150652 | 132 |
| 1252 | 3300013296 | Ga0157374_11875973 | Ga0157374_118759731 | 132 |
| 1253 | 3300013297 | Ga0157378_10428295 | Ga0157378_104282952 | 132 |
| 1254 | 3300013297 | Ga0157378_10821988 | Ga0157378_108219882 | 132 |
| 1255 | 3300013297 | Ga0157378_10858029 | Ga0157378_108580291 | 132 |
| 1256 | 3300013307 | Ga0157372_10704181 | Ga0157372_107041812 | 132 |
| 1257 | 3300013307 | Ga0157372_11034046 | Ga0157372_110340462 | 132 |
| 1258 | 3300013307 | Ga0157372_11765158 | Ga0157372_117651582 | 132 |
| 1259 | 3300013308 | Ga0157375_11897175 | Ga0157375_118971752 | 132 |
| 1260 | 3300013308 | Ga0157375_12566204 | Ga0157375_125662041 | 132 |
| 1261 | 3300014325 | Ga0163163_11471464 | Ga0163163_114714641 | 132 |
| 1262 | 3300014497 | Ga0182008_10132875 | Ga0182008_101328752 | 132 |
| 1263 | 3300014497 | Ga0182008_10336259 | Ga0182008_103362592 | 132 |
| 1264 | 3300015261 | Ga0182006_1014407 | Ga0182006_10144074 | 132 |
| 1265 | 3300015262 | Ga0182007_10108824 | Ga0182007_101088242 | 132 |
| 1266 | 3300015262 | Ga0182007_10287558 | Ga0182007_102875581 | 132 |
| 1267 | 3300015265 | Ga0182005_1006191 | Ga0182005_10061913 | 132 |
| 1268 | 3300015690 | Ga0183363_1111 | Ga0183363_111117 | 132 |
| 1269 | 3300017792 | Ga0163161_10684764 | Ga0163161_106847642 | 132 |
| 1270 | 3300017792 | Ga0163161_11316251 | Ga0163161_113162511 | 132 |
| 1271 | 3300021320 | Ga0214544_1000265 | Ga0214544_100026531 | 132 |
| 1272 | 3300021321 | Ga0214542_1000015 | Ga0214542_1000015192 | 132 |
| 1273 | 3300021327 | Ga0214543_1000011 | Ga0214543_1000011236 | 132 |
| 1274 | 3300021327 | Ga0214543_1000032 | Ga0214543_100003282 | 132 |
| 1275 | 3300022739 | Ga0228711_1000012 | Ga0228711_100001266 | 132 |
| 1276 | 3300022740 | Ga0228710_1000006 | Ga0228710_100000666 | 132 |
| 1277 | 3300025206 | Ga0209435_100022 | Ga0209435_10002290 | 132 |
| 1278 | 3300025208 | Ga0209436_100038 | Ga0209436_10003851 | 132 |
| 1279 | 3300025208 | Ga0209436_100837 | Ga0209436_1008379 | 132 |
| 1280 | 3300025208 | Ga0209436_111465 | Ga0209436_1114652 | 132 |
| 1281 | 3300025228 | Ga0209672_111952 | Ga0209672_1119522 | 132 |
| 1282 | 3300025233 | Ga0209437_100160 | Ga0209437_100160129 | 132 |
| 1283 | 3300025233 | Ga0209437_100310 | Ga0209437_10031042 | 132 |
| 1284 | 3300025245 | Ga0207425_1011762 | Ga0207425_10117622 | 132 |
| 1285 | 3300025245 | Ga0207425_1017027 | Ga0207425_10170273 | 132 |
| 1286 | 3300025245 | Ga0207425_1021384 | Ga0207425_10213842 | 132 |
| 1287 | 3300025245 | Ga0207425_1032792 | Ga0207425_10327922 | 132 |
| 1288 | 3300025245 | Ga0207425_1046284 | Ga0207425_10462842 | 132 |
| 1289 | 3300025246 | Ga0209646_1000078 | Ga0209646_100007890 | 132 |
| 1290 | 3300025250 | Ga0209026_1000002 | Ga0209026_1000002544 | 132 |
| 1291 | 3300025250 | Ga0209026_1000065 | Ga0209026_100006590 | 132 |
| 1292 | 3300025253 | Ga0209677_101256 | Ga0209677_1012567 | 132 |
| 1293 | 3300025254 | Ga0209148_1000570 | Ga0209148_100057028 | 132 |
| 1294 | 3300025256 | Ga0209759_1000055 | Ga0209759_100005590 | 132 |
| 1295 | 3300025256 | Ga0209759_1000119 | Ga0209759_100011982 | 132 |
| 1296 | 3300025256 | Ga0209759_1012005 | Ga0209759_10120052 | 132 |
| 1297 | 3300025258 | Ga0209129_1000349 | Ga0209129_100034936 | 132 |
| 1298 | 3300025258 | Ga0209129_1000432 | Ga0209129_100043226 | 132 |
| 1299 | 3300025258 | Ga0209129_1000442 | Ga0209129_10004426 | 132 |
| 1300 | 3300025258 | Ga0209129_1002862 | Ga0209129_10028627 | 132 |
| 1301 | 3300025258 | Ga0209129_1012729 | Ga0209129_10127292 | 132 |
| 1302 | 3300025261 | Ga0209233_1000027 | Ga0209233_1000027658 | 132 |
| 1303 | 3300025261 | Ga0209233_1000168 | Ga0209233_100016833 | 132 |
| 1304 | 3300025261 | Ga0209233_1000269 | Ga0209233_100026955 | 132 |
| 1305 | 3300025261 | Ga0209233_1000303 | Ga0209233_100030342 | 132 |
| 1306 | 3300025272 | Ga0209455_1000204 | Ga0209455_100020492 | 132 |
| 1307 | 3300025273 | Ga0209673_1000068 | Ga0209673_1000068182 | 132 |
| 1308 | 3300025273 | Ga0209673_1000139 | Ga0209673_1000139125 | 132 |
| 1309 | 3300025273 | Ga0209673_1001538 | Ga0209673_10015389 | 132 |
| 1310 | 3300025273 | Ga0209673_1002227 | Ga0209673_10022276 | 132 |
| 1311 | 3300025273 | Ga0209673_1005579 | Ga0209673_10055796 | 132 |
| 1312 | 3300025273 | Ga0209673_1008099 | Ga0209673_10080993 | 132 |
| 1313 | 3300025273 | Ga0209673_1015353 | Ga0209673_10153534 | 132 |
| 1314 | 3300025273 | Ga0209673_1056305 | Ga0209673_10563051 | 132 |
| 1315 | 3300025284 | Ga0209130_1000007 | Ga0209130_1000007437 | 132 |
| 1316 | 3300025284 | Ga0209130_1000012 | Ga0209130_100001290 | 132 |
| 1317 | 3300025284 | Ga0209130_1000097 | Ga0209130_100009755 | 132 |
| 1318 | 3300025284 | Ga0209130_1015683 | Ga0209130_10156833 | 132 |
| 1319 | 3300025284 | Ga0209130_1029780 | Ga0209130_10297802 | 132 |
| 1320 | 3300025291 | Ga0209675_1050911 | Ga0209675_10509112 | 132 |
| 1321 | 3300025292 | Ga0209676_1000399 | Ga0209676_100039914 | 132 |
| 1322 | 3300025292 | Ga0209676_1006026 | Ga0209676_10060264 | 132 |
| 1323 | 3300025294 | Ga0209025_1000237 | Ga0209025_100023739 | 132 |
| 1324 | 3300025294 | Ga0209025_1000358 | Ga0209025_10003583 | 132 |
| 1325 | 3300025294 | Ga0209025_1000729 | Ga0209025_100072926 | 132 |
| 1326 | 3300025294 | Ga0209025_1000923 | Ga0209025_100092343 | 132 |
| 1327 | 3300025294 | Ga0209025_1000949 | Ga0209025_100094933 | 132 |
| 1328 | 3300025294 | Ga0209025_1004865 | Ga0209025_10048659 | 132 |
| 1329 | 3300025294 | Ga0209025_1005123 | Ga0209025_100512312 | 132 |
| 1330 | 3300025294 | Ga0209025_1058527 | Ga0209025_10585272 | 132 |
| 1331 | 3300025294 | Ga0209025_1071341 | Ga0209025_10713412 | 132 |
| 1332 | 3300025294 | Ga0209025_1099690 | Ga0209025_10996902 | 132 |
| 1333 | 3300025294 | Ga0209025_1131642 | Ga0209025_11316422 | 132 |
| 1334 | 3300025295 | Ga0209564_1000140 | Ga0209564_100014060 | 132 |
| 1335 | 3300025295 | Ga0209564_1000794 | Ga0209564_100079433 | 132 |
| 1336 | 3300025295 | Ga0209564_1000802 | Ga0209564_100080231 | 132 |
| 1337 | 3300025295 | Ga0209564_1000868 | Ga0209564_100086825 | 132 |
| 1338 | 3300025295 | Ga0209564_1001618 | Ga0209564_100161813 | 132 |
| 1339 | 3300025295 | Ga0209564_1005687 | Ga0209564_10056873 | 132 |
| 1340 | 3300025295 | Ga0209564_1014049 | Ga0209564_10140492 | 132 |
| 1341 | 3300025295 | Ga0209564_1041733 | Ga0209564_10417332 | 132 |
| 1342 | 3300025297 | Ga0209758_1000155 | Ga0209758_100015586 | 132 |
| 1343 | 3300025297 | Ga0209758_1000545 | Ga0209758_100054533 | 132 |
| 1344 | 3300025297 | Ga0209758_1000587 | Ga0209758_100058731 | 132 |
| 1345 | 3300025297 | Ga0209758_1001100 | Ga0209758_100110031 | 132 |
| 1346 | 3300025297 | Ga0209758_1002445 | Ga0209758_10024459 | 132 |
| 1347 | 3300025297 | Ga0209758_1007782 | Ga0209758_10077825 | 132 |
| 1348 | 3300025297 | Ga0209758_1019396 | Ga0209758_10193965 | 132 |
| 1349 | 3300025297 | Ga0209758_1026684 | Ga0209758_10266842 | 132 |
| 1350 | 3300025297 | Ga0209758_1100007 | Ga0209758_11000072 | 132 |
| 1351 | 3300025298 | Ga0209050_1000650 | Ga0209050_100065034 | 132 |
| 1352 | 3300025298 | Ga0209050_1005095 | Ga0209050_10050955 | 132 |
| 1353 | 3300025298 | Ga0209050_1021205 | Ga0209050_10212053 | 132 |
| 1354 | 3300025299 | Ga0209256_1000557 | Ga0209256_100055724 | 132 |
| 1355 | 3300025299 | Ga0209256_1000687 | Ga0209256_100068736 | 132 |
| 1356 | 3300025299 | Ga0209256_1001048 | Ga0209256_100104822 | 132 |
| 1357 | 3300025299 | Ga0209256_1001371 | Ga0209256_10013719 | 132 |
| 1358 | 3300025299 | Ga0209256_1004147 | Ga0209256_10041474 | 132 |
| 1359 | 3300025299 | Ga0209256_1004371 | Ga0209256_10043719 | 132 |
| 1360 | 3300025299 | Ga0209256_1010809 | Ga0209256_10108096 | 132 |
| 1361 | 3300025299 | Ga0209256_1023871 | Ga0209256_10238713 | 132 |
| 1362 | 3300025299 | Ga0209256_1048199 | Ga0209256_10481991 | 132 |
| 1363 | 3300025302 | Ga0207426_1000003 | Ga0207426_1000003810 | 132 |
| 1364 | 3300025302 | Ga0207426_1000010 | Ga0207426_1000010449 | 132 |
| 1365 | 3300025302 | Ga0207426_1000094 | Ga0207426_10000942 | 132 |
| 1366 | 3300025302 | Ga0207426_1000111 | Ga0207426_100011178 | 132 |
| 1367 | 3300025302 | Ga0207426_1001840 | Ga0207426_100184011 | 132 |
| 1368 | 3300025303 | Ga0209051_1000095 | Ga0209051_1000095163 | 132 |
| 1369 | 3300025303 | Ga0209051_1001031 | Ga0209051_100103111 | 132 |
| 1370 | 3300025303 | Ga0209051_1001191 | Ga0209051_100119110 | 132 |
| 1371 | 3300025303 | Ga0209051_1003503 | Ga0209051_10035037 | 132 |
| 1372 | 3300025303 | Ga0209051_1007144 | Ga0209051_10071442 | 132 |
| 1373 | 3300025303 | Ga0209051_1008543 | Ga0209051_10085435 | 132 |
| 1374 | 3300025303 | Ga0209051_1017165 | Ga0209051_10171654 | 132 |
| 1375 | 3300025303 | Ga0209051_1072572 | Ga0209051_10725722 | 132 |
| 1376 | 3300025304 | Ga0209257_1001962 | Ga0209257_10019629 | 132 |
| 1377 | 3300025304 | Ga0209257_1003296 | Ga0209257_10032968 | 132 |
| 1378 | 3300025304 | Ga0209257_1010294 | Ga0209257_10102947 | 132 |
| 1379 | 3300025304 | Ga0209257_1060930 | Ga0209257_10609302 | 132 |
| 1380 | 3300025321 | Ga0207656_10064226 | Ga0207656_100642263 | 132 |
| 1381 | 3300025904 | Ga0207647_10072033 | Ga0207647_100720332 | 132 |
| 1382 | 3300025904 | Ga0207647_10402909 | Ga0207647_104029091 | 132 |
| 1383 | 3300025909 | Ga0207705_10743623 | Ga0207705_107436232 | 132 |
| 1384 | 3300025911 | Ga0207654_10024617 | Ga0207654_100246174 | 132 |
| 1385 | 3300025911 | Ga0207654_10119520 | Ga0207654_101195202 | 132 |
| 1386 | 3300025911 | Ga0207654_10161375 | Ga0207654_101613752 | 132 |
| 1387 | 3300025911 | Ga0207654_10581839 | Ga0207654_105818392 | 132 |
| 1388 | 3300025913 | Ga0207695_10000011 | Ga0207695_10000011581 | 132 |
| 1389 | 3300025913 | Ga0207695_10116388 | Ga0207695_101163883 | 132 |
| 1390 | 3300025913 | Ga0207695_10416388 | Ga0207695_104163882 | 132 |
| 1391 | 3300025913 | Ga0207695_10881666 | Ga0207695_108816661 | 132 |
| 1392 | 3300025914 | Ga0207671_10001291 | Ga0207671_100012913 | 132 |
| 1393 | 3300025914 | Ga0207671_10057729 | Ga0207671_100577294 | 132 |
| 1394 | 3300025914 | Ga0207671_10068428 | Ga0207671_100684284 | 132 |
| 1395 | 3300025917 | Ga0207660_10113774 | Ga0207660_101137743 | 132 |
| 1396 | 3300025918 | Ga0207662_10084295 | Ga0207662_100842952 | 132 |
| 1397 | 3300025919 | Ga0207657_10208952 | Ga0207657_102089522 | 132 |
| 1398 | 3300025923 | Ga0207681_11041881 | Ga0207681_110418812 | 132 |
| 1399 | 3300025924 | Ga0207694_10018894 | Ga0207694_100188944 | 132 |
| 1400 | 3300025925 | Ga0207650_10002090 | Ga0207650_100020906 | 132 |
| 1401 | 3300025925 | Ga0207650_10101930 | Ga0207650_101019302 | 132 |
| 1402 | 3300025927 | Ga0207687_10068838 | Ga0207687_100688382 | 132 |
| 1403 | 3300025927 | Ga0207687_10449791 | Ga0207687_104497912 | 132 |
| 1404 | 3300025931 | Ga0207644_10136348 | Ga0207644_101363482 | 132 |
| 1405 | 3300025932 | Ga0207690_10022460 | Ga0207690_100224603 | 132 |
| 1406 | 3300025935 | Ga0207709_10323219 | Ga0207709_103232191 | 132 |
| 1407 | 3300025935 | Ga0207709_10324599 | Ga0207709_103245992 | 132 |
| 1408 | 3300025937 | Ga0207669_10229582 | Ga0207669_102295821 | 132 |
| 1409 | 3300025938 | Ga0207704_10877843 | Ga0207704_108778432 | 132 |
| 1410 | 3300025949 | Ga0207667_10060300 | Ga0207667_100603004 | 132 |
| 1411 | 3300025949 | Ga0207667_10375499 | Ga0207667_103754993 | 132 |
| 1412 | 3300025949 | Ga0207667_10888412 | Ga0207667_108884122 | 132 |
| 1413 | 3300025972 | Ga0207668_10454674 | Ga0207668_104546743 | 132 |
| 1414 | 3300025972 | Ga0207668_10488791 | Ga0207668_104887912 | 132 |
| 1415 | 3300025972 | Ga0207668_12083217 | Ga0207668_120832171 | 132 |
| 1416 | 3300025981 | Ga0207640_11271407 | Ga0207640_112714072 | 132 |
| 1417 | 3300025986 | Ga0207658_10195410 | Ga0207658_101954103 | 132 |
| 1418 | 3300026035 | Ga0207703_10281150 | Ga0207703_102811502 | 132 |
| 1419 | 3300026041 | Ga0207639_10032104 | Ga0207639_100321045 | 132 |
| 1420 | 3300026041 | Ga0207639_10290502 | Ga0207639_102905022 | 132 |
| 1421 | 3300026067 | Ga0207678_11150419 | Ga0207678_111504192 | 132 |
| 1422 | 3300026078 | Ga0207702_10055211 | Ga0207702_100552113 | 132 |
| 1423 | 3300026078 | Ga0207702_10076099 | Ga0207702_100760994 | 132 |
| 1424 | 3300026078 | Ga0207702_10222409 | Ga0207702_102224092 | 132 |
| 1425 | 3300026089 | Ga0207648_10166316 | Ga0207648_101663162 | 132 |
| 1426 | 3300026116 | Ga0207674_10071651 | Ga0207674_100716512 | 132 |
| 1427 | 3300026116 | Ga0207674_10244903 | Ga0207674_102449033 | 132 |
| 1428 | 3300026121 | Ga0207683_10197424 | Ga0207683_101974242 | 132 |
| 1429 | 3300026142 | Ga0207698_10391441 | Ga0207698_103914412 | 132 |
| 1430 | 3300026142 | Ga0207698_10750481 | Ga0207698_107504812 | 132 |
| 1431 | 3300027111 | Ga0209281_1000310 | Ga0209281_100031042 | 132 |
| 1432 | 3300027111 | Ga0209281_1000334 | Ga0209281_100033463 | 132 |
| 1433 | 3300027111 | Ga0209281_1000361 | Ga0209281_100036164 | 132 |
| 1434 | 3300027312 | Ga0209371_1000021 | Ga0209371_1000021174 | 132 |
| 1435 | 3300027312 | Ga0209371_1000469 | Ga0209371_100046915 | 132 |
| 1436 | 3300027312 | Ga0209371_1001465 | Ga0209371_100146514 | 132 |
| 1437 | 3300027666 | Ga0209282_1000073 | Ga0209282_100007363 | 132 |
| 1438 | 3300027666 | Ga0209282_1000162 | Ga0209282_10001626 | 132 |
| 1439 | 3300027666 | Ga0209282_1182870 | Ga0209282_11828702 | 132 |
| 1440 | 3300027866 | Ga0209813_10117222 | Ga0209813_101172222 | 132 |
| 1441 | 3300028379 | Ga0268266_10182102 | Ga0268266_101821022 | 132 |
| 1442 | 3300028379 | Ga0268266_10220018 | Ga0268266_102200182 | 132 |
| 1443 | 3300028379 | Ga0268266_10817448 | Ga0268266_108174482 | 132 |
| 1444 | 3300028381 | Ga0268264_10773687 | Ga0268264_107736872 | 132 |
| 1445 | 3300028794 | Ga0307515_10000844 | Ga0307515_100008442 | 132 |
| 1446 | 3300028794 | Ga0307515_10004389 | Ga0307515_1000438918 | 132 |
| 1447 | 3300028794 | Ga0307515_10013773 | Ga0307515_1001377310 | 132 |
| 1448 | 3300028794 | Ga0307515_10020621 | Ga0307515_100206219 | 132 |
| 1449 | 3300030500 | Ga0268256_1000020 | Ga0268256_1000020180 | 132 |
| 1450 | 3300030500 | Ga0268256_1001794 | Ga0268256_100179410 | 132 |
| 1451 | 3300030500 | Ga0268256_1003189 | Ga0268256_10031899 | 132 |
| 1452 | 3300031456 | Ga0307513_10002223 | Ga0307513_1000222321 | 132 |
| 1453 | 3300031456 | Ga0307513_10134632 | Ga0307513_101346323 | 132 |
| 1454 | 3300031456 | Ga0307513_10674661 | Ga0307513_106746612 | 132 |
| 1455 | 3300031548 | Ga0307408_100164938 | Ga0307408_1001649383 | 132 |
| 1456 | 3300031548 | Ga0307408_100731680 | Ga0307408_1007316802 | 132 |
| 1457 | 3300031649 | Ga0307514_10300077 | Ga0307514_103000771 | 132 |
| 1458 | 3300031852 | Ga0307410_10349349 | Ga0307410_103493493 | 132 |
| 1459 | 3300031911 | Ga0307412_10083096 | Ga0307412_100830963 | 132 |
| 1460 | 3300031911 | Ga0307412_10914255 | Ga0307412_109142551 | 132 |
| 1461 | 3300031967 | Ga0315914_1000008 | Ga0315914_100000865 | 132 |
| 1462 | 3300031995 | Ga0307409_100255774 | Ga0307409_1002557743 | 132 |
| 1463 | 3300032002 | Ga0307416_100266271 | Ga0307416_1002662712 | 132 |
| 1464 | 3300032002 | Ga0307416_100668926 | Ga0307416_1006689263 | 132 |
| 1465 | 3300032004 | Ga0307414_10072609 | Ga0307414_100726093 | 132 |
| 1466 | 3300032005 | Ga0307411_10544797 | Ga0307411_105447971 | 132 |
| 1467 | 3300033180 | Ga0307510_10380280 | Ga0307510_103802802 | 132 |
| 1468 | 3300033430 | Ga0315913_1000688 | Ga0315913_100068813 | 132 |
| 1469 | 3300033464 | Ga0315915_1000014 | Ga0315915_1000014111 | 132 |
| 1470 | 3300035112 | Ga0373932_0296923 | Ga0373932_0296923_126_581 | 132 |
| 1471 | 3300035695 | Ga0373927_0000055 | Ga0373927_0000055_71094_71543 | 132 |
| 1472 | 3300037068 | Ga0373925_0002979 | Ga0373925_0002979_8370_8819 | 132 |
| 1473 | 3300037418 | Ga0395900_0022761 | Ga0395900_0022761_3970_4425 | 132 |
| 1474 | 3300037418 | Ga0395900_0246642 | Ga0395900_0246642_1089_1544 | 132 |
| 1475 | 3300037418 | Ga0395900_0560544 | Ga0395900_0560544_126_581 | 132 |
| 1476 | 3300037471 | Ga0395905_0000325 | Ga0395905_0000325_23961_24431 | 132 |
| 1477 | 3300037471 | Ga0395905_0013938 | Ga0395905_0013938_2083_2538 | 132 |
| 1478 | 3300037471 | Ga0395905_0018905 | Ga0395905_0018905_5274_5729 | 132 |
| 1479 | 3300037471 | Ga0395905_0105392 | Ga0395905_0105392_2123_2578 | 132 |
| 1480 | 3300037471 | Ga0395905_0341137 | Ga0395905_0341137_374_829 | 132 |
| 1481 | 3300038443 | Ga0395901_0068865 | Ga0395901_0068865_878_1333 | 132 |
| 1482 | 3300038443 | Ga0395901_0108822 | Ga0395901_0108822_1507_1962 | 132 |
| 1483 | 3300038443 | Ga0395901_0659512 | Ga0395901_0659512_565_1020 | 132 |
| 1484 | 3300041404 | Ga0439436_0063219 | Ga0439436_0063219_381_830 | 132 |
| 1485 | 3300041406 | Ga0439439_0032082 | Ga0439439_0032082_40_492 | 132 |
| 1486 | 3300041406 | Ga0439439_0047680 | Ga0439439_0047680_115_564 | 132 |
| 1487 | 3300041413 | Ga0439465_0014361 | Ga0439465_0014361_884_1333 | 132 |
| 1488 | 3300041413 | Ga0439465_0016011 | Ga0439465_0016011_1266_1718 | 132 |
| 1489 | 3300041413 | Ga0439465_0019035 | Ga0439465_0019035_1458_1979 | 132 |
| 1490 | 3300041413 | Ga0439465_0074391 | Ga0439465_0074391_243_695 | 132 |
| 1491 | 3300041413 | Ga0439465_0143370 | Ga0439465_0143370_35_487 | 132 |
| 1492 | 3300041452 | Ga0451793_1791429 | Ga0451793_1791429_312_770 | 132 |
| 1493 | 3300041456 | Ga0451795_0456879 | Ga0451795_0456879_34_480 | 132 |
| 1494 | 3300041463 | Ga0451804_0736472 | Ga0451804_0736472_543_995 | 132 |
| 1495 | 3300041491 | Ga0451833_0281263 | Ga0451833_0281263_401_856 | 132 |
| 1496 | 3300041492 | Ga0451835_0487550 | Ga0451835_0487550_239_691 | 132 |
| 1497 | 3300041494 | Ga0451837_1680411 | Ga0451837_1680411_32_484 | 132 |
| 1498 | 3300041497 | Ga0451840_11095 | Ga0451840_11095_20_472 | 132 |
| 1499 | 3300041498 | Ga0451841_1014141 | Ga0451841_1014141_266_718 | 132 |
| 1500 | 3300041501 | Ga0451845_0513581 | Ga0451845_0513581_1475_1927 | 132 |
| 1501 | 3300041502 | Ga0451846_68000 | Ga0451846_68000_34_486 | 132 |
| 1502 | 3300041503 | Ga0451847_0867267 | Ga0451847_0867267_709_1161 | 132 |
| 1503 | 3300041505 | Ga0451849_1243659 | Ga0451849_1243659_1086_1538 | 132 |
| 1504 | 3300041507 | Ga0451851_0085356 | Ga0451851_0085356_1045_1497 | 132 |
| 1505 | 3300041507 | Ga0451851_0906446 | Ga0451851_0906446_709_1161 | 132 |
| 1506 | 3300041509 | Ga0451843_0556366 | Ga0451843_0556366_754_1206 | 132 |
| 1507 | 3300041511 | Ga0451855_0767112 | Ga0451855_0767112_691_1143 | 132 |
| 1508 | 3300041512 | Ga0451853_0114112 | Ga0451853_0114112_245_700 | 132 |
| 1509 | 3300041512 | Ga0451853_1600377 | Ga0451853_1600377_920_1372 | 132 |
| 1510 | 3300041997 | Ga0439431_0084742 | Ga0439431_0084742_283_735 | 132 |
| 1511 | 3300042006 | Ga0439432_035895 | Ga0439432_035895_231_677 | 132 |
| 1512 | 3300042006 | Ga0439432_091543 | Ga0439432_091543_301_765 | 132 |
| 1513 | 3300042007 | Ga0439449_0024497 | Ga0439449_0024497_1351_1803 | 132 |
| 1514 | 3300042007 | Ga0439449_0030648 | Ga0439449_0030648_682_1131 | 132 |
| 1515 | 3300042007 | Ga0439449_0113867 | Ga0439449_0113867_63_512 | 132 |
| 1516 | 3300042012 | Ga0439455_0113540 | Ga0439455_0113540_247_708 | 132 |
| 1517 | 3300042122 | Ga0450920_061976 | Ga0450920_061976_158_679 | 132 |
| 1518 | 3300042435 | Ga0439434_0136733 | Ga0439434_0136733_148_594 | 132 |
| 1519 | 3300042531 | Ga0450918_083669 | Ga0450918_083669_35_544 | 132 |
| 1520 | 3300044658 | Ga0466972_0066750 | Ga0466972_0066750_155_610 | 132 |
| 1521 | 3300044684 | Ga0466966_0037410 | Ga0466966_0037410_2252_2698 | 132 |
| 1522 | 3300044694 | Ga0466963_0014097 | Ga0466963_0014097_1158_1604 | 132 |
| 1523 | 3300044735 | Ga0466968_0298045 | Ga0466968_0298045_220_675 | 132 |
| 1524 | 3300044765 | Ga0466970_0005266 | Ga0466970_0005266_2632_3078 | 132 |
| 1525 | 3300044901 | Ga0466960_0196335 | Ga0466960_0196335_310_765 | 132 |
| 1526 | 3300045976 | Ga0466967_0358143 | Ga0466967_0358143_241_687 | 132 |
| 1527 | 3300045976 | Ga0466967_0536706 | Ga0466967_0536706_278_724 | 132 |
| 1528 | 3300046457 | Ga0495590_0338167 | Ga0495590_0338167_62_520 | 132 |
| 1529 | 3300046460 | Ga0495638_0011505 | Ga0495638_0011505_5490_5948 | 132 |
| 1530 | 3300046460 | Ga0495638_0112270 | Ga0495638_0112270_978_1430 | 132 |
| 1531 | 3300046460 | Ga0495638_0134219 | Ga0495638_0134219_886_1338 | 132 |
| 1532 | 3300046471 | Ga0495650_0170839 | Ga0495650_0170839_211_663 | 132 |
| 1533 | 3300046492 | Ga0495585_0030296 | Ga0495585_0030296_680_1132 | 132 |
| 1534 | 3300046492 | Ga0495585_0045607 | Ga0495585_0045607_1837_2283 | 132 |
| 1535 | 3300046501 | Ga0495607_0082802 | Ga0495607_0082802_282_734 | 132 |
| 1536 | 3300046506 | Ga0495583_0091176 | Ga0495583_0091176_200_646 | 132 |
| 1537 | 3300046512 | Ga0495610_0010608 | Ga0495610_0010608_3037_3489 | 132 |
| 1538 | 3300046512 | Ga0495610_0075657 | Ga0495610_0075657_1049_1495 | 132 |
| 1539 | 3300046513 | Ga0495616_0026034 | Ga0495616_0026034_674_1126 | 132 |
| 1540 | 3300046513 | Ga0495616_0287975 | Ga0495616_0287975_83_535 | 132 |
| 1541 | 3300046515 | Ga0495620_0031522 | Ga0495620_0031522_48_494 | 132 |
| 1542 | 3300046515 | Ga0495620_0062294 | Ga0495620_0062294_616_1068 | 132 |
| 1543 | 3300046515 | Ga0495620_0066156 | Ga0495620_0066156_289_750 | 132 |
| 1544 | 3300046518 | Ga0495631_0082915 | Ga0495631_0082915_471_923 | 132 |
| 1545 | 3300046518 | Ga0495631_0183483 | Ga0495631_0183483_111_557 | 132 |
| 1546 | 3300046519 | Ga0495632_0017000 | Ga0495632_0017000_476_928 | 132 |
| 1547 | 3300046519 | Ga0495632_0287786 | Ga0495632_0287786_159_620 | 132 |
| 1548 | 3300046522 | Ga0495643_0001636 | Ga0495643_0001636_3841_4293 | 132 |
| 1549 | 3300046522 | Ga0495643_0027496 | Ga0495643_0027496_802_1248 | 132 |
| 1550 | 3300046524 | Ga0495648_0076360 | Ga0495648_0076360_1289_1741 | 132 |
| 1551 | 3300046529 | Ga0495652_0151995 | Ga0495652_0151995_305_751 | 132 |
| 1552 | 3300046530 | Ga0495654_0006825 | Ga0495654_0006825_1428_1886 | 132 |
| 1553 | 3300046530 | Ga0495654_0047409 | Ga0495654_0047409_77_523 | 132 |
| 1554 | 3300046530 | Ga0495654_0056366 | Ga0495654_0056366_180_632 | 132 |
| 1555 | 3300046538 | Ga0495609_0025916 | Ga0495609_0025916_1436_1882 | 132 |
| 1556 | 3300046558 | Ga0495633_0058720 | Ga0495633_0058720_1257_1709 | 132 |
| 1557 | 3300046615 | Ga0495656_0166823 | Ga0495656_0166823_433_885 | 132 |
| 1558 | 3300046616 | Ga0495668_0038831 | Ga0495668_0038831_1782_2228 | 132 |
| 1559 | 3300046616 | Ga0495668_0101187 | Ga0495668_0101187_608_1069 | 132 |
| 1560 | 3300046616 | Ga0495668_0121572 | Ga0495668_0121572_753_1211 | 132 |
| 1561 | 3300046616 | Ga0495668_0133404 | Ga0495668_0133404_387_839 | 132 |
| 1562 | 3300046648 | Ga0495611_0009786 | Ga0495611_0009786_1290_1736 | 132 |
| 1563 | 3300046660 | Ga0495625_0022163 | Ga0495625_0022163_4131_4583 | 132 |
| 1564 | 3300046660 | Ga0495625_0044796 | Ga0495625_0044796_2078_2530 | 132 |
| 1565 | 3300046660 | Ga0495625_0056641 | Ga0495625_0056641_1985_2440 | 132 |
| 1566 | 3300046674 | Ga0495588_0370574 | Ga0495588_0370574_208_660 | 132 |
| 1567 | 3300046691 | Ga0495670_0031733 | Ga0495670_0031733_1241_1687 | 132 |
| 1568 | 3300046691 | Ga0495670_0363084 | Ga0495670_0363084_38_490 | 132 |
| 1569 | 3300046692 | Ga0495671_0310575 | Ga0495671_0310575_154_606 | 132 |
| 1570 | 3300046694 | Ga0495649_0122502 | Ga0495649_0122502_675_1127 | 132 |
| 1571 | 3300046694 | Ga0495649_0226196 | Ga0495649_0226196_371_829 | 132 |
| 1572 | 3300046810 | Ga0495660_0191214 | Ga0495660_0191214_358_810 | 132 |
| 1573 | 3300047318 | Ga0495636_0044906 | Ga0495636_0044906_616_1068 | 132 |
| 1574 | 3300047318 | Ga0495636_0160057 | Ga0495636_0160057_352_816 | 132 |
| 1575 | 3300047320 | Ga0495672_0021456 | Ga0495672_0021456_512_958 | 132 |
| 1576 | 3300047321 | Ga0495676_0917551 | Ga0495676_0917551_25_483 | 132 |
| 1577 | 3300047443 | Ga0495687_066877 | Ga0495687_066877_644_1102 | 132 |
| 1578 | 3300047443 | Ga0495687_227815 | Ga0495687_227815_10_462 | 132 |
| 1579 | 3300047447 | Ga0495685_062052 | Ga0495685_062052_223_687 | 132 |
| 1580 | 3300047471 | Ga0495684_1010807 | Ga0495684_1010807_47_511 | 132 |
| 1581 | 3300047472 | Ga0495686_0004865 | Ga0495686_0004865_6036_6482 | 132 |
| 1582 | 3300047472 | Ga0495686_0119407 | Ga0495686_0119407_757_1203 | 132 |
| 1583 | 3300047472 | Ga0495686_0157036 | Ga0495686_0157036_169_615 | 132 |
| 1584 | 3300047472 | Ga0495686_0180354 | Ga0495686_0180354_148_609 | 132 |
| 1585 | 3300047472 | Ga0495686_0221559 | Ga0495686_0221559_604_1056 | 132 |
| 1586 | 3300047472 | Ga0495686_0245842 | Ga0495686_0245842_286_732 | 132 |
| 1587 | 3300047472 | Ga0495686_0345242 | Ga0495686_0345242_329_778 | 132 |
| 1588 | 3300048090 | Ga0495615_0115979 | Ga0495615_0115979_10_465 | 132 |
| 1589 | 3300048091 | Ga0495626_0162717 | Ga0495626_0162717_403_849 | 132 |
| 1590 | 3300048091 | Ga0495626_0198657 | Ga0495626_0198657_133_585 | 132 |
| 1591 | 3300048903 | Ga0496100_0012838 | Ga0496100_0012838_1948_2394 | 132 |
| 1592 | 3300048905 | Ga0496102_0008570 | Ga0496102_0008570_4528_4974 | 132 |
| 1593 | 3300048905 | Ga0496102_0177393 | Ga0496102_0177393_391_846 | 132 |
| 1594 | 3300048905 | Ga0496102_0296643 | Ga0496102_0296643_892_1350 | 132 |
| 1595 | 3300048905 | Ga0496102_0766906 | Ga0496102_0766906_149_604 | 132 |
| 1596 | 3300048906 | Ga0496103_0010686 | Ga0496103_0010686_2164_2610 | 132 |
| 1597 | 3300048907 | Ga0496104_0066142 | Ga0496104_0066142_826_1281 | 132 |
| 1598 | 3300048908 | Ga0496105_0182249 | Ga0496105_0182249_271_714 | 132 |
| 1599 | 3300048909 | Ga0496106_0004921 | Ga0496106_0004921_5346_5792 | 132 |
| 1600 | 3300048909 | Ga0496106_0452007 | Ga0496106_0452007_433_891 | 132 |
| 1601 | 3300048911 | Ga0496108_0114926 | Ga0496108_0114926_335_781 | 132 |
| 1602 | 3300048912 | Ga0496109_1146305 | Ga0496109_1146305_103_561 | 132 |
| 1603 | 3300048913 | Ga0496110_0180740 | Ga0496110_0180740_1089_1532 | 132 |
| 1604 | 3300048913 | Ga0496110_1133930 | Ga0496110_1133930_152_610 | 132 |
| 1605 | 3300048916 | Ga0496113_0312317 | Ga0496113_0312317_253_699 | 132 |
| 1606 | 3300048916 | Ga0496113_0570148 | Ga0496113_0570148_237_683 | 132 |
| 1607 | 3300048917 | Ga0496114_0236430 | Ga0496114_0236430_35_481 | 132 |
| 1608 | 3300048917 | Ga0496114_0584059 | Ga0496114_0584059_341_796 | 132 |
| 1609 | 3300048918 | Ga0496115_0237130 | Ga0496115_0237130_924_1382 | 132 |
| 1610 | 3300048918 | Ga0496115_0653995 | Ga0496115_0653995_236_691 | 132 |
| 1611 | 3300048919 | Ga0496116_0000043 | Ga0496116_0000043_242567_243016 | 132 |
| 1612 | 3300048919 | Ga0496116_0008089 | Ga0496116_0008089_4290_4736 | 132 |
| 1613 | 3300048919 | Ga0496116_0043036 | Ga0496116_0043036_1773_2216 | 132 |
| 1614 | 3300048919 | Ga0496116_0103446 | Ga0496116_0103446_233_679 | 132 |
| 1615 | 3300048920 | Ga0496117_0000338 | Ga0496117_0000338_51096_51542 | 132 |
| 1616 | 3300048920 | Ga0496117_0089281 | Ga0496117_0089281_1167_1619 | 132 |
| 1617 | 3300048920 | Ga0496117_0109558 | Ga0496117_0109558_1102_1551 | 132 |
| 1618 | 3300048920 | Ga0496117_0109935 | Ga0496117_0109935_440_886 | 132 |
| 1619 | 3300048921 | Ga0496118_0000958 | Ga0496118_0000958_31159_31605 | 132 |
| 1620 | 3300048921 | Ga0496118_0019045 | Ga0496118_0019045_1711_2163 | 132 |
| 1621 | 3300048921 | Ga0496118_0225279 | Ga0496118_0225279_388_846 | 132 |
| 1622 | 3300048921 | Ga0496118_0428829 | Ga0496118_0428829_21_470 | 132 |
| 1623 | 3300048921 | Ga0496118_0566227 | Ga0496118_0566227_63_518 | 132 |
| 1624 | 3300048922 | Ga0496119_0004440 | Ga0496119_0004440_11656_12102 | 132 |
| 1625 | 3300048922 | Ga0496119_0111222 | Ga0496119_0111222_1025_1489 | 132 |
| 1626 | 3300048922 | Ga0496119_0163672 | Ga0496119_0163672_266_724 | 132 |
| 1627 | 3300048922 | Ga0496119_0193562 | Ga0496119_0193562_447_896 | 132 |
| 1628 | 3300048922 | Ga0496119_0243093 | Ga0496119_0243093_217_675 | 132 |
| 1629 | 3300048923 | Ga0496120_0000589 | Ga0496120_0000589_1727_2182 | 132 |
| 1630 | 3300048923 | Ga0496120_0001472 | Ga0496120_0001472_11199_11645 | 132 |
| 1631 | 3300048923 | Ga0496120_0069230 | Ga0496120_0069230_801_1259 | 132 |
| 1632 | 3300048923 | Ga0496120_0187793 | Ga0496120_0187793_551_997 | 132 |
| 1633 | 3300048924 | Ga0496121_0002723 | Ga0496121_0002723_12016_12462 | 132 |
| 1634 | 3300048924 | Ga0496121_0009941 | Ga0496121_0009941_5912_6370 | 132 |
| 1635 | 3300048924 | Ga0496121_0027323 | Ga0496121_0027323_1355_1801 | 132 |
| 1636 | 3300048924 | Ga0496121_0038973 | Ga0496121_0038973_2745_3188 | 132 |
| 1637 | 3300048924 | Ga0496121_0074244 | Ga0496121_0074244_355_801 | 132 |
| 1638 | 3300048924 | Ga0496121_0082726 | Ga0496121_0082726_401_847 | 132 |
| 1639 | 3300048924 | Ga0496121_0088329 | Ga0496121_0088329_1334_1780 | 132 |
| 1640 | 3300048924 | Ga0496121_0206430 | Ga0496121_0206430_401_847 | 132 |
| 1641 | 3300048924 | Ga0496121_0229266 | Ga0496121_0229266_594_1049 | 132 |
| 1642 | 3300048924 | Ga0496121_0879236 | Ga0496121_0879236_43_501 | 132 |
| 1643 | 3300048925 | Ga0496122_0016499 | Ga0496122_0016499_925_1389 | 132 |
| 1644 | 3300048925 | Ga0496122_0018139 | Ga0496122_0018139_2651_3097 | 132 |
| 1645 | 3300048925 | Ga0496122_0055102 | Ga0496122_0055102_2144_2590 | 132 |
| 1646 | 3300048925 | Ga0496122_0062877 | Ga0496122_0062877_1729_2172 | 132 |
| 1647 | 3300048925 | Ga0496122_0093482 | Ga0496122_0093482_545_1003 | 132 |
| 1648 | 3300048925 | Ga0496122_0246008 | Ga0496122_0246008_105_554 | 132 |
| 1649 | 3300048926 | Ga0496123_0000043 | Ga0496123_0000043_252392_252856 | 132 |
| 1650 | 3300048926 | Ga0496123_0012797 | Ga0496123_0012797_2103_2549 | 132 |
| 1651 | 3300048926 | Ga0496123_0016748 | Ga0496123_0016748_1763_2209 | 132 |
| 1652 | 3300048926 | Ga0496123_0064778 | Ga0496123_0064778_1408_1854 | 132 |
| 1653 | 3300048926 | Ga0496123_0079012 | Ga0496123_0079012_780_1238 | 132 |
| 1654 | 3300048926 | Ga0496123_0422272 | Ga0496123_0422272_141_590 | 132 |
| 1655 | 3300048927 | Ga0496124_0017870 | Ga0496124_0017870_4240_4704 | 132 |
| 1656 | 3300048927 | Ga0496124_0025733 | Ga0496124_0025733_897_1343 | 132 |
| 1657 | 3300048927 | Ga0496124_0061282 | Ga0496124_0061282_775_1218 | 132 |
| 1658 | 3300048927 | Ga0496124_0274378 | Ga0496124_0274378_556_1014 | 132 |
| 1659 | 3300048927 | Ga0496124_0298730 | Ga0496124_0298730_635_1081 | 132 |
| 1660 | 3300048928 | Ga0496125_0000946 | Ga0496125_0000946_43556_44020 | 132 |
| 1661 | 3300048928 | Ga0496125_0025175 | Ga0496125_0025175_829_1284 | 132 |
| 1662 | 3300048928 | Ga0496125_0027520 | Ga0496125_0027520_2591_3037 | 132 |
| 1663 | 3300048928 | Ga0496125_0066860 | Ga0496125_0066860_1112_1567 | 132 |
| 1664 | 3300048928 | Ga0496125_0141564 | Ga0496125_0141564_285_728 | 132 |
| 1665 | 3300048928 | Ga0496125_0169920 | Ga0496125_0169920_508_954 | 132 |
| 1666 | 3300048928 | Ga0496125_0283632 | Ga0496125_0283632_461_907 | 132 |
| 1667 | 3300048928 | Ga0496125_0310552 | Ga0496125_0310552_155_610 | 132 |
| 1668 | 3300048929 | Ga0496126_0000362 | Ga0496126_0000362_4543_4992 | 132 |
| 1669 | 3300048929 | Ga0496126_0034554 | Ga0496126_0034554_1323_1769 | 132 |
| 1670 | 3300048929 | Ga0496126_0047224 | Ga0496126_0047224_1816_2274 | 132 |
| 1671 | 3300048929 | Ga0496126_0244916 | Ga0496126_0244916_708_1163 | 132 |
| 1672 | 3300048929 | Ga0496126_0266039 | Ga0496126_0266039_207_650 | 132 |
| 1673 | 3300048929 | Ga0496126_0340153 | Ga0496126_0340153_89_535 | 132 |
| 1674 | 3300048929 | Ga0496126_0756347 | Ga0496126_0756347_34_489 | 132 |
| 1675 | 3300049568 | Ga0501031_0000095 | Ga0501031_0000095_4426_4878 | 132 |
| 1676 | 3300049568 | Ga0501031_0418336 | Ga0501031_0418336_354_818 | 132 |
| 1677 | 3300049569 | Ga0501032_0000064 | Ga0501032_0000064_34844_35299 | 132 |
| 1678 | 3300049569 | Ga0501032_0000084 | Ga0501032_0000084_76984_77436 | 132 |
| 1679 | 3300049569 | Ga0501032_0002338 | Ga0501032_0002338_1542_2006 | 132 |
| 1680 | 3300049569 | Ga0501032_0048602 | Ga0501032_0048602_2054_2521 | 132 |
| 1681 | 3300049569 | Ga0501032_1008883 | Ga0501032_1008883_36_485 | 132 |
| 1682 | 3300049570 | Ga0501033_0000102 | Ga0501033_0000102_4130_4582 | 132 |
| 1683 | 3300049570 | Ga0501033_0000286 | Ga0501033_0000286_128_583 | 132 |
| 1684 | 3300049570 | Ga0501033_0007597 | Ga0501033_0007597_6886_7350 | 132 |
| 1685 | 3300049570 | Ga0501033_0020657 | Ga0501033_0020657_2659_3108 | 132 |
| 1686 | 3300049570 | Ga0501033_0029534 | Ga0501033_0029534_2223_2672 | 132 |
| 1687 | 3300049570 | Ga0501033_0050740 | Ga0501033_0050740_1180_1629 | 132 |
| 1688 | 3300049570 | Ga0501033_0083256 | Ga0501033_0083256_1193_1657 | 132 |
| 1689 | 3300049570 | Ga0501033_0528873 | Ga0501033_0528873_95_565 | 132 |
| 1690 | 3300049570 | Ga0501033_0904293 | Ga0501033_0904293_128_574 | 132 |
| 1691 | 3300049571 | Ga0501034_0000174 | Ga0501034_0000174_39438_39893 | 132 |
| 1692 | 3300049571 | Ga0501034_0001404 | Ga0501034_0001404_27791_28243 | 132 |
| 1693 | 3300049571 | Ga0501034_0090803 | Ga0501034_0090803_1448_1897 | 132 |
| 1694 | 3300049571 | Ga0501034_0202154 | Ga0501034_0202154_372_836 | 132 |
| 1695 | 3300049571 | Ga0501034_0240027 | Ga0501034_0240027_486_938 | 132 |
| 1696 | 3300049571 | Ga0501034_0339786 | Ga0501034_0339786_510_956 | 132 |
| 1697 | 3300049571 | Ga0501034_0655917 | Ga0501034_0655917_382_837 | 132 |
| 1698 | 3300049571 | Ga0501034_0831896 | Ga0501034_0831896_350_799 | 132 |
| 1699 | 3300049572 | Ga0501036_0000040 | Ga0501036_0000040_4130_4582 | 132 |
| 1700 | 3300049572 | Ga0501036_0011420 | Ga0501036_0011420_6822_7277 | 132 |
| 1701 | 3300049572 | Ga0501036_0064582 | Ga0501036_0064582_1448_1912 | 132 |
| 1702 | 3300049572 | Ga0501036_0122760 | Ga0501036_0122760_282_731 | 132 |
| 1703 | 3300049572 | Ga0501036_0160163 | Ga0501036_0160163_117_566 | 132 |
| 1704 | 3300049573 | Ga0501037_0000098 | Ga0501037_0000098_4130_4582 | 132 |
| 1705 | 3300049573 | Ga0501037_0009152 | Ga0501037_0009152_82_537 | 132 |
| 1706 | 3300049573 | Ga0501037_0095169 | Ga0501037_0095169_1012_1464 | 132 |
| 1707 | 3300049573 | Ga0501037_0127415 | Ga0501037_0127415_765_1232 | 132 |
| 1708 | 3300049573 | Ga0501037_0403344 | Ga0501037_0403344_347_811 | 132 |
| 1709 | 3300049573 | Ga0501037_0456452 | Ga0501037_0456452_79_549 | 132 |
| 1710 | 3300049574 | Ga0501038_0000002 | Ga0501038_0000002_271054_271506 | 132 |
| 1711 | 3300049574 | Ga0501038_0000031 | Ga0501038_0000031_116621_117076 | 132 |
| 1712 | 3300049574 | Ga0501038_0022666 | Ga0501038_0022666_400_864 | 132 |
| 1713 | 3300049574 | Ga0501038_0031557 | Ga0501038_0031557_2202_2669 | 132 |
| 1714 | 3300049574 | Ga0501038_0117560 | Ga0501038_0117560_890_1336 | 132 |
| 1715 | 3300049574 | Ga0501038_0272214 | Ga0501038_0272214_775_1239 | 132 |
| 1716 | 3300049574 | Ga0501038_1112264 | Ga0501038_1112264_97_549 | 132 |
| 1717 | 3300049575 | Ga0501039_0000002 | Ga0501039_0000002_77007_77459 | 132 |
| 1718 | 3300049575 | Ga0501039_0000057 | Ga0501039_0000057_32629_33084 | 132 |
| 1719 | 3300049575 | Ga0501039_0227793 | Ga0501039_0227793_76_522 | 132 |
| 1720 | 3300049576 | Ga0501040_0043172 | Ga0501040_0043172_788_1240 | 132 |
| 1721 | 3300049576 | Ga0501040_0117786 | Ga0501040_0117786_1093_1542 | 132 |
| 1722 | 3300049577 | Ga0501041_0160634 | Ga0501041_0160634_827_1282 | 132 |
| 1723 | 3300049578 | Ga0501042_0137759 | Ga0501042_0137759_916_1365 | 132 |
| 1724 | 3300049579 | Ga0501043_0000048 | Ga0501043_0000048_39438_39893 | 132 |
| 1725 | 3300049579 | Ga0501043_0000104 | Ga0501043_0000104_77821_78285 | 132 |
| 1726 | 3300049579 | Ga0501043_0006479 | Ga0501043_0006479_4108_4560 | 132 |
| 1727 | 3300049579 | Ga0501043_0074629 | Ga0501043_0074629_543_1007 | 132 |
| 1728 | 3300049579 | Ga0501043_0128235 | Ga0501043_0128235_1316_1762 | 132 |
| 1729 | 3300049579 | Ga0501043_0130374 | Ga0501043_0130374_692_1153 | 132 |
| 1730 | 3300049579 | Ga0501043_0230438 | Ga0501043_0230438_358_804 | 132 |
| 1731 | 3300049579 | Ga0501043_0674507 | Ga0501043_0674507_52_519 | 132 |
| 1732 | 3300049580 | Ga0501046_0059772 | Ga0501046_0059772_313_762 | 132 |
| 1733 | 3300049580 | Ga0501046_0175337 | Ga0501046_0175337_1127_1579 | 132 |
| 1734 | 3300049580 | Ga0501046_0193784 | Ga0501046_0193784_416_880 | 132 |
| 1735 | 3300049580 | Ga0501046_0200778 | Ga0501046_0200778_407_853 | 132 |
| 1736 | 3300049581 | Ga0501047_0002237 | Ga0501047_0002237_15621_16073 | 132 |
| 1737 | 3300049581 | Ga0501047_0027746 | Ga0501047_0027746_2683_3150 | 132 |
| 1738 | 3300049581 | Ga0501047_0036169 | Ga0501047_0036169_375_827 | 132 |
| 1739 | 3300049581 | Ga0501047_0140440 | Ga0501047_0140440_998_1444 | 132 |
| 1740 | 3300049581 | Ga0501047_0187248 | Ga0501047_0187248_152_601 | 132 |
| 1741 | 3300049581 | Ga0501047_0292240 | Ga0501047_0292240_543_1007 | 132 |
| 1742 | 3300049581 | Ga0501047_0716479 | Ga0501047_0716479_258_719 | 132 |
| 1743 | 3300049582 | Ga0501048_0022955 | Ga0501048_0022955_4089_4538 | 132 |
| 1744 | 3300049583 | Ga0501067_0042887 | Ga0501067_0042887_540_1004 | 132 |
| 1745 | 3300049584 | Ga0501068_0182523 | Ga0501068_0182523_338_802 | 132 |
| 1746 | 3300049584 | Ga0501068_0316121 | Ga0501068_0316121_521_982 | 132 |
| 1747 | 3300049584 | Ga0501068_0319333 | Ga0501068_0319333_287_733 | 132 |
| 1748 | 3300049584 | Ga0501068_0365952 | Ga0501068_0365952_17_466 | 132 |
| 1749 | 3300049585 | Ga0501069_0000018 | Ga0501069_0000018_11315_11779 | 132 |
| 1750 | 3300049585 | Ga0501069_0015350 | Ga0501069_0015350_2968_3420 | 132 |
| 1751 | 3300049585 | Ga0501069_0159953 | Ga0501069_0159953_111_560 | 132 |
| 1752 | 3300049585 | Ga0501069_0551510 | Ga0501069_0551510_17_487 | 132 |
| 1753 | 3300049586 | Ga0501070_0000048 | Ga0501070_0000048_13402_13866 | 132 |
| 1754 | 3300049586 | Ga0501070_0000420 | Ga0501070_0000420_10558_11010 | 132 |
| 1755 | 3300049586 | Ga0501070_0002333 | Ga0501070_0002333_12895_13362 | 132 |
| 1756 | 3300049586 | Ga0501070_0041003 | Ga0501070_0041003_47_502 | 132 |
| 1757 | 3300049586 | Ga0501070_0053889 | Ga0501070_0053889_2565_3035 | 132 |
| 1758 | 3300049586 | Ga0501070_0086815 | Ga0501070_0086815_1737_2189 | 132 |
| 1759 | 3300049586 | Ga0501070_0113114 | Ga0501070_0113114_1413_1862 | 132 |
| 1760 | 3300049586 | Ga0501070_0271796 | Ga0501070_0271796_542_994 | 132 |
| 1761 | 3300049586 | Ga0501070_0297951 | Ga0501070_0297951_703_1161 | 132 |
| 1762 | 3300049586 | Ga0501070_0338762 | Ga0501070_0338762_393_851 | 132 |
| 1763 | 3300049587 | Ga0501071_0017994 | Ga0501071_0017994_441_905 | 132 |
| 1764 | 3300049587 | Ga0501071_0094533 | Ga0501071_0094533_1465_1932 | 132 |
| 1765 | 3300049587 | Ga0501071_0150442 | Ga0501071_0150442_469_918 | 132 |
| 1766 | 3300049588 | Ga0501072_0069505 | Ga0501072_0069505_1827_2276 | 132 |
| 1767 | 3300049589 | Ga0501073_0006660 | Ga0501073_0006660_2491_2955 | 132 |
| 1768 | 3300049589 | Ga0501073_0072808 | Ga0501073_0072808_256_723 | 132 |
| 1769 | 3300049589 | Ga0501073_0127897 | Ga0501073_0127897_1119_1571 | 132 |
| 1770 | 3300049589 | Ga0501073_0161074 | Ga0501073_0161074_690_1154 | 132 |
| 1771 | 3300049590 | Ga0501074_0000001 | Ga0501074_0000001_56481_56945 | 132 |
| 1772 | 3300049590 | Ga0501074_0054142 | Ga0501074_0054142_2121_2573 | 132 |
| 1773 | 3300049590 | Ga0501074_0059274 | Ga0501074_0059274_1788_2255 | 132 |
| 1774 | 3300049590 | Ga0501074_0079423 | Ga0501074_0079423_588_1037 | 132 |
| 1775 | 3300049590 | Ga0501074_0266406 | Ga0501074_0266406_706_1161 | 132 |
| 1776 | 3300049590 | Ga0501074_0452599 | Ga0501074_0452599_341_799 | 132 |
| 1777 | 3300049592 | Ga0501076_0786847 | Ga0501076_0786847_105_551 | 132 |
| 1778 | 3300049592 | Ga0501076_1727592 | Ga0501076_1727592_43_501 | 132 |
| 1779 | 3300049741 | Ga0501079_0807143 | Ga0501079_0807143_255_704 | 132 |
| 1780 | 3300049742 | Ga0501080_0000197 | Ga0501080_0000197_29127_29591 | 132 |
| 1781 | 3300049742 | Ga0501080_0000413 | Ga0501080_0000413_31241_31693 | 132 |
| 1782 | 3300049742 | Ga0501080_0015859 | Ga0501080_0015859_544_1008 | 132 |
| 1783 | 3300049742 | Ga0501080_0133094 | Ga0501080_0133094_1105_1551 | 132 |
| 1784 | 3300049742 | Ga0501080_0243232 | Ga0501080_0243232_419_874 | 132 |
| 1785 | 3300049742 | Ga0501080_0245976 | Ga0501080_0245976_889_1338 | 132 |
| 1786 | 3300049744 | Ga0501083_0005530 | Ga0501083_0005530_6441_6905 | 132 |
| 1787 | 3300049744 | Ga0501083_0008060 | Ga0501083_0008060_1814_2260 | 132 |
| 1788 | 3300049744 | Ga0501083_0502426 | Ga0501083_0502426_171_635 | 132 |
| 1789 | 3300049744 | Ga0501083_0659780 | Ga0501083_0659780_178_627 | 132 |
| 1790 | 3300049744 | Ga0501083_0820992 | Ga0501083_0820992_78_527 | 132 |
| 1791 | 3300049776 | Ga0501280_012617 | Ga0501280_012617_705_1157 | 132 |
| 1792 | 3300049822 | Ga0501035_0000048 | Ga0501035_0000048_25159_25623 | 132 |
| 1793 | 3300049822 | Ga0501035_0000163 | Ga0501035_0000163_4440_4892 | 132 |
| 1794 | 3300049822 | Ga0501035_0001343 | Ga0501035_0001343_14452_14919 | 132 |
| 1795 | 3300049822 | Ga0501035_0004746 | Ga0501035_0004746_8776_9246 | 132 |
| 1796 | 3300049822 | Ga0501035_0007944 | Ga0501035_0007944_6536_6988 | 132 |
| 1797 | 3300049822 | Ga0501035_0063455 | Ga0501035_0063455_1160_1609 | 132 |
| 1798 | 3300049822 | Ga0501035_0094218 | Ga0501035_0094218_606_1055 | 132 |
| 1799 | 3300049822 | Ga0501035_0130236 | Ga0501035_0130236_1638_2093 | 132 |
| 1800 | 3300049822 | Ga0501035_0273987 | Ga0501035_0273987_442_894 | 132 |
| 1801 | 3300049822 | Ga0501035_0307036 | Ga0501035_0307036_615_1076 | 132 |
| 1802 | 3300049822 | Ga0501035_0336768 | Ga0501035_0336768_556_1026 | 132 |
| 1803 | 3300049822 | Ga0501035_0632845 | Ga0501035_0632845_253_708 | 132 |
| 1804 | 3300049823 | Ga0501044_0000002 | Ga0501044_0000002_297694_298146 | 132 |
| 1805 | 3300049823 | Ga0501044_0000003 | Ga0501044_0000003_228355_228819 | 132 |
| 1806 | 3300049823 | Ga0501044_0002384 | Ga0501044_0002384_3804_4271 | 132 |
| 1807 | 3300049823 | Ga0501044_0010560 | Ga0501044_0010560_4460_4915 | 132 |
| 1808 | 3300049823 | Ga0501044_0020100 | Ga0501044_0020100_2002_2454 | 132 |
| 1809 | 3300049823 | Ga0501044_0021489 | Ga0501044_0021489_4587_5051 | 132 |
| 1810 | 3300049823 | Ga0501044_0049943 | Ga0501044_0049943_3267_3716 | 132 |
| 1811 | 3300049823 | Ga0501044_0057802 | Ga0501044_0057802_159_629 | 132 |
| 1812 | 3300049823 | Ga0501044_0187627 | Ga0501044_0187627_1052_1501 | 132 |
| 1813 | 3300049823 | Ga0501044_0219738 | Ga0501044_0219738_1033_1479 | 132 |
| 1814 | 3300049823 | Ga0501044_0239744 | Ga0501044_0239744_39_500 | 132 |
| 1815 | 3300049823 | Ga0501044_0550038 | Ga0501044_0550038_481_936 | 132 |
| 1816 | 3300049823 | Ga0501044_0590090 | Ga0501044_0590090_297_764 | 132 |
| 1817 | 3300049824 | Ga0501045_0154648 | Ga0501045_0154648_207_656 | 132 |
| 1818 | 3300049824 | Ga0501045_0688966 | Ga0501045_0688966_101_553 | 132 |
| 1819 | 3300050489 | nmdc:mga03683_86913_c1 | nmdc:mga03683_86913_c1_170_628 | 132 |
| 1820 | 3300050490 | nmdc:mga03n38_3751_c1 | nmdc:mga03n38_3751_c1_3587_4039 | 132 |
| 1821 | 3300050490 | nmdc:mga03n38_65686_c1 | nmdc:mga03n38_65686_c1_82_534 | 132 |
| 1822 | 3300050490 | nmdc:mga03n38_90093_c1 | nmdc:mga03n38_90093_c1_683_1135 | 132 |
| 1823 | 3300050491 | nmdc:mga00v17_111801_c1 | nmdc:mga00v17_111801_c1_328_783 | 132 |
| 1824 | 3300050491 | nmdc:mga00v17_29610_c1 | nmdc:mga00v17_29610_c1_924_1379 | 132 |
| 1825 | 3300050491 | nmdc:mga00v17_498650_c1 | nmdc:mga00v17_498650_c1_201_659 | 132 |
| 1826 | 3300050492 | nmdc:mga0yw44_13733_c1 | nmdc:mga0yw44_13733_c1_103_561 | 132 |
| 1827 | 3300050492 | nmdc:mga0yw44_17832_c1 | nmdc:mga0yw44_17832_c1_2624_3082 | 132 |
| 1828 | 3300050492 | nmdc:mga0yw44_2486_c2 | nmdc:mga0yw44_2486_c2_605_1060 | 132 |
| 1829 | 3300050492 | nmdc:mga0yw44_3537_c1 | nmdc:mga0yw44_3537_c1_652_1107 | 132 |
| 1830 | 3300050492 | nmdc:mga0yw44_354317_c1 | nmdc:mga0yw44_354317_c1_151_606 | 132 |
| 1831 | 3300050492 | nmdc:mga0yw44_44196_c1 | nmdc:mga0yw44_44196_c1_796_1251 | 132 |
| 1832 | 3300050492 | nmdc:mga0yw44_47949_c1 | nmdc:mga0yw44_47949_c1_1978_2433 | 132 |
| 1833 | 3300050492 | nmdc:mga0yw44_94644_c1 | nmdc:mga0yw44_94644_c1_557_1009 | 132 |
| 1834 | 3300050493 | nmdc:mga0k408_126867_c1 | nmdc:mga0k408_126867_c1_886_1338 | 132 |
| 1835 | 3300050493 | nmdc:mga0k408_127554_c1 | nmdc:mga0k408_127554_c1_145_597 | 132 |
| 1836 | 3300050493 | nmdc:mga0k408_544382_c1 | nmdc:mga0k408_544382_c1_211_666 | 132 |
| 1837 | 3300050494 | nmdc:mga06z11_18343_c1 | nmdc:mga06z11_18343_c1_783_1238 | 132 |
| 1838 | 3300050494 | nmdc:mga06z11_255289_c1 | nmdc:mga06z11_255289_c1_21_476 | 132 |
| 1839 | 3300050494 | nmdc:mga06z11_320891_c1 | nmdc:mga06z11_320891_c1_63_518 | 132 |
| 1840 | 3300050494 | nmdc:mga06z11_41928_c1 | nmdc:mga06z11_41928_c1_623_1075 | 132 |
| 1841 | 3300050494 | nmdc:mga06z11_72589_c1 | nmdc:mga06z11_72589_c1_276_728 | 132 |
| 1842 | 3300050495 | nmdc:mga04h51_362632_c1 | nmdc:mga04h51_362632_c1_95_550 | 132 |
| 1843 | 3300050496 | nmdc:mga07m45_10513_c1 | nmdc:mga07m45_10513_c1_718_1170 | 132 |
| 1844 | 3300050496 | nmdc:mga07m45_200148_c1 | nmdc:mga07m45_200148_c1_34_486 | 132 |
| 1845 | 3300050496 | nmdc:mga07m45_213173_c1 | nmdc:mga07m45_213173_c1_61_519 | 132 |
| 1846 | 3300050496 | nmdc:mga07m45_28645_c1 | nmdc:mga07m45_28645_c1_704_1159 | 132 |
| 1847 | 3300050513 | nmdc:mga0rr50_53176_c1 | nmdc:mga0rr50_53176_c1_635_1096 | 132 |
| 1848 | 3300050514 | nmdc:mga08x19_14_c1 | nmdc:mga08x19_14_c1_286261_286722 | 132 |
| 1849 | 3300050516 | nmdc:mga0sz30_15908_c1 | nmdc:mga0sz30_15908_c1_2286_2741 | 132 |
| 1850 | 3300050516 | nmdc:mga0sz30_173779_c1 | nmdc:mga0sz30_173779_c1_93_548 | 132 |
| 1851 | 3300050516 | nmdc:mga0sz30_55470_c1 | nmdc:mga0sz30_55470_c1_146_589 | 132 |
| 1852 | 3300050516 | nmdc:mga0sz30_7864_c1 | nmdc:mga0sz30_7864_c1_633_1085 | 132 |
| 1853 | 3300050516 | nmdc:mga0sz30_85576_c1 | nmdc:mga0sz30_85576_c1_642_1097 | 132 |
| 1854 | 3300053079 | Ga0500610_0019111 | Ga0500610_0019111_373_831 | 132 |
| 1855 | 3300053079 | Ga0500610_0045559 | Ga0500610_0045559_738_1184 | 132 |
| 1856 | 3300053083 | Ga0495655_0098817 | Ga0495655_0098817_22_474 | 132 |
| 1857 | 3300053086 | Ga0500578_0108162 | Ga0500578_0108162_1109_1561 | 132 |
| 1858 | 3300053088 | Ga0500644_0195949 | Ga0500644_0195949_271_729 | 132 |
| 1859 | 3300053093 | Ga0500651_0208329 | Ga0500651_0208329_75_527 | 132 |
| 1860 | 3300053108 | Ga0500562_045885 | Ga0500562_045885_488_934 | 132 |
| 1861 | 3300053118 | Ga0500594_0101165 | Ga0500594_0101165_344_796 | 132 |
| 1862 | 3300053119 | Ga0500595_079905 | Ga0500595_079905_23_481 | 132 |
| 1863 | 3300053122 | Ga0500608_002494 | Ga0500608_002494_4473_4946 | 132 |
| 1864 | 3300053125 | Ga0500618_005279 | Ga0500618_005279_2415_2864 | 132 |
| 1865 | 3300053134 | Ga0500658_0001009 | Ga0500658_0001009_4282_4734 | 132 |
| 1866 | 3300053134 | Ga0500658_0015794 | Ga0500658_0015794_1674_2120 | 132 |
| 1867 | 3300053134 | Ga0500658_0357987 | Ga0500658_0357987_73_531 | 132 |
| 1868 | 3300053136 | Ga0500559_0031862 | Ga0500559_0031862_461_919 | 132 |
| 1869 | 3300053139 | Ga0500568_0005268 | Ga0500568_0005268_1874_2320 | 132 |
| 1870 | 3300053139 | Ga0500568_0016433 | Ga0500568_0016433_1841_2287 | 132 |
| 1871 | 3300053142 | Ga0500577_0068985 | Ga0500577_0068985_266_739 | 132 |
| 1872 | 3300053151 | Ga0500604_0021875 | Ga0500604_0021875_539_985 | 132 |
| 1873 | 3300053153 | Ga0500616_0000417 | Ga0500616_0000417_9196_9642 | 132 |
| 1874 | 3300053153 | Ga0500616_0043680 | Ga0500616_0043680_740_1192 | 132 |
| 1875 | 3300053153 | Ga0500616_0165368 | Ga0500616_0165368_451_903 | 132 |
| 1876 | 3300053153 | Ga0500616_0217736 | Ga0500616_0217736_91_552 | 132 |
| 1877 | 3300053155 | Ga0500620_000455 | Ga0500620_000455_6567_7028 | 132 |
| 1878 | 3300053156 | Ga0500622_0000168 | Ga0500622_0000168_37415_37888 | 132 |
| 1879 | 3300053156 | Ga0500622_0002307 | Ga0500622_0002307_11416_11862 | 132 |
| 1880 | 3300053158 | Ga0500627_0231349 | Ga0500627_0231349_149_607 | 132 |
| 1881 | 3300053160 | Ga0500633_0001613 | Ga0500633_0001613_861_1307 | 132 |
| 1882 | 3300053160 | Ga0500633_0148991 | Ga0500633_0148991_393_839 | 132 |
| 1883 | 3300053177 | Ga0500636_0027374 | Ga0500636_0027374_1122_1568 | 132 |
| 1884 | 3300054114 | Ga0501084_0193881 | Ga0501084_0193881_982_1446 | 132 |
| 1885 | 3300059510 | Ga0587090_026434 | Ga0587090_026434_69_527 | 132 |
| 1886 | 3300059512 | Ga0587092_088796 | Ga0587092_088796_63_521 | 132 |
| 1887 | 3300060353 | Ga0501082_0385991 | Ga0501082_0385991_757_1203 | 132 |
| 1888 | 3300060353 | Ga0501082_0424074 | Ga0501082_0424074_618_1082 | 132 |
| 1889 | 3300060353 | Ga0501082_0473178 | Ga0501082_0473178_367_828 | 132 |
| 1890 | 3300060353 | Ga0501082_0925755 | Ga0501082_0925755_227_706 | 132 |
| 1891 | iso_pu_bacteria | 2513237159 | 2514000272 | 132 |
| 1892 | iso_pu_bacteria | 2515154107 | 2515611499 | 132 |
| 1893 | iso_pu_bacteria | 2936996657 | 2936997721 | 132 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2d4r-assembly1.cif.gz_A | crystal structure of ttha0849 from thermus thermophilus hb8 | 0.8516 | 2 | 131 |
| 1t17-assembly1.cif.gz_A | solution structure of the 18 kda protein cc1736 from caulobacter crescentus: the northeast structural genomics consortium target ccr19 | 0.8288 | 1 | 130 |
| 6w3d-assembly1.cif.gz_A | rd1ntf2_05 with long sheet | 0.8129 | 32 | 79 |
| 1t17-assembly1.cif.gz_A | solution structure of the 18 kda protein cc1736 from caulobacter crescentus: the northeast structural genomics consortium target ccr19 | 0.8126 | 1 | 130 |
| 2d4r-assembly1.cif.gz_A | crystal structure of ttha0849 from thermus thermophilus hb8 | 0.811 | 2 | 131 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q556V1_54_199_3.30.530.20 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.9053 | 4 | 131 | 3.30.530.20 |
| af_P0AGL5_15_157_3.30.530.20 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.9011 | 2 | 130 | 3.30.530.20 |
| af_Q8MLL3_83_228_3.30.530.20 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.8962 | 2 | 130 | 3.30.530.20 |
| af_A0A1D6NAC7_96_241_3.30.530.20 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.8866 | 2 | 131 | 3.30.530.20 |
| af_Q9USM9_11_156_3.30.530.20 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.8816 | 2 | 125 | 3.30.530.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A256GYQ5-F1-model_v4 | Polyketide cyclase / dehydrase and lipid transport family protein | 0.9933 | 17 | 131 |
GO:0045333
GO:0048039 |
| AF-A0A5J4E2I0-F1-model_v4 | Persistence and stress-resistance toxin PasT | 0.9909 | 1 | 130 |
GO:0045333
GO:0048039 |
| AF-A0A101VI81-F1-model_v4 | Cyclase | 0.9896 | 1 | 131 |
GO:0045333
GO:0048039 |
| AF-A0A528LFB2-F1-model_v4 | Type II toxin-antitoxin system RatA family toxin | 0.9883 | 1 | 120 |
GO:0045333
GO:0048039 |
| AF-A0A125NW27-F1-model_v4 | Putative oligoketide cyclase/dehydratase or lipid transport protein YfjG | 0.9862 | 1 | 132 |
GO:0045333
GO:0048039 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar