F495988
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1892 | 777 | 1665 | 228 |
Family's Representative Sequence
| Representative Sequence | 3300007788|Ga0099795_10003238|Ga0099795_100032384 |
| Length | 240 |
| Sequence | MTASPLKIMIVDDEPPIRKLLRMGLGTQGYDVLEAANGKIALELLAQDPALIILDLGLPDIQGHDLLRMIRGRNDSVPIVVLSSRGDEAGKVQALDLGADDYLTKPFGMDELLARMRAALRHQLQVHGERPVFRSGDLSVDLVRRIVKVGDMDVKLSPKEYDLLRILVQHAGKVLTHKFLLGELWDQLTDAQYLRVYVRQLRQKIEADPERPQFVLTETGIGYRLRAPDEIVKPTLPLET |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 4 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 5 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 6 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 7 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 8 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 9 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 10 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 11 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 12 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 13 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 14 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 15 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 16 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 17 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 18 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 19 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 20 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 21 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 22 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 23 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 24 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 25 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 26 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 27 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 28 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 29 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 30 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 31 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 32 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 33 | 2791355199 | |||
| 34 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 35 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 36 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 37 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 38 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 39 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 40 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 41 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 42 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 43 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 44 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 45 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 46 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 47 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 48 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 49 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 50 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 51 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 52 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 53 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 54 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 55 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 56 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 57 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 58 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 59 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 60 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 61 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 62 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 63 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 64 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 65 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 66 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 67 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 68 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 69 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 70 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 71 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 72 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 73 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 74 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 75 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 76 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 77 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 78 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 79 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 80 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 81 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 82 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 83 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 84 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 85 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 86 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 87 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 88 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 89 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 90 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 91 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 92 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 93 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 94 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 95 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 96 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 97 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 98 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 99 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 100 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 101 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 102 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 103 | 2904699407 | |||
| 104 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 105 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 106 | 2906610324 | |||
| 107 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 108 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 109 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 110 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 111 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 112 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 113 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 114 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 115 | 2922368715 | |||
| 116 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 117 | 2922425934 | |||
| 118 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 119 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 120 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 121 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 122 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 123 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 124 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 125 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 126 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 127 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 128 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 129 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 130 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 131 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 132 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 133 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 134 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 135 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 136 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 137 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 138 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 139 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 140 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 141 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 142 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 143 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 144 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 145 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 146 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 147 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 148 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 149 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 150 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 151 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 152 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 153 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 154 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 155 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 156 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 157 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 158 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 159 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 160 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 161 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 162 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 163 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 164 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 165 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 166 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 167 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 168 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 169 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 170 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 171 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 172 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 173 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 174 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 175 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 176 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 177 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 178 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 179 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 180 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 181 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 182 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 183 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 184 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 185 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 186 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 187 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 188 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 189 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 190 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 191 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 192 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 193 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 194 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 195 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 196 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 197 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 198 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 199 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 200 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 201 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 202 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 203 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 204 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 205 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 206 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 207 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 208 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 209 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 210 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 211 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 212 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 213 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 214 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 215 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 216 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 217 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 218 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 219 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 220 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 221 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 222 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 223 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 224 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 225 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 226 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 227 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 228 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 229 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 230 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 231 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 232 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 233 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 234 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 235 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 236 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 237 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 238 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 239 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 240 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 241 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 242 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 243 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 244 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 245 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 246 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 247 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 248 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 249 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 250 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 251 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 252 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 253 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 254 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 255 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 256 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 257 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 258 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 259 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 260 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 261 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 262 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 263 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 264 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 265 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 266 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 267 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 268 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 269 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 270 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 271 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 272 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 273 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 274 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 275 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 276 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 277 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 278 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 279 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 280 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 281 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 282 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 283 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 284 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 285 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 286 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 287 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 288 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 289 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 290 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 291 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 292 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 293 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 294 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 295 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 296 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 297 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 298 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 299 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 300 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 301 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 302 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 303 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 304 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 305 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 306 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 307 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 308 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 309 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 310 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 311 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 312 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 313 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 314 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 315 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 316 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 317 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 318 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 319 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 320 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 321 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 322 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 323 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 324 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 325 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 326 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 327 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 328 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 329 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 330 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 331 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 332 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 333 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 334 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 335 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 336 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 337 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 338 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 339 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 340 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 341 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 342 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 343 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 344 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 345 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 346 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 347 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 348 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 349 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 350 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 351 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 352 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 353 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 354 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 355 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 356 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 357 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 358 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 359 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 360 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 361 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 362 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 363 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 364 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 365 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 366 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 367 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 368 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 369 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 370 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 371 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 372 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 373 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 374 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 375 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 376 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 377 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 378 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 379 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 380 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 381 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 382 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 383 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 384 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 385 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 386 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 387 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 388 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 389 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 390 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 391 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 392 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 393 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 394 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 395 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 396 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 397 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 398 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 399 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 400 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 401 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 402 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 403 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 404 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 405 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 406 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 407 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 408 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 409 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 410 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 411 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 412 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 413 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 414 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 415 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 416 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 417 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 418 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 419 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 420 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 421 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 422 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 423 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 424 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 425 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 426 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 427 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 428 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 429 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 430 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 431 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 432 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 433 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 434 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 435 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 436 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 437 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 438 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 439 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 440 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 441 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 442 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 443 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 444 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 445 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 446 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 447 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 448 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 449 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 450 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 451 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 452 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 453 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 454 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 455 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 456 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 457 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 458 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 459 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 460 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 461 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 462 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 463 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 464 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 465 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 466 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 467 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 468 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 469 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 470 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 471 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 472 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 473 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 474 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 475 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 476 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 477 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 478 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 479 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 480 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 481 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 482 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 483 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 484 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 485 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 486 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 487 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 488 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 489 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 490 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 491 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 492 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 493 | 3300036458 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 494 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 495 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 496 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 497 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 498 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 499 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 500 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 501 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 502 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 503 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 504 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 505 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 506 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 507 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 508 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 509 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 510 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 511 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 512 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 513 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 514 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 515 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 516 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 517 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 518 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 519 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 520 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 521 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 522 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 523 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 524 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 525 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 526 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 527 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 528 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 529 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 530 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 531 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 532 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 533 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 534 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 535 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 536 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 537 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 538 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 539 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 540 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 541 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 542 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 543 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 544 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 545 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 546 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 547 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 548 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 549 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 550 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 551 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 552 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 553 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 554 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 555 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 556 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 557 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 558 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 559 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 560 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 561 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 562 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 563 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 564 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 565 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 566 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 567 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 568 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 569 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 570 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 571 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 572 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 573 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 574 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 575 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 576 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 577 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 578 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 579 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 580 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 581 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 582 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 583 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 584 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 585 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 586 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 587 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 588 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 589 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 590 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 591 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 592 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 593 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 594 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 595 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 596 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 597 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 598 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 599 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 600 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 601 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 602 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 603 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 604 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 605 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 606 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 607 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 608 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 609 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 610 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 611 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 612 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 613 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 614 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 615 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 616 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 617 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 618 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 619 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 620 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 621 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 622 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 623 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 624 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 625 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 626 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 627 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 628 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 629 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 630 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 631 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 632 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 633 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 634 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 635 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 636 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 637 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 638 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 639 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 640 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 641 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 642 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 643 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 644 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 645 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 646 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 647 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 648 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 649 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 650 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 651 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 652 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 653 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 654 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 655 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 656 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 657 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 658 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 659 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 660 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 661 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 662 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 663 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 664 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 665 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 666 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 667 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 668 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 669 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 670 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 671 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 672 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 673 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 674 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 675 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 676 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 677 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 678 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 679 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 680 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 681 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 682 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 683 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 684 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 685 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 686 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 687 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 688 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 689 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 690 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 691 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 692 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 693 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 694 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 695 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 696 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 697 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 698 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 699 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 700 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 701 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 702 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 703 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 704 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 705 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 706 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 707 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 708 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 709 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 710 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 711 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 712 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 713 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 714 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 715 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 716 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 717 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 718 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 719 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 720 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 721 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 722 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 723 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 724 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 725 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 726 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 727 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 728 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 729 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 730 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 731 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 732 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 733 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 734 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 735 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 736 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 737 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 738 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 739 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 740 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 741 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 742 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 743 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 744 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 745 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 746 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 747 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 748 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 749 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 750 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 751 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 752 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 753 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 754 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 755 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 756 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 757 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 758 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 759 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 760 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 761 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 762 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 763 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 764 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 765 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 766 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 767 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 768 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 769 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 770 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 771 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 772 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 773 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 774 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 775 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 776 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 777 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.18 |
| Metatranscriptomes | 0.05 |
| Isolates | 11.76 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.26 |
| Nodule | 9.51 |
| Rhizoplane | 6.03 |
| Rhizosphere | 62.68 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.52 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24743J22301_10025479 | 3300001991 | Bacteria | 1146 |
| 2 | JGI24750J21931_1002499 | 3300002070 | Bacteria | 2216 |
| 3 | JGI24748J21848_1009014 | 3300002074 | Bacteria | 1174 |
| 4 | JGI25406J46586_10000062 | 3300003203 | Bacteria | 49646 |
| 5 | JGI25406J46586_10033356 | 3300003203 | Bacteria | 1901 |
| 6 | JGI25406J46586_10037177 | 3300003203 | Bacteria | 1758 |
| 7 | JGI25165J46597_1007367 | 3300003214 | Bacteria | 1835 |
| 8 | JGI25153J46596_10000706 | 3300003215 | Bacteria | 20364 |
| 9 | JGI25153J46596_10004539 | 3300003215 | Bacteria | 7463 |
| 10 | JGI25153J46596_10004975 | 3300003215 | Bacteria | 7053 |
| 11 | JGI25160J50197_1000505 | 3300003354 | Bacteria | 23190 |
| 12 | JGI25160J50197_1001624 | 3300003354 | Bacteria | 11023 |
| 13 | JGI25160J50197_1003729 | 3300003354 | Bacteria | 6719 |
| 14 | JGI25160J50197_1013653 | 3300003354 | Bacteria | 2757 |
| 15 | JGI25404J52841_10000577 | 3300003659 | Bacteria | 5453 |
| 16 | JGI25404J52841_10007066 | 3300003659 | Bacteria | 2365 |
| 17 | JGI25404J52841_10016320 | 3300003659 | Bacteria | 1612 |
| 18 | Ga0055539_1006186 | 3300003752 | Bacteria | 1534 |
| 19 | Ga0055531_10002829 | 3300003794 | Bacteria | 11355 |
| 20 | Ga0055543_1003558 | 3300004625 | Bacteria | 4520 |
| 21 | Ga0065165_1000376 | 3300005262 | Bacteria | 72908 |
| 22 | Ga0065165_1001328 | 3300005262 | Bacteria | 27503 |
| 23 | Ga0065165_1005920 | 3300005262 | Bacteria | 6630 |
| 24 | Ga0065165_1012917 | 3300005262 | Bacteria | 3359 |
| 25 | Ga0065165_1031508 | 3300005262 | Bacteria | 1675 |
| 26 | Ga0070658_10066416 | 3300005327 | Bacteria | 2946 |
| 27 | Ga0070658_10089165 | 3300005327 | Bacteria | 2540 |
| 28 | Ga0070658_10100710 | 3300005327 | Bacteria | 2388 |
| 29 | Ga0070676_10021890 | 3300005328 | Bacteria | 3581 |
| 30 | Ga0070676_10172142 | 3300005328 | Bacteria | 1401 |
| 31 | Ga0070683_100013060 | 3300005329 | Bacteria | 7232 |
| 32 | Ga0070683_100312333 | 3300005329 | Bacteria | 1496 |
| 33 | Ga0070690_100036663 | 3300005330 | Bacteria | 3084 |
| 34 | Ga0070670_100038515 | 3300005331 | Bacteria | 4111 |
| 35 | Ga0068869_100117440 | 3300005334 | Bacteria | 2030 |
| 36 | Ga0068869_100266303 | 3300005334 | Bacteria | 1373 |
| 37 | Ga0070666_10028520 | 3300005335 | Bacteria | 3664 |
| 38 | Ga0070666_10148716 | 3300005335 | Bacteria | 1634 |
| 39 | Ga0070680_100040572 | 3300005336 | Bacteria | 3769 |
| 40 | Ga0070680_100044717 | 3300005336 | Bacteria | 3598 |
| 41 | Ga0070682_100056258 | 3300005337 | Bacteria | 2473 |
| 42 | Ga0070682_100168518 | 3300005337 | Bacteria | 1520 |
| 43 | Ga0070682_100435055 | 3300005337 | Bacteria | 1001 |
| 44 | Ga0068868_100024604 | 3300005338 | Bacteria | 4571 |
| 45 | Ga0068868_100039506 | 3300005338 | Bacteria | 3667 |
| 46 | Ga0070660_100013819 | 3300005339 | Bacteria | 5807 |
| 47 | Ga0070660_100276331 | 3300005339 | Bacteria | 1374 |
| 48 | Ga0070689_100006833 | 3300005340 | Bacteria | 7937 |
| 49 | Ga0070689_100163571 | 3300005340 | Bacteria | 1800 |
| 50 | Ga0070689_100321899 | 3300005340 | Bacteria | 1291 |
| 51 | Ga0070691_10002298 | 3300005341 | Bacteria | 8466 |
| 52 | Ga0070691_10189482 | 3300005341 | Bacteria | 1075 |
| 53 | Ga0070687_100006033 | 3300005343 | Bacteria | 4941 |
| 54 | Ga0070661_100061751 | 3300005344 | Bacteria | 2750 |
| 55 | Ga0070692_10042926 | 3300005345 | Bacteria | 2324 |
| 56 | Ga0070668_100009146 | 3300005347 | Bacteria | 7352 |
| 57 | Ga0070668_100035322 | 3300005347 | Bacteria | 3811 |
| 58 | Ga0070668_100179233 | 3300005347 | Bacteria | 1730 |
| 59 | Ga0070668_100236865 | 3300005347 | Bacteria | 1511 |
| 60 | Ga0070668_100303532 | 3300005347 | Bacteria | 1339 |
| 61 | Ga0070668_100385910 | 3300005347 | Bacteria | 1193 |
| 62 | Ga0070668_100584821 | 3300005347 | Bacteria | 975 |
| 63 | Ga0070669_100076280 | 3300005353 | Bacteria | 2488 |
| 64 | Ga0070675_100069644 | 3300005354 | Bacteria | 2915 |
| 65 | Ga0070675_100100706 | 3300005354 | Bacteria | 2433 |
| 66 | Ga0070671_100014286 | 3300005355 | Bacteria | 6412 |
| 67 | Ga0070671_100158405 | 3300005355 | Bacteria | 1913 |
| 68 | Ga0070671_100168577 | 3300005355 | Bacteria | 1852 |
| 69 | Ga0070674_100016093 | 3300005356 | Bacteria | 4685 |
| 70 | Ga0070674_100023493 | 3300005356 | Bacteria | 3991 |
| 71 | Ga0070674_100243336 | 3300005356 | Bacteria | 1410 |
| 72 | Ga0070674_100266687 | 3300005356 | Bacteria | 1351 |
| 73 | Ga0070673_100046344 | 3300005364 | Bacteria | 3376 |
| 74 | Ga0070688_100003433 | 3300005365 | Bacteria | 8148 |
| 75 | Ga0070659_100086707 | 3300005366 | Bacteria | 2506 |
| 76 | Ga0070659_100091497 | 3300005366 | Bacteria | 2438 |
| 77 | Ga0070659_100122684 | 3300005366 | Bacteria | 2106 |
| 78 | Ga0070667_100012673 | 3300005367 | Bacteria | 6972 |
| 79 | Ga0070667_100363549 | 3300005367 | Bacteria | 1312 |
| 80 | Ga0070703_10015029 | 3300005406 | Bacteria | 2212 |
| 81 | Ga0070709_10001936 | 3300005434 | Bacteria | 11260 |
| 82 | Ga0070709_10004500 | 3300005434 | Bacteria | 7520 |
| 83 | Ga0070709_10010623 | 3300005434 | Bacteria | 5105 |
| 84 | Ga0070709_10106150 | 3300005434 | Bacteria | 1880 |
| 85 | Ga0070714_100064454 | 3300005435 | Bacteria | 3154 |
| 86 | Ga0070714_100089440 | 3300005435 | Bacteria | 2696 |
| 87 | Ga0070714_100089795 | 3300005435 | Bacteria | 2690 |
| 88 | Ga0070714_100112756 | 3300005435 | Bacteria | 2410 |
| 89 | Ga0070714_100175907 | 3300005435 | Bacteria | 1945 |
| 90 | Ga0070714_100289478 | 3300005435 | Bacteria | 1524 |
| 91 | Ga0070714_100291309 | 3300005435 | Bacteria | 1519 |
| 92 | Ga0070714_100334584 | 3300005435 | Bacteria | 1419 |
| 93 | Ga0070714_100447220 | 3300005435 | Bacteria | 1227 |
| 94 | Ga0070714_100462941 | 3300005435 | Bacteria | 1206 |
| 95 | Ga0070714_100710706 | 3300005435 | Bacteria | 970 |
| 96 | Ga0070713_100014005 | 3300005436 | Bacteria | 5938 |
| 97 | Ga0070713_100019321 | 3300005436 | Bacteria | 5199 |
| 98 | Ga0070713_100082531 | 3300005436 | Bacteria | 2745 |
| 99 | Ga0070713_100585329 | 3300005436 | Bacteria | 1059 |
| 100 | Ga0070710_10001143 | 3300005437 | Bacteria | 12589 |
| 101 | Ga0070710_10007386 | 3300005437 | Bacteria | 5320 |
| 102 | Ga0070710_10009090 | 3300005437 | Bacteria | 4858 |
| 103 | Ga0070710_10070635 | 3300005437 | Bacteria | 2012 |
| 104 | Ga0070711_100012156 | 3300005439 | Bacteria | 5372 |
| 105 | Ga0070711_100067520 | 3300005439 | Bacteria | 2509 |
| 106 | Ga0070705_100004226 | 3300005440 | Bacteria | 7011 |
| 107 | Ga0070700_100014881 | 3300005441 | Bacteria | 4398 |
| 108 | Ga0070700_100096091 | 3300005441 | Bacteria | 1943 |
| 109 | Ga0070700_100417851 | 3300005441 | Bacteria | 1013 |
| 110 | Ga0070694_100029391 | 3300005444 | Bacteria | 3586 |
| 111 | Ga0070694_100562756 | 3300005444 | Bacteria | 914 |
| 112 | Ga0070663_100000663 | 3300005455 | Bacteria | 18514 |
| 113 | Ga0070663_100003769 | 3300005455 | Bacteria | 8803 |
| 114 | Ga0070663_100007495 | 3300005455 | Bacteria | 6645 |
| 115 | Ga0070663_100027475 | 3300005455 | Bacteria | 3865 |
| 116 | Ga0070663_100062128 | 3300005455 | Bacteria | 2692 |
| 117 | Ga0070663_100064981 | 3300005455 | Bacteria | 2639 |
| 118 | Ga0070663_100077484 | 3300005455 | Bacteria | 2434 |
| 119 | Ga0070663_100192247 | 3300005455 | Bacteria | 1589 |
| 120 | Ga0070663_100250212 | 3300005455 | Bacteria | 1402 |
| 121 | Ga0070663_100254291 | 3300005455 | Bacteria | 1391 |
| 122 | Ga0070678_100007982 | 3300005456 | Bacteria | 6309 |
| 123 | Ga0070678_100061062 | 3300005456 | Bacteria | 2777 |
| 124 | Ga0070678_100097096 | 3300005456 | Bacteria | 2275 |
| 125 | Ga0070678_100103955 | 3300005456 | Bacteria | 2208 |
| 126 | Ga0070678_100187561 | 3300005456 | Bacteria | 1698 |
| 127 | Ga0070678_100384104 | 3300005456 | Bacteria | 1216 |
| 128 | Ga0070678_100627837 | 3300005456 | Bacteria | 962 |
| 129 | Ga0070662_100048176 | 3300005457 | Bacteria | 3069 |
| 130 | Ga0070662_100095251 | 3300005457 | Bacteria | 2243 |
| 131 | Ga0070662_100210615 | 3300005457 | Bacteria | 1547 |
| 132 | Ga0070681_10007338 | 3300005458 | Bacteria | 10769 |
| 133 | Ga0070681_10020420 | 3300005458 | Bacteria | 6639 |
| 134 | Ga0070681_10029849 | 3300005458 | Bacteria | 5472 |
| 135 | Ga0070681_10066728 | 3300005458 | Bacteria | 3567 |
| 136 | Ga0070681_10224209 | 3300005458 | Bacteria | 1795 |
| 137 | Ga0070681_10949403 | 3300005458 | Bacteria | 779 |
| 138 | Ga0068867_100068902 | 3300005459 | Bacteria | 2641 |
| 139 | Ga0068867_100186927 | 3300005459 | Bacteria | 1651 |
| 140 | Ga0068867_100563409 | 3300005459 | Bacteria | 989 |
| 141 | Ga0068867_100720976 | 3300005459 | Bacteria | 882 |
| 142 | Ga0070706_100222009 | 3300005467 | Bacteria | 1764 |
| 143 | Ga0070707_100255025 | 3300005468 | Bacteria | 1707 |
| 144 | Ga0070698_100025007 | 3300005471 | Bacteria | 6225 |
| 145 | Ga0070699_100772564 | 3300005518 | Bacteria | 879 |
| 146 | Ga0070679_100005095 | 3300005530 | Bacteria | 12139 |
| 147 | Ga0070679_100013509 | 3300005530 | Bacteria | 7821 |
| 148 | Ga0070679_100016927 | 3300005530 | Bacteria | 7048 |
| 149 | Ga0070679_100025320 | 3300005530 | Bacteria | 5821 |
| 150 | Ga0070679_100128869 | 3300005530 | Bacteria | 2511 |
| 151 | Ga0070679_100651375 | 3300005530 | Bacteria | 996 |
| 152 | Ga0070684_100023322 | 3300005535 | Bacteria | 5173 |
| 153 | Ga0070684_100048283 | 3300005535 | Bacteria | 3693 |
| 154 | Ga0070684_100049381 | 3300005535 | Bacteria | 3651 |
| 155 | Ga0070684_100084182 | 3300005535 | Bacteria | 2819 |
| 156 | Ga0070684_100187820 | 3300005535 | Bacteria | 1880 |
| 157 | Ga0070684_100387519 | 3300005535 | Bacteria | 1288 |
| 158 | Ga0070697_100007535 | 3300005536 | Bacteria | 8473 |
| 159 | Ga0070697_100202486 | 3300005536 | Bacteria | 1687 |
| 160 | Ga0068853_100040827 | 3300005539 | Bacteria | 3960 |
| 161 | Ga0068853_100041848 | 3300005539 | Bacteria | 3915 |
| 162 | Ga0068853_100081360 | 3300005539 | Bacteria | 2836 |
| 163 | Ga0068853_100109748 | 3300005539 | Bacteria | 2449 |
| 164 | Ga0068853_100154095 | 3300005539 | Bacteria | 2070 |
| 165 | Ga0070672_100027503 | 3300005543 | Bacteria | 4243 |
| 166 | Ga0070672_100035120 | 3300005543 | Bacteria | 3809 |
| 167 | Ga0070672_100326055 | 3300005543 | Bacteria | 1306 |
| 168 | Ga0070672_100517280 | 3300005543 | Bacteria | 1034 |
| 169 | Ga0070686_100033840 | 3300005544 | Bacteria | 3144 |
| 170 | Ga0070695_100007577 | 3300005545 | Bacteria | 6429 |
| 171 | Ga0070696_100064667 | 3300005546 | Bacteria | 2563 |
| 172 | Ga0070693_100004992 | 3300005547 | Bacteria | 6338 |
| 173 | Ga0070693_100181969 | 3300005547 | Bacteria | 1354 |
| 174 | Ga0070693_100273492 | 3300005547 | Bacteria | 1128 |
| 175 | Ga0070665_100005052 | 3300005548 | Bacteria | 13691 |
| 176 | Ga0070665_100021610 | 3300005548 | Bacteria | 6470 |
| 177 | Ga0070665_100039433 | 3300005548 | Bacteria | 4749 |
| 178 | Ga0070665_100097761 | 3300005548 | Bacteria | 2940 |
| 179 | Ga0070665_100131152 | 3300005548 | Bacteria | 2508 |
| 180 | Ga0070665_100134270 | 3300005548 | Bacteria | 2476 |
| 181 | Ga0070665_100137017 | 3300005548 | Bacteria | 2451 |
| 182 | Ga0070665_100157201 | 3300005548 | Bacteria | 2275 |
| 183 | Ga0070665_100166352 | 3300005548 | Bacteria | 2207 |
| 184 | Ga0070665_100313179 | 3300005548 | Bacteria | 1573 |
| 185 | Ga0070665_100794089 | 3300005548 | Bacteria | 960 |
| 186 | Ga0070704_100005271 | 3300005549 | Bacteria | 7529 |
| 187 | Ga0070704_100641765 | 3300005549 | Bacteria | 937 |
| 188 | Ga0068855_100027223 | 3300005563 | Bacteria | 6840 |
| 189 | Ga0068855_100034381 | 3300005563 | Bacteria | 6046 |
| 190 | Ga0068855_100037802 | 3300005563 | Bacteria | 5738 |
| 191 | Ga0068855_100115683 | 3300005563 | Bacteria | 3074 |
| 192 | Ga0068855_100141268 | 3300005563 | Bacteria | 2745 |
| 193 | Ga0068855_100538286 | 3300005563 | Bacteria | 1265 |
| 194 | Ga0070664_100009606 | 3300005564 | Bacteria | 7846 |
| 195 | Ga0070664_100355394 | 3300005564 | Bacteria | 1334 |
| 196 | Ga0068857_100015743 | 3300005577 | Bacteria | 6616 |
| 197 | Ga0068857_100018827 | 3300005577 | Bacteria | 6060 |
| 198 | Ga0068857_100078820 | 3300005577 | Bacteria | 2940 |
| 199 | Ga0068857_100201187 | 3300005577 | Bacteria | 1816 |
| 200 | Ga0068857_100313399 | 3300005577 | Bacteria | 1448 |
| 201 | Ga0068854_100033336 | 3300005578 | Bacteria | 3590 |
| 202 | Ga0068854_100080740 | 3300005578 | Bacteria | 2400 |
| 203 | Ga0068856_100000283 | 3300005614 | Bacteria | 55412 |
| 204 | Ga0068856_100016740 | 3300005614 | Bacteria | 7102 |
| 205 | Ga0068856_100019887 | 3300005614 | Bacteria | 6517 |
| 206 | Ga0068856_100108039 | 3300005614 | Bacteria | 2778 |
| 207 | Ga0068856_100116988 | 3300005614 | Bacteria | 2666 |
| 208 | Ga0068856_100440823 | 3300005614 | Bacteria | 1323 |
| 209 | Ga0068856_101136045 | 3300005614 | Unclassified | 798 |
| 210 | Ga0070702_100003746 | 3300005615 | Bacteria | 6860 |
| 211 | Ga0070702_100147855 | 3300005615 | Bacteria | 1504 |
| 212 | Ga0070702_100457246 | 3300005615 | Bacteria | 927 |
| 213 | Ga0068852_100007805 | 3300005616 | Bacteria | 7836 |
| 214 | Ga0068852_100058756 | 3300005616 | Bacteria | 3333 |
| 215 | Ga0068852_100070295 | 3300005616 | Bacteria | 3070 |
| 216 | Ga0068859_101056914 | 3300005617 | Bacteria | 892 |
| 217 | Ga0068864_100032278 | 3300005618 | Bacteria | 4448 |
| 218 | Ga0068864_100215062 | 3300005618 | Bacteria | 1771 |
| 219 | Ga0068866_10018909 | 3300005718 | Bacteria | 3125 |
| 220 | Ga0068866_10028659 | 3300005718 | Bacteria | 2655 |
| 221 | Ga0068861_100026034 | 3300005719 | Bacteria | 4248 |
| 222 | Ga0068861_100033280 | 3300005719 | Bacteria | 3801 |
| 223 | Ga0068861_100154774 | 3300005719 | Bacteria | 1884 |
| 224 | Ga0068861_100246718 | 3300005719 | Bacteria | 1521 |
| 225 | Ga0068851_10004060 | 3300005834 | Bacteria | 6571 |
| 226 | Ga0068851_10074104 | 3300005834 | Bacteria | 1766 |
| 227 | Ga0068870_10219054 | 3300005840 | Bacteria | 1164 |
| 228 | Ga0068863_100004189 | 3300005841 | Bacteria | 14241 |
| 229 | Ga0068863_100127752 | 3300005841 | Bacteria | 2426 |
| 230 | Ga0068863_100314107 | 3300005841 | Bacteria | 1521 |
| 231 | Ga0068858_100009007 | 3300005842 | Bacteria | 9548 |
| 232 | Ga0068858_100070599 | 3300005842 | Bacteria | 3237 |
| 233 | Ga0068858_100134948 | 3300005842 | Bacteria | 2315 |
| 234 | Ga0068858_100172454 | 3300005842 | Bacteria | 2040 |
| 235 | Ga0068860_100000277 | 3300005843 | Bacteria | 73951 |
| 236 | Ga0068860_100011349 | 3300005843 | Bacteria | 8779 |
| 237 | Ga0068860_100011762 | 3300005843 | Bacteria | 8625 |
| 238 | Ga0068860_100453402 | 3300005843 | Bacteria | 1275 |
| 239 | Ga0068860_101128785 | 3300005843 | Bacteria | 803 |
| 240 | Ga0068862_100048501 | 3300005844 | Bacteria | 3626 |
| 241 | Ga0068862_100136558 | 3300005844 | Bacteria | 2173 |
| 242 | Ga0068862_100224886 | 3300005844 | Bacteria | 1700 |
| 243 | Ga0068862_100405335 | 3300005844 | Bacteria | 1276 |
| 244 | Ga0081455_10000306 | 3300005937 | Bacteria | 64656 |
| 245 | Ga0081455_10001198 | 3300005937 | Bacteria | 32472 |
| 246 | Ga0081455_10006252 | 3300005937 | Bacteria | 12820 |
| 247 | Ga0081455_10009461 | 3300005937 | Bacteria | 10024 |
| 248 | Ga0081455_10033325 | 3300005937 | Bacteria | 4630 |
| 249 | Ga0081455_10040150 | 3300005937 | Bacteria | 4129 |
| 250 | Ga0081455_10183671 | 3300005937 | Bacteria | 1581 |
| 251 | Ga0081538_10102094 | 3300005981 | Bacteria | 1440 |
| 252 | Ga0081540_1000001 | 3300005983 | Bacteria | 293507 |
| 253 | Ga0081540_1001897 | 3300005983 | Bacteria | 17504 |
| 254 | Ga0081540_1006855 | 3300005983 | Bacteria | 8223 |
| 255 | Ga0081540_1011371 | 3300005983 | Bacteria | 5952 |
| 256 | Ga0081540_1013165 | 3300005983 | Bacteria | 5397 |
| 257 | Ga0081540_1013298 | 3300005983 | Bacteria | 5358 |
| 258 | Ga0081540_1017054 | 3300005983 | Bacteria | 4514 |
| 259 | Ga0081540_1017569 | 3300005983 | Bacteria | 4423 |
| 260 | Ga0081540_1022061 | 3300005983 | Bacteria | 3768 |
| 261 | Ga0081540_1024332 | 3300005983 | Bacteria | 3516 |
| 262 | Ga0081540_1026807 | 3300005983 | Bacteria | 3279 |
| 263 | Ga0081540_1026873 | 3300005983 | Bacteria | 3275 |
| 264 | Ga0081540_1037549 | 3300005983 | Bacteria | 2566 |
| 265 | Ga0081540_1048742 | 3300005983 | Bacteria | 2119 |
| 266 | Ga0081540_1078281 | 3300005983 | Bacteria | 1499 |
| 267 | Ga0081539_10000008 | 3300005985 | Bacteria | 525071 |
| 268 | Ga0081539_10026336 | 3300005985 | Bacteria | 3714 |
| 269 | Ga0070717_10001012 | 3300006028 | Bacteria | 18845 |
| 270 | Ga0070717_10010060 | 3300006028 | Bacteria | 7122 |
| 271 | Ga0075365_10011472 | 3300006038 | Bacteria | 5212 |
| 272 | Ga0075365_10068152 | 3300006038 | Bacteria | 2390 |
| 273 | Ga0075365_10075092 | 3300006038 | Bacteria | 2281 |
| 274 | Ga0075365_10202852 | 3300006038 | Bacteria | 1389 |
| 275 | Ga0075365_10302718 | 3300006038 | Bacteria | 1125 |
| 276 | Ga0075365_10378499 | 3300006038 | Bacteria | 998 |
| 277 | Ga0075365_10477743 | 3300006038 | Bacteria | 881 |
| 278 | Ga0075368_10002893 | 3300006042 | Bacteria | 5669 |
| 279 | Ga0075368_10003317 | 3300006042 | Bacteria | 5358 |
| 280 | Ga0075368_10109116 | 3300006042 | Bacteria | 1140 |
| 281 | Ga0075368_10115520 | 3300006042 | Bacteria | 1109 |
| 282 | Ga0075363_100001432 | 3300006048 | Bacteria | 9037 |
| 283 | Ga0075363_100137520 | 3300006048 | Bacteria | 1374 |
| 284 | Ga0075363_100137628 | 3300006048 | Bacteria | 1373 |
| 285 | Ga0075364_10038662 | 3300006051 | Bacteria | 3091 |
| 286 | Ga0075364_10045249 | 3300006051 | Bacteria | 2864 |
| 287 | Ga0075364_10065307 | 3300006051 | Bacteria | 2389 |
| 288 | Ga0075364_10087272 | 3300006051 | Bacteria | 2067 |
| 289 | Ga0075432_10018636 | 3300006058 | Bacteria | 2367 |
| 290 | Ga0075432_10037184 | 3300006058 | Bacteria | 1694 |
| 291 | Ga0070715_10005928 | 3300006163 | Bacteria | 4118 |
| 292 | Ga0070716_100017256 | 3300006173 | Bacteria | 3739 |
| 293 | Ga0070716_100036955 | 3300006173 | Bacteria | 2696 |
| 294 | Ga0070716_100194084 | 3300006173 | Bacteria | 1344 |
| 295 | Ga0070716_100247470 | 3300006173 | Bacteria | 1212 |
| 296 | Ga0070716_100356971 | 3300006173 | Bacteria | 1037 |
| 297 | Ga0070712_100019838 | 3300006175 | Bacteria | 4393 |
| 298 | Ga0070712_100049077 | 3300006175 | Bacteria | 2929 |
| 299 | Ga0070712_100056553 | 3300006175 | Bacteria | 2752 |
| 300 | Ga0070712_100058516 | 3300006175 | Bacteria | 2711 |
| 301 | Ga0070712_100158392 | 3300006175 | Bacteria | 1746 |
| 302 | Ga0070712_100172222 | 3300006175 | Bacteria | 1680 |
| 303 | Ga0070712_100273710 | 3300006175 | Bacteria | 1358 |
| 304 | Ga0075362_10050918 | 3300006177 | Bacteria | 1853 |
| 305 | Ga0075367_10031390 | 3300006178 | Bacteria | 3050 |
| 306 | Ga0075367_10079801 | 3300006178 | Bacteria | 1978 |
| 307 | Ga0075369_10061911 | 3300006186 | Bacteria | 1634 |
| 308 | Ga0075366_10116073 | 3300006195 | Bacteria | 1612 |
| 309 | Ga0097621_100166536 | 3300006237 | Bacteria | 1898 |
| 310 | Ga0097621_100757703 | 3300006237 | Bacteria | 897 |
| 311 | Ga0075370_10002046 | 3300006353 | Bacteria | 9161 |
| 312 | Ga0075370_10020184 | 3300006353 | Bacteria | 3638 |
| 313 | Ga0075370_10059641 | 3300006353 | Bacteria | 2172 |
| 314 | Ga0075370_10099673 | 3300006353 | Bacteria | 1680 |
| 315 | Ga0068871_100110201 | 3300006358 | Bacteria | 2315 |
| 316 | Ga0068871_100396995 | 3300006358 | Bacteria | 1228 |
| 317 | Ga0075428_100054152 | 3300006844 | Bacteria | 4396 |
| 318 | Ga0075428_100200750 | 3300006844 | Bacteria | 2156 |
| 319 | Ga0075431_100171833 | 3300006847 | Bacteria | 2226 |
| 320 | Ga0075433_10000999 | 3300006852 | Bacteria | 20100 |
| 321 | Ga0075433_10020386 | 3300006852 | Bacteria | 5541 |
| 322 | Ga0075433_10056224 | 3300006852 | Bacteria | 3436 |
| 323 | Ga0075433_10207995 | 3300006852 | Bacteria | 1739 |
| 324 | Ga0075434_100001934 | 3300006871 | Bacteria | 17961 |
| 325 | Ga0075434_100007502 | 3300006871 | Bacteria | 10096 |
| 326 | Ga0075434_100043273 | 3300006871 | Bacteria | 4465 |
| 327 | Ga0075434_100128231 | 3300006871 | Bacteria | 2554 |
| 328 | Ga0075429_100197702 | 3300006880 | Bacteria | 1761 |
| 329 | Ga0075429_100200317 | 3300006880 | Bacteria | 1749 |
| 330 | Ga0068865_100023292 | 3300006881 | Bacteria | 4053 |
| 331 | Ga0068865_100139877 | 3300006881 | Bacteria | 1824 |
| 332 | Ga0075436_100022603 | 3300006914 | Bacteria | 4319 |
| 333 | Ga0075436_100064703 | 3300006914 | Bacteria | 2528 |
| 334 | Ga0075436_100174825 | 3300006914 | Bacteria | 1516 |
| 335 | Ga0097620_101056928 | 3300006931 | Bacteria | 892 |
| 336 | Ga0099825_1027090 | 3300006941 | Bacteria | 2964 |
| 337 | Ga0099824_1014162 | 3300006942 | Bacteria | 8022 |
| 338 | Ga0099822_1026792 | 3300006943 | Bacteria | 4827 |
| 339 | Ga0099823_1069218 | 3300006944 | Bacteria | 1608 |
| 340 | Ga0075435_100005822 | 3300007076 | Bacteria | 8665 |
| 341 | Ga0075435_100024551 | 3300007076 | Bacteria | 4680 |
| 342 | Ga0099794_10089180 | 3300007265 | Bacteria | 1529 |
| 343 | Ga0099795_10003238 | 3300007788 | Bacteria | 4006 |
| 344 | Ga0099795_10012255 | 3300007788 | Bacteria | 2594 |
| 345 | Ga0105251_10027724 | 3300009011 | Bacteria | 2868 |
| 346 | Ga0105240_10002493 | 3300009093 | Bacteria | 29572 |
| 347 | Ga0105240_10018493 | 3300009093 | Bacteria | 9354 |
| 348 | Ga0105240_10076446 | 3300009093 | Bacteria | 4128 |
| 349 | Ga0105240_10112264 | 3300009093 | Bacteria | 3295 |
| 350 | Ga0105240_10138714 | 3300009093 | Bacteria | 2909 |
| 351 | Ga0105240_10323628 | 3300009093 | Bacteria | 1756 |
| 352 | Ga0105240_10994681 | 3300009093 | Bacteria | 897 |
| 353 | Ga0111539_10022154 | 3300009094 | Bacteria | 7810 |
| 354 | Ga0111539_10147744 | 3300009094 | Bacteria | 2752 |
| 355 | Ga0111539_10163929 | 3300009094 | Bacteria | 2600 |
| 356 | Ga0111539_10181011 | 3300009094 | Bacteria | 2461 |
| 357 | Ga0111539_10986493 | 3300009094 | Bacteria | 979 |
| 358 | Ga0105245_10003690 | 3300009098 | Bacteria | 13668 |
| 359 | Ga0105245_10044517 | 3300009098 | Bacteria | 3962 |
| 360 | Ga0105245_10129266 | 3300009098 | Bacteria | 2368 |
| 361 | Ga0105245_10479406 | 3300009098 | Bacteria | 1257 |
| 362 | Ga0105245_10487885 | 3300009098 | Bacteria | 1246 |
| 363 | Ga0105245_10610366 | 3300009098 | Bacteria | 1118 |
| 364 | Ga0105247_10017053 | 3300009101 | Bacteria | 4358 |
| 365 | Ga0105247_10041233 | 3300009101 | Bacteria | 2824 |
| 366 | Ga0105247_10202315 | 3300009101 | Bacteria | 1335 |
| 367 | Ga0114129_10027872 | 3300009147 | Bacteria | 7999 |
| 368 | Ga0114129_10306143 | 3300009147 | Bacteria | 2116 |
| 369 | Ga0114129_10991086 | 3300009147 | Bacteria | 1059 |
| 370 | Ga0105243_10007991 | 3300009148 | Bacteria | 8125 |
| 371 | Ga0105243_10074342 | 3300009148 | Bacteria | 2756 |
| 372 | Ga0105243_10478938 | 3300009148 | Bacteria | 1174 |
| 373 | Ga0105241_10008442 | 3300009174 | Bacteria | 7573 |
| 374 | Ga0105241_10014774 | 3300009174 | Bacteria | 5716 |
| 375 | Ga0105241_10017796 | 3300009174 | Bacteria | 5227 |
| 376 | Ga0105241_10028146 | 3300009174 | Bacteria | 4186 |
| 377 | Ga0105241_10037162 | 3300009174 | Bacteria | 3668 |
| 378 | Ga0105241_10131302 | 3300009174 | Bacteria | 2028 |
| 379 | Ga0105242_10015701 | 3300009176 | Bacteria | 5883 |
| 380 | Ga0105248_10006272 | 3300009177 | Bacteria | 13041 |
| 381 | Ga0105248_10028201 | 3300009177 | Bacteria | 6253 |
| 382 | Ga0105248_10278629 | 3300009177 | Bacteria | 1883 |
| 383 | Ga0105248_10472369 | 3300009177 | Bacteria | 1414 |
| 384 | Ga0105248_10955669 | 3300009177 | Bacteria | 968 |
| 385 | Ga0105237_10000158 | 3300009545 | Bacteria | 96082 |
| 386 | Ga0105237_10014566 | 3300009545 | Bacteria | 8217 |
| 387 | Ga0105237_10017088 | 3300009545 | Bacteria | 7526 |
| 388 | Ga0105237_10084146 | 3300009545 | Bacteria | 3172 |
| 389 | Ga0105237_10112758 | 3300009545 | Bacteria | 2711 |
| 390 | Ga0105237_10149127 | 3300009545 | Bacteria | 2335 |
| 391 | Ga0105237_10284630 | 3300009545 | Bacteria | 1656 |
| 392 | Ga0105238_10012869 | 3300009551 | Bacteria | 8443 |
| 393 | Ga0105238_10023571 | 3300009551 | Bacteria | 6271 |
| 394 | Ga0105238_10061525 | 3300009551 | Bacteria | 3757 |
| 395 | Ga0105238_10061908 | 3300009551 | Bacteria | 3744 |
| 396 | Ga0105238_10089704 | 3300009551 | Bacteria | 3062 |
| 397 | Ga0105238_10104562 | 3300009551 | Bacteria | 2812 |
| 398 | Ga0105238_10309131 | 3300009551 | Bacteria | 1565 |
| 399 | Ga0105238_10312311 | 3300009551 | Bacteria | 1557 |
| 400 | Ga0105238_10530343 | 3300009551 | Bacteria | 1180 |
| 401 | Ga0105249_10055328 | 3300009553 | Bacteria | 3629 |
| 402 | Ga0105249_10234844 | 3300009553 | Bacteria | 1810 |
| 403 | Ga0105249_11291472 | 3300009553 | Bacteria | 801 |
| 404 | Ga0105249_11364000 | 3300009553 | Bacteria | 781 |
| 405 | Ga0099796_10020712 | 3300010159 | Bacteria | 2014 |
| 406 | Ga0099796_10022780 | 3300010159 | Bacteria | 1948 |
| 407 | Ga0099796_10029557 | 3300010159 | Bacteria | 1769 |
| 408 | Ga0099796_10041469 | 3300010159 | Bacteria | 1559 |
| 409 | Ga0099796_10066536 | 3300010159 | Bacteria | 1291 |
| 410 | Ga0105239_10004277 | 3300010375 | Bacteria | 17129 |
| 411 | Ga0105239_10005523 | 3300010375 | Bacteria | 14807 |
| 412 | Ga0105239_10057289 | 3300010375 | Bacteria | 4274 |
| 413 | Ga0105239_10095874 | 3300010375 | Bacteria | 3277 |
| 414 | Ga0105239_10118537 | 3300010375 | Bacteria | 2937 |
| 415 | Ga0105239_10134899 | 3300010375 | Bacteria | 2748 |
| 416 | Ga0105239_10175383 | 3300010375 | Bacteria | 2397 |
| 417 | Ga0105239_11389529 | 3300010375 | Bacteria | 810 |
| 418 | Ga0105246_10007614 | 3300011119 | Bacteria | 6643 |
| 419 | Ga0105246_10194715 | 3300011119 | Bacteria | 1571 |
| 420 | Ga0157373_10133973 | 3300013100 | Bacteria | 1742 |
| 421 | Ga0157371_10105376 | 3300013102 | Bacteria | 2001 |
| 422 | Ga0157371_10496883 | 3300013102 | Bacteria | 901 |
| 423 | Ga0157370_10093144 | 3300013104 | Bacteria | 2827 |
| 424 | Ga0157370_10287409 | 3300013104 | Bacteria | 1519 |
| 425 | Ga0157369_10005514 | 3300013105 | Bacteria | 14695 |
| 426 | Ga0157369_10006035 | 3300013105 | Bacteria | 14061 |
| 427 | Ga0157369_10031238 | 3300013105 | Bacteria | 5867 |
| 428 | Ga0157374_10057878 | 3300013296 | Bacteria | 3621 |
| 429 | Ga0157374_10590525 | 3300013296 | Bacteria | 1120 |
| 430 | Ga0157378_10018416 | 3300013297 | Bacteria | 6132 |
| 431 | Ga0157378_10115012 | 3300013297 | Bacteria | 2472 |
| 432 | Ga0157378_10390418 | 3300013297 | Bacteria | 1369 |
| 433 | Ga0163162_10051849 | 3300013306 | Bacteria | 4118 |
| 434 | Ga0163162_10112846 | 3300013306 | Bacteria | 2817 |
| 435 | Ga0163162_10199564 | 3300013306 | Bacteria | 2129 |
| 436 | Ga0163162_10273004 | 3300013306 | Bacteria | 1823 |
| 437 | Ga0163162_10439138 | 3300013306 | Bacteria | 1437 |
| 438 | Ga0157372_10035289 | 3300013307 | Bacteria | 5505 |
| 439 | Ga0157372_10088052 | 3300013307 | Bacteria | 3525 |
| 440 | Ga0157372_10147696 | 3300013307 | Bacteria | 2711 |
| 441 | Ga0157375_10044735 | 3300013308 | Bacteria | 4304 |
| 442 | Ga0157375_10072217 | 3300013308 | Bacteria | 3467 |
| 443 | Ga0157375_10107146 | 3300013308 | Bacteria | 2888 |
| 444 | Ga0157375_10130039 | 3300013308 | Bacteria | 2636 |
| 445 | Ga0163163_10044996 | 3300014325 | Bacteria | 4331 |
| 446 | Ga0163163_10189978 | 3300014325 | Bacteria | 2102 |
| 447 | Ga0163163_10607446 | 3300014325 | Bacteria | 1157 |
| 448 | Ga0163163_10829088 | 3300014325 | Bacteria | 988 |
| 449 | Ga0157380_10009706 | 3300014326 | Bacteria | 6906 |
| 450 | Ga0157380_10030387 | 3300014326 | Bacteria | 4137 |
| 451 | Ga0157380_10169597 | 3300014326 | Bacteria | 1905 |
| 452 | Ga0157380_10414811 | 3300014326 | Bacteria | 1282 |
| 453 | Ga0157377_10004423 | 3300014745 | Bacteria | 6470 |
| 454 | Ga0157377_10141918 | 3300014745 | Bacteria | 1477 |
| 455 | Ga0157377_10527478 | 3300014745 | Bacteria | 830 |
| 456 | Ga0157379_10009402 | 3300014968 | Bacteria | 8519 |
| 457 | Ga0157379_10103657 | 3300014968 | Bacteria | 2553 |
| 458 | Ga0157379_10195701 | 3300014968 | Bacteria | 1827 |
| 459 | Ga0157379_10221610 | 3300014968 | Bacteria | 1714 |
| 460 | Ga0157379_10248252 | 3300014968 | Bacteria | 1615 |
| 461 | Ga0157379_10313215 | 3300014968 | Bacteria | 1432 |
| 462 | Ga0157376_10012280 | 3300014969 | Bacteria | 6352 |
| 463 | Ga0157376_10046154 | 3300014969 | Bacteria | 3591 |
| 464 | Ga0157376_10240131 | 3300014969 | Bacteria | 1688 |
| 465 | Ga0157376_10351916 | 3300014969 | Bacteria | 1410 |
| 466 | Ga0163161_10003814 | 3300017792 | Bacteria | 10568 |
| 467 | Ga0163161_10498400 | 3300017792 | Bacteria | 991 |
| 468 | Ga0163161_10913063 | 3300017792 | Bacteria | 745 |
| 469 | Ga0214544_1000001 | 3300021320 | Bacteria | 783667 |
| 470 | Ga0214544_1036392 | 3300021320 | Bacteria | 1267 |
| 471 | Ga0214542_1000005 | 3300021321 | Bacteria | 389646 |
| 472 | Ga0214545_1000003 | 3300021324 | Bacteria | 720274 |
| 473 | Ga0214545_1038911 | 3300021324 | Bacteria | 1361 |
| 474 | Ga0214543_1000002 | 3300021327 | Bacteria | 712733 |
| 475 | Ga0213872_10114627 | 3300021361 | Bacteria | 1195 |
| 476 | Ga0213874_10006171 | 3300021377 | Bacteria | 2827 |
| 477 | Ga0213874_10070496 | 3300021377 | Bacteria | 1114 |
| 478 | Ga0213874_10145707 | 3300021377 | Bacteria | 823 |
| 479 | Ga0213876_10123851 | 3300021384 | Bacteria | 1373 |
| 480 | Ga0213876_10132489 | 3300021384 | Bacteria | 1325 |
| 481 | Ga0213876_10227595 | 3300021384 | Bacteria | 991 |
| 482 | Ga0213875_10000169 | 3300021388 | Bacteria | 68414 |
| 483 | Ga0213875_10232200 | 3300021388 | Bacteria | 869 |
| 484 | Ga0213871_10107958 | 3300021441 | Bacteria | 820 |
| 485 | Ga0209563_102014 | 3300025230 | Bacteria | 4856 |
| 486 | Ga0207425_1021752 | 3300025245 | Bacteria | 1357 |
| 487 | Ga0209677_100668 | 3300025253 | Bacteria | 17893 |
| 488 | Ga0209677_104813 | 3300025253 | Bacteria | 3738 |
| 489 | Ga0209148_1000849 | 3300025254 | Bacteria | 21522 |
| 490 | Ga0209233_1001267 | 3300025261 | Bacteria | 10136 |
| 491 | Ga0209233_1005558 | 3300025261 | Bacteria | 4169 |
| 492 | Ga0209233_1007348 | 3300025261 | Bacteria | 3495 |
| 493 | Ga0209455_1003309 | 3300025272 | Bacteria | 5779 |
| 494 | Ga0209564_1000838 | 3300025295 | Bacteria | 41472 |
| 495 | Ga0209564_1004046 | 3300025295 | Bacteria | 9247 |
| 496 | Ga0209758_1000026 | 3300025297 | Bacteria | 582706 |
| 497 | Ga0209758_1000526 | 3300025297 | Bacteria | 61197 |
| 498 | Ga0209758_1004341 | 3300025297 | Bacteria | 11878 |
| 499 | Ga0209758_1007841 | 3300025297 | Bacteria | 7115 |
| 500 | Ga0209758_1008754 | 3300025297 | Bacteria | 6459 |
| 501 | Ga0209758_1014582 | 3300025297 | Bacteria | 4164 |
| 502 | Ga0209758_1023615 | 3300025297 | Bacteria | 2773 |
| 503 | Ga0209758_1080571 | 3300025297 | Bacteria | 986 |
| 504 | Ga0209256_1005563 | 3300025299 | Bacteria | 7186 |
| 505 | Ga0209256_1042573 | 3300025299 | Bacteria | 1146 |
| 506 | Ga0207426_1000213 | 3300025302 | Bacteria | 137311 |
| 507 | Ga0207426_1000740 | 3300025302 | Bacteria | 36958 |
| 508 | Ga0207426_1031908 | 3300025302 | Bacteria | 1715 |
| 509 | Ga0209051_1041983 | 3300025303 | Bacteria | 1621 |
| 510 | Ga0209257_1000930 | 3300025304 | Bacteria | 40542 |
| 511 | Ga0209257_1029117 | 3300025304 | Bacteria | 1804 |
| 512 | Ga0207697_10014409 | 3300025315 | Bacteria | 3279 |
| 513 | Ga0207697_10014551 | 3300025315 | Bacteria | 3262 |
| 514 | Ga0207656_10004418 | 3300025321 | Bacteria | 4908 |
| 515 | Ga0207656_10038504 | 3300025321 | Bacteria | 2018 |
| 516 | Ga0207692_10001730 | 3300025898 | Bacteria | 8265 |
| 517 | Ga0207692_10019163 | 3300025898 | Bacteria | 3087 |
| 518 | Ga0207692_10030253 | 3300025898 | Bacteria | 2581 |
| 519 | Ga0207692_10120850 | 3300025898 | Bacteria | 1467 |
| 520 | Ga0207692_10309668 | 3300025898 | Bacteria | 963 |
| 521 | Ga0207642_10039675 | 3300025899 | Bacteria | 2048 |
| 522 | Ga0207710_10013544 | 3300025900 | Bacteria | 3431 |
| 523 | Ga0207688_10001376 | 3300025901 | Bacteria | 12614 |
| 524 | Ga0207688_10020870 | 3300025901 | Bacteria | 3576 |
| 525 | Ga0207688_10027816 | 3300025901 | Bacteria | 3110 |
| 526 | Ga0207680_10082252 | 3300025903 | Bacteria | 2026 |
| 527 | Ga0207680_10219512 | 3300025903 | Bacteria | 1303 |
| 528 | Ga0207680_10240409 | 3300025903 | Bacteria | 1248 |
| 529 | Ga0207647_10034918 | 3300025904 | Bacteria | 3207 |
| 530 | Ga0207647_10036146 | 3300025904 | Bacteria | 3141 |
| 531 | Ga0207647_10149147 | 3300025904 | Bacteria | 1367 |
| 532 | Ga0207685_10165438 | 3300025905 | Bacteria | 1013 |
| 533 | Ga0207699_10004047 | 3300025906 | Bacteria | 7017 |
| 534 | Ga0207699_10007087 | 3300025906 | Bacteria | 5464 |
| 535 | Ga0207699_10007801 | 3300025906 | Bacteria | 5245 |
| 536 | Ga0207699_10039662 | 3300025906 | Bacteria | 2707 |
| 537 | Ga0207699_10115493 | 3300025906 | Bacteria | 1727 |
| 538 | Ga0207699_10346594 | 3300025906 | Bacteria | 1048 |
| 539 | Ga0207645_10007649 | 3300025907 | Bacteria | 7614 |
| 540 | Ga0207645_10055873 | 3300025907 | Bacteria | 2520 |
| 541 | Ga0207645_10167889 | 3300025907 | Bacteria | 1437 |
| 542 | Ga0207643_10058362 | 3300025908 | Bacteria | 2199 |
| 543 | Ga0207643_10060125 | 3300025908 | Bacteria | 2169 |
| 544 | Ga0207705_10070043 | 3300025909 | Bacteria | 2541 |
| 545 | Ga0207705_10076917 | 3300025909 | Bacteria | 2427 |
| 546 | Ga0207705_10227212 | 3300025909 | Bacteria | 1419 |
| 547 | Ga0207705_10273456 | 3300025909 | Bacteria | 1292 |
| 548 | Ga0207684_10231370 | 3300025910 | Bacteria | 1595 |
| 549 | Ga0207654_10000520 | 3300025911 | Bacteria | 22053 |
| 550 | Ga0207654_10005608 | 3300025911 | Bacteria | 6347 |
| 551 | Ga0207654_10008634 | 3300025911 | Bacteria | 5163 |
| 552 | Ga0207654_10087088 | 3300025911 | Bacteria | 1894 |
| 553 | Ga0207654_10154902 | 3300025911 | Bacteria | 1475 |
| 554 | Ga0207707_10001782 | 3300025912 | Bacteria | 19762 |
| 555 | Ga0207707_10014876 | 3300025912 | Bacteria | 6776 |
| 556 | Ga0207707_10018060 | 3300025912 | Bacteria | 6144 |
| 557 | Ga0207707_10139197 | 3300025912 | Bacteria | 2122 |
| 558 | Ga0207707_10232309 | 3300025912 | Bacteria | 1604 |
| 559 | Ga0207707_10273202 | 3300025912 | Bacteria | 1465 |
| 560 | Ga0207695_10000006 | 3300025913 | Bacteria | 1135309 |
| 561 | Ga0207695_10000325 | 3300025913 | Bacteria | 113706 |
| 562 | Ga0207695_10025997 | 3300025913 | Bacteria | 6541 |
| 563 | Ga0207695_10100090 | 3300025913 | Bacteria | 2895 |
| 564 | Ga0207695_10129580 | 3300025913 | Bacteria | 2481 |
| 565 | Ga0207695_10157380 | 3300025913 | Bacteria | 2206 |
| 566 | Ga0207695_10363625 | 3300025913 | Bacteria | 1333 |
| 567 | Ga0207671_10000774 | 3300025914 | Bacteria | 40531 |
| 568 | Ga0207671_10000795 | 3300025914 | Bacteria | 39998 |
| 569 | Ga0207671_10127294 | 3300025914 | Bacteria | 1952 |
| 570 | Ga0207671_10190146 | 3300025914 | Bacteria | 1601 |
| 571 | Ga0207693_10002301 | 3300025915 | Bacteria | 16603 |
| 572 | Ga0207693_10010463 | 3300025915 | Bacteria | 7528 |
| 573 | Ga0207693_10025020 | 3300025915 | Bacteria | 4735 |
| 574 | Ga0207693_10026610 | 3300025915 | Bacteria | 4577 |
| 575 | Ga0207693_10027516 | 3300025915 | Bacteria | 4495 |
| 576 | Ga0207693_10074778 | 3300025915 | Bacteria | 2653 |
| 577 | Ga0207693_10092862 | 3300025915 | Bacteria | 2365 |
| 578 | Ga0207693_10312758 | 3300025915 | Bacteria | 1230 |
| 579 | Ga0207663_10001398 | 3300025916 | Bacteria | 11185 |
| 580 | Ga0207663_10033830 | 3300025916 | Bacteria | 3049 |
| 581 | Ga0207663_10839981 | 3300025916 | Bacteria | 733 |
| 582 | Ga0207660_10040098 | 3300025917 | Bacteria | 3277 |
| 583 | Ga0207660_10074429 | 3300025917 | Bacteria | 2479 |
| 584 | Ga0207660_10095719 | 3300025917 | Bacteria | 2209 |
| 585 | Ga0207660_10422132 | 3300025917 | Bacteria | 1076 |
| 586 | Ga0207662_10002382 | 3300025918 | Bacteria | 9419 |
| 587 | Ga0207662_10135675 | 3300025918 | Bacteria | 1555 |
| 588 | Ga0207657_10014812 | 3300025919 | Bacteria | 7591 |
| 589 | Ga0207657_10038095 | 3300025919 | Bacteria | 4285 |
| 590 | Ga0207649_10058366 | 3300025920 | Bacteria | 2416 |
| 591 | Ga0207652_10017537 | 3300025921 | Bacteria | 5859 |
| 592 | Ga0207652_10038942 | 3300025921 | Bacteria | 4033 |
| 593 | Ga0207652_10072840 | 3300025921 | Bacteria | 2988 |
| 594 | Ga0207652_10168285 | 3300025921 | Bacteria | 1966 |
| 595 | Ga0207652_10270904 | 3300025921 | Bacteria | 1531 |
| 596 | Ga0207681_10085563 | 3300025923 | Bacteria | 2238 |
| 597 | Ga0207694_10000169 | 3300025924 | Bacteria | 67519 |
| 598 | Ga0207694_10116937 | 3300025924 | Bacteria | 2125 |
| 599 | Ga0207694_10135820 | 3300025924 | Bacteria | 1975 |
| 600 | Ga0207694_10175233 | 3300025924 | Bacteria | 1738 |
| 601 | Ga0207694_10302698 | 3300025924 | Bacteria | 1317 |
| 602 | Ga0207650_10088866 | 3300025925 | Bacteria | 2357 |
| 603 | Ga0207659_10098341 | 3300025926 | Bacteria | 2200 |
| 604 | Ga0207687_10011456 | 3300025927 | Bacteria | 5796 |
| 605 | Ga0207687_10334893 | 3300025927 | Bacteria | 1229 |
| 606 | Ga0207700_10013816 | 3300025928 | Bacteria | 5270 |
| 607 | Ga0207700_10056273 | 3300025928 | Bacteria | 2960 |
| 608 | Ga0207700_10129734 | 3300025928 | Bacteria | 2056 |
| 609 | Ga0207700_10503599 | 3300025928 | Bacteria | 1072 |
| 610 | Ga0207700_10872391 | 3300025928 | Bacteria | 805 |
| 611 | Ga0207664_10024228 | 3300025929 | Bacteria | 4559 |
| 612 | Ga0207664_10047761 | 3300025929 | Bacteria | 3364 |
| 613 | Ga0207664_10072404 | 3300025929 | Bacteria | 2778 |
| 614 | Ga0207664_10116494 | 3300025929 | Bacteria | 2229 |
| 615 | Ga0207664_10191013 | 3300025929 | Bacteria | 1763 |
| 616 | Ga0207664_10223666 | 3300025929 | Bacteria | 1633 |
| 617 | Ga0207664_10374751 | 3300025929 | Bacteria | 1263 |
| 618 | Ga0207664_10389935 | 3300025929 | Bacteria | 1237 |
| 619 | Ga0207664_10443709 | 3300025929 | Bacteria | 1158 |
| 620 | Ga0207644_10176821 | 3300025931 | Bacteria | 1670 |
| 621 | Ga0207644_10681172 | 3300025931 | Bacteria | 857 |
| 622 | Ga0207690_10065840 | 3300025932 | Bacteria | 2479 |
| 623 | Ga0207690_10446024 | 3300025932 | Bacteria | 1039 |
| 624 | Ga0207706_10009779 | 3300025933 | Bacteria | 8801 |
| 625 | Ga0207706_10026350 | 3300025933 | Bacteria | 5204 |
| 626 | Ga0207706_10073412 | 3300025933 | Bacteria | 3008 |
| 627 | Ga0207686_10043900 | 3300025934 | Bacteria | 2741 |
| 628 | Ga0207686_10306571 | 3300025934 | Bacteria | 1181 |
| 629 | Ga0207709_10067640 | 3300025935 | Bacteria | 2255 |
| 630 | Ga0207670_10075638 | 3300025936 | Bacteria | 2341 |
| 631 | Ga0207670_10134670 | 3300025936 | Bacteria | 1815 |
| 632 | Ga0207670_10517012 | 3300025936 | Bacteria | 971 |
| 633 | Ga0207669_10007561 | 3300025937 | Bacteria | 5037 |
| 634 | Ga0207669_10008972 | 3300025937 | Bacteria | 4729 |
| 635 | Ga0207669_10110858 | 3300025937 | Bacteria | 1838 |
| 636 | Ga0207704_10017120 | 3300025938 | Bacteria | 3748 |
| 637 | Ga0207704_10190233 | 3300025938 | Bacteria | 1492 |
| 638 | Ga0207665_10001960 | 3300025939 | Bacteria | 13847 |
| 639 | Ga0207665_10002091 | 3300025939 | Bacteria | 13489 |
| 640 | Ga0207665_10058036 | 3300025939 | Bacteria | 2616 |
| 641 | Ga0207665_10186683 | 3300025939 | Bacteria | 1504 |
| 642 | Ga0207665_10280090 | 3300025939 | Bacteria | 1241 |
| 643 | Ga0207665_10304482 | 3300025939 | Bacteria | 1192 |
| 644 | Ga0207665_10517061 | 3300025939 | Bacteria | 924 |
| 645 | Ga0207691_10029337 | 3300025940 | Bacteria | 5146 |
| 646 | Ga0207691_10132909 | 3300025940 | Bacteria | 2197 |
| 647 | Ga0207691_10636162 | 3300025940 | Bacteria | 902 |
| 648 | Ga0207711_10053200 | 3300025941 | Bacteria | 3472 |
| 649 | Ga0207711_10130445 | 3300025941 | Bacteria | 2253 |
| 650 | Ga0207711_10530638 | 3300025941 | Bacteria | 1098 |
| 651 | Ga0207711_10810180 | 3300025941 | Bacteria | 872 |
| 652 | Ga0207689_10035700 | 3300025942 | Bacteria | 4129 |
| 653 | Ga0207689_10089402 | 3300025942 | Bacteria | 2530 |
| 654 | Ga0207689_10116089 | 3300025942 | Bacteria | 2200 |
| 655 | Ga0207661_10000190 | 3300025944 | Bacteria | 39991 |
| 656 | Ga0207661_10018201 | 3300025944 | Bacteria | 5217 |
| 657 | Ga0207661_10107163 | 3300025944 | Bacteria | 2357 |
| 658 | Ga0207661_10225636 | 3300025944 | Bacteria | 1657 |
| 659 | Ga0207661_10373666 | 3300025944 | Bacteria | 1289 |
| 660 | Ga0207679_10074708 | 3300025945 | Bacteria | 2569 |
| 661 | Ga0207679_10249152 | 3300025945 | Bacteria | 1509 |
| 662 | Ga0207667_10049550 | 3300025949 | Bacteria | 4435 |
| 663 | Ga0207667_10078315 | 3300025949 | Bacteria | 3426 |
| 664 | Ga0207667_10164246 | 3300025949 | Bacteria | 2283 |
| 665 | Ga0207667_10194783 | 3300025949 | Bacteria | 2079 |
| 666 | Ga0207667_10197624 | 3300025949 | Bacteria | 2063 |
| 667 | Ga0207667_10242544 | 3300025949 | Bacteria | 1844 |
| 668 | Ga0207667_10286433 | 3300025949 | Bacteria | 1683 |
| 669 | Ga0207651_10088129 | 3300025960 | Bacteria | 2261 |
| 670 | Ga0207712_10062310 | 3300025961 | Bacteria | 2651 |
| 671 | Ga0207712_10901890 | 3300025961 | Bacteria | 781 |
| 672 | Ga0207668_10022231 | 3300025972 | Bacteria | 4056 |
| 673 | Ga0207668_10040143 | 3300025972 | Bacteria | 3156 |
| 674 | Ga0207668_10058829 | 3300025972 | Bacteria | 2688 |
| 675 | Ga0207668_10096133 | 3300025972 | Bacteria | 2188 |
| 676 | Ga0207668_10167890 | 3300025972 | Bacteria | 1718 |
| 677 | Ga0207640_10029000 | 3300025981 | Bacteria | 3391 |
| 678 | Ga0207640_10061743 | 3300025981 | Bacteria | 2483 |
| 679 | Ga0207640_10162056 | 3300025981 | Bacteria | 1656 |
| 680 | Ga0207640_10166426 | 3300025981 | Bacteria | 1638 |
| 681 | Ga0207640_10715237 | 3300025981 | Bacteria | 860 |
| 682 | Ga0207658_10044483 | 3300025986 | Bacteria | 3232 |
| 683 | Ga0207677_10055045 | 3300026023 | Bacteria | 2718 |
| 684 | Ga0207677_10086175 | 3300026023 | Bacteria | 2269 |
| 685 | Ga0207677_10186011 | 3300026023 | Bacteria | 1638 |
| 686 | Ga0207677_10433791 | 3300026023 | Bacteria | 1122 |
| 687 | Ga0207703_10023501 | 3300026035 | Bacteria | 4843 |
| 688 | Ga0207703_10045029 | 3300026035 | Bacteria | 3548 |
| 689 | Ga0207703_10184681 | 3300026035 | Bacteria | 1842 |
| 690 | Ga0207639_10049797 | 3300026041 | Bacteria | 3178 |
| 691 | Ga0207639_10057758 | 3300026041 | Bacteria | 2981 |
| 692 | Ga0207639_10174906 | 3300026041 | Bacteria | 1822 |
| 693 | Ga0207639_10434201 | 3300026041 | Bacteria | 1189 |
| 694 | Ga0207678_10002185 | 3300026067 | Bacteria | 17669 |
| 695 | Ga0207678_10020155 | 3300026067 | Bacteria | 5856 |
| 696 | Ga0207678_10021851 | 3300026067 | Bacteria | 5611 |
| 697 | Ga0207678_10046589 | 3300026067 | Bacteria | 3749 |
| 698 | Ga0207678_10077717 | 3300026067 | Bacteria | 2843 |
| 699 | Ga0207678_10078603 | 3300026067 | Bacteria | 2825 |
| 700 | Ga0207678_10088427 | 3300026067 | Bacteria | 2648 |
| 701 | Ga0207678_10100074 | 3300026067 | Bacteria | 2476 |
| 702 | Ga0207678_10148502 | 3300026067 | Bacteria | 2001 |
| 703 | Ga0207708_10001961 | 3300026075 | Bacteria | 15177 |
| 704 | Ga0207708_10070474 | 3300026075 | Bacteria | 2676 |
| 705 | Ga0207708_10191367 | 3300026075 | Bacteria | 1629 |
| 706 | Ga0207702_10000022 | 3300026078 | Bacteria | 192961 |
| 707 | Ga0207702_10000052 | 3300026078 | Bacteria | 137784 |
| 708 | Ga0207702_10094231 | 3300026078 | Bacteria | 2628 |
| 709 | Ga0207702_10117867 | 3300026078 | Bacteria | 2371 |
| 710 | Ga0207702_10136517 | 3300026078 | Bacteria | 2214 |
| 711 | Ga0207702_10153898 | 3300026078 | Bacteria | 2094 |
| 712 | Ga0207702_10154546 | 3300026078 | Bacteria | 2090 |
| 713 | Ga0207641_10082824 | 3300026088 | Bacteria | 2788 |
| 714 | Ga0207641_10095105 | 3300026088 | Bacteria | 2614 |
| 715 | Ga0207641_10172247 | 3300026088 | Bacteria | 1977 |
| 716 | Ga0207641_10330528 | 3300026088 | Bacteria | 1448 |
| 717 | Ga0207641_10441419 | 3300026088 | Bacteria | 1256 |
| 718 | Ga0207641_10458638 | 3300026088 | Bacteria | 1233 |
| 719 | Ga0207648_10017087 | 3300026089 | Bacteria | 6613 |
| 720 | Ga0207676_10130965 | 3300026095 | Bacteria | 2132 |
| 721 | Ga0207676_10252786 | 3300026095 | Bacteria | 1587 |
| 722 | Ga0207676_10278753 | 3300026095 | Bacteria | 1517 |
| 723 | Ga0207674_10012563 | 3300026116 | Bacteria | 9462 |
| 724 | Ga0207674_10020723 | 3300026116 | Bacteria | 7095 |
| 725 | Ga0207674_10068039 | 3300026116 | Bacteria | 3585 |
| 726 | Ga0207674_10123735 | 3300026116 | Bacteria | 2552 |
| 727 | Ga0207674_10169021 | 3300026116 | Bacteria | 2140 |
| 728 | Ga0207674_10213163 | 3300026116 | Bacteria | 1880 |
| 729 | Ga0207674_10920227 | 3300026116 | Bacteria | 843 |
| 730 | Ga0207675_100017040 | 3300026118 | Bacteria | 6789 |
| 731 | Ga0207675_100019581 | 3300026118 | Bacteria | 6315 |
| 732 | Ga0207675_100030553 | 3300026118 | Bacteria | 5019 |
| 733 | Ga0207675_100352199 | 3300026118 | Bacteria | 1443 |
| 734 | Ga0207683_10002193 | 3300026121 | Bacteria | 17161 |
| 735 | Ga0207683_10057402 | 3300026121 | Bacteria | 3417 |
| 736 | Ga0207683_10082242 | 3300026121 | Bacteria | 2860 |
| 737 | Ga0207683_10207001 | 3300026121 | Bacteria | 1784 |
| 738 | Ga0207683_10210647 | 3300026121 | Bacteria | 1769 |
| 739 | Ga0207683_10628129 | 3300026121 | Bacteria | 995 |
| 740 | Ga0207698_10019579 | 3300026142 | Bacteria | 4637 |
| 741 | Ga0207698_10039116 | 3300026142 | Bacteria | 3510 |
| 742 | Ga0207698_10199604 | 3300026142 | Bacteria | 1790 |
| 743 | Ga0207698_10490775 | 3300026142 | Bacteria | 1193 |
| 744 | Ga0207698_10920680 | 3300026142 | Bacteria | 882 |
| 745 | Ga0209389_1000057 | 3300027296 | Bacteria | 107632 |
| 746 | Ga0209389_1000083 | 3300027296 | Bacteria | 88461 |
| 747 | Ga0209589_1000007 | 3300027357 | Bacteria | 425699 |
| 748 | Ga0209589_1000097 | 3300027357 | Bacteria | 88461 |
| 749 | Ga0209489_100008 | 3300027361 | Bacteria | 425699 |
| 750 | Ga0209489_100105 | 3300027361 | Bacteria | 118979 |
| 751 | Ga0209489_100226 | 3300027361 | Bacteria | 94384 |
| 752 | Ga0209700_100009 | 3300027363 | Bacteria | 425699 |
| 753 | Ga0209700_100085 | 3300027363 | Bacteria | 128517 |
| 754 | Ga0209588_1016150 | 3300027671 | Bacteria | 2301 |
| 755 | Ga0209588_1040574 | 3300027671 | Bacteria | 1502 |
| 756 | Ga0209813_10005475 | 3300027866 | Bacteria | 3084 |
| 757 | Ga0209813_10083870 | 3300027866 | Bacteria | 1058 |
| 758 | Ga0207428_10049851 | 3300027907 | Bacteria | 3352 |
| 759 | Ga0207428_10063714 | 3300027907 | Bacteria | 2912 |
| 760 | Ga0268266_10000350 | 3300028379 | Bacteria | 71708 |
| 761 | Ga0268266_10000519 | 3300028379 | Bacteria | 54346 |
| 762 | Ga0268266_10002731 | 3300028379 | Bacteria | 18479 |
| 763 | Ga0268266_10019207 | 3300028379 | Bacteria | 5820 |
| 764 | Ga0268266_10037075 | 3300028379 | Bacteria | 4154 |
| 765 | Ga0268266_10074305 | 3300028379 | Bacteria | 2951 |
| 766 | Ga0268266_10156708 | 3300028379 | Bacteria | 2057 |
| 767 | Ga0268266_10229049 | 3300028379 | Bacteria | 1711 |
| 768 | Ga0268266_10391610 | 3300028379 | Bacteria | 1312 |
| 769 | Ga0268265_10049598 | 3300028380 | Bacteria | 3158 |
| 770 | Ga0268265_10107742 | 3300028380 | Bacteria | 2267 |
| 771 | Ga0268265_10208774 | 3300028380 | Bacteria | 1700 |
| 772 | Ga0268265_10608714 | 3300028380 | Bacteria | 1045 |
| 773 | Ga0268264_10000158 | 3300028381 | Bacteria | 153433 |
| 774 | Ga0268264_10070247 | 3300028381 | Bacteria | 2964 |
| 775 | Ga0268264_10099646 | 3300028381 | Bacteria | 2522 |
| 776 | Ga0268264_10108404 | 3300028381 | Bacteria | 2428 |
| 777 | Ga0268264_10124611 | 3300028381 | Bacteria | 2275 |
| 778 | Ga0265337_1001723 | 3300028556 | Bacteria | 10571 |
| 779 | Ga0265326_10002861 | 3300028558 | Bacteria | 5765 |
| 780 | Ga0265319_1002269 | 3300028563 | Bacteria | 10636 |
| 781 | Ga0265334_10002914 | 3300028573 | Bacteria | 7838 |
| 782 | Ga0265318_10005349 | 3300028577 | Bacteria | 6032 |
| 783 | Ga0265323_10001151 | 3300028653 | Bacteria | 13524 |
| 784 | Ga0265322_10004281 | 3300028654 | Bacteria | 4266 |
| 785 | Ga0265336_10000211 | 3300028666 | Bacteria | 40984 |
| 786 | Ga0307517_10000248 | 3300028786 | Bacteria | 92084 |
| 787 | Ga0307517_10060854 | 3300028786 | Bacteria | 3584 |
| 788 | Ga0307517_10141324 | 3300028786 | Bacteria | 1689 |
| 789 | Ga0307515_10150462 | 3300028794 | Bacteria | 2436 |
| 790 | Ga0307515_10256889 | 3300028794 | Bacteria | 1490 |
| 791 | Ga0265338_10004459 | 3300028800 | Bacteria | 18887 |
| 792 | Ga0265324_10033618 | 3300029957 | Bacteria | 1788 |
| 793 | Ga0307511_10065784 | 3300030521 | Bacteria | 2708 |
| 794 | Ga0265332_10033327 | 3300031238 | Bacteria | 2242 |
| 795 | Ga0265320_10043315 | 3300031240 | Bacteria | 2226 |
| 796 | Ga0265340_10032951 | 3300031247 | Bacteria | 2583 |
| 797 | Ga0265340_10151841 | 3300031247 | Bacteria | 1055 |
| 798 | Ga0265339_10000791 | 3300031249 | Bacteria | 24441 |
| 799 | Ga0265339_10017714 | 3300031249 | Bacteria | 4212 |
| 800 | Ga0265339_10063779 | 3300031249 | Bacteria | 1978 |
| 801 | Ga0265331_10045142 | 3300031250 | Bacteria | 2128 |
| 802 | Ga0265331_10049913 | 3300031250 | Bacteria | 2008 |
| 803 | Ga0307513_10512329 | 3300031456 | Bacteria | 916 |
| 804 | Ga0307509_10074149 | 3300031507 | Bacteria | 3540 |
| 805 | Ga0307509_10084204 | 3300031507 | Bacteria | 3276 |
| 806 | Ga0307509_10205094 | 3300031507 | Bacteria | 1803 |
| 807 | Ga0307509_10378734 | 3300031507 | Bacteria | 1128 |
| 808 | Ga0307408_100227663 | 3300031548 | Bacteria | 1525 |
| 809 | Ga0307508_10024925 | 3300031616 | Bacteria | 5426 |
| 810 | Ga0307508_10054665 | 3300031616 | Bacteria | 3538 |
| 811 | Ga0265314_10003471 | 3300031711 | Bacteria | 15228 |
| 812 | Ga0265314_10015898 | 3300031711 | Bacteria | 5960 |
| 813 | Ga0265314_10077853 | 3300031711 | Bacteria | 2198 |
| 814 | Ga0265314_10105152 | 3300031711 | Bacteria | 1806 |
| 815 | Ga0265342_10001311 | 3300031712 | Bacteria | 23336 |
| 816 | Ga0265342_10074566 | 3300031712 | Bacteria | 1971 |
| 817 | Ga0307516_10020861 | 3300031730 | Bacteria | 6762 |
| 818 | Ga0307516_10043612 | 3300031730 | Bacteria | 4443 |
| 819 | Ga0307516_10221803 | 3300031730 | Bacteria | 1599 |
| 820 | Ga0307516_10451251 | 3300031730 | Bacteria | 942 |
| 821 | Ga0307413_10222632 | 3300031824 | Bacteria | 1379 |
| 822 | Ga0307406_10204646 | 3300031901 | Bacteria | 1456 |
| 823 | Ga0307407_10167047 | 3300031903 | Bacteria | 1446 |
| 824 | Ga0307412_10104757 | 3300031911 | Bacteria | 2008 |
| 825 | Ga0307412_10127680 | 3300031911 | Bacteria | 1842 |
| 826 | Ga0307412_10253768 | 3300031911 | Bacteria | 1367 |
| 827 | Ga0307412_10539694 | 3300031911 | Bacteria | 978 |
| 828 | Ga0307409_100120990 | 3300031995 | Bacteria | 2217 |
| 829 | Ga0307416_100038819 | 3300032002 | Bacteria | 3678 |
| 830 | Ga0307416_100201470 | 3300032002 | Bacteria | 1889 |
| 831 | Ga0307416_100394760 | 3300032002 | Bacteria | 1419 |
| 832 | Ga0307415_100067119 | 3300032126 | Bacteria | 2505 |
| 833 | Ga0307507_10008612 | 3300033179 | Bacteria | 14010 |
| 834 | Ga0307510_10007392 | 3300033180 | Bacteria | 13100 |
| 835 | Ga0307510_10021151 | 3300033180 | Bacteria | 7586 |
| 836 | Ga0307510_10039656 | 3300033180 | Bacteria | 5184 |
| 837 | Ga0307510_10047952 | 3300033180 | Bacteria | 4565 |
| 838 | Ga0307510_10234318 | 3300033180 | Bacteria | 1336 |
| 839 | Ga0315911_1000031 | 3300033442 | Bacteria | 74171 |
| 840 | Ga0373958_0026429 | 3300034819 | Bacteria | 1111 |
| 841 | Ga0373938_0013658 | 3300034957 | Bacteria | 1545 |
| 842 | Ga0373938_0042402 | 3300034957 | Bacteria | 1015 |
| 843 | Ga0373926_0058534 | 3300035083 | Bacteria | 1401 |
| 844 | Ga0373929_0068087 | 3300035085 | Bacteria | 846 |
| 845 | Ga0373934_0004724 | 3300035086 | Bacteria | 5035 |
| 846 | Ga0373934_0014502 | 3300035086 | Bacteria | 2987 |
| 847 | Ga0373934_0020207 | 3300035086 | Bacteria | 2559 |
| 848 | Ga0373934_0172668 | 3300035086 | Bacteria | 887 |
| 849 | Ga0373940_0062717 | 3300035088 | Bacteria | 1067 |
| 850 | Ga0373949_0005172 | 3300035090 | Bacteria | 2928 |
| 851 | Ga0373923_0005165 | 3300035111 | Bacteria | 4414 |
| 852 | Ga0373923_0102368 | 3300035111 | Bacteria | 1264 |
| 853 | Ga0373936_0003595 | 3300035113 | Bacteria | 5832 |
| 854 | Ga0373936_0041251 | 3300035113 | Bacteria | 1851 |
| 855 | Ga0373945_0005590 | 3300035116 | Bacteria | 4031 |
| 856 | Ga0373953_0000957 | 3300035117 | Bacteria | 8077 |
| 857 | Ga0373953_0004118 | 3300035117 | Bacteria | 4610 |
| 858 | Ga0373953_0019754 | 3300035117 | Bacteria | 2510 |
| 859 | Ga0373953_0208063 | 3300035117 | Bacteria | 847 |
| 860 | Ga0373954_0011864 | 3300035118 | Bacteria | 3870 |
| 861 | Ga0373954_0031969 | 3300035118 | Bacteria | 2431 |
| 862 | Ga0373954_0038673 | 3300035118 | Bacteria | 2219 |
| 863 | Ga0373954_0053827 | 3300035118 | Bacteria | 1892 |
| 864 | Ga0373956_0058002 | 3300035119 | Bacteria | 1750 |
| 865 | Ga0373956_0296594 | 3300035119 | Bacteria | 770 |
| 866 | Ga0373960_0040855 | 3300035121 | Bacteria | 1340 |
| 867 | Ga0373943_0120099 | 3300035170 | Bacteria | 1396 |
| 868 | Ga0373943_0210860 | 3300035170 | Bacteria | 1079 |
| 869 | Ga0373943_0343614 | 3300035170 | Bacteria | 854 |
| 870 | Ga0373946_0007992 | 3300035171 | Bacteria | 3886 |
| 871 | Ga0373946_0050465 | 3300035171 | Bacteria | 1738 |
| 872 | Ga0373946_0195319 | 3300035171 | Bacteria | 967 |
| 873 | Ga0373955_0000304 | 3300035172 | Bacteria | 20374 |
| 874 | Ga0373955_0319719 | 3300035172 | Bacteria | 937 |
| 875 | Ga0373942_0124107 | 3300035207 | Bacteria | 809 |
| 876 | Ga0373962_0007446 | 3300035242 | Bacteria | 2680 |
| 877 | Ga0373931_0001970 | 3300035691 | Bacteria | 9029 |
| 878 | Ga0373935_0000088 | 3300035692 | Bacteria | 40092 |
| 879 | Ga0373935_0024272 | 3300035692 | Bacteria | 3731 |
| 880 | Ga0373935_0060786 | 3300035692 | Bacteria | 2417 |
| 881 | Ga0373935_0135996 | 3300035692 | Bacteria | 1656 |
| 882 | Ga0373927_0003336 | 3300035695 | Bacteria | 11548 |
| 883 | Ga0373927_0003671 | 3300035695 | Bacteria | 10930 |
| 884 | Ga0373927_0014610 | 3300035695 | Bacteria | 5194 |
| 885 | Ga0373927_0048900 | 3300035695 | Bacteria | 2735 |
| 886 | Ga0373927_0059166 | 3300035695 | Bacteria | 2478 |
| 887 | Ga0373927_0196279 | 3300035695 | Bacteria | 1324 |
| 888 | Ga0373927_0269080 | 3300035695 | Bacteria | 1121 |
| 889 | Ga0373927_0482615 | 3300035695 | Bacteria | 819 |
| 890 | Ga0373933_0017318 | 3300035724 | Bacteria | 4041 |
| 891 | Ga0373933_0153043 | 3300035724 | Bacteria | 1461 |
| 892 | Ga0373947_0001821 | 3300035725 | Bacteria | 13046 |
| 893 | Ga0373947_0002575 | 3300035725 | Bacteria | 10905 |
| 894 | Ga0373947_0012043 | 3300035725 | Bacteria | 4953 |
| 895 | Ga0373937_0000124 | 3300036401 | Bacteria | 73933 |
| 896 | Ga0373937_0000983 | 3300036401 | Bacteria | 24176 |
| 897 | Ga0373937_0021564 | 3300036401 | Bacteria | 5780 |
| 898 | Ga0373937_0089666 | 3300036401 | Bacteria | 2847 |
| 899 | Ga0373937_0360231 | 3300036401 | Bacteria | 1378 |
| 900 | Ga0373937_0465060 | 3300036401 | Bacteria | 1201 |
| 901 | Ga0310112_015267 | 3300036458 | Bacteria | 1092 |
| 902 | Ga0373925_0000210 | 3300037068 | Bacteria | 63621 |
| 903 | Ga0373925_0166054 | 3300037068 | Bacteria | 1741 |
| 904 | Ga0373925_0250667 | 3300037068 | Bacteria | 1420 |
| 905 | Ga0373925_0268047 | 3300037068 | Bacteria | 1373 |
| 906 | Ga0395898_0002276 | 3300037466 | Bacteria | 23184 |
| 907 | Ga0395898_0038790 | 3300037466 | Bacteria | 4718 |
| 908 | Ga0395898_0051399 | 3300037466 | Bacteria | 4030 |
| 909 | Ga0395898_0245304 | 3300037466 | Bacteria | 1708 |
| 910 | Ga0395905_0016854 | 3300037471 | Bacteria | 6942 |
| 911 | Ga0436364_0178575 | 3300037853 | Bacteria | 1782 |
| 912 | Ga0436364_0309073 | 3300037853 | Bacteria | 2353 |
| 913 | Ga0436364_0350531 | 3300037853 | Bacteria | 5930 |
| 914 | Ga0436364_0418429 | 3300037853 | Bacteria | 19706 |
| 915 | Ga0436364_0663094 | 3300037853 | Bacteria | 1362 |
| 916 | Ga0436364_0829844 | 3300037853 | Bacteria | 1821 |
| 917 | Ga0436364_1050269 | 3300037853 | Bacteria | 1141 |
| 918 | Ga0395901_0129827 | 3300038443 | Bacteria | 2648 |
| 919 | Ga0395901_0353511 | 3300038443 | Bacteria | 1516 |
| 920 | Ga0436365_0035453 | 3300039437 | Bacteria | 923 |
| 921 | Ga0436365_0132219 | 3300039437 | Bacteria | 3079 |
| 922 | Ga0436365_0607631 | 3300039437 | Bacteria | 926 |
| 923 | Ga0436365_0739478 | 3300039437 | Bacteria | 2600 |
| 924 | Ga0436365_0914371 | 3300039437 | Bacteria | 2316 |
| 925 | Ga0436365_1144022 | 3300039437 | Bacteria | 1347 |
| 926 | Ga0436365_1376117 | 3300039437 | Bacteria | 2173 |
| 927 | Ga0436365_1410381 | 3300039437 | Bacteria | 2140 |
| 928 | Ga0436365_1520875 | 3300039437 | Bacteria | 2457 |
| 929 | Ga0436365_1704008 | 3300039437 | Bacteria | 1599 |
| 930 | Ga0436360_0265948 | 3300039438 | Bacteria | 1718 |
| 931 | Ga0436360_0535298 | 3300039438 | Bacteria | 943 |
| 932 | Ga0436360_0872836 | 3300039438 | Bacteria | 3724 |
| 933 | Ga0436360_1281396 | 3300039438 | Bacteria | 2452 |
| 934 | Ga0436361_0335302 | 3300039447 | Bacteria | 2594 |
| 935 | Ga0436361_0518172 | 3300039447 | Bacteria | 1665 |
| 936 | Ga0436361_0978240 | 3300039447 | Bacteria | 3630 |
| 937 | Ga0436361_1196327 | 3300039447 | Bacteria | 4454 |
| 938 | Ga0436363_0060203 | 3300039450 | Bacteria | 863 |
| 939 | Ga0436363_0093542 | 3300039450 | Bacteria | 6968 |
| 940 | Ga0436363_0300553 | 3300039450 | Bacteria | 4994 |
| 941 | Ga0436363_0542830 | 3300039450 | Bacteria | 1938 |
| 942 | Ga0436363_0719444 | 3300039450 | Bacteria | 1228 |
| 943 | Ga0436362_0719751 | 3300039453 | Bacteria | 1673 |
| 944 | Ga0439465_0101101 | 3300041413 | Bacteria | 995 |
| 945 | Ga0451807_1928304 | 3300041486 | Bacteria | 944 |
| 946 | Ga0466969_0062246 | 3300044656 | Bacteria | 1811 |
| 947 | Ga0466972_0000244 | 3300044658 | Bacteria | 37027 |
| 948 | Ga0466972_0078001 | 3300044658 | Bacteria | 1577 |
| 949 | Ga0466966_0029887 | 3300044684 | Bacteria | 3542 |
| 950 | Ga0466966_0048888 | 3300044684 | Bacteria | 2694 |
| 951 | Ga0466961_0010569 | 3300044693 | Bacteria | 5887 |
| 952 | Ga0466963_0149800 | 3300044694 | Bacteria | 1620 |
| 953 | Ga0466963_0567593 | 3300044694 | Bacteria | 801 |
| 954 | Ga0466968_0005654 | 3300044735 | Bacteria | 4683 |
| 955 | Ga0466970_0026140 | 3300044765 | Bacteria | 3060 |
| 956 | Ga0466970_0158616 | 3300044765 | Bacteria | 1251 |
| 957 | Ga0466957_0050090 | 3300044842 | Bacteria | 2541 |
| 958 | Ga0466957_0186484 | 3300044842 | Bacteria | 1357 |
| 959 | Ga0466957_0237303 | 3300044842 | Bacteria | 1209 |
| 960 | Ga0466960_0002982 | 3300044901 | Bacteria | 6452 |
| 961 | Ga0466959_0021197 | 3300045049 | Bacteria | 4791 |
| 962 | Ga0466959_0309425 | 3300045049 | Bacteria | 1081 |
| 963 | Ga0466967_0042506 | 3300045976 | Bacteria | 3928 |
| 964 | Ga0466967_0096660 | 3300045976 | Bacteria | 2694 |
| 965 | Ga0466967_0119766 | 3300045976 | Bacteria | 2430 |
| 966 | Ga0466967_0261702 | 3300045976 | Bacteria | 1655 |
| 967 | Ga0466967_0397230 | 3300045976 | Bacteria | 1341 |
| 968 | Ga0466967_0791278 | 3300045976 | Bacteria | 941 |
| 969 | Ga0495617_003959 | 3300046452 | Bacteria | 5451 |
| 970 | Ga0495617_014139 | 3300046452 | Bacteria | 2713 |
| 971 | Ga0495592_0000020 | 3300046454 | Bacteria | 140576 |
| 972 | Ga0495592_0070778 | 3300046454 | Bacteria | 2540 |
| 973 | Ga0495592_0138747 | 3300046454 | Bacteria | 1693 |
| 974 | Ga0495592_0216323 | 3300046454 | Bacteria | 1284 |
| 975 | Ga0495592_0310049 | 3300046454 | Bacteria | 1023 |
| 976 | Ga0495592_0479756 | 3300046454 | Bacteria | 775 |
| 977 | Ga0495603_0007714 | 3300046455 | Bacteria | 6483 |
| 978 | Ga0495603_0011954 | 3300046455 | Bacteria | 5253 |
| 979 | Ga0495603_0013691 | 3300046455 | Bacteria | 4908 |
| 980 | Ga0495603_0014900 | 3300046455 | Bacteria | 4703 |
| 981 | Ga0495603_0042376 | 3300046455 | Bacteria | 2721 |
| 982 | Ga0495603_0081307 | 3300046455 | Bacteria | 1898 |
| 983 | Ga0495603_0102431 | 3300046455 | Bacteria | 1671 |
| 984 | Ga0495603_0113179 | 3300046455 | Bacteria | 1582 |
| 985 | Ga0495603_0234239 | 3300046455 | Bacteria | 1058 |
| 986 | Ga0495590_0054197 | 3300046457 | Bacteria | 1401 |
| 987 | Ga0495629_0002004 | 3300046459 | Bacteria | 15830 |
| 988 | Ga0495629_0030237 | 3300046459 | Bacteria | 3841 |
| 989 | Ga0495629_0056416 | 3300046459 | Bacteria | 2747 |
| 990 | Ga0495629_0106438 | 3300046459 | Bacteria | 1956 |
| 991 | Ga0495629_0116897 | 3300046459 | Bacteria | 1858 |
| 992 | Ga0495629_0173109 | 3300046459 | Bacteria | 1497 |
| 993 | Ga0495629_0221607 | 3300046459 | Bacteria | 1305 |
| 994 | Ga0495638_0006931 | 3300046460 | Bacteria | 8176 |
| 995 | Ga0495638_0010623 | 3300046460 | Bacteria | 6377 |
| 996 | Ga0495638_0063518 | 3300046460 | Bacteria | 2276 |
| 997 | Ga0495641_0094324 | 3300046461 | Bacteria | 1337 |
| 998 | Ga0495651_0005254 | 3300046462 | Bacteria | 9871 |
| 999 | Ga0495651_0008334 | 3300046462 | Bacteria | 7945 |
| 1000 | Ga0495651_0011786 | 3300046462 | Bacteria | 6719 |
| 1001 | Ga0495651_0012080 | 3300046462 | Bacteria | 6646 |
| 1002 | Ga0495653_0000046 | 3300046463 | Bacteria | 113893 |
| 1003 | Ga0495653_0024568 | 3300046463 | Bacteria | 4854 |
| 1004 | Ga0495653_0058242 | 3300046463 | Bacteria | 2937 |
| 1005 | Ga0495653_0085332 | 3300046463 | Bacteria | 2323 |
| 1006 | Ga0495653_0582831 | 3300046463 | Bacteria | 689 |
| 1007 | Ga0495650_0111704 | 3300046471 | Bacteria | 1014 |
| 1008 | Ga0495650_0207353 | 3300046471 | Bacteria | 679 |
| 1009 | Ga0495580_0065294 | 3300046472 | Bacteria | 2549 |
| 1010 | Ga0495580_0091517 | 3300046472 | Bacteria | 2117 |
| 1011 | Ga0495582_0010656 | 3300046473 | Bacteria | 5056 |
| 1012 | Ga0495582_0078349 | 3300046473 | Bacteria | 1833 |
| 1013 | Ga0495639_0024969 | 3300046475 | Bacteria | 2633 |
| 1014 | Ga0495639_0040768 | 3300046475 | Bacteria | 2090 |
| 1015 | Ga0495639_0094463 | 3300046475 | Bacteria | 1406 |
| 1016 | Ga0495639_0182369 | 3300046475 | Bacteria | 1022 |
| 1017 | Ga0495662_0001819 | 3300046476 | Bacteria | 10679 |
| 1018 | Ga0495662_0021962 | 3300046476 | Bacteria | 3084 |
| 1019 | Ga0495662_0042013 | 3300046476 | Bacteria | 2207 |
| 1020 | Ga0495664_0000017 | 3300046477 | Bacteria | 172210 |
| 1021 | Ga0495664_0027575 | 3300046477 | Bacteria | 3312 |
| 1022 | Ga0495664_0048743 | 3300046477 | Bacteria | 2515 |
| 1023 | Ga0495664_0051674 | 3300046477 | Bacteria | 2440 |
| 1024 | Ga0495664_0053309 | 3300046477 | Bacteria | 2405 |
| 1025 | Ga0495664_0066113 | 3300046477 | Bacteria | 2156 |
| 1026 | Ga0495664_0111519 | 3300046477 | Bacteria | 1651 |
| 1027 | Ga0495584_0311571 | 3300046491 | Bacteria | 799 |
| 1028 | Ga0495585_0020146 | 3300046492 | Bacteria | 3838 |
| 1029 | Ga0495585_0093551 | 3300046492 | Bacteria | 1616 |
| 1030 | Ga0495585_0138320 | 3300046492 | Bacteria | 1277 |
| 1031 | Ga0495594_0011382 | 3300046499 | Bacteria | 4622 |
| 1032 | Ga0495594_0374557 | 3300046499 | Bacteria | 810 |
| 1033 | Ga0495594_0450238 | 3300046499 | Bacteria | 732 |
| 1034 | Ga0495596_0144108 | 3300046500 | Bacteria | 925 |
| 1035 | Ga0495607_0018891 | 3300046501 | Bacteria | 4384 |
| 1036 | Ga0495607_0130560 | 3300046501 | Bacteria | 1308 |
| 1037 | Ga0495606_0003775 | 3300046507 | Bacteria | 15742 |
| 1038 | Ga0495606_0026394 | 3300046507 | Bacteria | 4141 |
| 1039 | Ga0495606_0191390 | 3300046507 | Bacteria | 1172 |
| 1040 | Ga0495606_0242694 | 3300046507 | Bacteria | 1004 |
| 1041 | Ga0495608_0002207 | 3300046511 | Bacteria | 14057 |
| 1042 | Ga0495608_0014874 | 3300046511 | Bacteria | 5399 |
| 1043 | Ga0495610_0016452 | 3300046512 | Bacteria | 4255 |
| 1044 | Ga0495610_0070452 | 3300046512 | Bacteria | 1633 |
| 1045 | Ga0495616_0070961 | 3300046513 | Bacteria | 1685 |
| 1046 | Ga0495618_0000059 | 3300046514 | Bacteria | 79623 |
| 1047 | Ga0495618_0028761 | 3300046514 | Bacteria | 3465 |
| 1048 | Ga0495618_0350422 | 3300046514 | Bacteria | 910 |
| 1049 | Ga0495620_0011016 | 3300046515 | Bacteria | 4738 |
| 1050 | Ga0495620_0063470 | 3300046515 | Bacteria | 1531 |
| 1051 | Ga0495620_0096599 | 3300046515 | Bacteria | 1181 |
| 1052 | Ga0495628_0000022 | 3300046516 | Bacteria | 140362 |
| 1053 | Ga0495628_0070806 | 3300046516 | Bacteria | 2718 |
| 1054 | Ga0495628_0110148 | 3300046516 | Bacteria | 2118 |
| 1055 | Ga0495628_0189583 | 3300046516 | Bacteria | 1553 |
| 1056 | Ga0495628_0358651 | 3300046516 | Bacteria | 1071 |
| 1057 | Ga0495628_0365884 | 3300046516 | Bacteria | 1058 |
| 1058 | Ga0495628_0386795 | 3300046516 | Bacteria | 1024 |
| 1059 | Ga0495630_0002896 | 3300046517 | Bacteria | 11914 |
| 1060 | Ga0495630_0056494 | 3300046517 | Bacteria | 2941 |
| 1061 | Ga0495630_0081683 | 3300046517 | Bacteria | 2439 |
| 1062 | Ga0495630_0165031 | 3300046517 | Bacteria | 1686 |
| 1063 | Ga0495630_0270129 | 3300046517 | Bacteria | 1299 |
| 1064 | Ga0495631_0036248 | 3300046518 | Bacteria | 2203 |
| 1065 | Ga0495643_0023470 | 3300046522 | Bacteria | 3507 |
| 1066 | Ga0495643_0096830 | 3300046522 | Bacteria | 1517 |
| 1067 | Ga0495648_0000854 | 3300046524 | Bacteria | 32146 |
| 1068 | Ga0495648_0001062 | 3300046524 | Bacteria | 27872 |
| 1069 | Ga0495648_0033553 | 3300046524 | Bacteria | 3350 |
| 1070 | Ga0495648_0213417 | 3300046524 | Bacteria | 957 |
| 1071 | Ga0495663_0021054 | 3300046525 | Bacteria | 1876 |
| 1072 | Ga0495666_0136235 | 3300046526 | Bacteria | 1146 |
| 1073 | Ga0495652_0000008 | 3300046529 | Bacteria | 343637 |
| 1074 | Ga0495652_0017865 | 3300046529 | Bacteria | 6331 |
| 1075 | Ga0495652_0022191 | 3300046529 | Bacteria | 5636 |
| 1076 | Ga0495652_0274636 | 3300046529 | Bacteria | 1237 |
| 1077 | Ga0495652_0740415 | 3300046529 | Bacteria | 658 |
| 1078 | Ga0495654_0075621 | 3300046530 | Bacteria | 1588 |
| 1079 | Ga0495665_0015520 | 3300046531 | Bacteria | 4102 |
| 1080 | Ga0495640_0000029 | 3300046533 | Bacteria | 79567 |
| 1081 | Ga0495640_0020310 | 3300046533 | Bacteria | 4892 |
| 1082 | Ga0495640_0029043 | 3300046533 | Bacteria | 3975 |
| 1083 | Ga0495640_0114615 | 3300046533 | Bacteria | 1757 |
| 1084 | Ga0495640_0188721 | 3300046533 | Bacteria | 1311 |
| 1085 | Ga0495640_0221887 | 3300046533 | Bacteria | 1192 |
| 1086 | Ga0495640_0282907 | 3300046533 | Bacteria | 1033 |
| 1087 | Ga0495586_0134308 | 3300046535 | Bacteria | 1386 |
| 1088 | Ga0495587_0000019 | 3300046536 | Bacteria | 161972 |
| 1089 | Ga0495587_0268669 | 3300046536 | Bacteria | 957 |
| 1090 | Ga0495598_0024224 | 3300046537 | Bacteria | 1643 |
| 1091 | Ga0495609_0194490 | 3300046538 | Bacteria | 850 |
| 1092 | Ga0495597_0030937 | 3300046542 | Bacteria | 2437 |
| 1093 | Ga0495645_0000006 | 3300046543 | Bacteria | 382503 |
| 1094 | Ga0495645_0011285 | 3300046543 | Bacteria | 6282 |
| 1095 | Ga0495645_0041158 | 3300046543 | Bacteria | 3369 |
| 1096 | Ga0495645_0131216 | 3300046543 | Bacteria | 1755 |
| 1097 | Ga0495645_0289645 | 3300046543 | Bacteria | 1074 |
| 1098 | Ga0495622_0029445 | 3300046557 | Bacteria | 2565 |
| 1099 | Ga0495622_0033750 | 3300046557 | Bacteria | 2388 |
| 1100 | Ga0495622_0034495 | 3300046557 | Bacteria | 2360 |
| 1101 | Ga0495622_0043851 | 3300046557 | Bacteria | 2079 |
| 1102 | Ga0495622_0134116 | 3300046557 | Bacteria | 1126 |
| 1103 | Ga0495633_0202327 | 3300046558 | Bacteria | 911 |
| 1104 | Ga0495667_0000061 | 3300046559 | Bacteria | 94650 |
| 1105 | Ga0495667_0016424 | 3300046559 | Bacteria | 5002 |
| 1106 | Ga0495667_0074103 | 3300046559 | Bacteria | 2216 |
| 1107 | Ga0495667_0384648 | 3300046559 | Bacteria | 885 |
| 1108 | Ga0495667_0392604 | 3300046559 | Bacteria | 874 |
| 1109 | Ga0495656_0048562 | 3300046615 | Bacteria | 1804 |
| 1110 | Ga0495656_0098817 | 3300046615 | Bacteria | 1346 |
| 1111 | Ga0495656_0314871 | 3300046615 | Bacteria | 805 |
| 1112 | Ga0495668_0035821 | 3300046616 | Bacteria | 2781 |
| 1113 | Ga0495668_0072754 | 3300046616 | Bacteria | 1888 |
| 1114 | Ga0495668_0093756 | 3300046616 | Bacteria | 1644 |
| 1115 | Ga0495668_0147430 | 3300046616 | Bacteria | 1288 |
| 1116 | Ga0495634_0000345 | 3300046642 | Bacteria | 44890 |
| 1117 | Ga0495634_0017567 | 3300046642 | Bacteria | 5102 |
| 1118 | Ga0495634_0019118 | 3300046642 | Bacteria | 4869 |
| 1119 | Ga0495634_0021915 | 3300046642 | Bacteria | 4507 |
| 1120 | Ga0495634_0051006 | 3300046642 | Bacteria | 2777 |
| 1121 | Ga0495634_0080705 | 3300046642 | Bacteria | 2128 |
| 1122 | Ga0495634_0088338 | 3300046642 | Bacteria | 2016 |
| 1123 | Ga0495611_0061096 | 3300046648 | Bacteria | 1712 |
| 1124 | Ga0495611_0078436 | 3300046648 | Bacteria | 1516 |
| 1125 | Ga0495625_0176666 | 3300046660 | Bacteria | 1423 |
| 1126 | Ga0495625_0282554 | 3300046660 | Bacteria | 1067 |
| 1127 | Ga0495635_0000023 | 3300046663 | Bacteria | 153429 |
| 1128 | Ga0495635_0005975 | 3300046663 | Bacteria | 8494 |
| 1129 | Ga0495635_0306443 | 3300046663 | Bacteria | 1064 |
| 1130 | Ga0495659_0007775 | 3300046664 | Bacteria | 3401 |
| 1131 | Ga0495659_0028267 | 3300046664 | Bacteria | 1940 |
| 1132 | Ga0495661_0003460 | 3300046665 | Bacteria | 11655 |
| 1133 | Ga0495588_0006542 | 3300046674 | Bacteria | 5255 |
| 1134 | Ga0495588_0010675 | 3300046674 | Bacteria | 4282 |
| 1135 | Ga0495588_0085088 | 3300046674 | Bacteria | 1653 |
| 1136 | Ga0495657_0000430 | 3300046675 | Bacteria | 39131 |
| 1137 | Ga0495657_0006657 | 3300046675 | Bacteria | 9023 |
| 1138 | Ga0495657_0036209 | 3300046675 | Bacteria | 3412 |
| 1139 | Ga0495599_0000066 | 3300046678 | Bacteria | 72412 |
| 1140 | Ga0495599_0012081 | 3300046678 | Bacteria | 5314 |
| 1141 | Ga0495599_0016718 | 3300046678 | Bacteria | 4556 |
| 1142 | Ga0495599_0305847 | 3300046678 | Bacteria | 959 |
| 1143 | Ga0495623_0000217 | 3300046679 | Bacteria | 36823 |
| 1144 | Ga0495623_0012982 | 3300046679 | Bacteria | 5393 |
| 1145 | Ga0495623_0063150 | 3300046679 | Bacteria | 2319 |
| 1146 | Ga0495623_0085513 | 3300046679 | Bacteria | 1945 |
| 1147 | Ga0495623_0121122 | 3300046679 | Bacteria | 1575 |
| 1148 | Ga0495623_0221644 | 3300046679 | Bacteria | 1077 |
| 1149 | Ga0495623_0229697 | 3300046679 | Bacteria | 1053 |
| 1150 | Ga0495646_0000108 | 3300046680 | Bacteria | 40754 |
| 1151 | Ga0495646_0008835 | 3300046680 | Bacteria | 6398 |
| 1152 | Ga0495646_0036150 | 3300046680 | Bacteria | 3061 |
| 1153 | Ga0495646_0038075 | 3300046680 | Bacteria | 2971 |
| 1154 | Ga0495646_0130856 | 3300046680 | Bacteria | 1413 |
| 1155 | Ga0495646_0335635 | 3300046680 | Bacteria | 794 |
| 1156 | Ga0495647_0147221 | 3300046681 | Bacteria | 1008 |
| 1157 | Ga0495647_0194140 | 3300046681 | Bacteria | 888 |
| 1158 | Ga0495658_0063348 | 3300046683 | Bacteria | 2127 |
| 1159 | Ga0495669_0047043 | 3300046684 | Bacteria | 1926 |
| 1160 | Ga0495669_0163732 | 3300046684 | Bacteria | 1056 |
| 1161 | Ga0495613_0023752 | 3300046689 | Bacteria | 4569 |
| 1162 | Ga0495613_0033461 | 3300046689 | Bacteria | 3820 |
| 1163 | Ga0495613_0051442 | 3300046689 | Bacteria | 3035 |
| 1164 | Ga0495613_0059873 | 3300046689 | Bacteria | 2790 |
| 1165 | Ga0495613_0084241 | 3300046689 | Bacteria | 2308 |
| 1166 | Ga0495624_0045158 | 3300046690 | Bacteria | 2806 |
| 1167 | Ga0495624_0051446 | 3300046690 | Bacteria | 2606 |
| 1168 | Ga0495624_0088134 | 3300046690 | Bacteria | 1916 |
| 1169 | Ga0495624_0184366 | 3300046690 | Bacteria | 1271 |
| 1170 | Ga0495624_0352418 | 3300046690 | Bacteria | 885 |
| 1171 | Ga0495670_0168609 | 3300046691 | Bacteria | 1152 |
| 1172 | Ga0495670_0175094 | 3300046691 | Bacteria | 1131 |
| 1173 | Ga0495671_0044706 | 3300046692 | Bacteria | 2219 |
| 1174 | Ga0495671_0070188 | 3300046692 | Bacteria | 1721 |
| 1175 | Ga0495649_0155308 | 3300046694 | Bacteria | 1201 |
| 1176 | Ga0495649_0207770 | 3300046694 | Bacteria | 1015 |
| 1177 | Ga0495589_0100355 | 3300046794 | Bacteria | 1401 |
| 1178 | Ga0495600_0000030 | 3300046809 | Bacteria | 89424 |
| 1179 | Ga0495600_0027316 | 3300046809 | Bacteria | 3687 |
| 1180 | Ga0495600_0043612 | 3300046809 | Bacteria | 2925 |
| 1181 | Ga0495600_0063327 | 3300046809 | Bacteria | 2416 |
| 1182 | Ga0495600_0294515 | 3300046809 | Bacteria | 1025 |
| 1183 | Ga0495581_0018264 | 3300047315 | Bacteria | 4073 |
| 1184 | Ga0495581_0082761 | 3300047315 | Bacteria | 1859 |
| 1185 | Ga0495581_0083147 | 3300047315 | Bacteria | 1854 |
| 1186 | Ga0495581_0119174 | 3300047315 | Bacteria | 1536 |
| 1187 | Ga0495581_0299774 | 3300047315 | Bacteria | 939 |
| 1188 | Ga0495604_0000030 | 3300047317 | Bacteria | 138597 |
| 1189 | Ga0495604_0005878 | 3300047317 | Bacteria | 9726 |
| 1190 | Ga0495604_0015814 | 3300047317 | Bacteria | 6022 |
| 1191 | Ga0495604_0087552 | 3300047317 | Bacteria | 2319 |
| 1192 | Ga0495604_0576171 | 3300047317 | Bacteria | 724 |
| 1193 | Ga0495636_0024287 | 3300047318 | Bacteria | 2457 |
| 1194 | Ga0495674_0000009 | 3300047319 | Bacteria | 310479 |
| 1195 | Ga0495674_0032023 | 3300047319 | Bacteria | 4772 |
| 1196 | Ga0495674_0043900 | 3300047319 | Bacteria | 3975 |
| 1197 | Ga0495674_0059204 | 3300047319 | Bacteria | 3346 |
| 1198 | Ga0495674_0209717 | 3300047319 | Bacteria | 1614 |
| 1199 | Ga0495672_0136324 | 3300047320 | Bacteria | 1287 |
| 1200 | Ga0495672_0176554 | 3300047320 | Bacteria | 1085 |
| 1201 | Ga0495676_0044184 | 3300047321 | Bacteria | 3639 |
| 1202 | Ga0495676_0061833 | 3300047321 | Bacteria | 2927 |
| 1203 | Ga0495680_0000359 | 3300047322 | Bacteria | 51000 |
| 1204 | Ga0495680_0014729 | 3300047322 | Bacteria | 6760 |
| 1205 | Ga0495680_0037429 | 3300047322 | Bacteria | 3886 |
| 1206 | Ga0495680_0044412 | 3300047322 | Bacteria | 3514 |
| 1207 | Ga0495680_0124374 | 3300047322 | Bacteria | 1901 |
| 1208 | Ga0495683_0178535 | 3300047323 | Bacteria | 971 |
| 1209 | Ga0495687_046499 | 3300047443 | Bacteria | 1873 |
| 1210 | Ga0495675_0000056 | 3300047444 | Bacteria | 77625 |
| 1211 | Ga0495675_0014001 | 3300047444 | Bacteria | 5070 |
| 1212 | Ga0495675_0066287 | 3300047444 | Bacteria | 2282 |
| 1213 | Ga0495675_0428481 | 3300047444 | Bacteria | 768 |
| 1214 | Ga0495685_058770 | 3300047447 | Bacteria | 1298 |
| 1215 | Ga0495673_0049200 | 3300047469 | Bacteria | 1856 |
| 1216 | Ga0495673_0103431 | 3300047469 | Bacteria | 1148 |
| 1217 | Ga0495681_0075503 | 3300047470 | Bacteria | 1517 |
| 1218 | Ga0495681_0161066 | 3300047470 | Bacteria | 934 |
| 1219 | Ga0495684_0000056 | 3300047471 | Bacteria | 79718 |
| 1220 | Ga0495684_0004111 | 3300047471 | Bacteria | 11365 |
| 1221 | Ga0495684_0005946 | 3300047471 | Bacteria | 9478 |
| 1222 | Ga0495684_0069462 | 3300047471 | Bacteria | 2678 |
| 1223 | Ga0495684_0076499 | 3300047471 | Bacteria | 2542 |
| 1224 | Ga0495684_0228743 | 3300047471 | Bacteria | 1361 |
| 1225 | Ga0495684_0265057 | 3300047471 | Bacteria | 1245 |
| 1226 | Ga0495686_0015219 | 3300047472 | Bacteria | 5263 |
| 1227 | Ga0495686_0030862 | 3300047472 | Bacteria | 3479 |
| 1228 | Ga0495686_0210289 | 3300047472 | Bacteria | 1112 |
| 1229 | Ga0495593_0004286 | 3300047673 | Bacteria | 8480 |
| 1230 | Ga0495593_0021861 | 3300047673 | Bacteria | 3569 |
| 1231 | Ga0495593_0031956 | 3300047673 | Bacteria | 2872 |
| 1232 | Ga0495593_0112508 | 3300047673 | Bacteria | 1389 |
| 1233 | Ga0495602_0000006 | 3300048088 | Bacteria | 322593 |
| 1234 | Ga0495602_0035000 | 3300048088 | Bacteria | 4688 |
| 1235 | Ga0495602_0037935 | 3300048088 | Bacteria | 4462 |
| 1236 | Ga0495602_0058573 | 3300048088 | Bacteria | 3370 |
| 1237 | Ga0495614_0074550 | 3300048089 | Bacteria | 1466 |
| 1238 | Ga0495614_0099727 | 3300048089 | Bacteria | 1268 |
| 1239 | Ga0495626_0021749 | 3300048091 | Bacteria | 3177 |
| 1240 | Ga0495626_0120419 | 3300048091 | Bacteria | 1129 |
| 1241 | Ga0496100_0010673 | 3300048903 | Bacteria | 5207 |
| 1242 | Ga0496100_0014447 | 3300048903 | Bacteria | 4583 |
| 1243 | Ga0496100_0052642 | 3300048903 | Bacteria | 2647 |
| 1244 | Ga0496100_0126790 | 3300048903 | Bacteria | 1792 |
| 1245 | Ga0496100_0134023 | 3300048903 | Bacteria | 1748 |
| 1246 | Ga0496100_0247364 | 3300048903 | Bacteria | 1318 |
| 1247 | Ga0496100_0735700 | 3300048903 | Unclassified | 771 |
| 1248 | Ga0496101_0014420 | 3300048904 | Bacteria | 5311 |
| 1249 | Ga0496101_0020710 | 3300048904 | Bacteria | 4510 |
| 1250 | Ga0496101_0030998 | 3300048904 | Bacteria | 3755 |
| 1251 | Ga0496101_0067588 | 3300048904 | Bacteria | 2610 |
| 1252 | Ga0496101_0115000 | 3300048904 | Bacteria | 2029 |
| 1253 | Ga0496101_0159905 | 3300048904 | Bacteria | 1727 |
| 1254 | Ga0496101_0192160 | 3300048904 | Bacteria | 1576 |
| 1255 | Ga0496101_0540765 | 3300048904 | Bacteria | 921 |
| 1256 | Ga0496102_0033287 | 3300048905 | Bacteria | 4630 |
| 1257 | Ga0496102_0035443 | 3300048905 | Bacteria | 4491 |
| 1258 | Ga0496102_0072709 | 3300048905 | Bacteria | 3160 |
| 1259 | Ga0496102_0412814 | 3300048905 | Bacteria | 1268 |
| 1260 | Ga0496102_0596085 | 3300048905 | Bacteria | 1028 |
| 1261 | Ga0496103_0018501 | 3300048906 | Bacteria | 4179 |
| 1262 | Ga0496103_0019749 | 3300048906 | Bacteria | 4044 |
| 1263 | Ga0496103_0043577 | 3300048906 | Bacteria | 2763 |
| 1264 | Ga0496103_0489692 | 3300048906 | Bacteria | 787 |
| 1265 | Ga0496104_0004602 | 3300048907 | Bacteria | 12026 |
| 1266 | Ga0496104_0005128 | 3300048907 | Bacteria | 11437 |
| 1267 | Ga0496104_0009959 | 3300048907 | Bacteria | 8483 |
| 1268 | Ga0496104_0013021 | 3300048907 | Bacteria | 7490 |
| 1269 | Ga0496104_0045400 | 3300048907 | Bacteria | 4132 |
| 1270 | Ga0496104_0056950 | 3300048907 | Bacteria | 3698 |
| 1271 | Ga0496104_0132117 | 3300048907 | Bacteria | 2398 |
| 1272 | Ga0496105_0004236 | 3300048908 | Bacteria | 10783 |
| 1273 | Ga0496105_0004815 | 3300048908 | Bacteria | 10196 |
| 1274 | Ga0496105_0008227 | 3300048908 | Bacteria | 8109 |
| 1275 | Ga0496105_0079072 | 3300048908 | Bacteria | 2715 |
| 1276 | Ga0496105_0264103 | 3300048908 | Bacteria | 1391 |
| 1277 | Ga0496106_0000711 | 3300048909 | Bacteria | 23960 |
| 1278 | Ga0496106_0018106 | 3300048909 | Bacteria | 5208 |
| 1279 | Ga0496106_0020447 | 3300048909 | Bacteria | 4911 |
| 1280 | Ga0496106_0043979 | 3300048909 | Bacteria | 3353 |
| 1281 | Ga0496106_0046610 | 3300048909 | Bacteria | 3259 |
| 1282 | Ga0496106_0154309 | 3300048909 | Bacteria | 1812 |
| 1283 | Ga0496106_0227939 | 3300048909 | Bacteria | 1487 |
| 1284 | Ga0496106_0247834 | 3300048909 | Bacteria | 1424 |
| 1285 | Ga0496107_0001289 | 3300048910 | Bacteria | 15330 |
| 1286 | Ga0496107_0016804 | 3300048910 | Bacteria | 5144 |
| 1287 | Ga0496107_0024770 | 3300048910 | Bacteria | 4246 |
| 1288 | Ga0496107_0105838 | 3300048910 | Bacteria | 2065 |
| 1289 | Ga0496107_0200620 | 3300048910 | Bacteria | 1483 |
| 1290 | Ga0496107_0203947 | 3300048910 | Bacteria | 1470 |
| 1291 | Ga0496107_0343138 | 3300048910 | Bacteria | 1111 |
| 1292 | Ga0496107_0727303 | 3300048910 | Bacteria | 729 |
| 1293 | Ga0496107_0819780 | 3300048910 | Bacteria | 681 |
| 1294 | Ga0496108_0002311 | 3300048911 | Bacteria | 15264 |
| 1295 | Ga0496108_0002638 | 3300048911 | Bacteria | 14372 |
| 1296 | Ga0496108_0027611 | 3300048911 | Bacteria | 4690 |
| 1297 | Ga0496108_0037748 | 3300048911 | Bacteria | 4025 |
| 1298 | Ga0496108_0249416 | 3300048911 | Bacteria | 1544 |
| 1299 | Ga0496108_0600121 | 3300048911 | Bacteria | 959 |
| 1300 | Ga0496109_0000199 | 3300048912 | Bacteria | 59773 |
| 1301 | Ga0496109_0061716 | 3300048912 | Bacteria | 3427 |
| 1302 | Ga0496109_0175625 | 3300048912 | Bacteria | 2010 |
| 1303 | Ga0496109_0205373 | 3300048912 | Bacteria | 1852 |
| 1304 | Ga0496109_0244081 | 3300048912 | Bacteria | 1691 |
| 1305 | Ga0496109_0407023 | 3300048912 | Bacteria | 1285 |
| 1306 | Ga0496109_0419430 | 3300048912 | Bacteria | 1264 |
| 1307 | Ga0496110_0006468 | 3300048913 | Bacteria | 9285 |
| 1308 | Ga0496110_0012653 | 3300048913 | Bacteria | 6943 |
| 1309 | Ga0496110_0047003 | 3300048913 | Bacteria | 3777 |
| 1310 | Ga0496110_0060991 | 3300048913 | Bacteria | 3327 |
| 1311 | Ga0496110_0118742 | 3300048913 | Bacteria | 2381 |
| 1312 | Ga0496110_0254135 | 3300048913 | Bacteria | 1600 |
| 1313 | Ga0496110_0388018 | 3300048913 | Bacteria | 1273 |
| 1314 | Ga0496110_0405447 | 3300048913 | Bacteria | 1243 |
| 1315 | Ga0496110_0407357 | 3300048913 | Bacteria | 1240 |
| 1316 | Ga0496111_0021807 | 3300048914 | Bacteria | 4475 |
| 1317 | Ga0496111_0064634 | 3300048914 | Bacteria | 2655 |
| 1318 | Ga0496111_0130779 | 3300048914 | Bacteria | 1857 |
| 1319 | Ga0496111_0161642 | 3300048914 | Bacteria | 1663 |
| 1320 | Ga0496112_0000046 | 3300048915 | Bacteria | 85631 |
| 1321 | Ga0496112_0001162 | 3300048915 | Bacteria | 19679 |
| 1322 | Ga0496112_0015605 | 3300048915 | Bacteria | 7095 |
| 1323 | Ga0496112_0069515 | 3300048915 | Bacteria | 3479 |
| 1324 | Ga0496112_0080282 | 3300048915 | Bacteria | 3225 |
| 1325 | Ga0496112_0085914 | 3300048915 | Bacteria | 3112 |
| 1326 | Ga0496112_0095268 | 3300048915 | Bacteria | 2947 |
| 1327 | Ga0496112_0192676 | 3300048915 | Bacteria | 1999 |
| 1328 | Ga0496112_0291754 | 3300048915 | Bacteria | 1577 |
| 1329 | Ga0496112_0387804 | 3300048915 | Bacteria | 1337 |
| 1330 | Ga0496112_0737222 | 3300048915 | Bacteria | 912 |
| 1331 | Ga0496113_0017700 | 3300048916 | Bacteria | 4954 |
| 1332 | Ga0496113_0039786 | 3300048916 | Bacteria | 3462 |
| 1333 | Ga0496113_0064533 | 3300048916 | Bacteria | 2769 |
| 1334 | Ga0496113_0118609 | 3300048916 | Bacteria | 2067 |
| 1335 | Ga0496113_0193821 | 3300048916 | Bacteria | 1613 |
| 1336 | Ga0496113_0223787 | 3300048916 | Bacteria | 1500 |
| 1337 | Ga0496114_0021980 | 3300048917 | Bacteria | 5193 |
| 1338 | Ga0496114_0070947 | 3300048917 | Bacteria | 2927 |
| 1339 | Ga0496114_0116723 | 3300048917 | Bacteria | 2292 |
| 1340 | Ga0496114_0179380 | 3300048917 | Bacteria | 1849 |
| 1341 | Ga0496114_0755522 | 3300048917 | Bacteria | 850 |
| 1342 | Ga0496115_0011470 | 3300048918 | Bacteria | 6645 |
| 1343 | Ga0496115_0036128 | 3300048918 | Bacteria | 3911 |
| 1344 | Ga0496115_0047512 | 3300048918 | Bacteria | 3432 |
| 1345 | Ga0496115_0095360 | 3300048918 | Bacteria | 2435 |
| 1346 | Ga0496115_0135307 | 3300048918 | Bacteria | 2032 |
| 1347 | Ga0496115_0146895 | 3300048918 | Bacteria | 1946 |
| 1348 | Ga0496115_0160111 | 3300048918 | Bacteria | 1860 |
| 1349 | Ga0496115_0246317 | 3300048918 | Bacteria | 1472 |
| 1350 | Ga0496115_0319997 | 3300048918 | Bacteria | 1269 |
| 1351 | Ga0496115_0937550 | 3300048918 | Bacteria | 665 |
| 1352 | Ga0496116_0019766 | 3300048919 | Bacteria | 5146 |
| 1353 | Ga0496116_0045659 | 3300048919 | Bacteria | 2963 |
| 1354 | Ga0496116_0082233 | 3300048919 | Bacteria | 1993 |
| 1355 | Ga0496116_0153831 | 3300048919 | Bacteria | 1273 |
| 1356 | Ga0496117_0016897 | 3300048920 | Bacteria | 6121 |
| 1357 | Ga0496117_0017567 | 3300048920 | Bacteria | 5969 |
| 1358 | Ga0496117_0030590 | 3300048920 | Bacteria | 4128 |
| 1359 | Ga0496117_0159904 | 3300048920 | Bacteria | 1321 |
| 1360 | Ga0496118_0003787 | 3300048921 | Bacteria | 18652 |
| 1361 | Ga0496118_0007612 | 3300048921 | Bacteria | 11410 |
| 1362 | Ga0496118_0020426 | 3300048921 | Bacteria | 5873 |
| 1363 | Ga0496118_0037280 | 3300048921 | Bacteria | 3916 |
| 1364 | Ga0496118_0088852 | 3300048921 | Bacteria | 2136 |
| 1365 | Ga0496118_0095855 | 3300048921 | Bacteria | 2024 |
| 1366 | Ga0496118_0111372 | 3300048921 | Bacteria | 1815 |
| 1367 | Ga0496118_0142967 | 3300048921 | Bacteria | 1512 |
| 1368 | Ga0496119_0035894 | 3300048922 | Bacteria | 3241 |
| 1369 | Ga0496119_0039376 | 3300048922 | Bacteria | 3039 |
| 1370 | Ga0496119_0045713 | 3300048922 | Bacteria | 2742 |
| 1371 | Ga0496119_0083319 | 3300048922 | Bacteria | 1837 |
| 1372 | Ga0496119_0084105 | 3300048922 | Bacteria | 1825 |
| 1373 | Ga0496119_0235643 | 3300048922 | Bacteria | 929 |
| 1374 | Ga0496120_0010175 | 3300048923 | Bacteria | 6586 |
| 1375 | Ga0496120_0030166 | 3300048923 | Bacteria | 3301 |
| 1376 | Ga0496120_0052545 | 3300048923 | Bacteria | 2320 |
| 1377 | Ga0496120_0073318 | 3300048923 | Bacteria | 1874 |
| 1378 | Ga0496120_0167655 | 3300048923 | Bacteria | 1089 |
| 1379 | Ga0496121_0000287 | 3300048924 | Bacteria | 104774 |
| 1380 | Ga0496121_0001942 | 3300048924 | Bacteria | 32958 |
| 1381 | Ga0496121_0009401 | 3300048924 | Bacteria | 11243 |
| 1382 | Ga0496121_0014663 | 3300048924 | Bacteria | 8287 |
| 1383 | Ga0496121_0015686 | 3300048924 | Bacteria | 7904 |
| 1384 | Ga0496121_0023934 | 3300048924 | Bacteria | 5856 |
| 1385 | Ga0496121_0032181 | 3300048924 | Bacteria | 4773 |
| 1386 | Ga0496121_0046396 | 3300048924 | Bacteria | 3720 |
| 1387 | Ga0496121_0080419 | 3300048924 | Bacteria | 2583 |
| 1388 | Ga0496121_0092574 | 3300048924 | Bacteria | 2356 |
| 1389 | Ga0496121_0128225 | 3300048924 | Bacteria | 1904 |
| 1390 | Ga0496121_0154429 | 3300048924 | Bacteria | 1685 |
| 1391 | Ga0496121_0163259 | 3300048924 | Bacteria | 1626 |
| 1392 | Ga0496121_0166365 | 3300048924 | Bacteria | 1607 |
| 1393 | Ga0496121_0282900 | 3300048924 | Bacteria | 1133 |
| 1394 | Ga0496122_0036761 | 3300048925 | Bacteria | 3953 |
| 1395 | Ga0496122_0042938 | 3300048925 | Bacteria | 3549 |
| 1396 | Ga0496122_0072985 | 3300048925 | Bacteria | 2436 |
| 1397 | Ga0496122_0234012 | 3300048925 | Bacteria | 1042 |
| 1398 | Ga0496123_0005902 | 3300048926 | Bacteria | 12090 |
| 1399 | Ga0496123_0063443 | 3300048926 | Bacteria | 2360 |
| 1400 | Ga0496124_0011609 | 3300048927 | Bacteria | 8791 |
| 1401 | Ga0496124_0031707 | 3300048927 | Bacteria | 4676 |
| 1402 | Ga0496124_0060645 | 3300048927 | Bacteria | 3173 |
| 1403 | Ga0496124_0085575 | 3300048927 | Bacteria | 2583 |
| 1404 | Ga0496124_0166271 | 3300048927 | Bacteria | 1714 |
| 1405 | Ga0496124_0197978 | 3300048927 | Bacteria | 1531 |
| 1406 | Ga0496124_0307426 | 3300048927 | Bacteria | 1142 |
| 1407 | Ga0496124_0336547 | 3300048927 | Bacteria | 1074 |
| 1408 | Ga0496124_0339590 | 3300048927 | Bacteria | 1067 |
| 1409 | Ga0496125_0000202 | 3300048928 | Bacteria | 125963 |
| 1410 | Ga0496125_0003766 | 3300048928 | Bacteria | 18045 |
| 1411 | Ga0496125_0005011 | 3300048928 | Bacteria | 14957 |
| 1412 | Ga0496125_0041192 | 3300048928 | Bacteria | 3952 |
| 1413 | Ga0496125_0056165 | 3300048928 | Bacteria | 3200 |
| 1414 | Ga0496125_0067491 | 3300048928 | Bacteria | 2818 |
| 1415 | Ga0496125_0118463 | 3300048928 | Bacteria | 1896 |
| 1416 | Ga0496125_0158463 | 3300048928 | Bacteria | 1542 |
| 1417 | Ga0496126_0002882 | 3300048929 | Bacteria | 22445 |
| 1418 | Ga0496126_0003892 | 3300048929 | Bacteria | 18355 |
| 1419 | Ga0496126_0008415 | 3300048929 | Bacteria | 11131 |
| 1420 | Ga0496126_0031108 | 3300048929 | Bacteria | 5047 |
| 1421 | Ga0496126_0032010 | 3300048929 | Bacteria | 4960 |
| 1422 | Ga0496126_0033666 | 3300048929 | Bacteria | 4819 |
| 1423 | Ga0496126_0072311 | 3300048929 | Bacteria | 3068 |
| 1424 | Ga0496126_0114370 | 3300048929 | Bacteria | 2348 |
| 1425 | Ga0496126_0122829 | 3300048929 | Bacteria | 2250 |
| 1426 | Ga0496126_0138685 | 3300048929 | Bacteria | 2095 |
| 1427 | Ga0496126_0139996 | 3300048929 | Bacteria | 2084 |
| 1428 | Ga0496126_0142683 | 3300048929 | Bacteria | 2060 |
| 1429 | Ga0496126_0161527 | 3300048929 | Bacteria | 1914 |
| 1430 | Ga0496126_0255259 | 3300048929 | Bacteria | 1460 |
| 1431 | Ga0496126_0261404 | 3300048929 | Bacteria | 1439 |
| 1432 | Ga0496126_0511172 | 3300048929 | Bacteria | 959 |
| 1433 | Ga0495682_0056664 | 3300049460 | Bacteria | 1420 |
| 1434 | Ga0495682_0097827 | 3300049460 | Bacteria | 1053 |
| 1435 | Ga0501031_0074827 | 3300049568 | Bacteria | 2205 |
| 1436 | Ga0501036_0129877 | 3300049572 | Bacteria | 2127 |
| 1437 | Ga0501036_0294811 | 3300049572 | Bacteria | 1357 |
| 1438 | Ga0501036_0583164 | 3300049572 | Bacteria | 928 |
| 1439 | Ga0501039_0021985 | 3300049575 | Bacteria | 4894 |
| 1440 | Ga0501039_0146764 | 3300049575 | Bacteria | 1854 |
| 1441 | Ga0501040_0032762 | 3300049576 | Bacteria | 3517 |
| 1442 | Ga0501041_0056509 | 3300049577 | Bacteria | 2398 |
| 1443 | Ga0501042_0040564 | 3300049578 | Bacteria | 3309 |
| 1444 | Ga0501042_0248420 | 3300049578 | Bacteria | 1284 |
| 1445 | Ga0501042_0394671 | 3300049578 | Bacteria | 1002 |
| 1446 | Ga0501046_0077340 | 3300049580 | Bacteria | 2576 |
| 1447 | Ga0501046_0094632 | 3300049580 | Bacteria | 2296 |
| 1448 | Ga0501048_0028191 | 3300049582 | Bacteria | 4077 |
| 1449 | Ga0501067_0041024 | 3300049583 | Bacteria | 2570 |
| 1450 | Ga0501070_0008301 | 3300049586 | Bacteria | 8777 |
| 1451 | Ga0501070_0515507 | 3300049586 | Bacteria | 960 |
| 1452 | Ga0501071_0003783 | 3300049587 | Bacteria | 9510 |
| 1453 | Ga0501071_0230976 | 3300049587 | Bacteria | 1394 |
| 1454 | Ga0501072_0002876 | 3300049588 | Bacteria | 12945 |
| 1455 | Ga0501072_0403786 | 3300049588 | Bacteria | 1084 |
| 1456 | Ga0501072_0613190 | 3300049588 | Bacteria | 858 |
| 1457 | Ga0501074_0085507 | 3300049590 | Bacteria | 2260 |
| 1458 | Ga0501074_0121706 | 3300049590 | Bacteria | 1866 |
| 1459 | Ga0501075_0006858 | 3300049591 | Bacteria | 7865 |
| 1460 | Ga0501075_0852744 | 3300049591 | Bacteria | 693 |
| 1461 | Ga0501076_0023255 | 3300049592 | Bacteria | 4775 |
| 1462 | Ga0501076_0058516 | 3300049592 | Bacteria | 3064 |
| 1463 | Ga0501076_0303950 | 3300049592 | Bacteria | 1308 |
| 1464 | Ga0501077_0090139 | 3300049593 | Bacteria | 1943 |
| 1465 | Ga0501079_0023093 | 3300049741 | Bacteria | 4775 |
| 1466 | Ga0501080_0270294 | 3300049742 | Bacteria | 1547 |
| 1467 | Ga0501081_0005285 | 3300049743 | Bacteria | 8326 |
| 1468 | Ga0501083_0219049 | 3300049744 | Bacteria | 1240 |
| 1469 | Ga0501035_0212261 | 3300049822 | Bacteria | 1656 |
| 1470 | Ga0501044_0095422 | 3300049823 | Bacteria | 2997 |
| 1471 | Ga0501044_0795634 | 3300049823 | Bacteria | 825 |
| 1472 | Ga0501045_0064327 | 3300049824 | Bacteria | 2692 |
| 1473 | nmdc:mga03n38_2816_c1 | 3300050490 | Bacteria | 5470 |
| 1474 | nmdc:mga00v17_106846_c1 | 3300050491 | Bacteria | 1772 |
| 1475 | nmdc:mga00v17_51710_c1 | 3300050491 | Bacteria | 2498 |
| 1476 | nmdc:mga00v17_87086_c2 | 3300050491 | Bacteria | 1503 |
| 1477 | nmdc:mga0yw44_101029_c1 | 3300050492 | Bacteria | 1837 |
| 1478 | nmdc:mga0yw44_133021_c1 | 3300050492 | Bacteria | 1612 |
| 1479 | nmdc:mga0yw44_140167_c1 | 3300050492 | Bacteria | 1571 |
| 1480 | nmdc:mga0yw44_1557_c2 | 3300050492 | Bacteria | 7183 |
| 1481 | nmdc:mga0yw44_171330_c1 | 3300050492 | Bacteria | 1425 |
| 1482 | nmdc:mga0yw44_18365_c1 | 3300050492 | Bacteria | 3828 |
| 1483 | nmdc:mga0yw44_301532_c1 | 3300050492 | Bacteria | 1074 |
| 1484 | nmdc:mga0yw44_34242_c1 | 3300050492 | Bacteria | 2975 |
| 1485 | nmdc:mga0yw44_46341_c1 | 3300050492 | Bacteria | 2610 |
| 1486 | nmdc:mga06z11_118171_c1 | 3300050494 | Bacteria | 1476 |
| 1487 | nmdc:mga06z11_152987_c1 | 3300050494 | Bacteria | 1313 |
| 1488 | nmdc:mga06z11_222971_c1 | 3300050494 | Bacteria | 1102 |
| 1489 | nmdc:mga06z11_24330_c1 | 3300050494 | Bacteria | 2856 |
| 1490 | nmdc:mga06z11_278326_c1 | 3300050494 | Bacteria | 991 |
| 1491 | nmdc:mga06z11_51828_c1 | 3300050494 | Bacteria | 2103 |
| 1492 | nmdc:mga04h51_86204_c1 | 3300050495 | Bacteria | 1123 |
| 1493 | nmdc:mga07m45_12747_c1 | 3300050496 | Bacteria | 4445 |
| 1494 | nmdc:mga07m45_52719_c1 | 3300050496 | Bacteria | 2297 |
| 1495 | nmdc:mga07m45_58808_c1 | 3300050496 | Bacteria | 2175 |
| 1496 | nmdc:mga07m45_67175_c1 | 3300050496 | Bacteria | 2038 |
| 1497 | nmdc:mga07m45_7177_c1 | 3300050496 | Bacteria | 5677 |
| 1498 | nmdc:mga05p37_14418_c1 | 3300050507 | Bacteria | 9488 |
| 1499 | nmdc:mga05p37_573079_c1 | 3300050507 | Bacteria | 1280 |
| 1500 | nmdc:mga05p37_60006_c1 | 3300050507 | Bacteria | 4684 |
| 1501 | nmdc:mga09592_231191_c1 | 3300050508 | Bacteria | 1602 |
| 1502 | nmdc:mga09592_307163_c1 | 3300050508 | Bacteria | 1375 |
| 1503 | nmdc:mga06r32_222121_c1 | 3300050510 | Bacteria | 1877 |
| 1504 | nmdc:mga06r32_82065_c1 | 3300050510 | Bacteria | 3140 |
| 1505 | nmdc:mga08y16_62194_c1 | 3300050511 | Bacteria | 3898 |
| 1506 | nmdc:mga0n895_107881_c1 | 3300050512 | Bacteria | 2798 |
| 1507 | nmdc:mga0n895_131212_c1 | 3300050512 | Bacteria | 2531 |
| 1508 | nmdc:mga0n895_3128_c1 | 3300050512 | Bacteria | 13195 |
| 1509 | nmdc:mga0n895_336291_c1 | 3300050512 | Bacteria | 1530 |
| 1510 | nmdc:mga0rr50_111459_c1 | 3300050513 | Bacteria | 2166 |
| 1511 | nmdc:mga0rr50_158590_c1 | 3300050513 | Bacteria | 1835 |
| 1512 | nmdc:mga0rr50_743732_c1 | 3300050513 | Bacteria | 837 |
| 1513 | nmdc:mga08x19_40995_c1 | 3300050514 | Bacteria | 2948 |
| 1514 | nmdc:mga08x19_61863_c1 | 3300050514 | Bacteria | 2426 |
| 1515 | nmdc:mga08x19_96101_c1 | 3300050514 | Bacteria | 1961 |
| 1516 | nmdc:mga0a205_105235_c1 | 3300050515 | Bacteria | 2721 |
| 1517 | nmdc:mga0a205_1115_c1 | 3300050515 | Bacteria | 22237 |
| 1518 | nmdc:mga0a205_181206_c1 | 3300050515 | Bacteria | 2001 |
| 1519 | nmdc:mga0a205_210214_c1 | 3300050515 | Bacteria | 1834 |
| 1520 | nmdc:mga0sz30_102011_c1 | 3300050516 | Bacteria | 1254 |
| 1521 | Ga0495601_0000007 | 3300053077 | Bacteria | 365972 |
| 1522 | Ga0495601_0021798 | 3300053077 | Bacteria | 3927 |
| 1523 | Ga0495601_0022270 | 3300053077 | Bacteria | 3888 |
| 1524 | Ga0495601_0103437 | 3300053077 | Bacteria | 1841 |
| 1525 | Ga0495601_0114458 | 3300053077 | Bacteria | 1749 |
| 1526 | Ga0495601_0163873 | 3300053077 | Bacteria | 1453 |
| 1527 | Ga0495601_0250686 | 3300053077 | Bacteria | 1156 |
| 1528 | Ga0495601_0326564 | 3300053077 | Bacteria | 999 |
| 1529 | Ga0495612_0000053 | 3300053078 | Bacteria | 52880 |
| 1530 | Ga0495612_0008986 | 3300053078 | Bacteria | 4050 |
| 1531 | Ga0495612_0038913 | 3300053078 | Bacteria | 1933 |
| 1532 | Ga0495612_0088189 | 3300053078 | Bacteria | 1310 |
| 1533 | Ga0500610_0190806 | 3300053079 | Bacteria | 995 |
| 1534 | Ga0500635_0024476 | 3300053080 | Bacteria | 1894 |
| 1535 | Ga0500635_0035831 | 3300053080 | Bacteria | 1632 |
| 1536 | Ga0495595_0000031 | 3300053084 | Bacteria | 89199 |
| 1537 | Ga0495595_0013466 | 3300053084 | Bacteria | 3455 |
| 1538 | Ga0495595_0017842 | 3300053084 | Bacteria | 3057 |
| 1539 | Ga0495595_0149988 | 3300053084 | Bacteria | 1147 |
| 1540 | Ga0495619_0000023 | 3300053085 | Bacteria | 182266 |
| 1541 | Ga0495619_0000883 | 3300053085 | Bacteria | 19721 |
| 1542 | Ga0495619_0016768 | 3300053085 | Bacteria | 4638 |
| 1543 | Ga0495619_0018161 | 3300053085 | Bacteria | 4460 |
| 1544 | Ga0495619_0020815 | 3300053085 | Bacteria | 4184 |
| 1545 | Ga0495619_0031212 | 3300053085 | Bacteria | 3451 |
| 1546 | Ga0495619_0043382 | 3300053085 | Bacteria | 2948 |
| 1547 | Ga0495619_0083414 | 3300053085 | Bacteria | 2155 |
| 1548 | Ga0500578_0065518 | 3300053086 | Bacteria | 2317 |
| 1549 | Ga0500643_000185 | 3300053087 | Bacteria | 60228 |
| 1550 | Ga0500643_090767 | 3300053087 | Bacteria | 833 |
| 1551 | Ga0500581_043520 | 3300053089 | Bacteria | 2296 |
| 1552 | Ga0500646_0031502 | 3300053090 | Bacteria | 1460 |
| 1553 | Ga0500647_0023235 | 3300053091 | Bacteria | 2907 |
| 1554 | Ga0500583_0002146 | 3300053092 | Bacteria | 5854 |
| 1555 | Ga0500583_0066074 | 3300053092 | Bacteria | 1720 |
| 1556 | Ga0500651_0013269 | 3300053093 | Bacteria | 5015 |
| 1557 | Ga0500651_0050912 | 3300053093 | Bacteria | 2597 |
| 1558 | Ga0500651_0177567 | 3300053093 | Bacteria | 1266 |
| 1559 | Ga0500651_0268026 | 3300053093 | Bacteria | 988 |
| 1560 | Ga0500566_0004635 | 3300053094 | Bacteria | 8176 |
| 1561 | Ga0500566_0006566 | 3300053094 | Bacteria | 6894 |
| 1562 | Ga0500566_0035073 | 3300053094 | Bacteria | 2916 |
| 1563 | Ga0500566_0117850 | 3300053094 | Bacteria | 1435 |
| 1564 | Ga0500566_0310327 | 3300053094 | Bacteria | 738 |
| 1565 | Ga0500640_010052 | 3300053095 | Bacteria | 3808 |
| 1566 | Ga0500641_0010909 | 3300053096 | Bacteria | 3294 |
| 1567 | Ga0500641_0034912 | 3300053096 | Bacteria | 2004 |
| 1568 | Ga0500648_117921 | 3300053097 | Bacteria | 1457 |
| 1569 | Ga0500650_0005311 | 3300053098 | Bacteria | 4785 |
| 1570 | Ga0500554_000916 | 3300053102 | Bacteria | 5756 |
| 1571 | Ga0500555_002692 | 3300053103 | Bacteria | 5120 |
| 1572 | Ga0500555_061599 | 3300053103 | Bacteria | 1008 |
| 1573 | Ga0500556_0000006 | 3300053104 | Bacteria | 453982 |
| 1574 | Ga0500557_000140 | 3300053105 | Bacteria | 17559 |
| 1575 | Ga0500562_002807 | 3300053108 | Bacteria | 4338 |
| 1576 | Ga0500562_011103 | 3300053108 | Bacteria | 2285 |
| 1577 | Ga0500569_000419 | 3300053109 | Bacteria | 6914 |
| 1578 | Ga0500569_117682 | 3300053109 | Bacteria | 882 |
| 1579 | Ga0500572_000429 | 3300053111 | Bacteria | 14783 |
| 1580 | Ga0500572_110995 | 3300053111 | Bacteria | 882 |
| 1581 | Ga0500592_000673 | 3300053116 | Bacteria | 5635 |
| 1582 | Ga0500592_013972 | 3300053116 | Bacteria | 1287 |
| 1583 | Ga0500593_085684 | 3300053117 | Bacteria | 1342 |
| 1584 | Ga0500594_0004791 | 3300053118 | Bacteria | 2990 |
| 1585 | Ga0500594_0061613 | 3300053118 | Bacteria | 1083 |
| 1586 | Ga0500595_001099 | 3300053119 | Bacteria | 15016 |
| 1587 | Ga0500595_001384 | 3300053119 | Bacteria | 12994 |
| 1588 | Ga0500595_003393 | 3300053119 | Bacteria | 7456 |
| 1589 | Ga0500595_007758 | 3300053119 | Bacteria | 4432 |
| 1590 | Ga0500595_017224 | 3300053119 | Bacteria | 2672 |
| 1591 | Ga0500595_037859 | 3300053119 | Bacteria | 1571 |
| 1592 | Ga0500595_058819 | 3300053119 | Bacteria | 1167 |
| 1593 | Ga0500597_143176 | 3300053120 | Bacteria | 1029 |
| 1594 | Ga0500608_002124 | 3300053122 | Bacteria | 7119 |
| 1595 | Ga0500608_010156 | 3300053122 | Bacteria | 4031 |
| 1596 | Ga0500614_002969 | 3300053123 | Bacteria | 3702 |
| 1597 | Ga0500614_034512 | 3300053123 | Bacteria | 1255 |
| 1598 | Ga0500642_0000004 | 3300053130 | Bacteria | 433122 |
| 1599 | Ga0500642_0000236 | 3300053130 | Bacteria | 21367 |
| 1600 | Ga0500642_0001875 | 3300053130 | Bacteria | 6074 |
| 1601 | Ga0500642_0071251 | 3300053130 | Bacteria | 1582 |
| 1602 | Ga0500642_0089543 | 3300053130 | Bacteria | 1421 |
| 1603 | Ga0500652_002175 | 3300053131 | Bacteria | 5891 |
| 1604 | Ga0500658_0054462 | 3300053134 | Bacteria | 1644 |
| 1605 | Ga0500658_0119218 | 3300053134 | Bacteria | 1168 |
| 1606 | Ga0500559_0000276 | 3300053136 | Bacteria | 39738 |
| 1607 | Ga0500559_0009412 | 3300053136 | Bacteria | 4229 |
| 1608 | Ga0500559_0015544 | 3300053136 | Bacteria | 3213 |
| 1609 | Ga0500559_0035409 | 3300053136 | Bacteria | 2156 |
| 1610 | Ga0500564_145540 | 3300053138 | Bacteria | 1014 |
| 1611 | Ga0500568_0006697 | 3300053139 | Bacteria | 5758 |
| 1612 | Ga0500568_0152491 | 3300053139 | Bacteria | 855 |
| 1613 | Ga0500573_0080148 | 3300053140 | Bacteria | 1855 |
| 1614 | Ga0500577_0000077 | 3300053142 | Bacteria | 22872 |
| 1615 | Ga0500588_0014950 | 3300053146 | Bacteria | 1978 |
| 1616 | Ga0500589_148714 | 3300053147 | Bacteria | 956 |
| 1617 | Ga0500590_014962 | 3300053148 | Bacteria | 4003 |
| 1618 | Ga0500590_076420 | 3300053148 | Bacteria | 1654 |
| 1619 | Ga0500603_000241 | 3300053150 | Bacteria | 14295 |
| 1620 | Ga0500603_000290 | 3300053150 | Bacteria | 13270 |
| 1621 | Ga0500603_048464 | 3300053150 | Bacteria | 1156 |
| 1622 | Ga0500603_168895 | 3300053150 | Bacteria | 685 |
| 1623 | Ga0500604_0024730 | 3300053151 | Bacteria | 1721 |
| 1624 | Ga0500616_0000022 | 3300053153 | Bacteria | 460463 |
| 1625 | Ga0500616_0011206 | 3300053153 | Bacteria | 5317 |
| 1626 | Ga0500620_012565 | 3300053155 | Bacteria | 2310 |
| 1627 | Ga0500622_0005645 | 3300053156 | Bacteria | 7454 |
| 1628 | Ga0500622_0006743 | 3300053156 | Bacteria | 6613 |
| 1629 | Ga0500627_0003500 | 3300053158 | Bacteria | 4866 |
| 1630 | Ga0500627_0130354 | 3300053158 | Bacteria | 1136 |
| 1631 | Ga0500630_003701 | 3300053159 | Bacteria | 7421 |
| 1632 | Ga0500633_0021542 | 3300053160 | Bacteria | 1961 |
| 1633 | Ga0500634_0210818 | 3300053161 | Bacteria | 843 |
| 1634 | Ga0500638_002209 | 3300053162 | Bacteria | 6649 |
| 1635 | Ga0500638_044389 | 3300053162 | Bacteria | 2157 |
| 1636 | Ga0500638_097803 | 3300053162 | Bacteria | 1373 |
| 1637 | Ga0500639_000076 | 3300053163 | Bacteria | 45936 |
| 1638 | Ga0500639_192688 | 3300053163 | Bacteria | 886 |
| 1639 | Ga0500636_0014113 | 3300053177 | Bacteria | 4694 |
| 1640 | Ga0500636_0057046 | 3300053177 | Bacteria | 2286 |
| 1641 | Ga0500636_0076645 | 3300053177 | Bacteria | 1932 |
| 1642 | Ga0500636_0089923 | 3300053177 | Bacteria | 1759 |
| 1643 | Ga0500637_0004134 | 3300053178 | Bacteria | 6835 |
| 1644 | Ga0500637_0006951 | 3300053178 | Bacteria | 5625 |
| 1645 | Ga0500637_0156863 | 3300053178 | Bacteria | 1313 |
| 1646 | Ga0500570_043566 | 3300053724 | Bacteria | 2322 |
| 1647 | Ga0500625_016040 | 3300053729 | Bacteria | 3484 |
| 1648 | Ga0500645_029606 | 3300053730 | Bacteria | 1651 |
| 1649 | Ga0500645_033089 | 3300053730 | Bacteria | 1548 |
| 1650 | Ga0500645_059528 | 3300053730 | Bacteria | 1106 |
| 1651 | Ga0500645_091294 | 3300053730 | Bacteria | 863 |
| 1652 | Ga0500609_011444 | 3300053731 | Bacteria | 1198 |
| 1653 | Ga0500596_000689 | 3300053735 | Bacteria | 6581 |
| 1654 | Ga0500596_006485 | 3300053735 | Bacteria | 1974 |
| 1655 | Ga0500596_016390 | 3300053735 | Bacteria | 1113 |
| 1656 | Ga0500599_002024 | 3300053736 | Bacteria | 2400 |
| 1657 | Ga0500601_000495 | 3300053737 | Bacteria | 6093 |
| 1658 | Ga0500601_006551 | 3300053737 | Bacteria | 1283 |
| 1659 | Ga0501084_0020051 | 3300054114 | Bacteria | 5575 |
| 1660 | Ga0501084_0518444 | 3300054114 | Bacteria | 1008 |
| 1661 | Ga0501084_0972392 | 3300054114 | Bacteria | 714 |
| 1662 | Ga0500661_000404 | 3300055283 | Bacteria | 7983 |
| 1663 | Ga0501082_0017993 | 3300060353 | Bacteria | 6086 |
| 1664 | Ga0530510_0002632 | 3300061734 | Bacteria | 12338 |
| 1665 | Ga0530510_0537565 | 3300061734 | Bacteria | 887 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053078 | Ga0495612_0088189 | Ga0495612_0088189_27_623 | 198 |
| 2 | 3300005937 | Ga0081455_10000306 | Ga0081455_1000030645 | 199 |
| 3 | 3300048903 | Ga0496100_0735700 | Ga0496100_0735700_19_642 | 202 |
| 4 | 3300032002 | Ga0307416_100038819 | Ga0307416_1000388192 | 205 |
| 5 | 3300048922 | Ga0496119_0235643 | Ga0496119_0235643_280_897 | 205 |
| 6 | 3300046463 | Ga0495653_0582831 | Ga0495653_0582831_26_649 | 207 |
| 7 | 3300046471 | Ga0495650_0207353 | Ga0495650_0207353_26_649 | 207 |
| 8 | 3300046491 | Ga0495584_0311571 | Ga0495584_0311571_143_766 | 207 |
| 9 | 3300046492 | Ga0495585_0138320 | Ga0495585_0138320_27_650 | 207 |
| 10 | 3300046499 | Ga0495594_0374557 | Ga0495594_0374557_17_640 | 207 |
| 11 | 3300046529 | Ga0495652_0740415 | Ga0495652_0740415_17_640 | 207 |
| 12 | 3300046663 | Ga0495635_0306443 | Ga0495635_0306443_14_637 | 207 |
| 13 | 3300046681 | Ga0495647_0194140 | Ga0495647_0194140_245_868 | 207 |
| 14 | 3300047322 | Ga0495680_0124374 | Ga0495680_0124374_1249_1872 | 207 |
| 15 | 3300048904 | Ga0496101_0540765 | Ga0496101_0540765_12_635 | 207 |
| 16 | 3300048910 | Ga0496107_0727303 | Ga0496107_0727303_82_705 | 207 |
| 17 | 3300048910 | Ga0496107_0819780 | Ga0496107_0819780_43_666 | 207 |
| 18 | 3300048918 | Ga0496115_0937550 | Ga0496115_0937550_10_633 | 207 |
| 19 | 3300048927 | Ga0496124_0060645 | Ga0496124_0060645_2535_3158 | 207 |
| 20 | 3300049591 | Ga0501075_0852744 | Ga0501075_0852744_52_675 | 207 |
| 21 | 3300053094 | Ga0500566_0310327 | Ga0500566_0310327_17_640 | 207 |
| 22 | 3300053150 | Ga0500603_168895 | Ga0500603_168895_45_668 | 207 |
| 23 | 3300053163 | Ga0500639_192688 | Ga0500639_192688_249_872 | 207 |
| 24 | 3300006058 | Ga0075432_10018636 | Ga0075432_100186362 | 209 |
| 25 | 3300006852 | Ga0075433_10000999 | Ga0075433_1000099912 | 209 |
| 26 | 3300006871 | Ga0075434_100001934 | Ga0075434_10000193416 | 209 |
| 27 | 3300009094 | Ga0111539_10147744 | Ga0111539_101477443 | 209 |
| 28 | 3300034819 | Ga0373958_0026429 | Ga0373958_0026429_181_867 | 209 |
| 29 | 3300034957 | Ga0373938_0042402 | Ga0373938_0042402_251_937 | 209 |
| 30 | 3300035085 | Ga0373929_0068087 | Ga0373929_0068087_136_822 | 209 |
| 31 | 3300035090 | Ga0373949_0005172 | Ga0373949_0005172_1869_2555 | 209 |
| 32 | 3300035121 | Ga0373960_0040855 | Ga0373960_0040855_129_815 | 209 |
| 33 | 3300035242 | Ga0373962_0007446 | Ga0373962_0007446_1239_1925 | 209 |
| 34 | 3300035691 | Ga0373931_0001970 | Ga0373931_0001970_1997_2683 | 209 |
| 35 | 3300050512 | nmdc:mga0n895_3128_c1 | nmdc:mga0n895_3128_c1_10744_11430 | 209 |
| 36 | 3300050513 | nmdc:mga0rr50_743732_c1 | nmdc:mga0rr50_743732_c1_20_706 | 209 |
| 37 | 3300050515 | nmdc:mga0a205_1115_c1 | nmdc:mga0a205_1115_c1_2682_3368 | 209 |
| 38 | iso_pu_bacteria | 8019619141 | 8019624938 | 218 |
| 39 | 3300049580 | Ga0501046_0077340 | Ga0501046_0077340_712_1377 | 221 |
| 40 | 3300053108 | Ga0500562_002807 | Ga0500562_002807_3311_3994 | 222 |
| 41 | 3300053156 | Ga0500622_0005645 | Ga0500622_0005645_1474_2157 | 222 |
| 42 | 3300053730 | Ga0500645_059528 | Ga0500645_059528_29_712 | 222 |
| 43 | 3300005614 | Ga0068856_101136045 | Ga0068856_1011360451 | 224 |
| 44 | 3300025928 | Ga0207700_10872391 | Ga0207700_108723911 | 224 |
| 45 | iso_pu_bacteria | 2507262055 | 2507511196 | 225 |
| 46 | iso_pu_bacteria | 2508501009 | 2508545005 | 225 |
| 47 | iso_pu_bacteria | 2508501042 | 2508693741 | 225 |
| 48 | iso_pu_bacteria | 2508501128 | 2509146841 | 225 |
| 49 | iso_pu_bacteria | 2511231028 | 2511395348 | 225 |
| 50 | iso_pu_bacteria | 2513237094 | 2513637295 | 225 |
| 51 | iso_pu_bacteria | 2513237095 | 2513650855 | 225 |
| 52 | iso_pu_bacteria | 2513237096 | 2513655198 | 225 |
| 53 | iso_pu_bacteria | 2513237098 | 2513676674 | 225 |
| 54 | iso_pu_bacteria | 2513237101 | 2513693408 | 225 |
| 55 | iso_pu_bacteria | 2513237102 | 2513705099 | 225 |
| 56 | iso_pu_bacteria | 2513237104 | 2513719658 | 225 |
| 57 | iso_pu_bacteria | 2513237137 | 2513861450 | 225 |
| 58 | iso_pu_bacteria | 2513237139 | 2513874818 | 225 |
| 59 | iso_pu_bacteria | 2513237145 | 2513915778 | 225 |
| 60 | iso_pu_bacteria | 2513237161 | 2514010463 | 225 |
| 61 | iso_pu_bacteria | 2515154112 | 2515625238 | 225 |
| 62 | iso_pu_bacteria | 2517093001 | 2517100767 | 225 |
| 63 | iso_pu_bacteria | 2517572143 | 2517894916 | 225 |
| 64 | iso_pu_bacteria | 2524023205 | 2524438021 | 225 |
| 65 | iso_pu_bacteria | 2524023210 | 2524466606 | 225 |
| 66 | iso_pu_bacteria | 2524023228 | 2524534687 | 225 |
| 67 | iso_pu_bacteria | 2528768022 | 2528849173 | 225 |
| 68 | iso_pu_bacteria | 2602042107 | 2603858437 | 225 |
| 69 | iso_pu_bacteria | 2617270735 | 2617350561 | 225 |
| 70 | iso_pu_bacteria | 2617270741 | 2617373317 | 225 |
| 71 | iso_pu_bacteria | 2643221651 | 2644287301 | 225 |
| 72 | iso_pu_bacteria | 2667528175 | 2671123025 | 225 |
| 73 | iso_pu_bacteria | 2728368998 | 2728748801 | 225 |
| 74 | iso_pu_bacteria | 2744054633 | 2745081022 | 225 |
| 75 | iso_pu_bacteria | 2791355196 | 2793061866 | 225 |
| 76 | iso_pu_bacteria | 2791355197 | 2793072010 | 225 |
| 77 | iso_pu_bacteria | 2791355199 | 2793079595 | 225 |
| 78 | iso_pu_bacteria | 2802429603 | 2805916819 | 225 |
| 79 | iso_pu_bacteria | 2816332527 | 2818238331 | 225 |
| 80 | iso_pu_bacteria | 2824600985 | 2824603956 | 225 |
| 81 | iso_pu_bacteria | 2824609381 | 2824611537 | 225 |
| 82 | iso_pu_bacteria | 2824617872 | 2824622499 | 225 |
| 83 | iso_pu_bacteria | 2824626560 | 2824630321 | 225 |
| 84 | iso_pu_bacteria | 2824635225 | 2824638351 | 225 |
| 85 | iso_pu_bacteria | 2824644064 | 2824645965 | 225 |
| 86 | iso_pu_bacteria | 2824653114 | 2824655439 | 225 |
| 87 | iso_pu_bacteria | 2824661429 | 2824663305 | 225 |
| 88 | iso_pu_bacteria | 2824671348 | 2824673579 | 225 |
| 89 | iso_pu_bacteria | 2824679649 | 2824680953 | 225 |
| 90 | iso_pu_bacteria | 2824687955 | 2824690298 | 225 |
| 91 | iso_pu_bacteria | 2824696289 | 2824698635 | 225 |
| 92 | iso_pu_bacteria | 2824704595 | 2824707116 | 225 |
| 93 | iso_pu_bacteria | 2824714736 | 2824716086 | 225 |
| 94 | iso_pu_bacteria | 2824723954 | 2824725942 | 225 |
| 95 | iso_pu_bacteria | 2824732956 | 2824734756 | 225 |
| 96 | iso_pu_bacteria | 2824746037 | 2824747670 | 225 |
| 97 | iso_pu_bacteria | 2824753945 | 2824754568 | 225 |
| 98 | iso_pu_bacteria | 2824763712 | 2824765386 | 225 |
| 99 | iso_pu_bacteria | 2824773399 | 2824773485 | 225 |
| 100 | iso_pu_bacteria | 2838122688 | 2838129120 | 225 |
| 101 | iso_pu_bacteria | 2841941048 | 2841943363 | 225 |
| 102 | iso_pu_bacteria | 2841949485 | 2841953909 | 225 |
| 103 | iso_pu_bacteria | 2841957949 | 2841962059 | 225 |
| 104 | iso_pu_bacteria | 2841966195 | 2841968001 | 225 |
| 105 | iso_pu_bacteria | 2841974524 | 2841981255 | 225 |
| 106 | iso_pu_bacteria | 2841983080 | 2841990337 | 225 |
| 107 | iso_pu_bacteria | 2842038055 | 2842042530 | 225 |
| 108 | iso_pu_bacteria | 2842045827 | 2842050573 | 225 |
| 109 | iso_pu_bacteria | 2844315083 | 2844316736 | 225 |
| 110 | iso_pu_bacteria | 2847930680 | 2847938736 | 225 |
| 111 | iso_pu_bacteria | 2847939898 | 2847944066 | 225 |
| 112 | iso_pu_bacteria | 2849076700 | 2849081710 | 225 |
| 113 | iso_pu_bacteria | 2857509624 | 2857512360 | 225 |
| 114 | iso_pu_bacteria | 2857524615 | 2857526471 | 225 |
| 115 | iso_pu_bacteria | 2874590934 | 2874597930 | 225 |
| 116 | iso_pu_bacteria | 2874604998 | 2874607465 | 225 |
| 117 | iso_pu_bacteria | 2874612657 | 2874619733 | 225 |
| 118 | iso_pu_bacteria | 2874620515 | 2874626208 | 225 |
| 119 | iso_pu_bacteria | 2874628541 | 2874631408 | 225 |
| 120 | iso_pu_bacteria | 2874645413 | 2874651458 | 225 |
| 121 | iso_pu_bacteria | 2876761206 | 2876763039 | 225 |
| 122 | iso_pu_bacteria | 2876771140 | 2876776530 | 225 |
| 123 | iso_pu_bacteria | 2876808645 | 2876814802 | 225 |
| 124 | iso_pu_bacteria | 2876818435 | 2876824880 | 225 |
| 125 | iso_pu_bacteria | 2879074833 | 2879081607 | 225 |
| 126 | iso_pu_bacteria | 2879083081 | 2879088289 | 225 |
| 127 | iso_pu_bacteria | 2879099564 | 2879108993 | 225 |
| 128 | iso_pu_bacteria | 2879110137 | 2879111056 | 225 |
| 129 | iso_pu_bacteria | 2879127579 | 2879134218 | 225 |
| 130 | iso_pu_bacteria | 2879142872 | 2879147878 | 225 |
| 131 | iso_pu_bacteria | 2881364244 | 2881365912 | 225 |
| 132 | iso_pu_bacteria | 2881665667 | 2881667463 | 225 |
| 133 | iso_pu_bacteria | 2885366525 | 2885366762 | 225 |
| 134 | iso_pu_bacteria | 2885374607 | 2885383076 | 225 |
| 135 | iso_pu_bacteria | 2885383462 | 2885385939 | 225 |
| 136 | iso_pu_bacteria | 2885409591 | 2885411566 | 225 |
| 137 | iso_pu_bacteria | 2888378607 | 2888381345 | 225 |
| 138 | iso_pu_bacteria | 2888388044 | 2888389293 | 225 |
| 139 | iso_pu_bacteria | 2888419890 | 2888421765 | 225 |
| 140 | iso_pu_bacteria | 2889033259 | 2889037153 | 225 |
| 141 | iso_pu_bacteria | 2893066018 | 2893067287 | 225 |
| 142 | iso_pu_bacteria | 2903727486 | 2903733791 | 225 |
| 143 | iso_pu_bacteria | 2903748898 | 2903756551 | 225 |
| 144 | iso_pu_bacteria | 2903768456 | 2903769778 | 225 |
| 145 | iso_pu_bacteria | 2904666416 | 2904669226 | 225 |
| 146 | iso_pu_bacteria | 2904690495 | 2904698051 | 225 |
| 147 | iso_pu_bacteria | 2904699407 | 2904706170 | 225 |
| 148 | iso_pu_bacteria | 2904711408 | 2904718810 | 225 |
| 149 | iso_pu_bacteria | 2906602504 | 2906608025 | 225 |
| 150 | iso_pu_bacteria | 2906610324 | 2906611651 | 225 |
| 151 | iso_pu_bacteria | 2906626472 | 2906630732 | 225 |
| 152 | iso_pu_bacteria | 2906635258 | 2906639630 | 225 |
| 153 | iso_pu_bacteria | 2906643746 | 2906648537 | 225 |
| 154 | iso_pu_bacteria | 2906660503 | 2906660627 | 225 |
| 155 | iso_pu_bacteria | 2908739725 | 2908745237 | 225 |
| 156 | iso_pu_bacteria | 2908756301 | 2908763088 | 225 |
| 157 | iso_pu_bacteria | 2908775508 | 2908781774 | 225 |
| 158 | iso_pu_bacteria | 2919073203 | 2919073712 | 225 |
| 159 | iso_pu_bacteria | 2922368715 | 2922370992 | 225 |
| 160 | iso_pu_bacteria | 2922393267 | 2922401179 | 225 |
| 161 | iso_pu_bacteria | 2922425934 | 2922427696 | 225 |
| 162 | iso_pu_bacteria | 2929615660 | 2929619389 | 225 |
| 163 | iso_pu_bacteria | 2929624759 | 2929628141 | 225 |
| 164 | iso_pu_bacteria | 2932784394 | 2932785689 | 225 |
| 165 | iso_pu_bacteria | 2932794094 | 2932799083 | 225 |
| 166 | iso_pu_bacteria | 2932801729 | 2932808501 | 225 |
| 167 | iso_pu_bacteria | 2932809354 | 2932813720 | 225 |
| 168 | iso_pu_bacteria | 2932818245 | 2932822312 | 225 |
| 169 | iso_pu_bacteria | 2932828146 | 2932830753 | 225 |
| 170 | iso_pu_bacteria | 2933577622 | 2933581309 | 225 |
| 171 | iso_pu_bacteria | 2935608549 | 2935612575 | 225 |
| 172 | iso_pu_bacteria | 2935616580 | 2935620800 | 225 |
| 173 | iso_pu_bacteria | 2935630451 | 2935632357 | 225 |
| 174 | iso_pu_bacteria | 2935638405 | 2935639879 | 225 |
| 175 | iso_pu_bacteria | 2935648319 | 2935653528 | 225 |
| 176 | iso_pu_bacteria | 2935656913 | 2935662277 | 225 |
| 177 | iso_pu_bacteria | 2935665750 | 2935667267 | 225 |
| 178 | iso_pu_bacteria | 2935675223 | 2935677654 | 225 |
| 179 | iso_pu_bacteria | 2935684952 | 2935690407 | 225 |
| 180 | iso_pu_bacteria | 2935694250 | 2935697270 | 225 |
| 181 | iso_pu_bacteria | 2935703347 | 2935705023 | 225 |
| 182 | iso_pu_bacteria | 2935713505 | 2935717897 | 225 |
| 183 | iso_pu_bacteria | 2935722832 | 2935726953 | 225 |
| 184 | iso_pu_bacteria | 2935732158 | 2935735723 | 225 |
| 185 | iso_pu_bacteria | 2935741537 | 2935745006 | 225 |
| 186 | iso_pu_bacteria | 2935750917 | 2935755417 | 225 |
| 187 | iso_pu_bacteria | 2935760218 | 2935762076 | 225 |
| 188 | iso_pu_bacteria | 2935769743 | 2935776138 | 225 |
| 189 | iso_pu_bacteria | 2935777560 | 2935781971 | 225 |
| 190 | iso_pu_bacteria | 2935785616 | 2935791995 | 225 |
| 191 | iso_pu_bacteria | 2935793552 | 2935800355 | 225 |
| 192 | iso_pu_bacteria | 2935801545 | 2935803575 | 225 |
| 193 | iso_pu_bacteria | 2935810662 | 2935811495 | 225 |
| 194 | iso_pu_bacteria | 2935819856 | 2935824064 | 225 |
| 195 | iso_pu_bacteria | 2935827899 | 2935829362 | 225 |
| 196 | iso_pu_bacteria | 2935837841 | 2935842660 | 225 |
| 197 | iso_pu_bacteria | 2935847175 | 2935852789 | 225 |
| 198 | iso_pu_bacteria | 2935855204 | 2935858608 | 225 |
| 199 | iso_pu_bacteria | 2935864058 | 2935866971 | 225 |
| 200 | iso_pu_bacteria | 2935873716 | 2935877101 | 225 |
| 201 | iso_pu_bacteria | 2935883170 | 2935884702 | 225 |
| 202 | iso_pu_bacteria | 2935908558 | 2935912059 | 225 |
| 203 | iso_pu_bacteria | 2935916978 | 2935922270 | 225 |
| 204 | iso_pu_bacteria | 2935926038 | 2935929088 | 225 |
| 205 | iso_pu_bacteria | 2935934488 | 2935935719 | 225 |
| 206 | iso_pu_bacteria | 2935942939 | 2935947285 | 225 |
| 207 | iso_pu_bacteria | 2935951376 | 2935953621 | 225 |
| 208 | iso_pu_bacteria | 2935959822 | 2935961867 | 225 |
| 209 | iso_pu_bacteria | 2935967501 | 2935968647 | 225 |
| 210 | iso_pu_bacteria | 2935975950 | 2935976853 | 225 |
| 211 | iso_pu_bacteria | 2935984226 | 2935986185 | 225 |
| 212 | iso_pu_bacteria | 2935992306 | 2935995263 | 225 |
| 213 | iso_pu_bacteria | 2936002035 | 2936004150 | 225 |
| 214 | iso_pu_bacteria | 2936011229 | 2936016579 | 225 |
| 215 | iso_pu_bacteria | 2936019824 | 2936025107 | 225 |
| 216 | iso_pu_bacteria | 2936028420 | 2936034054 | 225 |
| 217 | iso_pu_bacteria | 2936037263 | 2936038077 | 225 |
| 218 | iso_pu_bacteria | 2936046547 | 2936052006 | 225 |
| 219 | iso_pu_bacteria | 2936055302 | 2936059779 | 225 |
| 220 | iso_pu_bacteria | 2940556831 | 2940561302 | 225 |
| 221 | iso_pu_bacteria | 2941507105 | 2941508304 | 225 |
| 222 | iso_pu_bacteria | 2941515067 | 2941515190 | 225 |
| 223 | iso_pu_bacteria | 2941523033 | 2941524235 | 225 |
| 224 | iso_pu_bacteria | 2941531003 | 2941533523 | 225 |
| 225 | iso_pu_bacteria | 2941538514 | 2941544493 | 225 |
| 226 | iso_pu_bacteria | 3005474847 | 3005477410 | 225 |
| 227 | iso_pu_bacteria | 3005506211 | 3005511340 | 225 |
| 228 | iso_pu_bacteria | 3005587118 | 3005592903 | 225 |
| 229 | iso_pu_bacteria | 3005594810 | 3005596344 | 225 |
| 230 | iso_pu_bacteria | 3005710791 | 3005712427 | 225 |
| 231 | iso_pu_bacteria | 3005718088 | 3005719501 | 225 |
| 232 | iso_pu_bacteria | 8006926726 | 8006927693 | 225 |
| 233 | iso_pu_bacteria | 8006933436 | 8006933825 | 225 |
| 234 | iso_pu_bacteria | 8006964411 | 8006969625 | 225 |
| 235 | iso_pu_bacteria | 8006973647 | 8006983497 | 225 |
| 236 | iso_pu_bacteria | 8006984368 | 8006990669 | 225 |
| 237 | iso_pu_bacteria | 8006994254 | 8006998702 | 225 |
| 238 | iso_pu_bacteria | 8016511872 | 8016516652 | 225 |
| 239 | iso_pu_bacteria | 8016522445 | 8016524035 | 225 |
| 240 | iso_pu_bacteria | 8016530956 | 8016537580 | 225 |
| 241 | iso_pu_bacteria | 8016539877 | 8016541846 | 225 |
| 242 | iso_pu_bacteria | 8016548790 | 8016551430 | 225 |
| 243 | iso_pu_bacteria | 8016557553 | 8016559812 | 225 |
| 244 | iso_pu_bacteria | 8016566248 | 8016567231 | 225 |
| 245 | iso_pu_bacteria | 8016575299 | 8016579948 | 225 |
| 246 | iso_pu_bacteria | 8016603502 | 8016604558 | 225 |
| 247 | iso_pu_bacteria | 8016613128 | 8016620454 | 225 |
| 248 | iso_pu_bacteria | 8016622563 | 8016629521 | 225 |
| 249 | iso_pu_bacteria | 8016630954 | 8016637875 | 225 |
| 250 | iso_pu_bacteria | 8017057580 | 8017059903 | 225 |
| 251 | iso_pu_bacteria | 8019530166 | 8019537255 | 225 |
| 252 | iso_pu_bacteria | 8019538911 | 8019538965 | 225 |
| 253 | iso_pu_bacteria | 8019547302 | 8019548460 | 225 |
| 254 | iso_pu_bacteria | 8019555841 | 8019559754 | 225 |
| 255 | iso_pu_bacteria | 8019565922 | 8019569863 | 225 |
| 256 | iso_pu_bacteria | 8019576017 | 8019579394 | 225 |
| 257 | iso_pu_bacteria | 8019586578 | 8019597452 | 225 |
| 258 | iso_pu_bacteria | 8019597564 | 8019604233 | 225 |
| 259 | iso_pu_bacteria | 8019608314 | 8019614299 | 225 |
| 260 | iso_pu_bacteria | 8019629233 | 8019637246 | 225 |
| 261 | iso_pu_bacteria | 8019638758 | 8019642350 | 225 |
| 262 | iso_pu_bacteria | 8019648815 | 8019650232 | 225 |
| 263 | iso_pu_bacteria | 8019668869 | 8019674634 | 225 |
| 264 | iso_pu_bacteria | 8019678201 | 8019681467 | 225 |
| 265 | iso_pu_bacteria | 8019687851 | 8019694315 | 225 |
| 266 | iso_pu_bacteria | 8055742211 | 8055749354 | 225 |
| 267 | iso_pu_bacteria | 8056673599 | 8056676665 | 225 |
| 268 | iso_pu_bacteria | 8056681323 | 8056689657 | 225 |
| 269 | iso_pu_bacteria | 8056689827 | 8056693208 | 225 |
| 270 | iso_pu_bacteria | 8056967851 | 8056973604 | 225 |
| 271 | 3300003659 | JGI25404J52841_10007066 | JGI25404J52841_100070663 | 228 |
| 272 | 3300005328 | Ga0070676_10021890 | Ga0070676_100218902 | 228 |
| 273 | 3300005339 | Ga0070660_100276331 | Ga0070660_1002763312 | 228 |
| 274 | 3300005354 | Ga0070675_100069644 | Ga0070675_1000696444 | 228 |
| 275 | 3300005356 | Ga0070674_100023493 | Ga0070674_1000234932 | 228 |
| 276 | 3300005366 | Ga0070659_100122684 | Ga0070659_1001226841 | 228 |
| 277 | 3300005543 | Ga0070672_100035120 | Ga0070672_1000351206 | 228 |
| 278 | 3300005548 | Ga0070665_100137017 | Ga0070665_1001370172 | 228 |
| 279 | 3300005937 | Ga0081455_10183671 | Ga0081455_101836712 | 228 |
| 280 | 3300005983 | Ga0081540_1000001 | Ga0081540_1000001145 | 228 |
| 281 | 3300005983 | Ga0081540_1026807 | Ga0081540_10268073 | 228 |
| 282 | 3300006881 | Ga0068865_100139877 | Ga0068865_1001398771 | 228 |
| 283 | 3300010375 | Ga0105239_10057289 | Ga0105239_100572894 | 228 |
| 284 | 3300021377 | Ga0213874_10006171 | Ga0213874_100061712 | 228 |
| 285 | 3300025907 | Ga0207645_10055873 | Ga0207645_100558732 | 228 |
| 286 | 3300025937 | Ga0207669_10007561 | Ga0207669_100075617 | 228 |
| 287 | 3300025940 | Ga0207691_10132909 | Ga0207691_101329092 | 228 |
| 288 | 3300028379 | Ga0268266_10229049 | Ga0268266_102290492 | 228 |
| 289 | 3300031240 | Ga0265320_10043315 | Ga0265320_100433152 | 228 |
| 290 | 3300031250 | Ga0265331_10045142 | Ga0265331_100451422 | 228 |
| 291 | 3300039437 | Ga0436365_0739478 | Ga0436365_0739478_699_1385 | 228 |
| 292 | 3300039447 | Ga0436361_1196327 | Ga0436361_1196327_469_1161 | 228 |
| 293 | 3300039450 | Ga0436363_0093542 | Ga0436363_0093542_1343_2035 | 228 |
| 294 | 3300048922 | Ga0496119_0039376 | Ga0496119_0039376_1887_2573 | 228 |
| 295 | 3300048924 | Ga0496121_0166365 | Ga0496121_0166365_332_1018 | 228 |
| 296 | 3300053119 | Ga0500595_037859 | Ga0500595_037859_158_844 | 228 |
| 297 | 3300001991 | JGI24743J22301_10025479 | JGI24743J22301_100254792 | 229 |
| 298 | 3300002070 | JGI24750J21931_1002499 | JGI24750J21931_10024992 | 229 |
| 299 | 3300002074 | JGI24748J21848_1009014 | JGI24748J21848_10090141 | 229 |
| 300 | 3300003203 | JGI25406J46586_10000062 | JGI25406J46586_1000006223 | 229 |
| 301 | 3300003203 | JGI25406J46586_10033356 | JGI25406J46586_100333562 | 229 |
| 302 | 3300003203 | JGI25406J46586_10037177 | JGI25406J46586_100371772 | 229 |
| 303 | 3300003214 | JGI25165J46597_1007367 | JGI25165J46597_10073672 | 229 |
| 304 | 3300003215 | JGI25153J46596_10000706 | JGI25153J46596_100007065 | 229 |
| 305 | 3300003215 | JGI25153J46596_10004539 | JGI25153J46596_100045395 | 229 |
| 306 | 3300003215 | JGI25153J46596_10004975 | JGI25153J46596_100049751 | 229 |
| 307 | 3300003354 | JGI25160J50197_1000505 | JGI25160J50197_10005052 | 229 |
| 308 | 3300003354 | JGI25160J50197_1001624 | JGI25160J50197_10016244 | 229 |
| 309 | 3300003354 | JGI25160J50197_1003729 | JGI25160J50197_10037292 | 229 |
| 310 | 3300003354 | JGI25160J50197_1013653 | JGI25160J50197_10136531 | 229 |
| 311 | 3300003659 | JGI25404J52841_10000577 | JGI25404J52841_100005773 | 229 |
| 312 | 3300003659 | JGI25404J52841_10016320 | JGI25404J52841_100163201 | 229 |
| 313 | 3300003752 | Ga0055539_1006186 | Ga0055539_10061861 | 229 |
| 314 | 3300003794 | Ga0055531_10002829 | Ga0055531_100028292 | 229 |
| 315 | 3300004625 | Ga0055543_1003558 | Ga0055543_10035582 | 229 |
| 316 | 3300005262 | Ga0065165_1000376 | Ga0065165_10003769 | 229 |
| 317 | 3300005262 | Ga0065165_1001328 | Ga0065165_100132813 | 229 |
| 318 | 3300005262 | Ga0065165_1005920 | Ga0065165_10059203 | 229 |
| 319 | 3300005262 | Ga0065165_1012917 | Ga0065165_10129172 | 229 |
| 320 | 3300005262 | Ga0065165_1031508 | Ga0065165_10315082 | 229 |
| 321 | 3300005327 | Ga0070658_10066416 | Ga0070658_100664164 | 229 |
| 322 | 3300005327 | Ga0070658_10089165 | Ga0070658_100891652 | 229 |
| 323 | 3300005327 | Ga0070658_10100710 | Ga0070658_101007102 | 229 |
| 324 | 3300005328 | Ga0070676_10172142 | Ga0070676_101721422 | 229 |
| 325 | 3300005329 | Ga0070683_100013060 | Ga0070683_1000130602 | 229 |
| 326 | 3300005329 | Ga0070683_100312333 | Ga0070683_1003123331 | 229 |
| 327 | 3300005330 | Ga0070690_100036663 | Ga0070690_1000366632 | 229 |
| 328 | 3300005331 | Ga0070670_100038515 | Ga0070670_1000385153 | 229 |
| 329 | 3300005334 | Ga0068869_100117440 | Ga0068869_1001174402 | 229 |
| 330 | 3300005334 | Ga0068869_100266303 | Ga0068869_1002663032 | 229 |
| 331 | 3300005335 | Ga0070666_10028520 | Ga0070666_100285202 | 229 |
| 332 | 3300005335 | Ga0070666_10148716 | Ga0070666_101487162 | 229 |
| 333 | 3300005336 | Ga0070680_100040572 | Ga0070680_1000405723 | 229 |
| 334 | 3300005336 | Ga0070680_100044717 | Ga0070680_1000447172 | 229 |
| 335 | 3300005337 | Ga0070682_100056258 | Ga0070682_1000562582 | 229 |
| 336 | 3300005337 | Ga0070682_100168518 | Ga0070682_1001685182 | 229 |
| 337 | 3300005337 | Ga0070682_100435055 | Ga0070682_1004350552 | 229 |
| 338 | 3300005338 | Ga0068868_100024604 | Ga0068868_1000246043 | 229 |
| 339 | 3300005338 | Ga0068868_100039506 | Ga0068868_1000395062 | 229 |
| 340 | 3300005339 | Ga0070660_100013819 | Ga0070660_1000138193 | 229 |
| 341 | 3300005340 | Ga0070689_100006833 | Ga0070689_1000068333 | 229 |
| 342 | 3300005340 | Ga0070689_100163571 | Ga0070689_1001635711 | 229 |
| 343 | 3300005340 | Ga0070689_100321899 | Ga0070689_1003218992 | 229 |
| 344 | 3300005341 | Ga0070691_10002298 | Ga0070691_100022985 | 229 |
| 345 | 3300005341 | Ga0070691_10189482 | Ga0070691_101894822 | 229 |
| 346 | 3300005343 | Ga0070687_100006033 | Ga0070687_1000060334 | 229 |
| 347 | 3300005344 | Ga0070661_100061751 | Ga0070661_1000617512 | 229 |
| 348 | 3300005345 | Ga0070692_10042926 | Ga0070692_100429262 | 229 |
| 349 | 3300005347 | Ga0070668_100009146 | Ga0070668_1000091464 | 229 |
| 350 | 3300005347 | Ga0070668_100035322 | Ga0070668_1000353223 | 229 |
| 351 | 3300005347 | Ga0070668_100179233 | Ga0070668_1001792332 | 229 |
| 352 | 3300005347 | Ga0070668_100236865 | Ga0070668_1002368652 | 229 |
| 353 | 3300005347 | Ga0070668_100303532 | Ga0070668_1003035321 | 229 |
| 354 | 3300005347 | Ga0070668_100385910 | Ga0070668_1003859101 | 229 |
| 355 | 3300005347 | Ga0070668_100584821 | Ga0070668_1005848212 | 229 |
| 356 | 3300005353 | Ga0070669_100076280 | Ga0070669_1000762802 | 229 |
| 357 | 3300005354 | Ga0070675_100100706 | Ga0070675_1001007062 | 229 |
| 358 | 3300005355 | Ga0070671_100014286 | Ga0070671_1000142862 | 229 |
| 359 | 3300005355 | Ga0070671_100158405 | Ga0070671_1001584052 | 229 |
| 360 | 3300005355 | Ga0070671_100168577 | Ga0070671_1001685772 | 229 |
| 361 | 3300005356 | Ga0070674_100016093 | Ga0070674_1000160934 | 229 |
| 362 | 3300005356 | Ga0070674_100243336 | Ga0070674_1002433362 | 229 |
| 363 | 3300005356 | Ga0070674_100266687 | Ga0070674_1002666872 | 229 |
| 364 | 3300005364 | Ga0070673_100046344 | Ga0070673_1000463442 | 229 |
| 365 | 3300005365 | Ga0070688_100003433 | Ga0070688_1000034332 | 229 |
| 366 | 3300005366 | Ga0070659_100086707 | Ga0070659_1000867072 | 229 |
| 367 | 3300005366 | Ga0070659_100091497 | Ga0070659_1000914972 | 229 |
| 368 | 3300005367 | Ga0070667_100012673 | Ga0070667_1000126734 | 229 |
| 369 | 3300005367 | Ga0070667_100363549 | Ga0070667_1003635491 | 229 |
| 370 | 3300005406 | Ga0070703_10015029 | Ga0070703_100150292 | 229 |
| 371 | 3300005434 | Ga0070709_10001936 | Ga0070709_100019367 | 229 |
| 372 | 3300005434 | Ga0070709_10004500 | Ga0070709_100045003 | 229 |
| 373 | 3300005434 | Ga0070709_10010623 | Ga0070709_100106233 | 229 |
| 374 | 3300005434 | Ga0070709_10106150 | Ga0070709_101061503 | 229 |
| 375 | 3300005435 | Ga0070714_100064454 | Ga0070714_1000644542 | 229 |
| 376 | 3300005435 | Ga0070714_100089440 | Ga0070714_1000894403 | 229 |
| 377 | 3300005435 | Ga0070714_100089795 | Ga0070714_1000897952 | 229 |
| 378 | 3300005435 | Ga0070714_100112756 | Ga0070714_1001127562 | 229 |
| 379 | 3300005435 | Ga0070714_100175907 | Ga0070714_1001759072 | 229 |
| 380 | 3300005435 | Ga0070714_100289478 | Ga0070714_1002894782 | 229 |
| 381 | 3300005435 | Ga0070714_100291309 | Ga0070714_1002913092 | 229 |
| 382 | 3300005435 | Ga0070714_100334584 | Ga0070714_1003345842 | 229 |
| 383 | 3300005435 | Ga0070714_100447220 | Ga0070714_1004472201 | 229 |
| 384 | 3300005435 | Ga0070714_100462941 | Ga0070714_1004629412 | 229 |
| 385 | 3300005435 | Ga0070714_100710706 | Ga0070714_1007107061 | 229 |
| 386 | 3300005436 | Ga0070713_100014005 | Ga0070713_1000140054 | 229 |
| 387 | 3300005436 | Ga0070713_100019321 | Ga0070713_1000193214 | 229 |
| 388 | 3300005436 | Ga0070713_100082531 | Ga0070713_1000825313 | 229 |
| 389 | 3300005436 | Ga0070713_100585329 | Ga0070713_1005853292 | 229 |
| 390 | 3300005437 | Ga0070710_10001143 | Ga0070710_100011433 | 229 |
| 391 | 3300005437 | Ga0070710_10007386 | Ga0070710_100073864 | 229 |
| 392 | 3300005437 | Ga0070710_10009090 | Ga0070710_100090904 | 229 |
| 393 | 3300005437 | Ga0070710_10070635 | Ga0070710_100706352 | 229 |
| 394 | 3300005439 | Ga0070711_100012156 | Ga0070711_1000121564 | 229 |
| 395 | 3300005439 | Ga0070711_100067520 | Ga0070711_1000675204 | 229 |
| 396 | 3300005440 | Ga0070705_100004226 | Ga0070705_1000042264 | 229 |
| 397 | 3300005441 | Ga0070700_100014881 | Ga0070700_1000148813 | 229 |
| 398 | 3300005441 | Ga0070700_100096091 | Ga0070700_1000960912 | 229 |
| 399 | 3300005441 | Ga0070700_100417851 | Ga0070700_1004178512 | 229 |
| 400 | 3300005444 | Ga0070694_100029391 | Ga0070694_1000293912 | 229 |
| 401 | 3300005444 | Ga0070694_100562756 | Ga0070694_1005627561 | 229 |
| 402 | 3300005455 | Ga0070663_100000663 | Ga0070663_1000006634 | 229 |
| 403 | 3300005455 | Ga0070663_100003769 | Ga0070663_1000037694 | 229 |
| 404 | 3300005455 | Ga0070663_100007495 | Ga0070663_1000074954 | 229 |
| 405 | 3300005455 | Ga0070663_100027475 | Ga0070663_1000274752 | 229 |
| 406 | 3300005455 | Ga0070663_100062128 | Ga0070663_1000621283 | 229 |
| 407 | 3300005455 | Ga0070663_100064981 | Ga0070663_1000649813 | 229 |
| 408 | 3300005455 | Ga0070663_100077484 | Ga0070663_1000774843 | 229 |
| 409 | 3300005455 | Ga0070663_100192247 | Ga0070663_1001922472 | 229 |
| 410 | 3300005455 | Ga0070663_100250212 | Ga0070663_1002502122 | 229 |
| 411 | 3300005455 | Ga0070663_100254291 | Ga0070663_1002542912 | 229 |
| 412 | 3300005456 | Ga0070678_100007982 | Ga0070678_1000079822 | 229 |
| 413 | 3300005456 | Ga0070678_100061062 | Ga0070678_1000610622 | 229 |
| 414 | 3300005456 | Ga0070678_100097096 | Ga0070678_1000970962 | 229 |
| 415 | 3300005456 | Ga0070678_100103955 | Ga0070678_1001039552 | 229 |
| 416 | 3300005456 | Ga0070678_100187561 | Ga0070678_1001875612 | 229 |
| 417 | 3300005456 | Ga0070678_100384104 | Ga0070678_1003841041 | 229 |
| 418 | 3300005456 | Ga0070678_100627837 | Ga0070678_1006278372 | 229 |
| 419 | 3300005457 | Ga0070662_100048176 | Ga0070662_1000481762 | 229 |
| 420 | 3300005457 | Ga0070662_100095251 | Ga0070662_1000952513 | 229 |
| 421 | 3300005457 | Ga0070662_100210615 | Ga0070662_1002106152 | 229 |
| 422 | 3300005458 | Ga0070681_10007338 | Ga0070681_100073384 | 229 |
| 423 | 3300005458 | Ga0070681_10020420 | Ga0070681_100204205 | 229 |
| 424 | 3300005458 | Ga0070681_10029849 | Ga0070681_100298491 | 229 |
| 425 | 3300005458 | Ga0070681_10066728 | Ga0070681_100667282 | 229 |
| 426 | 3300005458 | Ga0070681_10224209 | Ga0070681_102242092 | 229 |
| 427 | 3300005458 | Ga0070681_10949403 | Ga0070681_109494031 | 229 |
| 428 | 3300005459 | Ga0068867_100068902 | Ga0068867_1000689022 | 229 |
| 429 | 3300005459 | Ga0068867_100186927 | Ga0068867_1001869272 | 229 |
| 430 | 3300005459 | Ga0068867_100563409 | Ga0068867_1005634092 | 229 |
| 431 | 3300005459 | Ga0068867_100720976 | Ga0068867_1007209761 | 229 |
| 432 | 3300005467 | Ga0070706_100222009 | Ga0070706_1002220092 | 229 |
| 433 | 3300005468 | Ga0070707_100255025 | Ga0070707_1002550252 | 229 |
| 434 | 3300005471 | Ga0070698_100025007 | Ga0070698_1000250077 | 229 |
| 435 | 3300005518 | Ga0070699_100772564 | Ga0070699_1007725642 | 229 |
| 436 | 3300005530 | Ga0070679_100005095 | Ga0070679_1000050954 | 229 |
| 437 | 3300005530 | Ga0070679_100013509 | Ga0070679_1000135096 | 229 |
| 438 | 3300005530 | Ga0070679_100016927 | Ga0070679_1000169274 | 229 |
| 439 | 3300005530 | Ga0070679_100025320 | Ga0070679_1000253202 | 229 |
| 440 | 3300005530 | Ga0070679_100128869 | Ga0070679_1001288692 | 229 |
| 441 | 3300005530 | Ga0070679_100651375 | Ga0070679_1006513751 | 229 |
| 442 | 3300005535 | Ga0070684_100023322 | Ga0070684_1000233222 | 229 |
| 443 | 3300005535 | Ga0070684_100048283 | Ga0070684_1000482832 | 229 |
| 444 | 3300005535 | Ga0070684_100049381 | Ga0070684_1000493812 | 229 |
| 445 | 3300005535 | Ga0070684_100084182 | Ga0070684_1000841824 | 229 |
| 446 | 3300005535 | Ga0070684_100187820 | Ga0070684_1001878202 | 229 |
| 447 | 3300005535 | Ga0070684_100387519 | Ga0070684_1003875192 | 229 |
| 448 | 3300005536 | Ga0070697_100007535 | Ga0070697_1000075359 | 229 |
| 449 | 3300005536 | Ga0070697_100202486 | Ga0070697_1002024862 | 229 |
| 450 | 3300005539 | Ga0068853_100040827 | Ga0068853_1000408274 | 229 |
| 451 | 3300005539 | Ga0068853_100041848 | Ga0068853_1000418483 | 229 |
| 452 | 3300005539 | Ga0068853_100081360 | Ga0068853_1000813602 | 229 |
| 453 | 3300005539 | Ga0068853_100109748 | Ga0068853_1001097482 | 229 |
| 454 | 3300005539 | Ga0068853_100154095 | Ga0068853_1001540952 | 229 |
| 455 | 3300005543 | Ga0070672_100027503 | Ga0070672_1000275033 | 229 |
| 456 | 3300005543 | Ga0070672_100326055 | Ga0070672_1003260552 | 229 |
| 457 | 3300005543 | Ga0070672_100517280 | Ga0070672_1005172801 | 229 |
| 458 | 3300005544 | Ga0070686_100033840 | Ga0070686_1000338403 | 229 |
| 459 | 3300005545 | Ga0070695_100007577 | Ga0070695_1000075772 | 229 |
| 460 | 3300005546 | Ga0070696_100064667 | Ga0070696_1000646672 | 229 |
| 461 | 3300005547 | Ga0070693_100004992 | Ga0070693_1000049922 | 229 |
| 462 | 3300005547 | Ga0070693_100181969 | Ga0070693_1001819692 | 229 |
| 463 | 3300005547 | Ga0070693_100273492 | Ga0070693_1002734922 | 229 |
| 464 | 3300005548 | Ga0070665_100005052 | Ga0070665_1000050525 | 229 |
| 465 | 3300005548 | Ga0070665_100021610 | Ga0070665_1000216104 | 229 |
| 466 | 3300005548 | Ga0070665_100039433 | Ga0070665_1000394332 | 229 |
| 467 | 3300005548 | Ga0070665_100097761 | Ga0070665_1000977612 | 229 |
| 468 | 3300005548 | Ga0070665_100131152 | Ga0070665_1001311522 | 229 |
| 469 | 3300005548 | Ga0070665_100134270 | Ga0070665_1001342702 | 229 |
| 470 | 3300005548 | Ga0070665_100157201 | Ga0070665_1001572012 | 229 |
| 471 | 3300005548 | Ga0070665_100166352 | Ga0070665_1001663522 | 229 |
| 472 | 3300005548 | Ga0070665_100313179 | Ga0070665_1003131792 | 229 |
| 473 | 3300005548 | Ga0070665_100794089 | Ga0070665_1007940891 | 229 |
| 474 | 3300005549 | Ga0070704_100005271 | Ga0070704_1000052713 | 229 |
| 475 | 3300005549 | Ga0070704_100641765 | Ga0070704_1006417651 | 229 |
| 476 | 3300005563 | Ga0068855_100027223 | Ga0068855_1000272235 | 229 |
| 477 | 3300005563 | Ga0068855_100034381 | Ga0068855_1000343813 | 229 |
| 478 | 3300005563 | Ga0068855_100037802 | Ga0068855_1000378024 | 229 |
| 479 | 3300005563 | Ga0068855_100115683 | Ga0068855_1001156833 | 229 |
| 480 | 3300005563 | Ga0068855_100141268 | Ga0068855_1001412682 | 229 |
| 481 | 3300005563 | Ga0068855_100538286 | Ga0068855_1005382862 | 229 |
| 482 | 3300005564 | Ga0070664_100009606 | Ga0070664_1000096065 | 229 |
| 483 | 3300005564 | Ga0070664_100355394 | Ga0070664_1003553941 | 229 |
| 484 | 3300005577 | Ga0068857_100015743 | Ga0068857_1000157433 | 229 |
| 485 | 3300005577 | Ga0068857_100018827 | Ga0068857_1000188274 | 229 |
| 486 | 3300005577 | Ga0068857_100078820 | Ga0068857_1000788202 | 229 |
| 487 | 3300005577 | Ga0068857_100201187 | Ga0068857_1002011873 | 229 |
| 488 | 3300005577 | Ga0068857_100313399 | Ga0068857_1003133992 | 229 |
| 489 | 3300005578 | Ga0068854_100033336 | Ga0068854_1000333362 | 229 |
| 490 | 3300005578 | Ga0068854_100080740 | Ga0068854_1000807402 | 229 |
| 491 | 3300005614 | Ga0068856_100000283 | Ga0068856_10000028320 | 229 |
| 492 | 3300005614 | Ga0068856_100016740 | Ga0068856_1000167403 | 229 |
| 493 | 3300005614 | Ga0068856_100019887 | Ga0068856_1000198874 | 229 |
| 494 | 3300005614 | Ga0068856_100108039 | Ga0068856_1001080391 | 229 |
| 495 | 3300005614 | Ga0068856_100116988 | Ga0068856_1001169882 | 229 |
| 496 | 3300005614 | Ga0068856_100440823 | Ga0068856_1004408232 | 229 |
| 497 | 3300005615 | Ga0070702_100003746 | Ga0070702_1000037465 | 229 |
| 498 | 3300005615 | Ga0070702_100147855 | Ga0070702_1001478552 | 229 |
| 499 | 3300005615 | Ga0070702_100457246 | Ga0070702_1004572461 | 229 |
| 500 | 3300005616 | Ga0068852_100007805 | Ga0068852_1000078055 | 229 |
| 501 | 3300005616 | Ga0068852_100058756 | Ga0068852_1000587563 | 229 |
| 502 | 3300005616 | Ga0068852_100070295 | Ga0068852_1000702951 | 229 |
| 503 | 3300005617 | Ga0068859_101056914 | Ga0068859_1010569142 | 229 |
| 504 | 3300005618 | Ga0068864_100032278 | Ga0068864_1000322781 | 229 |
| 505 | 3300005618 | Ga0068864_100215062 | Ga0068864_1002150622 | 229 |
| 506 | 3300005718 | Ga0068866_10018909 | Ga0068866_100189093 | 229 |
| 507 | 3300005718 | Ga0068866_10028659 | Ga0068866_100286591 | 229 |
| 508 | 3300005719 | Ga0068861_100026034 | Ga0068861_1000260345 | 229 |
| 509 | 3300005719 | Ga0068861_100033280 | Ga0068861_1000332803 | 229 |
| 510 | 3300005719 | Ga0068861_100154774 | Ga0068861_1001547742 | 229 |
| 511 | 3300005719 | Ga0068861_100246718 | Ga0068861_1002467182 | 229 |
| 512 | 3300005834 | Ga0068851_10004060 | Ga0068851_100040602 | 229 |
| 513 | 3300005834 | Ga0068851_10074104 | Ga0068851_100741043 | 229 |
| 514 | 3300005840 | Ga0068870_10219054 | Ga0068870_102190542 | 229 |
| 515 | 3300005841 | Ga0068863_100004189 | Ga0068863_10000418915 | 229 |
| 516 | 3300005841 | Ga0068863_100127752 | Ga0068863_1001277523 | 229 |
| 517 | 3300005841 | Ga0068863_100314107 | Ga0068863_1003141072 | 229 |
| 518 | 3300005842 | Ga0068858_100009007 | Ga0068858_1000090078 | 229 |
| 519 | 3300005842 | Ga0068858_100070599 | Ga0068858_1000705994 | 229 |
| 520 | 3300005842 | Ga0068858_100134948 | Ga0068858_1001349482 | 229 |
| 521 | 3300005842 | Ga0068858_100172454 | Ga0068858_1001724543 | 229 |
| 522 | 3300005843 | Ga0068860_100000277 | Ga0068860_10000027743 | 229 |
| 523 | 3300005843 | Ga0068860_100011349 | Ga0068860_1000113497 | 229 |
| 524 | 3300005843 | Ga0068860_100011762 | Ga0068860_1000117623 | 229 |
| 525 | 3300005843 | Ga0068860_100453402 | Ga0068860_1004534022 | 229 |
| 526 | 3300005843 | Ga0068860_101128785 | Ga0068860_1011287852 | 229 |
| 527 | 3300005844 | Ga0068862_100048501 | Ga0068862_1000485012 | 229 |
| 528 | 3300005844 | Ga0068862_100136558 | Ga0068862_1001365582 | 229 |
| 529 | 3300005844 | Ga0068862_100224886 | Ga0068862_1002248862 | 229 |
| 530 | 3300005844 | Ga0068862_100405335 | Ga0068862_1004053352 | 229 |
| 531 | 3300005937 | Ga0081455_10001198 | Ga0081455_1000119816 | 229 |
| 532 | 3300005937 | Ga0081455_10006252 | Ga0081455_100062524 | 229 |
| 533 | 3300005937 | Ga0081455_10009461 | Ga0081455_100094613 | 229 |
| 534 | 3300005937 | Ga0081455_10033325 | Ga0081455_100333252 | 229 |
| 535 | 3300005937 | Ga0081455_10040150 | Ga0081455_100401503 | 229 |
| 536 | 3300005981 | Ga0081538_10102094 | Ga0081538_101020942 | 229 |
| 537 | 3300005983 | Ga0081540_1001897 | Ga0081540_100189720 | 229 |
| 538 | 3300005983 | Ga0081540_1006855 | Ga0081540_10068552 | 229 |
| 539 | 3300005983 | Ga0081540_1011371 | Ga0081540_10113712 | 229 |
| 540 | 3300005983 | Ga0081540_1013165 | Ga0081540_10131655 | 229 |
| 541 | 3300005983 | Ga0081540_1013298 | Ga0081540_10132986 | 229 |
| 542 | 3300005983 | Ga0081540_1017054 | Ga0081540_10170543 | 229 |
| 543 | 3300005983 | Ga0081540_1017569 | Ga0081540_10175692 | 229 |
| 544 | 3300005983 | Ga0081540_1022061 | Ga0081540_10220612 | 229 |
| 545 | 3300005983 | Ga0081540_1024332 | Ga0081540_10243322 | 229 |
| 546 | 3300005983 | Ga0081540_1026873 | Ga0081540_10268732 | 229 |
| 547 | 3300005983 | Ga0081540_1037549 | Ga0081540_10375492 | 229 |
| 548 | 3300005983 | Ga0081540_1048742 | Ga0081540_10487422 | 229 |
| 549 | 3300005983 | Ga0081540_1078281 | Ga0081540_10782813 | 229 |
| 550 | 3300005985 | Ga0081539_10000008 | Ga0081539_10000008316 | 229 |
| 551 | 3300005985 | Ga0081539_10026336 | Ga0081539_100263363 | 229 |
| 552 | 3300006028 | Ga0070717_10001012 | Ga0070717_100010125 | 229 |
| 553 | 3300006028 | Ga0070717_10010060 | Ga0070717_100100605 | 229 |
| 554 | 3300006038 | Ga0075365_10011472 | Ga0075365_100114723 | 229 |
| 555 | 3300006038 | Ga0075365_10068152 | Ga0075365_100681522 | 229 |
| 556 | 3300006038 | Ga0075365_10075092 | Ga0075365_100750922 | 229 |
| 557 | 3300006038 | Ga0075365_10202852 | Ga0075365_102028522 | 229 |
| 558 | 3300006038 | Ga0075365_10302718 | Ga0075365_103027182 | 229 |
| 559 | 3300006038 | Ga0075365_10378499 | Ga0075365_103784992 | 229 |
| 560 | 3300006038 | Ga0075365_10477743 | Ga0075365_104777432 | 229 |
| 561 | 3300006042 | Ga0075368_10002893 | Ga0075368_100028932 | 229 |
| 562 | 3300006042 | Ga0075368_10003317 | Ga0075368_100033173 | 229 |
| 563 | 3300006042 | Ga0075368_10109116 | Ga0075368_101091162 | 229 |
| 564 | 3300006042 | Ga0075368_10115520 | Ga0075368_101155202 | 229 |
| 565 | 3300006048 | Ga0075363_100001432 | Ga0075363_1000014329 | 229 |
| 566 | 3300006048 | Ga0075363_100137520 | Ga0075363_1001375202 | 229 |
| 567 | 3300006048 | Ga0075363_100137628 | Ga0075363_1001376282 | 229 |
| 568 | 3300006051 | Ga0075364_10038662 | Ga0075364_100386622 | 229 |
| 569 | 3300006051 | Ga0075364_10045249 | Ga0075364_100452492 | 229 |
| 570 | 3300006051 | Ga0075364_10065307 | Ga0075364_100653073 | 229 |
| 571 | 3300006051 | Ga0075364_10087272 | Ga0075364_100872722 | 229 |
| 572 | 3300006058 | Ga0075432_10037184 | Ga0075432_100371843 | 229 |
| 573 | 3300006163 | Ga0070715_10005928 | Ga0070715_100059286 | 229 |
| 574 | 3300006173 | Ga0070716_100017256 | Ga0070716_1000172565 | 229 |
| 575 | 3300006173 | Ga0070716_100036955 | Ga0070716_1000369552 | 229 |
| 576 | 3300006173 | Ga0070716_100194084 | Ga0070716_1001940842 | 229 |
| 577 | 3300006173 | Ga0070716_100247470 | Ga0070716_1002474702 | 229 |
| 578 | 3300006173 | Ga0070716_100356971 | Ga0070716_1003569711 | 229 |
| 579 | 3300006175 | Ga0070712_100019838 | Ga0070712_1000198382 | 229 |
| 580 | 3300006175 | Ga0070712_100049077 | Ga0070712_1000490774 | 229 |
| 581 | 3300006175 | Ga0070712_100056553 | Ga0070712_1000565533 | 229 |
| 582 | 3300006175 | Ga0070712_100058516 | Ga0070712_1000585162 | 229 |
| 583 | 3300006175 | Ga0070712_100158392 | Ga0070712_1001583922 | 229 |
| 584 | 3300006175 | Ga0070712_100172222 | Ga0070712_1001722222 | 229 |
| 585 | 3300006175 | Ga0070712_100273710 | Ga0070712_1002737102 | 229 |
| 586 | 3300006177 | Ga0075362_10050918 | Ga0075362_100509183 | 229 |
| 587 | 3300006178 | Ga0075367_10031390 | Ga0075367_100313902 | 229 |
| 588 | 3300006178 | Ga0075367_10079801 | Ga0075367_100798012 | 229 |
| 589 | 3300006186 | Ga0075369_10061911 | Ga0075369_100619112 | 229 |
| 590 | 3300006195 | Ga0075366_10116073 | Ga0075366_101160732 | 229 |
| 591 | 3300006237 | Ga0097621_100166536 | Ga0097621_1001665363 | 229 |
| 592 | 3300006237 | Ga0097621_100757703 | Ga0097621_1007577032 | 229 |
| 593 | 3300006353 | Ga0075370_10002046 | Ga0075370_100020466 | 229 |
| 594 | 3300006353 | Ga0075370_10020184 | Ga0075370_100201842 | 229 |
| 595 | 3300006353 | Ga0075370_10059641 | Ga0075370_100596412 | 229 |
| 596 | 3300006353 | Ga0075370_10099673 | Ga0075370_100996732 | 229 |
| 597 | 3300006358 | Ga0068871_100110201 | Ga0068871_1001102012 | 229 |
| 598 | 3300006358 | Ga0068871_100396995 | Ga0068871_1003969952 | 229 |
| 599 | 3300006844 | Ga0075428_100054152 | Ga0075428_1000541523 | 229 |
| 600 | 3300006844 | Ga0075428_100200750 | Ga0075428_1002007502 | 229 |
| 601 | 3300006847 | Ga0075431_100171833 | Ga0075431_1001718332 | 229 |
| 602 | 3300006852 | Ga0075433_10020386 | Ga0075433_100203865 | 229 |
| 603 | 3300006852 | Ga0075433_10056224 | Ga0075433_100562246 | 229 |
| 604 | 3300006852 | Ga0075433_10207995 | Ga0075433_102079953 | 229 |
| 605 | 3300006871 | Ga0075434_100007502 | Ga0075434_1000075024 | 229 |
| 606 | 3300006871 | Ga0075434_100043273 | Ga0075434_1000432733 | 229 |
| 607 | 3300006871 | Ga0075434_100128231 | Ga0075434_1001282312 | 229 |
| 608 | 3300006880 | Ga0075429_100197702 | Ga0075429_1001977023 | 229 |
| 609 | 3300006880 | Ga0075429_100200317 | Ga0075429_1002003172 | 229 |
| 610 | 3300006881 | Ga0068865_100023292 | Ga0068865_1000232922 | 229 |
| 611 | 3300006914 | Ga0075436_100022603 | Ga0075436_1000226033 | 229 |
| 612 | 3300006914 | Ga0075436_100064703 | Ga0075436_1000647033 | 229 |
| 613 | 3300006914 | Ga0075436_100174825 | Ga0075436_1001748253 | 229 |
| 614 | 3300006931 | Ga0097620_101056928 | Ga0097620_1010569282 | 229 |
| 615 | 3300006941 | Ga0099825_1027090 | Ga0099825_10270902 | 229 |
| 616 | 3300006942 | Ga0099824_1014162 | Ga0099824_10141623 | 229 |
| 617 | 3300006943 | Ga0099822_1026792 | Ga0099822_10267924 | 229 |
| 618 | 3300006944 | Ga0099823_1069218 | Ga0099823_10692181 | 229 |
| 619 | 3300007076 | Ga0075435_100005822 | Ga0075435_1000058226 | 229 |
| 620 | 3300007076 | Ga0075435_100024551 | Ga0075435_1000245511 | 229 |
| 621 | 3300007265 | Ga0099794_10089180 | Ga0099794_100891802 | 229 |
| 622 | 3300007788 | Ga0099795_10003238 | Ga0099795_100032384 | 229 |
| 623 | 3300007788 | Ga0099795_10012255 | Ga0099795_100122552 | 229 |
| 624 | 3300009011 | Ga0105251_10027724 | Ga0105251_100277242 | 229 |
| 625 | 3300009093 | Ga0105240_10002493 | Ga0105240_1000249319 | 229 |
| 626 | 3300009093 | Ga0105240_10018493 | Ga0105240_100184934 | 229 |
| 627 | 3300009093 | Ga0105240_10076446 | Ga0105240_100764462 | 229 |
| 628 | 3300009093 | Ga0105240_10112264 | Ga0105240_101122644 | 229 |
| 629 | 3300009093 | Ga0105240_10138714 | Ga0105240_101387141 | 229 |
| 630 | 3300009093 | Ga0105240_10323628 | Ga0105240_103236282 | 229 |
| 631 | 3300009093 | Ga0105240_10994681 | Ga0105240_109946811 | 229 |
| 632 | 3300009094 | Ga0111539_10022154 | Ga0111539_100221542 | 229 |
| 633 | 3300009094 | Ga0111539_10163929 | Ga0111539_101639292 | 229 |
| 634 | 3300009094 | Ga0111539_10181011 | Ga0111539_101810112 | 229 |
| 635 | 3300009094 | Ga0111539_10986493 | Ga0111539_109864931 | 229 |
| 636 | 3300009098 | Ga0105245_10003690 | Ga0105245_100036904 | 229 |
| 637 | 3300009098 | Ga0105245_10044517 | Ga0105245_100445172 | 229 |
| 638 | 3300009098 | Ga0105245_10129266 | Ga0105245_101292662 | 229 |
| 639 | 3300009098 | Ga0105245_10479406 | Ga0105245_104794061 | 229 |
| 640 | 3300009098 | Ga0105245_10487885 | Ga0105245_104878851 | 229 |
| 641 | 3300009098 | Ga0105245_10610366 | Ga0105245_106103661 | 229 |
| 642 | 3300009101 | Ga0105247_10017053 | Ga0105247_100170534 | 229 |
| 643 | 3300009101 | Ga0105247_10041233 | Ga0105247_100412332 | 229 |
| 644 | 3300009101 | Ga0105247_10202315 | Ga0105247_102023151 | 229 |
| 645 | 3300009147 | Ga0114129_10027872 | Ga0114129_100278722 | 229 |
| 646 | 3300009147 | Ga0114129_10306143 | Ga0114129_103061432 | 229 |
| 647 | 3300009147 | Ga0114129_10991086 | Ga0114129_109910862 | 229 |
| 648 | 3300009148 | Ga0105243_10007991 | Ga0105243_100079913 | 229 |
| 649 | 3300009148 | Ga0105243_10074342 | Ga0105243_100743422 | 229 |
| 650 | 3300009148 | Ga0105243_10478938 | Ga0105243_104789381 | 229 |
| 651 | 3300009174 | Ga0105241_10008442 | Ga0105241_100084425 | 229 |
| 652 | 3300009174 | Ga0105241_10014774 | Ga0105241_100147743 | 229 |
| 653 | 3300009174 | Ga0105241_10017796 | Ga0105241_100177962 | 229 |
| 654 | 3300009174 | Ga0105241_10028146 | Ga0105241_100281463 | 229 |
| 655 | 3300009174 | Ga0105241_10037162 | Ga0105241_100371623 | 229 |
| 656 | 3300009174 | Ga0105241_10131302 | Ga0105241_101313022 | 229 |
| 657 | 3300009176 | Ga0105242_10015701 | Ga0105242_100157012 | 229 |
| 658 | 3300009177 | Ga0105248_10006272 | Ga0105248_100062723 | 229 |
| 659 | 3300009177 | Ga0105248_10028201 | Ga0105248_100282012 | 229 |
| 660 | 3300009177 | Ga0105248_10278629 | Ga0105248_102786292 | 229 |
| 661 | 3300009177 | Ga0105248_10472369 | Ga0105248_104723691 | 229 |
| 662 | 3300009177 | Ga0105248_10955669 | Ga0105248_109556692 | 229 |
| 663 | 3300009545 | Ga0105237_10000158 | Ga0105237_1000015866 | 229 |
| 664 | 3300009545 | Ga0105237_10014566 | Ga0105237_100145662 | 229 |
| 665 | 3300009545 | Ga0105237_10017088 | Ga0105237_100170884 | 229 |
| 666 | 3300009545 | Ga0105237_10084146 | Ga0105237_100841462 | 229 |
| 667 | 3300009545 | Ga0105237_10112758 | Ga0105237_101127584 | 229 |
| 668 | 3300009545 | Ga0105237_10149127 | Ga0105237_101491272 | 229 |
| 669 | 3300009545 | Ga0105237_10284630 | Ga0105237_102846302 | 229 |
| 670 | 3300009551 | Ga0105238_10012869 | Ga0105238_100128692 | 229 |
| 671 | 3300009551 | Ga0105238_10023571 | Ga0105238_100235712 | 229 |
| 672 | 3300009551 | Ga0105238_10061525 | Ga0105238_100615252 | 229 |
| 673 | 3300009551 | Ga0105238_10061908 | Ga0105238_100619082 | 229 |
| 674 | 3300009551 | Ga0105238_10089704 | Ga0105238_100897043 | 229 |
| 675 | 3300009551 | Ga0105238_10104562 | Ga0105238_101045623 | 229 |
| 676 | 3300009551 | Ga0105238_10309131 | Ga0105238_103091312 | 229 |
| 677 | 3300009551 | Ga0105238_10312311 | Ga0105238_103123112 | 229 |
| 678 | 3300009551 | Ga0105238_10530343 | Ga0105238_105303431 | 229 |
| 679 | 3300009553 | Ga0105249_10055328 | Ga0105249_100553283 | 229 |
| 680 | 3300009553 | Ga0105249_10234844 | Ga0105249_102348442 | 229 |
| 681 | 3300009553 | Ga0105249_11291472 | Ga0105249_112914721 | 229 |
| 682 | 3300009553 | Ga0105249_11364000 | Ga0105249_113640001 | 229 |
| 683 | 3300010159 | Ga0099796_10020712 | Ga0099796_100207123 | 229 |
| 684 | 3300010159 | Ga0099796_10022780 | Ga0099796_100227803 | 229 |
| 685 | 3300010159 | Ga0099796_10029557 | Ga0099796_100295572 | 229 |
| 686 | 3300010159 | Ga0099796_10041469 | Ga0099796_100414692 | 229 |
| 687 | 3300010159 | Ga0099796_10066536 | Ga0099796_100665362 | 229 |
| 688 | 3300010375 | Ga0105239_10004277 | Ga0105239_1000427712 | 229 |
| 689 | 3300010375 | Ga0105239_10005523 | Ga0105239_100055234 | 229 |
| 690 | 3300010375 | Ga0105239_10095874 | Ga0105239_100958742 | 229 |
| 691 | 3300010375 | Ga0105239_10118537 | Ga0105239_101185371 | 229 |
| 692 | 3300010375 | Ga0105239_10134899 | Ga0105239_101348992 | 229 |
| 693 | 3300010375 | Ga0105239_10175383 | Ga0105239_101753832 | 229 |
| 694 | 3300010375 | Ga0105239_11389529 | Ga0105239_113895291 | 229 |
| 695 | 3300011119 | Ga0105246_10007614 | Ga0105246_100076144 | 229 |
| 696 | 3300011119 | Ga0105246_10194715 | Ga0105246_101947153 | 229 |
| 697 | 3300013100 | Ga0157373_10133973 | Ga0157373_101339733 | 229 |
| 698 | 3300013102 | Ga0157371_10105376 | Ga0157371_101053763 | 229 |
| 699 | 3300013102 | Ga0157371_10496883 | Ga0157371_104968831 | 229 |
| 700 | 3300013104 | Ga0157370_10093144 | Ga0157370_100931443 | 229 |
| 701 | 3300013104 | Ga0157370_10287409 | Ga0157370_102874093 | 229 |
| 702 | 3300013105 | Ga0157369_10005514 | Ga0157369_1000551412 | 229 |
| 703 | 3300013105 | Ga0157369_10006035 | Ga0157369_100060354 | 229 |
| 704 | 3300013105 | Ga0157369_10031238 | Ga0157369_100312384 | 229 |
| 705 | 3300013296 | Ga0157374_10057878 | Ga0157374_100578782 | 229 |
| 706 | 3300013296 | Ga0157374_10590525 | Ga0157374_105905251 | 229 |
| 707 | 3300013297 | Ga0157378_10018416 | Ga0157378_100184164 | 229 |
| 708 | 3300013297 | Ga0157378_10115012 | Ga0157378_101150123 | 229 |
| 709 | 3300013297 | Ga0157378_10390418 | Ga0157378_103904182 | 229 |
| 710 | 3300013306 | Ga0163162_10051849 | Ga0163162_100518494 | 229 |
| 711 | 3300013306 | Ga0163162_10112846 | Ga0163162_101128462 | 229 |
| 712 | 3300013306 | Ga0163162_10199564 | Ga0163162_101995642 | 229 |
| 713 | 3300013306 | Ga0163162_10273004 | Ga0163162_102730042 | 229 |
| 714 | 3300013306 | Ga0163162_10439138 | Ga0163162_104391382 | 229 |
| 715 | 3300013307 | Ga0157372_10035289 | Ga0157372_100352893 | 229 |
| 716 | 3300013307 | Ga0157372_10088052 | Ga0157372_100880522 | 229 |
| 717 | 3300013307 | Ga0157372_10147696 | Ga0157372_101476963 | 229 |
| 718 | 3300013308 | Ga0157375_10044735 | Ga0157375_100447353 | 229 |
| 719 | 3300013308 | Ga0157375_10072217 | Ga0157375_100722174 | 229 |
| 720 | 3300013308 | Ga0157375_10107146 | Ga0157375_101071462 | 229 |
| 721 | 3300013308 | Ga0157375_10130039 | Ga0157375_101300394 | 229 |
| 722 | 3300014325 | Ga0163163_10044996 | Ga0163163_100449963 | 229 |
| 723 | 3300014325 | Ga0163163_10189978 | Ga0163163_101899782 | 229 |
| 724 | 3300014325 | Ga0163163_10607446 | Ga0163163_106074462 | 229 |
| 725 | 3300014325 | Ga0163163_10829088 | Ga0163163_108290882 | 229 |
| 726 | 3300014326 | Ga0157380_10009706 | Ga0157380_100097064 | 229 |
| 727 | 3300014326 | Ga0157380_10030387 | Ga0157380_100303873 | 229 |
| 728 | 3300014326 | Ga0157380_10169597 | Ga0157380_101695972 | 229 |
| 729 | 3300014326 | Ga0157380_10414811 | Ga0157380_104148112 | 229 |
| 730 | 3300014745 | Ga0157377_10004423 | Ga0157377_100044234 | 229 |
| 731 | 3300014745 | Ga0157377_10141918 | Ga0157377_101419183 | 229 |
| 732 | 3300014745 | Ga0157377_10527478 | Ga0157377_105274781 | 229 |
| 733 | 3300014968 | Ga0157379_10009402 | Ga0157379_100094024 | 229 |
| 734 | 3300014968 | Ga0157379_10103657 | Ga0157379_101036572 | 229 |
| 735 | 3300014968 | Ga0157379_10195701 | Ga0157379_101957012 | 229 |
| 736 | 3300014968 | Ga0157379_10221610 | Ga0157379_102216102 | 229 |
| 737 | 3300014968 | Ga0157379_10248252 | Ga0157379_102482522 | 229 |
| 738 | 3300014968 | Ga0157379_10313215 | Ga0157379_103132151 | 229 |
| 739 | 3300014969 | Ga0157376_10012280 | Ga0157376_100122804 | 229 |
| 740 | 3300014969 | Ga0157376_10046154 | Ga0157376_100461542 | 229 |
| 741 | 3300014969 | Ga0157376_10240131 | Ga0157376_102401312 | 229 |
| 742 | 3300014969 | Ga0157376_10351916 | Ga0157376_103519163 | 229 |
| 743 | 3300017792 | Ga0163161_10003814 | Ga0163161_100038144 | 229 |
| 744 | 3300017792 | Ga0163161_10498400 | Ga0163161_104984001 | 229 |
| 745 | 3300017792 | Ga0163161_10913063 | Ga0163161_109130631 | 229 |
| 746 | 3300021320 | Ga0214544_1000001 | Ga0214544_1000001161 | 229 |
| 747 | 3300021320 | Ga0214544_1036392 | Ga0214544_10363922 | 229 |
| 748 | 3300021321 | Ga0214542_1000005 | Ga0214542_1000005161 | 229 |
| 749 | 3300021324 | Ga0214545_1000003 | Ga0214545_1000003603 | 229 |
| 750 | 3300021324 | Ga0214545_1038911 | Ga0214545_10389112 | 229 |
| 751 | 3300021327 | Ga0214543_1000002 | Ga0214543_1000002162 | 229 |
| 752 | 3300021361 | Ga0213872_10114627 | Ga0213872_101146273 | 229 |
| 753 | 3300021377 | Ga0213874_10070496 | Ga0213874_100704962 | 229 |
| 754 | 3300021377 | Ga0213874_10145707 | Ga0213874_101457071 | 229 |
| 755 | 3300021384 | Ga0213876_10123851 | Ga0213876_101238512 | 229 |
| 756 | 3300021384 | Ga0213876_10132489 | Ga0213876_101324892 | 229 |
| 757 | 3300021384 | Ga0213876_10227595 | Ga0213876_102275952 | 229 |
| 758 | 3300021388 | Ga0213875_10000169 | Ga0213875_100001694 | 229 |
| 759 | 3300021388 | Ga0213875_10232200 | Ga0213875_102322002 | 229 |
| 760 | 3300021441 | Ga0213871_10107958 | Ga0213871_101079581 | 229 |
| 761 | 3300025230 | Ga0209563_102014 | Ga0209563_1020142 | 229 |
| 762 | 3300025245 | Ga0207425_1021752 | Ga0207425_10217522 | 229 |
| 763 | 3300025253 | Ga0209677_100668 | Ga0209677_10066811 | 229 |
| 764 | 3300025253 | Ga0209677_104813 | Ga0209677_1048133 | 229 |
| 765 | 3300025254 | Ga0209148_1000849 | Ga0209148_100084920 | 229 |
| 766 | 3300025261 | Ga0209233_1001267 | Ga0209233_10012672 | 229 |
| 767 | 3300025261 | Ga0209233_1005558 | Ga0209233_10055584 | 229 |
| 768 | 3300025261 | Ga0209233_1007348 | Ga0209233_10073482 | 229 |
| 769 | 3300025272 | Ga0209455_1003309 | Ga0209455_10033092 | 229 |
| 770 | 3300025295 | Ga0209564_1000838 | Ga0209564_100083836 | 229 |
| 771 | 3300025295 | Ga0209564_1004046 | Ga0209564_10040466 | 229 |
| 772 | 3300025297 | Ga0209758_1000026 | Ga0209758_1000026159 | 229 |
| 773 | 3300025297 | Ga0209758_1000526 | Ga0209758_10005261 | 229 |
| 774 | 3300025297 | Ga0209758_1004341 | Ga0209758_10043413 | 229 |
| 775 | 3300025297 | Ga0209758_1007841 | Ga0209758_10078416 | 229 |
| 776 | 3300025297 | Ga0209758_1008754 | Ga0209758_10087544 | 229 |
| 777 | 3300025297 | Ga0209758_1014582 | Ga0209758_10145822 | 229 |
| 778 | 3300025297 | Ga0209758_1023615 | Ga0209758_10236152 | 229 |
| 779 | 3300025297 | Ga0209758_1080571 | Ga0209758_10805712 | 229 |
| 780 | 3300025299 | Ga0209256_1005563 | Ga0209256_10055636 | 229 |
| 781 | 3300025299 | Ga0209256_1042573 | Ga0209256_10425732 | 229 |
| 782 | 3300025302 | Ga0207426_1000213 | Ga0207426_1000213109 | 229 |
| 783 | 3300025302 | Ga0207426_1000740 | Ga0207426_100074021 | 229 |
| 784 | 3300025302 | Ga0207426_1031908 | Ga0207426_10319082 | 229 |
| 785 | 3300025303 | Ga0209051_1041983 | Ga0209051_10419831 | 229 |
| 786 | 3300025304 | Ga0209257_1000930 | Ga0209257_10009309 | 229 |
| 787 | 3300025304 | Ga0209257_1029117 | Ga0209257_10291172 | 229 |
| 788 | 3300025315 | Ga0207697_10014409 | Ga0207697_100144093 | 229 |
| 789 | 3300025315 | Ga0207697_10014551 | Ga0207697_100145512 | 229 |
| 790 | 3300025321 | Ga0207656_10004418 | Ga0207656_100044184 | 229 |
| 791 | 3300025321 | Ga0207656_10038504 | Ga0207656_100385042 | 229 |
| 792 | 3300025898 | Ga0207692_10001730 | Ga0207692_100017302 | 229 |
| 793 | 3300025898 | Ga0207692_10019163 | Ga0207692_100191632 | 229 |
| 794 | 3300025898 | Ga0207692_10030253 | Ga0207692_100302532 | 229 |
| 795 | 3300025898 | Ga0207692_10120850 | Ga0207692_101208502 | 229 |
| 796 | 3300025898 | Ga0207692_10309668 | Ga0207692_103096682 | 229 |
| 797 | 3300025899 | Ga0207642_10039675 | Ga0207642_100396753 | 229 |
| 798 | 3300025900 | Ga0207710_10013544 | Ga0207710_100135442 | 229 |
| 799 | 3300025901 | Ga0207688_10001376 | Ga0207688_1000137610 | 229 |
| 800 | 3300025901 | Ga0207688_10020870 | Ga0207688_100208704 | 229 |
| 801 | 3300025901 | Ga0207688_10027816 | Ga0207688_100278162 | 229 |
| 802 | 3300025903 | Ga0207680_10082252 | Ga0207680_100822522 | 229 |
| 803 | 3300025903 | Ga0207680_10219512 | Ga0207680_102195122 | 229 |
| 804 | 3300025903 | Ga0207680_10240409 | Ga0207680_102404091 | 229 |
| 805 | 3300025904 | Ga0207647_10034918 | Ga0207647_100349182 | 229 |
| 806 | 3300025904 | Ga0207647_10036146 | Ga0207647_100361463 | 229 |
| 807 | 3300025904 | Ga0207647_10149147 | Ga0207647_101491472 | 229 |
| 808 | 3300025905 | Ga0207685_10165438 | Ga0207685_101654382 | 229 |
| 809 | 3300025906 | Ga0207699_10004047 | Ga0207699_100040473 | 229 |
| 810 | 3300025906 | Ga0207699_10007087 | Ga0207699_100070874 | 229 |
| 811 | 3300025906 | Ga0207699_10007801 | Ga0207699_100078014 | 229 |
| 812 | 3300025906 | Ga0207699_10039662 | Ga0207699_100396623 | 229 |
| 813 | 3300025906 | Ga0207699_10115493 | Ga0207699_101154933 | 229 |
| 814 | 3300025906 | Ga0207699_10346594 | Ga0207699_103465942 | 229 |
| 815 | 3300025907 | Ga0207645_10007649 | Ga0207645_100076495 | 229 |
| 816 | 3300025907 | Ga0207645_10167889 | Ga0207645_101678892 | 229 |
| 817 | 3300025908 | Ga0207643_10058362 | Ga0207643_100583623 | 229 |
| 818 | 3300025908 | Ga0207643_10060125 | Ga0207643_100601253 | 229 |
| 819 | 3300025909 | Ga0207705_10070043 | Ga0207705_100700432 | 229 |
| 820 | 3300025909 | Ga0207705_10076917 | Ga0207705_100769172 | 229 |
| 821 | 3300025909 | Ga0207705_10227212 | Ga0207705_102272121 | 229 |
| 822 | 3300025909 | Ga0207705_10273456 | Ga0207705_102734562 | 229 |
| 823 | 3300025910 | Ga0207684_10231370 | Ga0207684_102313702 | 229 |
| 824 | 3300025911 | Ga0207654_10000520 | Ga0207654_1000052014 | 229 |
| 825 | 3300025911 | Ga0207654_10005608 | Ga0207654_100056081 | 229 |
| 826 | 3300025911 | Ga0207654_10008634 | Ga0207654_100086346 | 229 |
| 827 | 3300025911 | Ga0207654_10087088 | Ga0207654_100870882 | 229 |
| 828 | 3300025911 | Ga0207654_10154902 | Ga0207654_101549022 | 229 |
| 829 | 3300025912 | Ga0207707_10001782 | Ga0207707_100017825 | 229 |
| 830 | 3300025912 | Ga0207707_10014876 | Ga0207707_100148764 | 229 |
| 831 | 3300025912 | Ga0207707_10018060 | Ga0207707_100180604 | 229 |
| 832 | 3300025912 | Ga0207707_10139197 | Ga0207707_101391973 | 229 |
| 833 | 3300025912 | Ga0207707_10232309 | Ga0207707_102323092 | 229 |
| 834 | 3300025912 | Ga0207707_10273202 | Ga0207707_102732021 | 229 |
| 835 | 3300025913 | Ga0207695_10000006 | Ga0207695_100000061028 | 229 |
| 836 | 3300025913 | Ga0207695_10000325 | Ga0207695_100003259 | 229 |
| 837 | 3300025913 | Ga0207695_10025997 | Ga0207695_100259971 | 229 |
| 838 | 3300025913 | Ga0207695_10100090 | Ga0207695_101000903 | 229 |
| 839 | 3300025913 | Ga0207695_10129580 | Ga0207695_101295802 | 229 |
| 840 | 3300025913 | Ga0207695_10157380 | Ga0207695_101573802 | 229 |
| 841 | 3300025913 | Ga0207695_10363625 | Ga0207695_103636252 | 229 |
| 842 | 3300025914 | Ga0207671_10000774 | Ga0207671_1000077419 | 229 |
| 843 | 3300025914 | Ga0207671_10000795 | Ga0207671_1000079521 | 229 |
| 844 | 3300025914 | Ga0207671_10127294 | Ga0207671_101272942 | 229 |
| 845 | 3300025914 | Ga0207671_10190146 | Ga0207671_101901462 | 229 |
| 846 | 3300025915 | Ga0207693_10002301 | Ga0207693_1000230114 | 229 |
| 847 | 3300025915 | Ga0207693_10010463 | Ga0207693_100104639 | 229 |
| 848 | 3300025915 | Ga0207693_10025020 | Ga0207693_100250202 | 229 |
| 849 | 3300025915 | Ga0207693_10026610 | Ga0207693_100266102 | 229 |
| 850 | 3300025915 | Ga0207693_10027516 | Ga0207693_100275164 | 229 |
| 851 | 3300025915 | Ga0207693_10074778 | Ga0207693_100747782 | 229 |
| 852 | 3300025915 | Ga0207693_10092862 | Ga0207693_100928622 | 229 |
| 853 | 3300025915 | Ga0207693_10312758 | Ga0207693_103127581 | 229 |
| 854 | 3300025916 | Ga0207663_10001398 | Ga0207663_100013988 | 229 |
| 855 | 3300025916 | Ga0207663_10033830 | Ga0207663_100338302 | 229 |
| 856 | 3300025916 | Ga0207663_10839981 | Ga0207663_108399811 | 229 |
| 857 | 3300025917 | Ga0207660_10040098 | Ga0207660_100400982 | 229 |
| 858 | 3300025917 | Ga0207660_10074429 | Ga0207660_100744292 | 229 |
| 859 | 3300025917 | Ga0207660_10095719 | Ga0207660_100957191 | 229 |
| 860 | 3300025917 | Ga0207660_10422132 | Ga0207660_104221322 | 229 |
| 861 | 3300025918 | Ga0207662_10002382 | Ga0207662_100023826 | 229 |
| 862 | 3300025918 | Ga0207662_10135675 | Ga0207662_101356752 | 229 |
| 863 | 3300025919 | Ga0207657_10014812 | Ga0207657_100148124 | 229 |
| 864 | 3300025919 | Ga0207657_10038095 | Ga0207657_100380951 | 229 |
| 865 | 3300025920 | Ga0207649_10058366 | Ga0207649_100583662 | 229 |
| 866 | 3300025921 | Ga0207652_10017537 | Ga0207652_100175373 | 229 |
| 867 | 3300025921 | Ga0207652_10038942 | Ga0207652_100389422 | 229 |
| 868 | 3300025921 | Ga0207652_10072840 | Ga0207652_100728402 | 229 |
| 869 | 3300025921 | Ga0207652_10168285 | Ga0207652_101682852 | 229 |
| 870 | 3300025921 | Ga0207652_10270904 | Ga0207652_102709042 | 229 |
| 871 | 3300025923 | Ga0207681_10085563 | Ga0207681_100855632 | 229 |
| 872 | 3300025924 | Ga0207694_10000169 | Ga0207694_1000016952 | 229 |
| 873 | 3300025924 | Ga0207694_10116937 | Ga0207694_101169372 | 229 |
| 874 | 3300025924 | Ga0207694_10135820 | Ga0207694_101358201 | 229 |
| 875 | 3300025924 | Ga0207694_10175233 | Ga0207694_101752332 | 229 |
| 876 | 3300025924 | Ga0207694_10302698 | Ga0207694_103026982 | 229 |
| 877 | 3300025925 | Ga0207650_10088866 | Ga0207650_100888662 | 229 |
| 878 | 3300025926 | Ga0207659_10098341 | Ga0207659_100983412 | 229 |
| 879 | 3300025927 | Ga0207687_10011456 | Ga0207687_100114564 | 229 |
| 880 | 3300025927 | Ga0207687_10334893 | Ga0207687_103348932 | 229 |
| 881 | 3300025928 | Ga0207700_10013816 | Ga0207700_100138164 | 229 |
| 882 | 3300025928 | Ga0207700_10056273 | Ga0207700_100562732 | 229 |
| 883 | 3300025928 | Ga0207700_10129734 | Ga0207700_101297343 | 229 |
| 884 | 3300025928 | Ga0207700_10503599 | Ga0207700_105035991 | 229 |
| 885 | 3300025929 | Ga0207664_10024228 | Ga0207664_100242284 | 229 |
| 886 | 3300025929 | Ga0207664_10047761 | Ga0207664_100477612 | 229 |
| 887 | 3300025929 | Ga0207664_10072404 | Ga0207664_100724043 | 229 |
| 888 | 3300025929 | Ga0207664_10116494 | Ga0207664_101164944 | 229 |
| 889 | 3300025929 | Ga0207664_10191013 | Ga0207664_101910131 | 229 |
| 890 | 3300025929 | Ga0207664_10223666 | Ga0207664_102236662 | 229 |
| 891 | 3300025929 | Ga0207664_10374751 | Ga0207664_103747511 | 229 |
| 892 | 3300025929 | Ga0207664_10389935 | Ga0207664_103899352 | 229 |
| 893 | 3300025929 | Ga0207664_10443709 | Ga0207664_104437092 | 229 |
| 894 | 3300025931 | Ga0207644_10176821 | Ga0207644_101768212 | 229 |
| 895 | 3300025931 | Ga0207644_10681172 | Ga0207644_106811722 | 229 |
| 896 | 3300025932 | Ga0207690_10065840 | Ga0207690_100658403 | 229 |
| 897 | 3300025932 | Ga0207690_10446024 | Ga0207690_104460241 | 229 |
| 898 | 3300025933 | Ga0207706_10009779 | Ga0207706_100097792 | 229 |
| 899 | 3300025933 | Ga0207706_10026350 | Ga0207706_100263502 | 229 |
| 900 | 3300025933 | Ga0207706_10073412 | Ga0207706_100734121 | 229 |
| 901 | 3300025934 | Ga0207686_10043900 | Ga0207686_100439002 | 229 |
| 902 | 3300025934 | Ga0207686_10306571 | Ga0207686_103065712 | 229 |
| 903 | 3300025935 | Ga0207709_10067640 | Ga0207709_100676402 | 229 |
| 904 | 3300025936 | Ga0207670_10075638 | Ga0207670_100756383 | 229 |
| 905 | 3300025936 | Ga0207670_10134670 | Ga0207670_101346702 | 229 |
| 906 | 3300025936 | Ga0207670_10517012 | Ga0207670_105170122 | 229 |
| 907 | 3300025937 | Ga0207669_10008972 | Ga0207669_100089724 | 229 |
| 908 | 3300025937 | Ga0207669_10110858 | Ga0207669_101108582 | 229 |
| 909 | 3300025938 | Ga0207704_10017120 | Ga0207704_100171204 | 229 |
| 910 | 3300025938 | Ga0207704_10190233 | Ga0207704_101902332 | 229 |
| 911 | 3300025939 | Ga0207665_10001960 | Ga0207665_1000196011 | 229 |
| 912 | 3300025939 | Ga0207665_10002091 | Ga0207665_100020919 | 229 |
| 913 | 3300025939 | Ga0207665_10058036 | Ga0207665_100580362 | 229 |
| 914 | 3300025939 | Ga0207665_10186683 | Ga0207665_101866832 | 229 |
| 915 | 3300025939 | Ga0207665_10280090 | Ga0207665_102800902 | 229 |
| 916 | 3300025939 | Ga0207665_10304482 | Ga0207665_103044821 | 229 |
| 917 | 3300025939 | Ga0207665_10517061 | Ga0207665_105170612 | 229 |
| 918 | 3300025940 | Ga0207691_10029337 | Ga0207691_100293374 | 229 |
| 919 | 3300025940 | Ga0207691_10636162 | Ga0207691_106361622 | 229 |
| 920 | 3300025941 | Ga0207711_10053200 | Ga0207711_100532004 | 229 |
| 921 | 3300025941 | Ga0207711_10130445 | Ga0207711_101304452 | 229 |
| 922 | 3300025941 | Ga0207711_10530638 | Ga0207711_105306382 | 229 |
| 923 | 3300025941 | Ga0207711_10810180 | Ga0207711_108101801 | 229 |
| 924 | 3300025942 | Ga0207689_10035700 | Ga0207689_100357002 | 229 |
| 925 | 3300025942 | Ga0207689_10089402 | Ga0207689_100894022 | 229 |
| 926 | 3300025942 | Ga0207689_10116089 | Ga0207689_101160892 | 229 |
| 927 | 3300025944 | Ga0207661_10000190 | Ga0207661_1000019040 | 229 |
| 928 | 3300025944 | Ga0207661_10018201 | Ga0207661_100182012 | 229 |
| 929 | 3300025944 | Ga0207661_10107163 | Ga0207661_101071634 | 229 |
| 930 | 3300025944 | Ga0207661_10225636 | Ga0207661_102256362 | 229 |
| 931 | 3300025944 | Ga0207661_10373666 | Ga0207661_103736661 | 229 |
| 932 | 3300025945 | Ga0207679_10074708 | Ga0207679_100747082 | 229 |
| 933 | 3300025945 | Ga0207679_10249152 | Ga0207679_102491521 | 229 |
| 934 | 3300025949 | Ga0207667_10049550 | Ga0207667_100495504 | 229 |
| 935 | 3300025949 | Ga0207667_10078315 | Ga0207667_100783152 | 229 |
| 936 | 3300025949 | Ga0207667_10164246 | Ga0207667_101642462 | 229 |
| 937 | 3300025949 | Ga0207667_10194783 | Ga0207667_101947832 | 229 |
| 938 | 3300025949 | Ga0207667_10197624 | Ga0207667_101976242 | 229 |
| 939 | 3300025949 | Ga0207667_10242544 | Ga0207667_102425441 | 229 |
| 940 | 3300025949 | Ga0207667_10286433 | Ga0207667_102864332 | 229 |
| 941 | 3300025960 | Ga0207651_10088129 | Ga0207651_100881292 | 229 |
| 942 | 3300025961 | Ga0207712_10062310 | Ga0207712_100623102 | 229 |
| 943 | 3300025961 | Ga0207712_10901890 | Ga0207712_109018901 | 229 |
| 944 | 3300025972 | Ga0207668_10022231 | Ga0207668_100222312 | 229 |
| 945 | 3300025972 | Ga0207668_10040143 | Ga0207668_100401433 | 229 |
| 946 | 3300025972 | Ga0207668_10058829 | Ga0207668_100588294 | 229 |
| 947 | 3300025972 | Ga0207668_10096133 | Ga0207668_100961332 | 229 |
| 948 | 3300025972 | Ga0207668_10167890 | Ga0207668_101678902 | 229 |
| 949 | 3300025981 | Ga0207640_10029000 | Ga0207640_100290003 | 229 |
| 950 | 3300025981 | Ga0207640_10061743 | Ga0207640_100617432 | 229 |
| 951 | 3300025981 | Ga0207640_10162056 | Ga0207640_101620562 | 229 |
| 952 | 3300025981 | Ga0207640_10166426 | Ga0207640_101664262 | 229 |
| 953 | 3300025981 | Ga0207640_10715237 | Ga0207640_107152371 | 229 |
| 954 | 3300025986 | Ga0207658_10044483 | Ga0207658_100444833 | 229 |
| 955 | 3300026023 | Ga0207677_10055045 | Ga0207677_100550453 | 229 |
| 956 | 3300026023 | Ga0207677_10086175 | Ga0207677_100861752 | 229 |
| 957 | 3300026023 | Ga0207677_10186011 | Ga0207677_101860112 | 229 |
| 958 | 3300026023 | Ga0207677_10433791 | Ga0207677_104337912 | 229 |
| 959 | 3300026035 | Ga0207703_10023501 | Ga0207703_100235012 | 229 |
| 960 | 3300026035 | Ga0207703_10045029 | Ga0207703_100450292 | 229 |
| 961 | 3300026035 | Ga0207703_10184681 | Ga0207703_101846813 | 229 |
| 962 | 3300026041 | Ga0207639_10049797 | Ga0207639_100497972 | 229 |
| 963 | 3300026041 | Ga0207639_10057758 | Ga0207639_100577582 | 229 |
| 964 | 3300026041 | Ga0207639_10174906 | Ga0207639_101749062 | 229 |
| 965 | 3300026041 | Ga0207639_10434201 | Ga0207639_104342012 | 229 |
| 966 | 3300026067 | Ga0207678_10002185 | Ga0207678_1000218512 | 229 |
| 967 | 3300026067 | Ga0207678_10020155 | Ga0207678_100201554 | 229 |
| 968 | 3300026067 | Ga0207678_10021851 | Ga0207678_100218513 | 229 |
| 969 | 3300026067 | Ga0207678_10046589 | Ga0207678_100465893 | 229 |
| 970 | 3300026067 | Ga0207678_10077717 | Ga0207678_100777173 | 229 |
| 971 | 3300026067 | Ga0207678_10078603 | Ga0207678_100786032 | 229 |
| 972 | 3300026067 | Ga0207678_10088427 | Ga0207678_100884273 | 229 |
| 973 | 3300026067 | Ga0207678_10100074 | Ga0207678_101000743 | 229 |
| 974 | 3300026067 | Ga0207678_10148502 | Ga0207678_101485022 | 229 |
| 975 | 3300026075 | Ga0207708_10001961 | Ga0207708_100019612 | 229 |
| 976 | 3300026075 | Ga0207708_10070474 | Ga0207708_100704742 | 229 |
| 977 | 3300026075 | Ga0207708_10191367 | Ga0207708_101913671 | 229 |
| 978 | 3300026078 | Ga0207702_10000022 | Ga0207702_1000002274 | 229 |
| 979 | 3300026078 | Ga0207702_10000052 | Ga0207702_1000005265 | 229 |
| 980 | 3300026078 | Ga0207702_10094231 | Ga0207702_100942311 | 229 |
| 981 | 3300026078 | Ga0207702_10117867 | Ga0207702_101178673 | 229 |
| 982 | 3300026078 | Ga0207702_10136517 | Ga0207702_101365173 | 229 |
| 983 | 3300026078 | Ga0207702_10153898 | Ga0207702_101538982 | 229 |
| 984 | 3300026078 | Ga0207702_10154546 | Ga0207702_101545462 | 229 |
| 985 | 3300026088 | Ga0207641_10082824 | Ga0207641_100828242 | 229 |
| 986 | 3300026088 | Ga0207641_10095105 | Ga0207641_100951052 | 229 |
| 987 | 3300026088 | Ga0207641_10172247 | Ga0207641_101722472 | 229 |
| 988 | 3300026088 | Ga0207641_10330528 | Ga0207641_103305282 | 229 |
| 989 | 3300026088 | Ga0207641_10441419 | Ga0207641_104414192 | 229 |
| 990 | 3300026088 | Ga0207641_10458638 | Ga0207641_104586382 | 229 |
| 991 | 3300026089 | Ga0207648_10017087 | Ga0207648_100170872 | 229 |
| 992 | 3300026095 | Ga0207676_10130965 | Ga0207676_101309652 | 229 |
| 993 | 3300026095 | Ga0207676_10252786 | Ga0207676_102527863 | 229 |
| 994 | 3300026095 | Ga0207676_10278753 | Ga0207676_102787532 | 229 |
| 995 | 3300026116 | Ga0207674_10012563 | Ga0207674_100125638 | 229 |
| 996 | 3300026116 | Ga0207674_10020723 | Ga0207674_100207234 | 229 |
| 997 | 3300026116 | Ga0207674_10068039 | Ga0207674_100680394 | 229 |
| 998 | 3300026116 | Ga0207674_10123735 | Ga0207674_101237353 | 229 |
| 999 | 3300026116 | Ga0207674_10169021 | Ga0207674_101690212 | 229 |
| 1000 | 3300026116 | Ga0207674_10213163 | Ga0207674_102131632 | 229 |
| 1001 | 3300026116 | Ga0207674_10920227 | Ga0207674_109202271 | 229 |
| 1002 | 3300026118 | Ga0207675_100017040 | Ga0207675_1000170402 | 229 |
| 1003 | 3300026118 | Ga0207675_100019581 | Ga0207675_1000195812 | 229 |
| 1004 | 3300026118 | Ga0207675_100030553 | Ga0207675_1000305534 | 229 |
| 1005 | 3300026118 | Ga0207675_100352199 | Ga0207675_1003521992 | 229 |
| 1006 | 3300026121 | Ga0207683_10002193 | Ga0207683_1000219314 | 229 |
| 1007 | 3300026121 | Ga0207683_10057402 | Ga0207683_100574022 | 229 |
| 1008 | 3300026121 | Ga0207683_10082242 | Ga0207683_100822422 | 229 |
| 1009 | 3300026121 | Ga0207683_10207001 | Ga0207683_102070012 | 229 |
| 1010 | 3300026121 | Ga0207683_10210647 | Ga0207683_102106472 | 229 |
| 1011 | 3300026121 | Ga0207683_10628129 | Ga0207683_106281291 | 229 |
| 1012 | 3300026142 | Ga0207698_10019579 | Ga0207698_100195794 | 229 |
| 1013 | 3300026142 | Ga0207698_10039116 | Ga0207698_100391163 | 229 |
| 1014 | 3300026142 | Ga0207698_10199604 | Ga0207698_101996042 | 229 |
| 1015 | 3300026142 | Ga0207698_10490775 | Ga0207698_104907751 | 229 |
| 1016 | 3300026142 | Ga0207698_10920680 | Ga0207698_109206801 | 229 |
| 1017 | 3300027296 | Ga0209389_1000057 | Ga0209389_100005765 | 229 |
| 1018 | 3300027296 | Ga0209389_1000083 | Ga0209389_100008353 | 229 |
| 1019 | 3300027357 | Ga0209589_1000007 | Ga0209589_100000753 | 229 |
| 1020 | 3300027357 | Ga0209589_1000097 | Ga0209589_100009753 | 229 |
| 1021 | 3300027361 | Ga0209489_100008 | Ga0209489_10000853 | 229 |
| 1022 | 3300027361 | Ga0209489_100105 | Ga0209489_10010579 | 229 |
| 1023 | 3300027361 | Ga0209489_100226 | Ga0209489_10022654 | 229 |
| 1024 | 3300027363 | Ga0209700_100009 | Ga0209700_10000953 | 229 |
| 1025 | 3300027363 | Ga0209700_100085 | Ga0209700_10008582 | 229 |
| 1026 | 3300027671 | Ga0209588_1016150 | Ga0209588_10161502 | 229 |
| 1027 | 3300027671 | Ga0209588_1040574 | Ga0209588_10405742 | 229 |
| 1028 | 3300027866 | Ga0209813_10005475 | Ga0209813_100054751 | 229 |
| 1029 | 3300027866 | Ga0209813_10083870 | Ga0209813_100838702 | 229 |
| 1030 | 3300027907 | Ga0207428_10049851 | Ga0207428_100498513 | 229 |
| 1031 | 3300027907 | Ga0207428_10063714 | Ga0207428_100637143 | 229 |
| 1032 | 3300028379 | Ga0268266_10000350 | Ga0268266_1000035045 | 229 |
| 1033 | 3300028379 | Ga0268266_10000519 | Ga0268266_1000051914 | 229 |
| 1034 | 3300028379 | Ga0268266_10002731 | Ga0268266_100027316 | 229 |
| 1035 | 3300028379 | Ga0268266_10019207 | Ga0268266_100192074 | 229 |
| 1036 | 3300028379 | Ga0268266_10037075 | Ga0268266_100370753 | 229 |
| 1037 | 3300028379 | Ga0268266_10074305 | Ga0268266_100743052 | 229 |
| 1038 | 3300028379 | Ga0268266_10156708 | Ga0268266_101567082 | 229 |
| 1039 | 3300028379 | Ga0268266_10391610 | Ga0268266_103916102 | 229 |
| 1040 | 3300028380 | Ga0268265_10049598 | Ga0268265_100495984 | 229 |
| 1041 | 3300028380 | Ga0268265_10107742 | Ga0268265_101077423 | 229 |
| 1042 | 3300028380 | Ga0268265_10208774 | Ga0268265_102087742 | 229 |
| 1043 | 3300028380 | Ga0268265_10608714 | Ga0268265_106087142 | 229 |
| 1044 | 3300028381 | Ga0268264_10000158 | Ga0268264_1000015830 | 229 |
| 1045 | 3300028381 | Ga0268264_10070247 | Ga0268264_100702472 | 229 |
| 1046 | 3300028381 | Ga0268264_10099646 | Ga0268264_100996463 | 229 |
| 1047 | 3300028381 | Ga0268264_10108404 | Ga0268264_101084042 | 229 |
| 1048 | 3300028381 | Ga0268264_10124611 | Ga0268264_101246112 | 229 |
| 1049 | 3300028556 | Ga0265337_1001723 | Ga0265337_100172311 | 229 |
| 1050 | 3300028558 | Ga0265326_10002861 | Ga0265326_100028614 | 229 |
| 1051 | 3300028563 | Ga0265319_1002269 | Ga0265319_100226911 | 229 |
| 1052 | 3300028573 | Ga0265334_10002914 | Ga0265334_100029145 | 229 |
| 1053 | 3300028577 | Ga0265318_10005349 | Ga0265318_100053492 | 229 |
| 1054 | 3300028653 | Ga0265323_10001151 | Ga0265323_100011512 | 229 |
| 1055 | 3300028654 | Ga0265322_10004281 | Ga0265322_100042812 | 229 |
| 1056 | 3300028666 | Ga0265336_10000211 | Ga0265336_100002112 | 229 |
| 1057 | 3300028786 | Ga0307517_10000248 | Ga0307517_1000024819 | 229 |
| 1058 | 3300028786 | Ga0307517_10060854 | Ga0307517_100608542 | 229 |
| 1059 | 3300028786 | Ga0307517_10141324 | Ga0307517_101413243 | 229 |
| 1060 | 3300028794 | Ga0307515_10150462 | Ga0307515_101504622 | 229 |
| 1061 | 3300028794 | Ga0307515_10256889 | Ga0307515_102568892 | 229 |
| 1062 | 3300028800 | Ga0265338_10004459 | Ga0265338_1000445918 | 229 |
| 1063 | 3300029957 | Ga0265324_10033618 | Ga0265324_100336182 | 229 |
| 1064 | 3300030521 | Ga0307511_10065784 | Ga0307511_100657842 | 229 |
| 1065 | 3300031238 | Ga0265332_10033327 | Ga0265332_100333272 | 229 |
| 1066 | 3300031247 | Ga0265340_10032951 | Ga0265340_100329512 | 229 |
| 1067 | 3300031247 | Ga0265340_10151841 | Ga0265340_101518412 | 229 |
| 1068 | 3300031249 | Ga0265339_10000791 | Ga0265339_100007915 | 229 |
| 1069 | 3300031249 | Ga0265339_10017714 | Ga0265339_100177142 | 229 |
| 1070 | 3300031249 | Ga0265339_10063779 | Ga0265339_100637792 | 229 |
| 1071 | 3300031250 | Ga0265331_10049913 | Ga0265331_100499132 | 229 |
| 1072 | 3300031456 | Ga0307513_10512329 | Ga0307513_105123291 | 229 |
| 1073 | 3300031507 | Ga0307509_10074149 | Ga0307509_100741492 | 229 |
| 1074 | 3300031507 | Ga0307509_10084204 | Ga0307509_100842042 | 229 |
| 1075 | 3300031507 | Ga0307509_10205094 | Ga0307509_102050942 | 229 |
| 1076 | 3300031507 | Ga0307509_10378734 | Ga0307509_103787342 | 229 |
| 1077 | 3300031548 | Ga0307408_100227663 | Ga0307408_1002276632 | 229 |
| 1078 | 3300031616 | Ga0307508_10024925 | Ga0307508_100249251 | 229 |
| 1079 | 3300031616 | Ga0307508_10054665 | Ga0307508_100546652 | 229 |
| 1080 | 3300031711 | Ga0265314_10003471 | Ga0265314_100034713 | 229 |
| 1081 | 3300031711 | Ga0265314_10015898 | Ga0265314_100158984 | 229 |
| 1082 | 3300031711 | Ga0265314_10077853 | Ga0265314_100778532 | 229 |
| 1083 | 3300031711 | Ga0265314_10105152 | Ga0265314_101051522 | 229 |
| 1084 | 3300031712 | Ga0265342_10001311 | Ga0265342_1000131117 | 229 |
| 1085 | 3300031712 | Ga0265342_10074566 | Ga0265342_100745662 | 229 |
| 1086 | 3300031730 | Ga0307516_10020861 | Ga0307516_100208614 | 229 |
| 1087 | 3300031730 | Ga0307516_10043612 | Ga0307516_100436122 | 229 |
| 1088 | 3300031730 | Ga0307516_10221803 | Ga0307516_102218032 | 229 |
| 1089 | 3300031730 | Ga0307516_10451251 | Ga0307516_104512512 | 229 |
| 1090 | 3300031824 | Ga0307413_10222632 | Ga0307413_102226322 | 229 |
| 1091 | 3300031901 | Ga0307406_10204646 | Ga0307406_102046462 | 229 |
| 1092 | 3300031903 | Ga0307407_10167047 | Ga0307407_101670472 | 229 |
| 1093 | 3300031911 | Ga0307412_10104757 | Ga0307412_101047571 | 229 |
| 1094 | 3300031911 | Ga0307412_10127680 | Ga0307412_101276802 | 229 |
| 1095 | 3300031911 | Ga0307412_10253768 | Ga0307412_102537682 | 229 |
| 1096 | 3300031911 | Ga0307412_10539694 | Ga0307412_105396942 | 229 |
| 1097 | 3300031995 | Ga0307409_100120990 | Ga0307409_1001209903 | 229 |
| 1098 | 3300032002 | Ga0307416_100201470 | Ga0307416_1002014702 | 229 |
| 1099 | 3300032002 | Ga0307416_100394760 | Ga0307416_1003947602 | 229 |
| 1100 | 3300032126 | Ga0307415_100067119 | Ga0307415_1000671192 | 229 |
| 1101 | 3300033179 | Ga0307507_10008612 | Ga0307507_100086129 | 229 |
| 1102 | 3300033180 | Ga0307510_10007392 | Ga0307510_100073923 | 229 |
| 1103 | 3300033180 | Ga0307510_10021151 | Ga0307510_100211514 | 229 |
| 1104 | 3300033180 | Ga0307510_10039656 | Ga0307510_100396562 | 229 |
| 1105 | 3300033180 | Ga0307510_10047952 | Ga0307510_100479523 | 229 |
| 1106 | 3300033180 | Ga0307510_10234318 | Ga0307510_102343182 | 229 |
| 1107 | 3300033442 | Ga0315911_1000031 | Ga0315911_100003133 | 229 |
| 1108 | 3300034957 | Ga0373938_0013658 | Ga0373938_0013658_602_1291 | 229 |
| 1109 | 3300035083 | Ga0373926_0058534 | Ga0373926_0058534_272_961 | 229 |
| 1110 | 3300035086 | Ga0373934_0004724 | Ga0373934_0004724_2423_3112 | 229 |
| 1111 | 3300035086 | Ga0373934_0014502 | Ga0373934_0014502_1888_2577 | 229 |
| 1112 | 3300035086 | Ga0373934_0020207 | Ga0373934_0020207_302_991 | 229 |
| 1113 | 3300035086 | Ga0373934_0172668 | Ga0373934_0172668_33_722 | 229 |
| 1114 | 3300035088 | Ga0373940_0062717 | Ga0373940_0062717_22_711 | 229 |
| 1115 | 3300035111 | Ga0373923_0005165 | Ga0373923_0005165_2528_3217 | 229 |
| 1116 | 3300035111 | Ga0373923_0102368 | Ga0373923_0102368_339_1028 | 229 |
| 1117 | 3300035113 | Ga0373936_0003595 | Ga0373936_0003595_1175_1864 | 229 |
| 1118 | 3300035113 | Ga0373936_0041251 | Ga0373936_0041251_1148_1837 | 229 |
| 1119 | 3300035116 | Ga0373945_0005590 | Ga0373945_0005590_1809_2498 | 229 |
| 1120 | 3300035117 | Ga0373953_0000957 | Ga0373953_0000957_5783_6472 | 229 |
| 1121 | 3300035117 | Ga0373953_0004118 | Ga0373953_0004118_3335_4024 | 229 |
| 1122 | 3300035117 | Ga0373953_0019754 | Ga0373953_0019754_886_1575 | 229 |
| 1123 | 3300035117 | Ga0373953_0208063 | Ga0373953_0208063_52_741 | 229 |
| 1124 | 3300035118 | Ga0373954_0011864 | Ga0373954_0011864_2101_2790 | 229 |
| 1125 | 3300035118 | Ga0373954_0031969 | Ga0373954_0031969_1116_1805 | 229 |
| 1126 | 3300035118 | Ga0373954_0038673 | Ga0373954_0038673_1102_1791 | 229 |
| 1127 | 3300035118 | Ga0373954_0053827 | Ga0373954_0053827_793_1482 | 229 |
| 1128 | 3300035119 | Ga0373956_0058002 | Ga0373956_0058002_903_1592 | 229 |
| 1129 | 3300035119 | Ga0373956_0296594 | Ga0373956_0296594_45_734 | 229 |
| 1130 | 3300035170 | Ga0373943_0120099 | Ga0373943_0120099_13_702 | 229 |
| 1131 | 3300035170 | Ga0373943_0210860 | Ga0373943_0210860_260_949 | 229 |
| 1132 | 3300035170 | Ga0373943_0343614 | Ga0373943_0343614_92_781 | 229 |
| 1133 | 3300035171 | Ga0373946_0007992 | Ga0373946_0007992_463_1152 | 229 |
| 1134 | 3300035171 | Ga0373946_0050465 | Ga0373946_0050465_497_1186 | 229 |
| 1135 | 3300035171 | Ga0373946_0195319 | Ga0373946_0195319_65_754 | 229 |
| 1136 | 3300035172 | Ga0373955_0000304 | Ga0373955_0000304_2039_2728 | 229 |
| 1137 | 3300035172 | Ga0373955_0319719 | Ga0373955_0319719_44_733 | 229 |
| 1138 | 3300035207 | Ga0373942_0124107 | Ga0373942_0124107_13_702 | 229 |
| 1139 | 3300035692 | Ga0373935_0000088 | Ga0373935_0000088_36098_36787 | 229 |
| 1140 | 3300035692 | Ga0373935_0024272 | Ga0373935_0024272_2233_2922 | 229 |
| 1141 | 3300035692 | Ga0373935_0060786 | Ga0373935_0060786_1611_2300 | 229 |
| 1142 | 3300035692 | Ga0373935_0135996 | Ga0373935_0135996_104_793 | 229 |
| 1143 | 3300035695 | Ga0373927_0003336 | Ga0373927_0003336_6721_7410 | 229 |
| 1144 | 3300035695 | Ga0373927_0003671 | Ga0373927_0003671_4167_4856 | 229 |
| 1145 | 3300035695 | Ga0373927_0014610 | Ga0373927_0014610_2558_3247 | 229 |
| 1146 | 3300035695 | Ga0373927_0048900 | Ga0373927_0048900_1615_2304 | 229 |
| 1147 | 3300035695 | Ga0373927_0059166 | Ga0373927_0059166_1404_2093 | 229 |
| 1148 | 3300035695 | Ga0373927_0196279 | Ga0373927_0196279_473_1162 | 229 |
| 1149 | 3300035695 | Ga0373927_0269080 | Ga0373927_0269080_414_1103 | 229 |
| 1150 | 3300035695 | Ga0373927_0482615 | Ga0373927_0482615_61_750 | 229 |
| 1151 | 3300035724 | Ga0373933_0017318 | Ga0373933_0017318_3096_3785 | 229 |
| 1152 | 3300035724 | Ga0373933_0153043 | Ga0373933_0153043_440_1129 | 229 |
| 1153 | 3300035725 | Ga0373947_0001821 | Ga0373947_0001821_7962_8651 | 229 |
| 1154 | 3300035725 | Ga0373947_0002575 | Ga0373947_0002575_9706_10395 | 229 |
| 1155 | 3300035725 | Ga0373947_0012043 | Ga0373947_0012043_3850_4539 | 229 |
| 1156 | 3300036401 | Ga0373937_0000124 | Ga0373937_0000124_37060_37749 | 229 |
| 1157 | 3300036401 | Ga0373937_0000983 | Ga0373937_0000983_23049_23738 | 229 |
| 1158 | 3300036401 | Ga0373937_0021564 | Ga0373937_0021564_768_1457 | 229 |
| 1159 | 3300036401 | Ga0373937_0089666 | Ga0373937_0089666_1211_1900 | 229 |
| 1160 | 3300036401 | Ga0373937_0360231 | Ga0373937_0360231_540_1229 | 229 |
| 1161 | 3300036401 | Ga0373937_0465060 | Ga0373937_0465060_214_903 | 229 |
| 1162 | 3300036458 | Ga0310112_015267 | Ga0310112_015267_133_822 | 229 |
| 1163 | 3300037068 | Ga0373925_0000210 | Ga0373925_0000210_8350_9039 | 229 |
| 1164 | 3300037068 | Ga0373925_0166054 | Ga0373925_0166054_967_1656 | 229 |
| 1165 | 3300037068 | Ga0373925_0250667 | Ga0373925_0250667_141_830 | 229 |
| 1166 | 3300037068 | Ga0373925_0268047 | Ga0373925_0268047_452_1141 | 229 |
| 1167 | 3300037466 | Ga0395898_0002276 | Ga0395898_0002276_8556_9245 | 229 |
| 1168 | 3300037466 | Ga0395898_0038790 | Ga0395898_0038790_3621_4310 | 229 |
| 1169 | 3300037466 | Ga0395898_0051399 | Ga0395898_0051399_634_1323 | 229 |
| 1170 | 3300037466 | Ga0395898_0245304 | Ga0395898_0245304_308_997 | 229 |
| 1171 | 3300037471 | Ga0395905_0016854 | Ga0395905_0016854_3821_4510 | 229 |
| 1172 | 3300037853 | Ga0436364_0178575 | Ga0436364_0178575_700_1389 | 229 |
| 1173 | 3300037853 | Ga0436364_0309073 | Ga0436364_0309073_573_1262 | 229 |
| 1174 | 3300037853 | Ga0436364_0350531 | Ga0436364_0350531_1385_2074 | 229 |
| 1175 | 3300037853 | Ga0436364_0418429 | Ga0436364_0418429_3833_4522 | 229 |
| 1176 | 3300037853 | Ga0436364_0663094 | Ga0436364_0663094_274_963 | 229 |
| 1177 | 3300037853 | Ga0436364_0829844 | Ga0436364_0829844_213_908 | 229 |
| 1178 | 3300037853 | Ga0436364_1050269 | Ga0436364_1050269_387_1076 | 229 |
| 1179 | 3300038443 | Ga0395901_0129827 | Ga0395901_0129827_342_1031 | 229 |
| 1180 | 3300038443 | Ga0395901_0353511 | Ga0395901_0353511_801_1490 | 229 |
| 1181 | 3300039437 | Ga0436365_0035453 | Ga0436365_0035453_158_847 | 229 |
| 1182 | 3300039437 | Ga0436365_0132219 | Ga0436365_0132219_935_1624 | 229 |
| 1183 | 3300039437 | Ga0436365_0607631 | Ga0436365_0607631_168_857 | 229 |
| 1184 | 3300039437 | Ga0436365_0914371 | Ga0436365_0914371_1173_1862 | 229 |
| 1185 | 3300039437 | Ga0436365_1144022 | Ga0436365_1144022_232_921 | 229 |
| 1186 | 3300039437 | Ga0436365_1376117 | Ga0436365_1376117_264_953 | 229 |
| 1187 | 3300039437 | Ga0436365_1410381 | Ga0436365_1410381_382_1071 | 229 |
| 1188 | 3300039437 | Ga0436365_1520875 | Ga0436365_1520875_234_923 | 229 |
| 1189 | 3300039437 | Ga0436365_1704008 | Ga0436365_1704008_261_950 | 229 |
| 1190 | 3300039438 | Ga0436360_0265948 | Ga0436360_0265948_531_1220 | 229 |
| 1191 | 3300039438 | Ga0436360_0535298 | Ga0436360_0535298_58_747 | 229 |
| 1192 | 3300039438 | Ga0436360_0872836 | Ga0436360_0872836_2950_3639 | 229 |
| 1193 | 3300039438 | Ga0436360_1281396 | Ga0436360_1281396_1073_1762 | 229 |
| 1194 | 3300039447 | Ga0436361_0335302 | Ga0436361_0335302_1433_2122 | 229 |
| 1195 | 3300039447 | Ga0436361_0518172 | Ga0436361_0518172_50_739 | 229 |
| 1196 | 3300039447 | Ga0436361_0978240 | Ga0436361_0978240_2709_3398 | 229 |
| 1197 | 3300039450 | Ga0436363_0060203 | Ga0436363_0060203_59_748 | 229 |
| 1198 | 3300039450 | Ga0436363_0300553 | Ga0436363_0300553_68_757 | 229 |
| 1199 | 3300039450 | Ga0436363_0542830 | Ga0436363_0542830_104_793 | 229 |
| 1200 | 3300039450 | Ga0436363_0719444 | Ga0436363_0719444_105_794 | 229 |
| 1201 | 3300039453 | Ga0436362_0719751 | Ga0436362_0719751_606_1295 | 229 |
| 1202 | 3300041413 | Ga0439465_0101101 | Ga0439465_0101101_20_709 | 229 |
| 1203 | 3300041486 | Ga0451807_1928304 | Ga0451807_1928304_118_807 | 229 |
| 1204 | 3300044656 | Ga0466969_0062246 | Ga0466969_0062246_167_856 | 229 |
| 1205 | 3300044658 | Ga0466972_0000244 | Ga0466972_0000244_4829_5518 | 229 |
| 1206 | 3300044658 | Ga0466972_0078001 | Ga0466972_0078001_368_1057 | 229 |
| 1207 | 3300044684 | Ga0466966_0029887 | Ga0466966_0029887_1340_2029 | 229 |
| 1208 | 3300044684 | Ga0466966_0048888 | Ga0466966_0048888_1478_2167 | 229 |
| 1209 | 3300044693 | Ga0466961_0010569 | Ga0466961_0010569_4356_5045 | 229 |
| 1210 | 3300044694 | Ga0466963_0149800 | Ga0466963_0149800_543_1232 | 229 |
| 1211 | 3300044694 | Ga0466963_0567593 | Ga0466963_0567593_100_789 | 229 |
| 1212 | 3300044735 | Ga0466968_0005654 | Ga0466968_0005654_3093_3782 | 229 |
| 1213 | 3300044765 | Ga0466970_0026140 | Ga0466970_0026140_2306_2995 | 229 |
| 1214 | 3300044765 | Ga0466970_0158616 | Ga0466970_0158616_13_702 | 229 |
| 1215 | 3300044842 | Ga0466957_0050090 | Ga0466957_0050090_843_1532 | 229 |
| 1216 | 3300044842 | Ga0466957_0186484 | Ga0466957_0186484_40_729 | 229 |
| 1217 | 3300044842 | Ga0466957_0237303 | Ga0466957_0237303_194_883 | 229 |
| 1218 | 3300044901 | Ga0466960_0002982 | Ga0466960_0002982_1519_2208 | 229 |
| 1219 | 3300045049 | Ga0466959_0021197 | Ga0466959_0021197_3906_4595 | 229 |
| 1220 | 3300045049 | Ga0466959_0309425 | Ga0466959_0309425_29_718 | 229 |
| 1221 | 3300045976 | Ga0466967_0042506 | Ga0466967_0042506_1688_2377 | 229 |
| 1222 | 3300045976 | Ga0466967_0096660 | Ga0466967_0096660_815_1504 | 229 |
| 1223 | 3300045976 | Ga0466967_0119766 | Ga0466967_0119766_390_1079 | 229 |
| 1224 | 3300045976 | Ga0466967_0261702 | Ga0466967_0261702_245_934 | 229 |
| 1225 | 3300045976 | Ga0466967_0397230 | Ga0466967_0397230_244_933 | 229 |
| 1226 | 3300045976 | Ga0466967_0791278 | Ga0466967_0791278_241_930 | 229 |
| 1227 | 3300046452 | Ga0495617_003959 | Ga0495617_003959_1580_2269 | 229 |
| 1228 | 3300046452 | Ga0495617_014139 | Ga0495617_014139_185_874 | 229 |
| 1229 | 3300046454 | Ga0495592_0000020 | Ga0495592_0000020_103737_104426 | 229 |
| 1230 | 3300046454 | Ga0495592_0070778 | Ga0495592_0070778_1205_1894 | 229 |
| 1231 | 3300046454 | Ga0495592_0138747 | Ga0495592_0138747_603_1292 | 229 |
| 1232 | 3300046454 | Ga0495592_0216323 | Ga0495592_0216323_528_1217 | 229 |
| 1233 | 3300046454 | Ga0495592_0310049 | Ga0495592_0310049_24_713 | 229 |
| 1234 | 3300046454 | Ga0495592_0479756 | Ga0495592_0479756_38_727 | 229 |
| 1235 | 3300046455 | Ga0495603_0007714 | Ga0495603_0007714_1709_2398 | 229 |
| 1236 | 3300046455 | Ga0495603_0011954 | Ga0495603_0011954_3232_3921 | 229 |
| 1237 | 3300046455 | Ga0495603_0013691 | Ga0495603_0013691_1084_1773 | 229 |
| 1238 | 3300046455 | Ga0495603_0014900 | Ga0495603_0014900_3721_4410 | 229 |
| 1239 | 3300046455 | Ga0495603_0042376 | Ga0495603_0042376_1783_2472 | 229 |
| 1240 | 3300046455 | Ga0495603_0081307 | Ga0495603_0081307_1042_1731 | 229 |
| 1241 | 3300046455 | Ga0495603_0102431 | Ga0495603_0102431_746_1435 | 229 |
| 1242 | 3300046455 | Ga0495603_0113179 | Ga0495603_0113179_645_1334 | 229 |
| 1243 | 3300046455 | Ga0495603_0234239 | Ga0495603_0234239_211_900 | 229 |
| 1244 | 3300046457 | Ga0495590_0054197 | Ga0495590_0054197_701_1390 | 229 |
| 1245 | 3300046459 | Ga0495629_0002004 | Ga0495629_0002004_11321_12010 | 229 |
| 1246 | 3300046459 | Ga0495629_0030237 | Ga0495629_0030237_250_939 | 229 |
| 1247 | 3300046459 | Ga0495629_0056416 | Ga0495629_0056416_1023_1712 | 229 |
| 1248 | 3300046459 | Ga0495629_0106438 | Ga0495629_0106438_592_1281 | 229 |
| 1249 | 3300046459 | Ga0495629_0116897 | Ga0495629_0116897_282_971 | 229 |
| 1250 | 3300046459 | Ga0495629_0173109 | Ga0495629_0173109_690_1379 | 229 |
| 1251 | 3300046459 | Ga0495629_0221607 | Ga0495629_0221607_562_1251 | 229 |
| 1252 | 3300046460 | Ga0495638_0006931 | Ga0495638_0006931_1939_2628 | 229 |
| 1253 | 3300046460 | Ga0495638_0010623 | Ga0495638_0010623_1606_2295 | 229 |
| 1254 | 3300046460 | Ga0495638_0063518 | Ga0495638_0063518_1186_1875 | 229 |
| 1255 | 3300046461 | Ga0495641_0094324 | Ga0495641_0094324_571_1260 | 229 |
| 1256 | 3300046462 | Ga0495651_0005254 | Ga0495651_0005254_5748_6437 | 229 |
| 1257 | 3300046462 | Ga0495651_0008334 | Ga0495651_0008334_4605_5294 | 229 |
| 1258 | 3300046462 | Ga0495651_0011786 | Ga0495651_0011786_3788_4477 | 229 |
| 1259 | 3300046462 | Ga0495651_0012080 | Ga0495651_0012080_4060_4749 | 229 |
| 1260 | 3300046463 | Ga0495653_0000046 | Ga0495653_0000046_36372_37061 | 229 |
| 1261 | 3300046463 | Ga0495653_0024568 | Ga0495653_0024568_280_969 | 229 |
| 1262 | 3300046463 | Ga0495653_0058242 | Ga0495653_0058242_1956_2645 | 229 |
| 1263 | 3300046463 | Ga0495653_0085332 | Ga0495653_0085332_269_958 | 229 |
| 1264 | 3300046471 | Ga0495650_0111704 | Ga0495650_0111704_226_915 | 229 |
| 1265 | 3300046472 | Ga0495580_0065294 | Ga0495580_0065294_1376_2065 | 229 |
| 1266 | 3300046472 | Ga0495580_0091517 | Ga0495580_0091517_634_1323 | 229 |
| 1267 | 3300046473 | Ga0495582_0010656 | Ga0495582_0010656_4044_4733 | 229 |
| 1268 | 3300046473 | Ga0495582_0078349 | Ga0495582_0078349_74_763 | 229 |
| 1269 | 3300046475 | Ga0495639_0024969 | Ga0495639_0024969_1795_2484 | 229 |
| 1270 | 3300046475 | Ga0495639_0040768 | Ga0495639_0040768_1135_1824 | 229 |
| 1271 | 3300046475 | Ga0495639_0094463 | Ga0495639_0094463_296_985 | 229 |
| 1272 | 3300046475 | Ga0495639_0182369 | Ga0495639_0182369_310_999 | 229 |
| 1273 | 3300046476 | Ga0495662_0001819 | Ga0495662_0001819_365_1054 | 229 |
| 1274 | 3300046476 | Ga0495662_0021962 | Ga0495662_0021962_319_1008 | 229 |
| 1275 | 3300046476 | Ga0495662_0042013 | Ga0495662_0042013_330_1019 | 229 |
| 1276 | 3300046477 | Ga0495664_0000017 | Ga0495664_0000017_36313_37002 | 229 |
| 1277 | 3300046477 | Ga0495664_0027575 | Ga0495664_0027575_2597_3286 | 229 |
| 1278 | 3300046477 | Ga0495664_0048743 | Ga0495664_0048743_705_1394 | 229 |
| 1279 | 3300046477 | Ga0495664_0051674 | Ga0495664_0051674_1508_2197 | 229 |
| 1280 | 3300046477 | Ga0495664_0053309 | Ga0495664_0053309_513_1202 | 229 |
| 1281 | 3300046477 | Ga0495664_0066113 | Ga0495664_0066113_354_1043 | 229 |
| 1282 | 3300046477 | Ga0495664_0111519 | Ga0495664_0111519_315_1004 | 229 |
| 1283 | 3300046492 | Ga0495585_0020146 | Ga0495585_0020146_3068_3757 | 229 |
| 1284 | 3300046492 | Ga0495585_0093551 | Ga0495585_0093551_92_781 | 229 |
| 1285 | 3300046499 | Ga0495594_0011382 | Ga0495594_0011382_2082_2771 | 229 |
| 1286 | 3300046499 | Ga0495594_0450238 | Ga0495594_0450238_27_716 | 229 |
| 1287 | 3300046500 | Ga0495596_0144108 | Ga0495596_0144108_38_727 | 229 |
| 1288 | 3300046501 | Ga0495607_0018891 | Ga0495607_0018891_1676_2365 | 229 |
| 1289 | 3300046501 | Ga0495607_0130560 | Ga0495607_0130560_385_1074 | 229 |
| 1290 | 3300046507 | Ga0495606_0003775 | Ga0495606_0003775_11316_12005 | 229 |
| 1291 | 3300046507 | Ga0495606_0026394 | Ga0495606_0026394_3323_4012 | 229 |
| 1292 | 3300046507 | Ga0495606_0191390 | Ga0495606_0191390_30_719 | 229 |
| 1293 | 3300046507 | Ga0495606_0242694 | Ga0495606_0242694_88_777 | 229 |
| 1294 | 3300046511 | Ga0495608_0002207 | Ga0495608_0002207_9587_10276 | 229 |
| 1295 | 3300046511 | Ga0495608_0014874 | Ga0495608_0014874_4497_5186 | 229 |
| 1296 | 3300046512 | Ga0495610_0016452 | Ga0495610_0016452_1426_2115 | 229 |
| 1297 | 3300046512 | Ga0495610_0070452 | Ga0495610_0070452_182_871 | 229 |
| 1298 | 3300046513 | Ga0495616_0070961 | Ga0495616_0070961_971_1660 | 229 |
| 1299 | 3300046514 | Ga0495618_0000059 | Ga0495618_0000059_36294_36983 | 229 |
| 1300 | 3300046514 | Ga0495618_0028761 | Ga0495618_0028761_613_1302 | 229 |
| 1301 | 3300046514 | Ga0495618_0350422 | Ga0495618_0350422_122_811 | 229 |
| 1302 | 3300046515 | Ga0495620_0011016 | Ga0495620_0011016_1362_2051 | 229 |
| 1303 | 3300046515 | Ga0495620_0063470 | Ga0495620_0063470_34_723 | 229 |
| 1304 | 3300046515 | Ga0495620_0096599 | Ga0495620_0096599_317_1006 | 229 |
| 1305 | 3300046516 | Ga0495628_0000022 | Ga0495628_0000022_9459_10148 | 229 |
| 1306 | 3300046516 | Ga0495628_0070806 | Ga0495628_0070806_997_1686 | 229 |
| 1307 | 3300046516 | Ga0495628_0110148 | Ga0495628_0110148_971_1660 | 229 |
| 1308 | 3300046516 | Ga0495628_0189583 | Ga0495628_0189583_658_1347 | 229 |
| 1309 | 3300046516 | Ga0495628_0358651 | Ga0495628_0358651_62_751 | 229 |
| 1310 | 3300046516 | Ga0495628_0365884 | Ga0495628_0365884_244_933 | 229 |
| 1311 | 3300046516 | Ga0495628_0386795 | Ga0495628_0386795_287_976 | 229 |
| 1312 | 3300046517 | Ga0495630_0002896 | Ga0495630_0002896_9447_10136 | 229 |
| 1313 | 3300046517 | Ga0495630_0056494 | Ga0495630_0056494_1862_2551 | 229 |
| 1314 | 3300046517 | Ga0495630_0081683 | Ga0495630_0081683_1294_1983 | 229 |
| 1315 | 3300046517 | Ga0495630_0165031 | Ga0495630_0165031_958_1647 | 229 |
| 1316 | 3300046517 | Ga0495630_0270129 | Ga0495630_0270129_209_898 | 229 |
| 1317 | 3300046518 | Ga0495631_0036248 | Ga0495631_0036248_1216_1905 | 229 |
| 1318 | 3300046522 | Ga0495643_0023470 | Ga0495643_0023470_473_1162 | 229 |
| 1319 | 3300046522 | Ga0495643_0096830 | Ga0495643_0096830_585_1274 | 229 |
| 1320 | 3300046524 | Ga0495648_0000854 | Ga0495648_0000854_26215_26904 | 229 |
| 1321 | 3300046524 | Ga0495648_0001062 | Ga0495648_0001062_22234_22923 | 229 |
| 1322 | 3300046524 | Ga0495648_0033553 | Ga0495648_0033553_2039_2728 | 229 |
| 1323 | 3300046524 | Ga0495648_0213417 | Ga0495648_0213417_163_852 | 229 |
| 1324 | 3300046525 | Ga0495663_0021054 | Ga0495663_0021054_523_1212 | 229 |
| 1325 | 3300046526 | Ga0495666_0136235 | Ga0495666_0136235_193_882 | 229 |
| 1326 | 3300046529 | Ga0495652_0000008 | Ga0495652_0000008_333490_334179 | 229 |
| 1327 | 3300046529 | Ga0495652_0017865 | Ga0495652_0017865_1249_1938 | 229 |
| 1328 | 3300046529 | Ga0495652_0022191 | Ga0495652_0022191_1587_2276 | 229 |
| 1329 | 3300046529 | Ga0495652_0274636 | Ga0495652_0274636_512_1201 | 229 |
| 1330 | 3300046530 | Ga0495654_0075621 | Ga0495654_0075621_203_892 | 229 |
| 1331 | 3300046531 | Ga0495665_0015520 | Ga0495665_0015520_206_895 | 229 |
| 1332 | 3300046533 | Ga0495640_0000029 | Ga0495640_0000029_42712_43401 | 229 |
| 1333 | 3300046533 | Ga0495640_0020310 | Ga0495640_0020310_2085_2774 | 229 |
| 1334 | 3300046533 | Ga0495640_0029043 | Ga0495640_0029043_1500_2189 | 229 |
| 1335 | 3300046533 | Ga0495640_0114615 | Ga0495640_0114615_1031_1720 | 229 |
| 1336 | 3300046533 | Ga0495640_0188721 | Ga0495640_0188721_574_1263 | 229 |
| 1337 | 3300046533 | Ga0495640_0221887 | Ga0495640_0221887_258_947 | 229 |
| 1338 | 3300046533 | Ga0495640_0282907 | Ga0495640_0282907_304_993 | 229 |
| 1339 | 3300046535 | Ga0495586_0134308 | Ga0495586_0134308_26_715 | 229 |
| 1340 | 3300046536 | Ga0495587_0000019 | Ga0495587_0000019_125133_125822 | 229 |
| 1341 | 3300046536 | Ga0495587_0268669 | Ga0495587_0268669_111_803 | 229 |
| 1342 | 3300046537 | Ga0495598_0024224 | Ga0495598_0024224_508_1197 | 229 |
| 1343 | 3300046538 | Ga0495609_0194490 | Ga0495609_0194490_128_820 | 229 |
| 1344 | 3300046542 | Ga0495597_0030937 | Ga0495597_0030937_95_784 | 229 |
| 1345 | 3300046543 | Ga0495645_0000006 | Ga0495645_0000006_81201_81890 | 229 |
| 1346 | 3300046543 | Ga0495645_0011285 | Ga0495645_0011285_1954_2643 | 229 |
| 1347 | 3300046543 | Ga0495645_0041158 | Ga0495645_0041158_1000_1689 | 229 |
| 1348 | 3300046543 | Ga0495645_0131216 | Ga0495645_0131216_923_1612 | 229 |
| 1349 | 3300046543 | Ga0495645_0289645 | Ga0495645_0289645_329_1018 | 229 |
| 1350 | 3300046557 | Ga0495622_0029445 | Ga0495622_0029445_912_1601 | 229 |
| 1351 | 3300046557 | Ga0495622_0033750 | Ga0495622_0033750_339_1028 | 229 |
| 1352 | 3300046557 | Ga0495622_0034495 | Ga0495622_0034495_852_1541 | 229 |
| 1353 | 3300046557 | Ga0495622_0043851 | Ga0495622_0043851_294_983 | 229 |
| 1354 | 3300046557 | Ga0495622_0134116 | Ga0495622_0134116_41_730 | 229 |
| 1355 | 3300046558 | Ga0495633_0202327 | Ga0495633_0202327_78_767 | 229 |
| 1356 | 3300046559 | Ga0495667_0000061 | Ga0495667_0000061_57831_58520 | 229 |
| 1357 | 3300046559 | Ga0495667_0016424 | Ga0495667_0016424_3677_4366 | 229 |
| 1358 | 3300046559 | Ga0495667_0074103 | Ga0495667_0074103_398_1087 | 229 |
| 1359 | 3300046559 | Ga0495667_0384648 | Ga0495667_0384648_23_712 | 229 |
| 1360 | 3300046559 | Ga0495667_0392604 | Ga0495667_0392604_11_700 | 229 |
| 1361 | 3300046615 | Ga0495656_0048562 | Ga0495656_0048562_256_945 | 229 |
| 1362 | 3300046615 | Ga0495656_0098817 | Ga0495656_0098817_177_866 | 229 |
| 1363 | 3300046615 | Ga0495656_0314871 | Ga0495656_0314871_100_789 | 229 |
| 1364 | 3300046616 | Ga0495668_0035821 | Ga0495668_0035821_1131_1820 | 229 |
| 1365 | 3300046616 | Ga0495668_0072754 | Ga0495668_0072754_351_1040 | 229 |
| 1366 | 3300046616 | Ga0495668_0093756 | Ga0495668_0093756_695_1384 | 229 |
| 1367 | 3300046616 | Ga0495668_0147430 | Ga0495668_0147430_195_884 | 229 |
| 1368 | 3300046642 | Ga0495634_0000345 | Ga0495634_0000345_17769_18458 | 229 |
| 1369 | 3300046642 | Ga0495634_0017567 | Ga0495634_0017567_322_1011 | 229 |
| 1370 | 3300046642 | Ga0495634_0019118 | Ga0495634_0019118_4127_4816 | 229 |
| 1371 | 3300046642 | Ga0495634_0021915 | Ga0495634_0021915_202_891 | 229 |
| 1372 | 3300046642 | Ga0495634_0051006 | Ga0495634_0051006_1148_1837 | 229 |
| 1373 | 3300046642 | Ga0495634_0080705 | Ga0495634_0080705_1324_2013 | 229 |
| 1374 | 3300046642 | Ga0495634_0088338 | Ga0495634_0088338_569_1258 | 229 |
| 1375 | 3300046648 | Ga0495611_0061096 | Ga0495611_0061096_980_1669 | 229 |
| 1376 | 3300046648 | Ga0495611_0078436 | Ga0495611_0078436_430_1119 | 229 |
| 1377 | 3300046660 | Ga0495625_0176666 | Ga0495625_0176666_722_1411 | 229 |
| 1378 | 3300046660 | Ga0495625_0282554 | Ga0495625_0282554_324_1013 | 229 |
| 1379 | 3300046663 | Ga0495635_0000023 | Ga0495635_0000023_125365_126054 | 229 |
| 1380 | 3300046663 | Ga0495635_0005975 | Ga0495635_0005975_3908_4597 | 229 |
| 1381 | 3300046664 | Ga0495659_0007775 | Ga0495659_0007775_1758_2447 | 229 |
| 1382 | 3300046664 | Ga0495659_0028267 | Ga0495659_0028267_671_1360 | 229 |
| 1383 | 3300046665 | Ga0495661_0003460 | Ga0495661_0003460_8801_9490 | 229 |
| 1384 | 3300046674 | Ga0495588_0006542 | Ga0495588_0006542_3739_4428 | 229 |
| 1385 | 3300046674 | Ga0495588_0010675 | Ga0495588_0010675_2088_2777 | 229 |
| 1386 | 3300046674 | Ga0495588_0085088 | Ga0495588_0085088_637_1326 | 229 |
| 1387 | 3300046675 | Ga0495657_0000430 | Ga0495657_0000430_28856_29545 | 229 |
| 1388 | 3300046675 | Ga0495657_0006657 | Ga0495657_0006657_4426_5115 | 229 |
| 1389 | 3300046675 | Ga0495657_0036209 | Ga0495657_0036209_2322_3011 | 229 |
| 1390 | 3300046678 | Ga0495599_0000066 | Ga0495599_0000066_44157_44846 | 229 |
| 1391 | 3300046678 | Ga0495599_0012081 | Ga0495599_0012081_583_1272 | 229 |
| 1392 | 3300046678 | Ga0495599_0016718 | Ga0495599_0016718_2288_2977 | 229 |
| 1393 | 3300046678 | Ga0495599_0305847 | Ga0495599_0305847_113_802 | 229 |
| 1394 | 3300046679 | Ga0495623_0000217 | Ga0495623_0000217_27716_28405 | 229 |
| 1395 | 3300046679 | Ga0495623_0012982 | Ga0495623_0012982_861_1550 | 229 |
| 1396 | 3300046679 | Ga0495623_0063150 | Ga0495623_0063150_1229_1918 | 229 |
| 1397 | 3300046679 | Ga0495623_0085513 | Ga0495623_0085513_1029_1718 | 229 |
| 1398 | 3300046679 | Ga0495623_0121122 | Ga0495623_0121122_640_1329 | 229 |
| 1399 | 3300046679 | Ga0495623_0221644 | Ga0495623_0221644_206_895 | 229 |
| 1400 | 3300046679 | Ga0495623_0229697 | Ga0495623_0229697_110_799 | 229 |
| 1401 | 3300046680 | Ga0495646_0000108 | Ga0495646_0000108_36132_36821 | 229 |
| 1402 | 3300046680 | Ga0495646_0008835 | Ga0495646_0008835_2725_3414 | 229 |
| 1403 | 3300046680 | Ga0495646_0036150 | Ga0495646_0036150_1463_2152 | 229 |
| 1404 | 3300046680 | Ga0495646_0038075 | Ga0495646_0038075_422_1111 | 229 |
| 1405 | 3300046680 | Ga0495646_0130856 | Ga0495646_0130856_329_1018 | 229 |
| 1406 | 3300046680 | Ga0495646_0335635 | Ga0495646_0335635_30_719 | 229 |
| 1407 | 3300046681 | Ga0495647_0147221 | Ga0495647_0147221_44_733 | 229 |
| 1408 | 3300046683 | Ga0495658_0063348 | Ga0495658_0063348_1047_1736 | 229 |
| 1409 | 3300046684 | Ga0495669_0047043 | Ga0495669_0047043_302_991 | 229 |
| 1410 | 3300046684 | Ga0495669_0163732 | Ga0495669_0163732_160_849 | 229 |
| 1411 | 3300046689 | Ga0495613_0023752 | Ga0495613_0023752_131_820 | 229 |
| 1412 | 3300046689 | Ga0495613_0033461 | Ga0495613_0033461_720_1409 | 229 |
| 1413 | 3300046689 | Ga0495613_0051442 | Ga0495613_0051442_1348_2037 | 229 |
| 1414 | 3300046689 | Ga0495613_0059873 | Ga0495613_0059873_1722_2609 | 229 |
| 1415 | 3300046689 | Ga0495613_0084241 | Ga0495613_0084241_647_1336 | 229 |
| 1416 | 3300046690 | Ga0495624_0045158 | Ga0495624_0045158_1409_2098 | 229 |
| 1417 | 3300046690 | Ga0495624_0051446 | Ga0495624_0051446_1480_2169 | 229 |
| 1418 | 3300046690 | Ga0495624_0088134 | Ga0495624_0088134_1139_1828 | 229 |
| 1419 | 3300046690 | Ga0495624_0184366 | Ga0495624_0184366_396_1085 | 229 |
| 1420 | 3300046690 | Ga0495624_0352418 | Ga0495624_0352418_29_718 | 229 |
| 1421 | 3300046691 | Ga0495670_0168609 | Ga0495670_0168609_401_1090 | 229 |
| 1422 | 3300046691 | Ga0495670_0175094 | Ga0495670_0175094_74_763 | 229 |
| 1423 | 3300046692 | Ga0495671_0044706 | Ga0495671_0044706_208_897 | 229 |
| 1424 | 3300046692 | Ga0495671_0070188 | Ga0495671_0070188_427_1116 | 229 |
| 1425 | 3300046694 | Ga0495649_0155308 | Ga0495649_0155308_74_763 | 229 |
| 1426 | 3300046694 | Ga0495649_0207770 | Ga0495649_0207770_38_727 | 229 |
| 1427 | 3300046794 | Ga0495589_0100355 | Ga0495589_0100355_424_1113 | 229 |
| 1428 | 3300046809 | Ga0495600_0000030 | Ga0495600_0000030_52674_53363 | 229 |
| 1429 | 3300046809 | Ga0495600_0027316 | Ga0495600_0027316_2782_3471 | 229 |
| 1430 | 3300046809 | Ga0495600_0043612 | Ga0495600_0043612_807_1496 | 229 |
| 1431 | 3300046809 | Ga0495600_0063327 | Ga0495600_0063327_1537_2226 | 229 |
| 1432 | 3300046809 | Ga0495600_0294515 | Ga0495600_0294515_277_966 | 229 |
| 1433 | 3300047315 | Ga0495581_0018264 | Ga0495581_0018264_1771_2460 | 229 |
| 1434 | 3300047315 | Ga0495581_0082761 | Ga0495581_0082761_555_1244 | 229 |
| 1435 | 3300047315 | Ga0495581_0083147 | Ga0495581_0083147_1091_1780 | 229 |
| 1436 | 3300047315 | Ga0495581_0119174 | Ga0495581_0119174_599_1288 | 229 |
| 1437 | 3300047315 | Ga0495581_0299774 | Ga0495581_0299774_34_723 | 229 |
| 1438 | 3300047317 | Ga0495604_0000030 | Ga0495604_0000030_128322_129011 | 229 |
| 1439 | 3300047317 | Ga0495604_0005878 | Ga0495604_0005878_3940_4629 | 229 |
| 1440 | 3300047317 | Ga0495604_0015814 | Ga0495604_0015814_270_959 | 229 |
| 1441 | 3300047317 | Ga0495604_0087552 | Ga0495604_0087552_402_1091 | 229 |
| 1442 | 3300047317 | Ga0495604_0576171 | Ga0495604_0576171_14_703 | 229 |
| 1443 | 3300047318 | Ga0495636_0024287 | Ga0495636_0024287_218_907 | 229 |
| 1444 | 3300047319 | Ga0495674_0000009 | Ga0495674_0000009_300204_300893 | 229 |
| 1445 | 3300047319 | Ga0495674_0032023 | Ga0495674_0032023_472_1161 | 229 |
| 1446 | 3300047319 | Ga0495674_0043900 | Ga0495674_0043900_562_1251 | 229 |
| 1447 | 3300047319 | Ga0495674_0059204 | Ga0495674_0059204_819_1508 | 229 |
| 1448 | 3300047319 | Ga0495674_0209717 | Ga0495674_0209717_603_1292 | 229 |
| 1449 | 3300047320 | Ga0495672_0136324 | Ga0495672_0136324_389_1078 | 229 |
| 1450 | 3300047320 | Ga0495672_0176554 | Ga0495672_0176554_83_772 | 229 |
| 1451 | 3300047321 | Ga0495676_0044184 | Ga0495676_0044184_123_812 | 229 |
| 1452 | 3300047321 | Ga0495676_0061833 | Ga0495676_0061833_1047_1736 | 229 |
| 1453 | 3300047322 | Ga0495680_0000359 | Ga0495680_0000359_42719_43408 | 229 |
| 1454 | 3300047322 | Ga0495680_0014729 | Ga0495680_0014729_5715_6404 | 229 |
| 1455 | 3300047322 | Ga0495680_0037429 | Ga0495680_0037429_153_842 | 229 |
| 1456 | 3300047322 | Ga0495680_0044412 | Ga0495680_0044412_1878_2567 | 229 |
| 1457 | 3300047323 | Ga0495683_0178535 | Ga0495683_0178535_136_825 | 229 |
| 1458 | 3300047443 | Ga0495687_046499 | Ga0495687_046499_516_1205 | 229 |
| 1459 | 3300047444 | Ga0495675_0000056 | Ga0495675_0000056_58842_59531 | 229 |
| 1460 | 3300047444 | Ga0495675_0014001 | Ga0495675_0014001_859_1548 | 229 |
| 1461 | 3300047444 | Ga0495675_0066287 | Ga0495675_0066287_40_729 | 229 |
| 1462 | 3300047444 | Ga0495675_0428481 | Ga0495675_0428481_52_741 | 229 |
| 1463 | 3300047447 | Ga0495685_058770 | Ga0495685_058770_151_840 | 229 |
| 1464 | 3300047469 | Ga0495673_0049200 | Ga0495673_0049200_477_1166 | 229 |
| 1465 | 3300047469 | Ga0495673_0103431 | Ga0495673_0103431_140_829 | 229 |
| 1466 | 3300047470 | Ga0495681_0075503 | Ga0495681_0075503_131_820 | 229 |
| 1467 | 3300047470 | Ga0495681_0161066 | Ga0495681_0161066_53_742 | 229 |
| 1468 | 3300047471 | Ga0495684_0000056 | Ga0495684_0000056_42741_43430 | 229 |
| 1469 | 3300047471 | Ga0495684_0004111 | Ga0495684_0004111_2791_3480 | 229 |
| 1470 | 3300047471 | Ga0495684_0005946 | Ga0495684_0005946_5036_5725 | 229 |
| 1471 | 3300047471 | Ga0495684_0069462 | Ga0495684_0069462_815_1504 | 229 |
| 1472 | 3300047471 | Ga0495684_0076499 | Ga0495684_0076499_613_1302 | 229 |
| 1473 | 3300047471 | Ga0495684_0228743 | Ga0495684_0228743_578_1267 | 229 |
| 1474 | 3300047471 | Ga0495684_0265057 | Ga0495684_0265057_183_872 | 229 |
| 1475 | 3300047472 | Ga0495686_0015219 | Ga0495686_0015219_2342_3031 | 229 |
| 1476 | 3300047472 | Ga0495686_0030862 | Ga0495686_0030862_487_1176 | 229 |
| 1477 | 3300047472 | Ga0495686_0210289 | Ga0495686_0210289_228_917 | 229 |
| 1478 | 3300047673 | Ga0495593_0004286 | Ga0495593_0004286_2041_2730 | 229 |
| 1479 | 3300047673 | Ga0495593_0021861 | Ga0495593_0021861_1055_1744 | 229 |
| 1480 | 3300047673 | Ga0495593_0031956 | Ga0495593_0031956_1772_2461 | 229 |
| 1481 | 3300047673 | Ga0495593_0112508 | Ga0495593_0112508_682_1371 | 229 |
| 1482 | 3300048088 | Ga0495602_0000006 | Ga0495602_0000006_36263_36952 | 229 |
| 1483 | 3300048088 | Ga0495602_0035000 | Ga0495602_0035000_2379_3068 | 229 |
| 1484 | 3300048088 | Ga0495602_0037935 | Ga0495602_0037935_40_729 | 229 |
| 1485 | 3300048088 | Ga0495602_0058573 | Ga0495602_0058573_2280_2969 | 229 |
| 1486 | 3300048089 | Ga0495614_0074550 | Ga0495614_0074550_111_800 | 229 |
| 1487 | 3300048089 | Ga0495614_0099727 | Ga0495614_0099727_75_764 | 229 |
| 1488 | 3300048091 | Ga0495626_0021749 | Ga0495626_0021749_1810_2499 | 229 |
| 1489 | 3300048091 | Ga0495626_0120419 | Ga0495626_0120419_90_779 | 229 |
| 1490 | 3300048903 | Ga0496100_0010673 | Ga0496100_0010673_447_1136 | 229 |
| 1491 | 3300048903 | Ga0496100_0014447 | Ga0496100_0014447_443_1132 | 229 |
| 1492 | 3300048903 | Ga0496100_0052642 | Ga0496100_0052642_45_734 | 229 |
| 1493 | 3300048903 | Ga0496100_0126790 | Ga0496100_0126790_613_1302 | 229 |
| 1494 | 3300048903 | Ga0496100_0134023 | Ga0496100_0134023_78_767 | 229 |
| 1495 | 3300048903 | Ga0496100_0247364 | Ga0496100_0247364_444_1133 | 229 |
| 1496 | 3300048904 | Ga0496101_0014420 | Ga0496101_0014420_2087_2776 | 229 |
| 1497 | 3300048904 | Ga0496101_0020710 | Ga0496101_0020710_2432_3121 | 229 |
| 1498 | 3300048904 | Ga0496101_0030998 | Ga0496101_0030998_2686_3375 | 229 |
| 1499 | 3300048904 | Ga0496101_0067588 | Ga0496101_0067588_1125_1814 | 229 |
| 1500 | 3300048904 | Ga0496101_0115000 | Ga0496101_0115000_828_1517 | 229 |
| 1501 | 3300048904 | Ga0496101_0159905 | Ga0496101_0159905_737_1426 | 229 |
| 1502 | 3300048904 | Ga0496101_0192160 | Ga0496101_0192160_229_918 | 229 |
| 1503 | 3300048905 | Ga0496102_0033287 | Ga0496102_0033287_2986_3675 | 229 |
| 1504 | 3300048905 | Ga0496102_0035443 | Ga0496102_0035443_1475_2164 | 229 |
| 1505 | 3300048905 | Ga0496102_0072709 | Ga0496102_0072709_45_734 | 229 |
| 1506 | 3300048905 | Ga0496102_0412814 | Ga0496102_0412814_44_733 | 229 |
| 1507 | 3300048905 | Ga0496102_0596085 | Ga0496102_0596085_264_953 | 229 |
| 1508 | 3300048906 | Ga0496103_0018501 | Ga0496103_0018501_2757_3446 | 229 |
| 1509 | 3300048906 | Ga0496103_0019749 | Ga0496103_0019749_1719_2408 | 229 |
| 1510 | 3300048906 | Ga0496103_0043577 | Ga0496103_0043577_324_1013 | 229 |
| 1511 | 3300048906 | Ga0496103_0489692 | Ga0496103_0489692_23_712 | 229 |
| 1512 | 3300048907 | Ga0496104_0004602 | Ga0496104_0004602_1973_2662 | 229 |
| 1513 | 3300048907 | Ga0496104_0005128 | Ga0496104_0005128_10324_11013 | 229 |
| 1514 | 3300048907 | Ga0496104_0009959 | Ga0496104_0009959_3431_4120 | 229 |
| 1515 | 3300048907 | Ga0496104_0013021 | Ga0496104_0013021_2185_2874 | 229 |
| 1516 | 3300048907 | Ga0496104_0045400 | Ga0496104_0045400_788_1477 | 229 |
| 1517 | 3300048907 | Ga0496104_0056950 | Ga0496104_0056950_2738_3427 | 229 |
| 1518 | 3300048907 | Ga0496104_0132117 | Ga0496104_0132117_492_1181 | 229 |
| 1519 | 3300048908 | Ga0496105_0004236 | Ga0496105_0004236_9587_10276 | 229 |
| 1520 | 3300048908 | Ga0496105_0004815 | Ga0496105_0004815_6965_7654 | 229 |
| 1521 | 3300048908 | Ga0496105_0008227 | Ga0496105_0008227_3722_4411 | 229 |
| 1522 | 3300048908 | Ga0496105_0079072 | Ga0496105_0079072_1145_1834 | 229 |
| 1523 | 3300048908 | Ga0496105_0264103 | Ga0496105_0264103_222_911 | 229 |
| 1524 | 3300048909 | Ga0496106_0000711 | Ga0496106_0000711_20243_20932 | 229 |
| 1525 | 3300048909 | Ga0496106_0018106 | Ga0496106_0018106_3985_4674 | 229 |
| 1526 | 3300048909 | Ga0496106_0020447 | Ga0496106_0020447_3894_4583 | 229 |
| 1527 | 3300048909 | Ga0496106_0043979 | Ga0496106_0043979_141_830 | 229 |
| 1528 | 3300048909 | Ga0496106_0046610 | Ga0496106_0046610_1309_1998 | 229 |
| 1529 | 3300048909 | Ga0496106_0154309 | Ga0496106_0154309_910_1599 | 229 |
| 1530 | 3300048909 | Ga0496106_0227939 | Ga0496106_0227939_389_1078 | 229 |
| 1531 | 3300048909 | Ga0496106_0247834 | Ga0496106_0247834_561_1250 | 229 |
| 1532 | 3300048910 | Ga0496107_0001289 | Ga0496107_0001289_10677_11366 | 229 |
| 1533 | 3300048910 | Ga0496107_0016804 | Ga0496107_0016804_3968_4657 | 229 |
| 1534 | 3300048910 | Ga0496107_0024770 | Ga0496107_0024770_1330_2019 | 229 |
| 1535 | 3300048910 | Ga0496107_0105838 | Ga0496107_0105838_416_1105 | 229 |
| 1536 | 3300048910 | Ga0496107_0200620 | Ga0496107_0200620_357_1046 | 229 |
| 1537 | 3300048910 | Ga0496107_0203947 | Ga0496107_0203947_62_751 | 229 |
| 1538 | 3300048910 | Ga0496107_0343138 | Ga0496107_0343138_386_1075 | 229 |
| 1539 | 3300048911 | Ga0496108_0002311 | Ga0496108_0002311_11831_12520 | 229 |
| 1540 | 3300048911 | Ga0496108_0002638 | Ga0496108_0002638_11391_12080 | 229 |
| 1541 | 3300048911 | Ga0496108_0027611 | Ga0496108_0027611_1656_2345 | 229 |
| 1542 | 3300048911 | Ga0496108_0037748 | Ga0496108_0037748_1722_2411 | 229 |
| 1543 | 3300048911 | Ga0496108_0249416 | Ga0496108_0249416_675_1364 | 229 |
| 1544 | 3300048911 | Ga0496108_0600121 | Ga0496108_0600121_53_742 | 229 |
| 1545 | 3300048912 | Ga0496109_0000199 | Ga0496109_0000199_50158_50847 | 229 |
| 1546 | 3300048912 | Ga0496109_0061716 | Ga0496109_0061716_671_1360 | 229 |
| 1547 | 3300048912 | Ga0496109_0175625 | Ga0496109_0175625_1149_1838 | 229 |
| 1548 | 3300048912 | Ga0496109_0205373 | Ga0496109_0205373_548_1237 | 229 |
| 1549 | 3300048912 | Ga0496109_0244081 | Ga0496109_0244081_664_1353 | 229 |
| 1550 | 3300048912 | Ga0496109_0407023 | Ga0496109_0407023_313_1002 | 229 |
| 1551 | 3300048912 | Ga0496109_0419430 | Ga0496109_0419430_383_1072 | 229 |
| 1552 | 3300048913 | Ga0496110_0006468 | Ga0496110_0006468_6952_7641 | 229 |
| 1553 | 3300048913 | Ga0496110_0012653 | Ga0496110_0012653_4389_5078 | 229 |
| 1554 | 3300048913 | Ga0496110_0047003 | Ga0496110_0047003_2762_3451 | 229 |
| 1555 | 3300048913 | Ga0496110_0060991 | Ga0496110_0060991_234_923 | 229 |
| 1556 | 3300048913 | Ga0496110_0118742 | Ga0496110_0118742_1421_2110 | 229 |
| 1557 | 3300048913 | Ga0496110_0254135 | Ga0496110_0254135_784_1473 | 229 |
| 1558 | 3300048913 | Ga0496110_0388018 | Ga0496110_0388018_571_1260 | 229 |
| 1559 | 3300048913 | Ga0496110_0405447 | Ga0496110_0405447_31_720 | 229 |
| 1560 | 3300048913 | Ga0496110_0407357 | Ga0496110_0407357_350_1039 | 229 |
| 1561 | 3300048914 | Ga0496111_0021807 | Ga0496111_0021807_1914_2603 | 229 |
| 1562 | 3300048914 | Ga0496111_0064634 | Ga0496111_0064634_1596_2285 | 229 |
| 1563 | 3300048914 | Ga0496111_0130779 | Ga0496111_0130779_202_891 | 229 |
| 1564 | 3300048914 | Ga0496111_0161642 | Ga0496111_0161642_299_988 | 229 |
| 1565 | 3300048915 | Ga0496112_0000046 | Ga0496112_0000046_7425_8114 | 229 |
| 1566 | 3300048915 | Ga0496112_0001162 | Ga0496112_0001162_12011_12700 | 229 |
| 1567 | 3300048915 | Ga0496112_0015605 | Ga0496112_0015605_4874_5563 | 229 |
| 1568 | 3300048915 | Ga0496112_0069515 | Ga0496112_0069515_1239_1928 | 229 |
| 1569 | 3300048915 | Ga0496112_0080282 | Ga0496112_0080282_1718_2407 | 229 |
| 1570 | 3300048915 | Ga0496112_0085914 | Ga0496112_0085914_2310_2999 | 229 |
| 1571 | 3300048915 | Ga0496112_0095268 | Ga0496112_0095268_511_1200 | 229 |
| 1572 | 3300048915 | Ga0496112_0192676 | Ga0496112_0192676_492_1181 | 229 |
| 1573 | 3300048915 | Ga0496112_0291754 | Ga0496112_0291754_409_1098 | 229 |
| 1574 | 3300048915 | Ga0496112_0387804 | Ga0496112_0387804_40_729 | 229 |
| 1575 | 3300048915 | Ga0496112_0737222 | Ga0496112_0737222_112_801 | 229 |
| 1576 | 3300048916 | Ga0496113_0017700 | Ga0496113_0017700_522_1211 | 229 |
| 1577 | 3300048916 | Ga0496113_0039786 | Ga0496113_0039786_1246_1935 | 229 |
| 1578 | 3300048916 | Ga0496113_0064533 | Ga0496113_0064533_522_1211 | 229 |
| 1579 | 3300048916 | Ga0496113_0118609 | Ga0496113_0118609_30_719 | 229 |
| 1580 | 3300048916 | Ga0496113_0193821 | Ga0496113_0193821_173_862 | 229 |
| 1581 | 3300048916 | Ga0496113_0223787 | Ga0496113_0223787_367_1056 | 229 |
| 1582 | 3300048917 | Ga0496114_0021980 | Ga0496114_0021980_1213_1902 | 229 |
| 1583 | 3300048917 | Ga0496114_0070947 | Ga0496114_0070947_754_1443 | 229 |
| 1584 | 3300048917 | Ga0496114_0116723 | Ga0496114_0116723_1299_1988 | 229 |
| 1585 | 3300048917 | Ga0496114_0179380 | Ga0496114_0179380_1103_1792 | 229 |
| 1586 | 3300048917 | Ga0496114_0755522 | Ga0496114_0755522_138_827 | 229 |
| 1587 | 3300048918 | Ga0496115_0011470 | Ga0496115_0011470_682_1371 | 229 |
| 1588 | 3300048918 | Ga0496115_0036128 | Ga0496115_0036128_3001_3690 | 229 |
| 1589 | 3300048918 | Ga0496115_0047512 | Ga0496115_0047512_1107_1796 | 229 |
| 1590 | 3300048918 | Ga0496115_0095360 | Ga0496115_0095360_1603_2292 | 229 |
| 1591 | 3300048918 | Ga0496115_0135307 | Ga0496115_0135307_167_856 | 229 |
| 1592 | 3300048918 | Ga0496115_0146895 | Ga0496115_0146895_825_1514 | 229 |
| 1593 | 3300048918 | Ga0496115_0160111 | Ga0496115_0160111_482_1171 | 229 |
| 1594 | 3300048918 | Ga0496115_0246317 | Ga0496115_0246317_68_757 | 229 |
| 1595 | 3300048918 | Ga0496115_0319997 | Ga0496115_0319997_440_1129 | 229 |
| 1596 | 3300048919 | Ga0496116_0019766 | Ga0496116_0019766_989_1678 | 229 |
| 1597 | 3300048919 | Ga0496116_0045659 | Ga0496116_0045659_735_1424 | 229 |
| 1598 | 3300048919 | Ga0496116_0082233 | Ga0496116_0082233_130_822 | 229 |
| 1599 | 3300048919 | Ga0496116_0153831 | Ga0496116_0153831_299_988 | 229 |
| 1600 | 3300048920 | Ga0496117_0016897 | Ga0496117_0016897_4851_5540 | 229 |
| 1601 | 3300048920 | Ga0496117_0017567 | Ga0496117_0017567_315_1004 | 229 |
| 1602 | 3300048920 | Ga0496117_0030590 | Ga0496117_0030590_429_1118 | 229 |
| 1603 | 3300048920 | Ga0496117_0159904 | Ga0496117_0159904_567_1256 | 229 |
| 1604 | 3300048921 | Ga0496118_0003787 | Ga0496118_0003787_4026_4715 | 229 |
| 1605 | 3300048921 | Ga0496118_0007612 | Ga0496118_0007612_8050_8739 | 229 |
| 1606 | 3300048921 | Ga0496118_0020426 | Ga0496118_0020426_3614_4306 | 229 |
| 1607 | 3300048921 | Ga0496118_0037280 | Ga0496118_0037280_143_832 | 229 |
| 1608 | 3300048921 | Ga0496118_0088852 | Ga0496118_0088852_603_1292 | 229 |
| 1609 | 3300048921 | Ga0496118_0095855 | Ga0496118_0095855_1221_1910 | 229 |
| 1610 | 3300048921 | Ga0496118_0111372 | Ga0496118_0111372_734_1423 | 229 |
| 1611 | 3300048921 | Ga0496118_0142967 | Ga0496118_0142967_755_1444 | 229 |
| 1612 | 3300048922 | Ga0496119_0035894 | Ga0496119_0035894_305_994 | 229 |
| 1613 | 3300048922 | Ga0496119_0045713 | Ga0496119_0045713_1901_2590 | 229 |
| 1614 | 3300048922 | Ga0496119_0083319 | Ga0496119_0083319_492_1181 | 229 |
| 1615 | 3300048922 | Ga0496119_0084105 | Ga0496119_0084105_726_1415 | 229 |
| 1616 | 3300048923 | Ga0496120_0010175 | Ga0496120_0010175_3670_4359 | 229 |
| 1617 | 3300048923 | Ga0496120_0030166 | Ga0496120_0030166_418_1107 | 229 |
| 1618 | 3300048923 | Ga0496120_0052545 | Ga0496120_0052545_948_1637 | 229 |
| 1619 | 3300048923 | Ga0496120_0073318 | Ga0496120_0073318_332_1024 | 229 |
| 1620 | 3300048923 | Ga0496120_0167655 | Ga0496120_0167655_271_960 | 229 |
| 1621 | 3300048924 | Ga0496121_0000287 | Ga0496121_0000287_28640_29329 | 229 |
| 1622 | 3300048924 | Ga0496121_0001942 | Ga0496121_0001942_28369_29058 | 229 |
| 1623 | 3300048924 | Ga0496121_0009401 | Ga0496121_0009401_4107_4796 | 229 |
| 1624 | 3300048924 | Ga0496121_0014663 | Ga0496121_0014663_7005_7697 | 229 |
| 1625 | 3300048924 | Ga0496121_0015686 | Ga0496121_0015686_5081_5770 | 229 |
| 1626 | 3300048924 | Ga0496121_0023934 | Ga0496121_0023934_3697_4386 | 229 |
| 1627 | 3300048924 | Ga0496121_0032181 | Ga0496121_0032181_1906_2595 | 229 |
| 1628 | 3300048924 | Ga0496121_0046396 | Ga0496121_0046396_2668_3357 | 229 |
| 1629 | 3300048924 | Ga0496121_0080419 | Ga0496121_0080419_1820_2509 | 229 |
| 1630 | 3300048924 | Ga0496121_0092574 | Ga0496121_0092574_156_845 | 229 |
| 1631 | 3300048924 | Ga0496121_0128225 | Ga0496121_0128225_817_1506 | 229 |
| 1632 | 3300048924 | Ga0496121_0154429 | Ga0496121_0154429_89_778 | 229 |
| 1633 | 3300048924 | Ga0496121_0163259 | Ga0496121_0163259_922_1611 | 229 |
| 1634 | 3300048924 | Ga0496121_0282900 | Ga0496121_0282900_169_858 | 229 |
| 1635 | 3300048925 | Ga0496122_0036761 | Ga0496122_0036761_2536_3225 | 229 |
| 1636 | 3300048925 | Ga0496122_0042938 | Ga0496122_0042938_1755_2444 | 229 |
| 1637 | 3300048925 | Ga0496122_0072985 | Ga0496122_0072985_630_1319 | 229 |
| 1638 | 3300048925 | Ga0496122_0234012 | Ga0496122_0234012_331_1020 | 229 |
| 1639 | 3300048926 | Ga0496123_0005902 | Ga0496123_0005902_5345_6034 | 229 |
| 1640 | 3300048926 | Ga0496123_0063443 | Ga0496123_0063443_262_951 | 229 |
| 1641 | 3300048927 | Ga0496124_0011609 | Ga0496124_0011609_1084_1773 | 229 |
| 1642 | 3300048927 | Ga0496124_0031707 | Ga0496124_0031707_1049_1738 | 229 |
| 1643 | 3300048927 | Ga0496124_0085575 | Ga0496124_0085575_1826_2515 | 229 |
| 1644 | 3300048927 | Ga0496124_0166271 | Ga0496124_0166271_232_921 | 229 |
| 1645 | 3300048927 | Ga0496124_0197978 | Ga0496124_0197978_228_917 | 229 |
| 1646 | 3300048927 | Ga0496124_0307426 | Ga0496124_0307426_206_895 | 229 |
| 1647 | 3300048927 | Ga0496124_0336547 | Ga0496124_0336547_124_813 | 229 |
| 1648 | 3300048927 | Ga0496124_0339590 | Ga0496124_0339590_345_1034 | 229 |
| 1649 | 3300048928 | Ga0496125_0000202 | Ga0496125_0000202_63766_64455 | 229 |
| 1650 | 3300048928 | Ga0496125_0003766 | Ga0496125_0003766_15376_16065 | 229 |
| 1651 | 3300048928 | Ga0496125_0005011 | Ga0496125_0005011_14112_14801 | 229 |
| 1652 | 3300048928 | Ga0496125_0041192 | Ga0496125_0041192_1230_1919 | 229 |
| 1653 | 3300048928 | Ga0496125_0056165 | Ga0496125_0056165_2073_2762 | 229 |
| 1654 | 3300048928 | Ga0496125_0067491 | Ga0496125_0067491_1973_2662 | 229 |
| 1655 | 3300048928 | Ga0496125_0118463 | Ga0496125_0118463_281_970 | 229 |
| 1656 | 3300048928 | Ga0496125_0158463 | Ga0496125_0158463_478_1167 | 229 |
| 1657 | 3300048929 | Ga0496126_0002882 | Ga0496126_0002882_14895_15584 | 229 |
| 1658 | 3300048929 | Ga0496126_0003892 | Ga0496126_0003892_13415_14104 | 229 |
| 1659 | 3300048929 | Ga0496126_0008415 | Ga0496126_0008415_7875_8564 | 229 |
| 1660 | 3300048929 | Ga0496126_0031108 | Ga0496126_0031108_3822_4511 | 229 |
| 1661 | 3300048929 | Ga0496126_0032010 | Ga0496126_0032010_3530_4219 | 229 |
| 1662 | 3300048929 | Ga0496126_0033666 | Ga0496126_0033666_383_1072 | 229 |
| 1663 | 3300048929 | Ga0496126_0072311 | Ga0496126_0072311_1213_1902 | 229 |
| 1664 | 3300048929 | Ga0496126_0114370 | Ga0496126_0114370_1336_2025 | 229 |
| 1665 | 3300048929 | Ga0496126_0122829 | Ga0496126_0122829_269_958 | 229 |
| 1666 | 3300048929 | Ga0496126_0138685 | Ga0496126_0138685_120_809 | 229 |
| 1667 | 3300048929 | Ga0496126_0139996 | Ga0496126_0139996_1320_2009 | 229 |
| 1668 | 3300048929 | Ga0496126_0142683 | Ga0496126_0142683_1205_1894 | 229 |
| 1669 | 3300048929 | Ga0496126_0161527 | Ga0496126_0161527_207_896 | 229 |
| 1670 | 3300048929 | Ga0496126_0255259 | Ga0496126_0255259_49_738 | 229 |
| 1671 | 3300048929 | Ga0496126_0261404 | Ga0496126_0261404_630_1319 | 229 |
| 1672 | 3300048929 | Ga0496126_0511172 | Ga0496126_0511172_56_745 | 229 |
| 1673 | 3300049460 | Ga0495682_0056664 | Ga0495682_0056664_383_1072 | 229 |
| 1674 | 3300049460 | Ga0495682_0097827 | Ga0495682_0097827_40_729 | 229 |
| 1675 | 3300049568 | Ga0501031_0074827 | Ga0501031_0074827_919_1608 | 229 |
| 1676 | 3300049572 | Ga0501036_0129877 | Ga0501036_0129877_466_1155 | 229 |
| 1677 | 3300049572 | Ga0501036_0294811 | Ga0501036_0294811_429_1118 | 229 |
| 1678 | 3300049572 | Ga0501036_0583164 | Ga0501036_0583164_119_808 | 229 |
| 1679 | 3300049575 | Ga0501039_0021985 | Ga0501039_0021985_2616_3305 | 229 |
| 1680 | 3300049575 | Ga0501039_0146764 | Ga0501039_0146764_951_1640 | 229 |
| 1681 | 3300049576 | Ga0501040_0032762 | Ga0501040_0032762_1505_2194 | 229 |
| 1682 | 3300049577 | Ga0501041_0056509 | Ga0501041_0056509_1159_1848 | 229 |
| 1683 | 3300049578 | Ga0501042_0040564 | Ga0501042_0040564_1638_2327 | 229 |
| 1684 | 3300049578 | Ga0501042_0248420 | Ga0501042_0248420_146_835 | 229 |
| 1685 | 3300049578 | Ga0501042_0394671 | Ga0501042_0394671_144_833 | 229 |
| 1686 | 3300049580 | Ga0501046_0094632 | Ga0501046_0094632_1349_2038 | 229 |
| 1687 | 3300049582 | Ga0501048_0028191 | Ga0501048_0028191_1654_2343 | 229 |
| 1688 | 3300049583 | Ga0501067_0041024 | Ga0501067_0041024_1169_1858 | 229 |
| 1689 | 3300049586 | Ga0501070_0008301 | Ga0501070_0008301_7347_8036 | 229 |
| 1690 | 3300049586 | Ga0501070_0515507 | Ga0501070_0515507_196_885 | 229 |
| 1691 | 3300049587 | Ga0501071_0003783 | Ga0501071_0003783_7404_8093 | 229 |
| 1692 | 3300049587 | Ga0501071_0230976 | Ga0501071_0230976_175_864 | 229 |
| 1693 | 3300049588 | Ga0501072_0002876 | Ga0501072_0002876_6901_7590 | 229 |
| 1694 | 3300049588 | Ga0501072_0403786 | Ga0501072_0403786_11_700 | 229 |
| 1695 | 3300049588 | Ga0501072_0613190 | Ga0501072_0613190_125_814 | 229 |
| 1696 | 3300049590 | Ga0501074_0085507 | Ga0501074_0085507_190_879 | 229 |
| 1697 | 3300049590 | Ga0501074_0121706 | Ga0501074_0121706_539_1228 | 229 |
| 1698 | 3300049591 | Ga0501075_0006858 | Ga0501075_0006858_5139_5828 | 229 |
| 1699 | 3300049592 | Ga0501076_0023255 | Ga0501076_0023255_455_1144 | 229 |
| 1700 | 3300049592 | Ga0501076_0058516 | Ga0501076_0058516_631_1320 | 229 |
| 1701 | 3300049592 | Ga0501076_0303950 | Ga0501076_0303950_117_806 | 229 |
| 1702 | 3300049593 | Ga0501077_0090139 | Ga0501077_0090139_23_712 | 229 |
| 1703 | 3300049741 | Ga0501079_0023093 | Ga0501079_0023093_1200_1889 | 229 |
| 1704 | 3300049742 | Ga0501080_0270294 | Ga0501080_0270294_294_983 | 229 |
| 1705 | 3300049743 | Ga0501081_0005285 | Ga0501081_0005285_21_710 | 229 |
| 1706 | 3300049744 | Ga0501083_0219049 | Ga0501083_0219049_331_1020 | 229 |
| 1707 | 3300049822 | Ga0501035_0212261 | Ga0501035_0212261_954_1643 | 229 |
| 1708 | 3300049823 | Ga0501044_0095422 | Ga0501044_0095422_37_726 | 229 |
| 1709 | 3300049823 | Ga0501044_0795634 | Ga0501044_0795634_51_740 | 229 |
| 1710 | 3300049824 | Ga0501045_0064327 | Ga0501045_0064327_381_1070 | 229 |
| 1711 | 3300050490 | nmdc:mga03n38_2816_c1 | nmdc:mga03n38_2816_c1_2015_2704 | 229 |
| 1712 | 3300050491 | nmdc:mga00v17_106846_c1 | nmdc:mga00v17_106846_c1_362_1051 | 229 |
| 1713 | 3300050491 | nmdc:mga00v17_51710_c1 | nmdc:mga00v17_51710_c1_965_1654 | 229 |
| 1714 | 3300050491 | nmdc:mga00v17_87086_c2 | nmdc:mga00v17_87086_c2_306_995 | 229 |
| 1715 | 3300050492 | nmdc:mga0yw44_101029_c1 | nmdc:mga0yw44_101029_c1_555_1244 | 229 |
| 1716 | 3300050492 | nmdc:mga0yw44_133021_c1 | nmdc:mga0yw44_133021_c1_631_1320 | 229 |
| 1717 | 3300050492 | nmdc:mga0yw44_140167_c1 | nmdc:mga0yw44_140167_c1_454_1143 | 229 |
| 1718 | 3300050492 | nmdc:mga0yw44_1557_c2 | nmdc:mga0yw44_1557_c2_4417_5106 | 229 |
| 1719 | 3300050492 | nmdc:mga0yw44_171330_c1 | nmdc:mga0yw44_171330_c1_250_939 | 229 |
| 1720 | 3300050492 | nmdc:mga0yw44_18365_c1 | nmdc:mga0yw44_18365_c1_2354_3043 | 229 |
| 1721 | 3300050492 | nmdc:mga0yw44_301532_c1 | nmdc:mga0yw44_301532_c1_169_858 | 229 |
| 1722 | 3300050492 | nmdc:mga0yw44_34242_c1 | nmdc:mga0yw44_34242_c1_62_751 | 229 |
| 1723 | 3300050492 | nmdc:mga0yw44_46341_c1 | nmdc:mga0yw44_46341_c1_78_767 | 229 |
| 1724 | 3300050494 | nmdc:mga06z11_118171_c1 | nmdc:mga06z11_118171_c1_50_739 | 229 |
| 1725 | 3300050494 | nmdc:mga06z11_152987_c1 | nmdc:mga06z11_152987_c1_571_1260 | 229 |
| 1726 | 3300050494 | nmdc:mga06z11_222971_c1 | nmdc:mga06z11_222971_c1_337_1026 | 229 |
| 1727 | 3300050494 | nmdc:mga06z11_24330_c1 | nmdc:mga06z11_24330_c1_1698_2387 | 229 |
| 1728 | 3300050494 | nmdc:mga06z11_278326_c1 | nmdc:mga06z11_278326_c1_280_969 | 229 |
| 1729 | 3300050494 | nmdc:mga06z11_51828_c1 | nmdc:mga06z11_51828_c1_126_815 | 229 |
| 1730 | 3300050495 | nmdc:mga04h51_86204_c1 | nmdc:mga04h51_86204_c1_357_1046 | 229 |
| 1731 | 3300050496 | nmdc:mga07m45_12747_c1 | nmdc:mga07m45_12747_c1_1645_2334 | 229 |
| 1732 | 3300050496 | nmdc:mga07m45_52719_c1 | nmdc:mga07m45_52719_c1_846_1535 | 229 |
| 1733 | 3300050496 | nmdc:mga07m45_58808_c1 | nmdc:mga07m45_58808_c1_409_1098 | 229 |
| 1734 | 3300050496 | nmdc:mga07m45_67175_c1 | nmdc:mga07m45_67175_c1_603_1292 | 229 |
| 1735 | 3300050496 | nmdc:mga07m45_7177_c1 | nmdc:mga07m45_7177_c1_3373_4062 | 229 |
| 1736 | 3300050507 | nmdc:mga05p37_14418_c1 | nmdc:mga05p37_14418_c1_2680_3369 | 229 |
| 1737 | 3300050507 | nmdc:mga05p37_573079_c1 | nmdc:mga05p37_573079_c1_127_816 | 229 |
| 1738 | 3300050507 | nmdc:mga05p37_60006_c1 | nmdc:mga05p37_60006_c1_2547_3236 | 229 |
| 1739 | 3300050508 | nmdc:mga09592_231191_c1 | nmdc:mga09592_231191_c1_445_1134 | 229 |
| 1740 | 3300050508 | nmdc:mga09592_307163_c1 | nmdc:mga09592_307163_c1_280_969 | 229 |
| 1741 | 3300050510 | nmdc:mga06r32_222121_c1 | nmdc:mga06r32_222121_c1_415_1104 | 229 |
| 1742 | 3300050510 | nmdc:mga06r32_82065_c1 | nmdc:mga06r32_82065_c1_1381_2070 | 229 |
| 1743 | 3300050511 | nmdc:mga08y16_62194_c1 | nmdc:mga08y16_62194_c1_2508_3197 | 229 |
| 1744 | 3300050512 | nmdc:mga0n895_107881_c1 | nmdc:mga0n895_107881_c1_1924_2613 | 229 |
| 1745 | 3300050512 | nmdc:mga0n895_131212_c1 | nmdc:mga0n895_131212_c1_1564_2253 | 229 |
| 1746 | 3300050512 | nmdc:mga0n895_336291_c1 | nmdc:mga0n895_336291_c1_603_1292 | 229 |
| 1747 | 3300050513 | nmdc:mga0rr50_111459_c1 | nmdc:mga0rr50_111459_c1_1132_1821 | 229 |
| 1748 | 3300050513 | nmdc:mga0rr50_158590_c1 | nmdc:mga0rr50_158590_c1_84_773 | 229 |
| 1749 | 3300050514 | nmdc:mga08x19_40995_c1 | nmdc:mga08x19_40995_c1_1177_1866 | 229 |
| 1750 | 3300050514 | nmdc:mga08x19_61863_c1 | nmdc:mga08x19_61863_c1_388_1077 | 229 |
| 1751 | 3300050514 | nmdc:mga08x19_96101_c1 | nmdc:mga08x19_96101_c1_948_1637 | 229 |
| 1752 | 3300050515 | nmdc:mga0a205_105235_c1 | nmdc:mga0a205_105235_c1_947_1636 | 229 |
| 1753 | 3300050515 | nmdc:mga0a205_181206_c1 | nmdc:mga0a205_181206_c1_1077_1766 | 229 |
| 1754 | 3300050515 | nmdc:mga0a205_210214_c1 | nmdc:mga0a205_210214_c1_1120_1809 | 229 |
| 1755 | 3300050516 | nmdc:mga0sz30_102011_c1 | nmdc:mga0sz30_102011_c1_508_1197 | 229 |
| 1756 | 3300053077 | Ga0495601_0000007 | Ga0495601_0000007_329106_329795 | 229 |
| 1757 | 3300053077 | Ga0495601_0021798 | Ga0495601_0021798_2259_2948 | 229 |
| 1758 | 3300053077 | Ga0495601_0022270 | Ga0495601_0022270_821_1510 | 229 |
| 1759 | 3300053077 | Ga0495601_0103437 | Ga0495601_0103437_339_1028 | 229 |
| 1760 | 3300053077 | Ga0495601_0114458 | Ga0495601_0114458_969_1658 | 229 |
| 1761 | 3300053077 | Ga0495601_0163873 | Ga0495601_0163873_533_1222 | 229 |
| 1762 | 3300053077 | Ga0495601_0250686 | Ga0495601_0250686_45_734 | 229 |
| 1763 | 3300053077 | Ga0495601_0326564 | Ga0495601_0326564_287_976 | 229 |
| 1764 | 3300053078 | Ga0495612_0000053 | Ga0495612_0000053_9459_10148 | 229 |
| 1765 | 3300053078 | Ga0495612_0008986 | Ga0495612_0008986_280_969 | 229 |
| 1766 | 3300053078 | Ga0495612_0038913 | Ga0495612_0038913_151_840 | 229 |
| 1767 | 3300053079 | Ga0500610_0190806 | Ga0500610_0190806_45_734 | 229 |
| 1768 | 3300053080 | Ga0500635_0024476 | Ga0500635_0024476_794_1483 | 229 |
| 1769 | 3300053080 | Ga0500635_0035831 | Ga0500635_0035831_928_1617 | 229 |
| 1770 | 3300053084 | Ga0495595_0000031 | Ga0495595_0000031_23944_24633 | 229 |
| 1771 | 3300053084 | Ga0495595_0013466 | Ga0495595_0013466_2591_3280 | 229 |
| 1772 | 3300053084 | Ga0495595_0017842 | Ga0495595_0017842_632_1321 | 229 |
| 1773 | 3300053084 | Ga0495595_0149988 | Ga0495595_0149988_94_783 | 229 |
| 1774 | 3300053085 | Ga0495619_0000023 | Ga0495619_0000023_129235_129924 | 229 |
| 1775 | 3300053085 | Ga0495619_0000883 | Ga0495619_0000883_9594_10283 | 229 |
| 1776 | 3300053085 | Ga0495619_0016768 | Ga0495619_0016768_316_1005 | 229 |
| 1777 | 3300053085 | Ga0495619_0018161 | Ga0495619_0018161_2572_3261 | 229 |
| 1778 | 3300053085 | Ga0495619_0020815 | Ga0495619_0020815_2526_3215 | 229 |
| 1779 | 3300053085 | Ga0495619_0031212 | Ga0495619_0031212_2590_3279 | 229 |
| 1780 | 3300053085 | Ga0495619_0043382 | Ga0495619_0043382_208_897 | 229 |
| 1781 | 3300053085 | Ga0495619_0083414 | Ga0495619_0083414_399_1088 | 229 |
| 1782 | 3300053086 | Ga0500578_0065518 | Ga0500578_0065518_281_970 | 229 |
| 1783 | 3300053087 | Ga0500643_000185 | Ga0500643_000185_20974_21663 | 229 |
| 1784 | 3300053087 | Ga0500643_090767 | Ga0500643_090767_128_817 | 229 |
| 1785 | 3300053089 | Ga0500581_043520 | Ga0500581_043520_1187_1876 | 229 |
| 1786 | 3300053090 | Ga0500646_0031502 | Ga0500646_0031502_466_1155 | 229 |
| 1787 | 3300053091 | Ga0500647_0023235 | Ga0500647_0023235_589_1278 | 229 |
| 1788 | 3300053092 | Ga0500583_0002146 | Ga0500583_0002146_3336_4025 | 229 |
| 1789 | 3300053092 | Ga0500583_0066074 | Ga0500583_0066074_103_792 | 229 |
| 1790 | 3300053093 | Ga0500651_0013269 | Ga0500651_0013269_1870_2559 | 229 |
| 1791 | 3300053093 | Ga0500651_0050912 | Ga0500651_0050912_487_1176 | 229 |
| 1792 | 3300053093 | Ga0500651_0177567 | Ga0500651_0177567_215_904 | 229 |
| 1793 | 3300053093 | Ga0500651_0268026 | Ga0500651_0268026_125_814 | 229 |
| 1794 | 3300053094 | Ga0500566_0004635 | Ga0500566_0004635_3833_4522 | 229 |
| 1795 | 3300053094 | Ga0500566_0006566 | Ga0500566_0006566_4682_5371 | 229 |
| 1796 | 3300053094 | Ga0500566_0035073 | Ga0500566_0035073_1270_1959 | 229 |
| 1797 | 3300053094 | Ga0500566_0117850 | Ga0500566_0117850_27_716 | 229 |
| 1798 | 3300053095 | Ga0500640_010052 | Ga0500640_010052_2873_3562 | 229 |
| 1799 | 3300053096 | Ga0500641_0010909 | Ga0500641_0010909_17_706 | 229 |
| 1800 | 3300053096 | Ga0500641_0034912 | Ga0500641_0034912_139_828 | 229 |
| 1801 | 3300053097 | Ga0500648_117921 | Ga0500648_117921_80_769 | 229 |
| 1802 | 3300053098 | Ga0500650_0005311 | Ga0500650_0005311_4086_4775 | 229 |
| 1803 | 3300053102 | Ga0500554_000916 | Ga0500554_000916_5038_5727 | 229 |
| 1804 | 3300053103 | Ga0500555_002692 | Ga0500555_002692_2669_3358 | 229 |
| 1805 | 3300053103 | Ga0500555_061599 | Ga0500555_061599_160_849 | 229 |
| 1806 | 3300053104 | Ga0500556_0000006 | Ga0500556_0000006_420051_420740 | 229 |
| 1807 | 3300053105 | Ga0500557_000140 | Ga0500557_000140_12002_12691 | 229 |
| 1808 | 3300053108 | Ga0500562_011103 | Ga0500562_011103_121_810 | 229 |
| 1809 | 3300053109 | Ga0500569_000419 | Ga0500569_000419_2155_2844 | 229 |
| 1810 | 3300053109 | Ga0500569_117682 | Ga0500569_117682_96_785 | 229 |
| 1811 | 3300053111 | Ga0500572_000429 | Ga0500572_000429_10509_11198 | 229 |
| 1812 | 3300053111 | Ga0500572_110995 | Ga0500572_110995_30_719 | 229 |
| 1813 | 3300053116 | Ga0500592_000673 | Ga0500592_000673_1991_2680 | 229 |
| 1814 | 3300053116 | Ga0500592_013972 | Ga0500592_013972_412_1101 | 229 |
| 1815 | 3300053117 | Ga0500593_085684 | Ga0500593_085684_31_720 | 229 |
| 1816 | 3300053118 | Ga0500594_0004791 | Ga0500594_0004791_2068_2757 | 229 |
| 1817 | 3300053118 | Ga0500594_0061613 | Ga0500594_0061613_103_792 | 229 |
| 1818 | 3300053119 | Ga0500595_001099 | Ga0500595_001099_13328_14017 | 229 |
| 1819 | 3300053119 | Ga0500595_001384 | Ga0500595_001384_9147_9836 | 229 |
| 1820 | 3300053119 | Ga0500595_003393 | Ga0500595_003393_5791_6480 | 229 |
| 1821 | 3300053119 | Ga0500595_007758 | Ga0500595_007758_1158_1847 | 229 |
| 1822 | 3300053119 | Ga0500595_017224 | Ga0500595_017224_1701_2390 | 229 |
| 1823 | 3300053119 | Ga0500595_058819 | Ga0500595_058819_33_722 | 229 |
| 1824 | 3300053120 | Ga0500597_143176 | Ga0500597_143176_82_771 | 229 |
| 1825 | 3300053122 | Ga0500608_002124 | Ga0500608_002124_617_1306 | 229 |
| 1826 | 3300053122 | Ga0500608_010156 | Ga0500608_010156_2580_3269 | 229 |
| 1827 | 3300053123 | Ga0500614_002969 | Ga0500614_002969_2619_3308 | 229 |
| 1828 | 3300053123 | Ga0500614_034512 | Ga0500614_034512_513_1202 | 229 |
| 1829 | 3300053130 | Ga0500642_0000004 | Ga0500642_0000004_33251_33940 | 229 |
| 1830 | 3300053130 | Ga0500642_0000236 | Ga0500642_0000236_15812_16501 | 229 |
| 1831 | 3300053130 | Ga0500642_0001875 | Ga0500642_0001875_1639_2328 | 229 |
| 1832 | 3300053130 | Ga0500642_0071251 | Ga0500642_0071251_506_1195 | 229 |
| 1833 | 3300053130 | Ga0500642_0089543 | Ga0500642_0089543_237_926 | 229 |
| 1834 | 3300053131 | Ga0500652_002175 | Ga0500652_002175_262_951 | 229 |
| 1835 | 3300053134 | Ga0500658_0054462 | Ga0500658_0054462_793_1482 | 229 |
| 1836 | 3300053134 | Ga0500658_0119218 | Ga0500658_0119218_142_831 | 229 |
| 1837 | 3300053136 | Ga0500559_0000276 | Ga0500559_0000276_10501_11190 | 229 |
| 1838 | 3300053136 | Ga0500559_0009412 | Ga0500559_0009412_3354_4043 | 229 |
| 1839 | 3300053136 | Ga0500559_0015544 | Ga0500559_0015544_1314_2003 | 229 |
| 1840 | 3300053136 | Ga0500559_0035409 | Ga0500559_0035409_1451_2140 | 229 |
| 1841 | 3300053138 | Ga0500564_145540 | Ga0500564_145540_67_756 | 229 |
| 1842 | 3300053139 | Ga0500568_0006697 | Ga0500568_0006697_4084_4773 | 229 |
| 1843 | 3300053139 | Ga0500568_0152491 | Ga0500568_0152491_67_756 | 229 |
| 1844 | 3300053140 | Ga0500573_0080148 | Ga0500573_0080148_101_790 | 229 |
| 1845 | 3300053142 | Ga0500577_0000077 | Ga0500577_0000077_18237_18926 | 229 |
| 1846 | 3300053146 | Ga0500588_0014950 | Ga0500588_0014950_1248_1937 | 229 |
| 1847 | 3300053147 | Ga0500589_148714 | Ga0500589_148714_223_912 | 229 |
| 1848 | 3300053148 | Ga0500590_014962 | Ga0500590_014962_691_1380 | 229 |
| 1849 | 3300053148 | Ga0500590_076420 | Ga0500590_076420_159_848 | 229 |
| 1850 | 3300053150 | Ga0500603_000241 | Ga0500603_000241_9896_10585 | 229 |
| 1851 | 3300053150 | Ga0500603_000290 | Ga0500603_000290_11711_12400 | 229 |
| 1852 | 3300053150 | Ga0500603_048464 | Ga0500603_048464_412_1101 | 229 |
| 1853 | 3300053151 | Ga0500604_0024730 | Ga0500604_0024730_425_1114 | 229 |
| 1854 | 3300053153 | Ga0500616_0000022 | Ga0500616_0000022_418947_419636 | 229 |
| 1855 | 3300053153 | Ga0500616_0011206 | Ga0500616_0011206_2855_3544 | 229 |
| 1856 | 3300053155 | Ga0500620_012565 | Ga0500620_012565_1138_1827 | 229 |
| 1857 | 3300053156 | Ga0500622_0006743 | Ga0500622_0006743_5228_5917 | 229 |
| 1858 | 3300053158 | Ga0500627_0003500 | Ga0500627_0003500_2074_2763 | 229 |
| 1859 | 3300053158 | Ga0500627_0130354 | Ga0500627_0130354_162_851 | 229 |
| 1860 | 3300053159 | Ga0500630_003701 | Ga0500630_003701_3316_4005 | 229 |
| 1861 | 3300053160 | Ga0500633_0021542 | Ga0500633_0021542_824_1513 | 229 |
| 1862 | 3300053161 | Ga0500634_0210818 | Ga0500634_0210818_36_725 | 229 |
| 1863 | 3300053162 | Ga0500638_002209 | Ga0500638_002209_1134_1823 | 229 |
| 1864 | 3300053162 | Ga0500638_044389 | Ga0500638_044389_416_1105 | 229 |
| 1865 | 3300053162 | Ga0500638_097803 | Ga0500638_097803_401_1090 | 229 |
| 1866 | 3300053163 | Ga0500639_000076 | Ga0500639_000076_3689_4378 | 229 |
| 1867 | 3300053177 | Ga0500636_0014113 | Ga0500636_0014113_1270_1959 | 229 |
| 1868 | 3300053177 | Ga0500636_0057046 | Ga0500636_0057046_1455_2144 | 229 |
| 1869 | 3300053177 | Ga0500636_0076645 | Ga0500636_0076645_1143_1832 | 229 |
| 1870 | 3300053177 | Ga0500636_0089923 | Ga0500636_0089923_175_864 | 229 |
| 1871 | 3300053178 | Ga0500637_0004134 | Ga0500637_0004134_857_1546 | 229 |
| 1872 | 3300053178 | Ga0500637_0006951 | Ga0500637_0006951_4009_4698 | 229 |
| 1873 | 3300053178 | Ga0500637_0156863 | Ga0500637_0156863_224_913 | 229 |
| 1874 | 3300053724 | Ga0500570_043566 | Ga0500570_043566_62_751 | 229 |
| 1875 | 3300053729 | Ga0500625_016040 | Ga0500625_016040_2765_3454 | 229 |
| 1876 | 3300053730 | Ga0500645_029606 | Ga0500645_029606_369_1058 | 229 |
| 1877 | 3300053730 | Ga0500645_033089 | Ga0500645_033089_634_1323 | 229 |
| 1878 | 3300053730 | Ga0500645_091294 | Ga0500645_091294_144_833 | 229 |
| 1879 | 3300053731 | Ga0500609_011444 | Ga0500609_011444_64_753 | 229 |
| 1880 | 3300053735 | Ga0500596_000689 | Ga0500596_000689_3679_4368 | 229 |
| 1881 | 3300053735 | Ga0500596_006485 | Ga0500596_006485_500_1189 | 229 |
| 1882 | 3300053735 | Ga0500596_016390 | Ga0500596_016390_318_1007 | 229 |
| 1883 | 3300053736 | Ga0500599_002024 | Ga0500599_002024_561_1250 | 229 |
| 1884 | 3300053737 | Ga0500601_000495 | Ga0500601_000495_1837_2526 | 229 |
| 1885 | 3300053737 | Ga0500601_006551 | Ga0500601_006551_75_764 | 229 |
| 1886 | 3300054114 | Ga0501084_0020051 | Ga0501084_0020051_3098_3787 | 229 |
| 1887 | 3300054114 | Ga0501084_0518444 | Ga0501084_0518444_226_915 | 229 |
| 1888 | 3300054114 | Ga0501084_0972392 | Ga0501084_0972392_10_699 | 229 |
| 1889 | 3300055283 | Ga0500661_000404 | Ga0500661_000404_3704_4393 | 229 |
| 1890 | 3300060353 | Ga0501082_0017993 | Ga0501082_0017993_1795_2484 | 229 |
| 1891 | 3300061734 | Ga0530510_0002632 | Ga0530510_0002632_11518_12207 | 229 |
| 1892 | 3300061734 | Ga0530510_0537565 | Ga0530510_0537565_73_762 | 229 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6ifh-assembly1.cif.gz_A | unphosphorylated spo0f from paenisporosarcina sp. tg-14 | 0.961 | 6 | 120 |
| 6cqg-assembly1.cif.gz_A | yycf effector domain structure without dna bound | 0.9599 | 132 | 226 |
| 4d6x-assembly1.cif.gz_A | crystal structure of the receiver domain of ntrx from brucella abortus | 0.959 | 8 | 120 |
| 3zq7-assembly1.cif.gz_A | the structure of dna-binding domain of response regulator from escherichia coli k-12 | 0.9536 | 128 | 226 |
| 1nat-assembly1.cif.gz_A | crystal structure of spoof from bacillus subtilis | 0.9524 | 6 | 111 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O69730_8_88_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9641 | 5 | 80 | 3.40.50.2300 |
| af_P0AFJ5_1_84_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.959 | 4 | 80 | 3.40.50.2300 |
| af_Q2FXN6_3_86_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.959 | 7 | 86 | 3.40.50.2300 |
| 1p2fA02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9582 | 132 | 226 | 1.10.10.10 |
| af_P9WGN1_116_225_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9562 | 128 | 225 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1B9TDJ5-F1-model_v4 | deleted | 0.9727 | 4 | 225 |
|
| AF-A0A3D3SA73-F1-model_v4 | DNA-binding response regulator | 0.9634 | 5 | 225 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-V4PE34-F1-model_v4 | Fis family transcriptional regulator | 0.9633 | 6 | 226 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A7Y8MEZ3-F1-model_v4 | Response regulator | 0.9613 | 1 | 225 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A522VH33-F1-model_v4 | Response regulator | 0.9607 | 3 | 228 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar