F495970
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1885 | 737 | 1665 | 499 |
Family's Representative Sequence
| Representative Sequence | 3300050492|nmdc:mga0yw44_1056_c1|nmdc:mga0yw44_1056_c1_3311_5014 |
| Length | 567 |
| Sequence | MKRELQSGYVLVNVVSGDCVTAPGPLRRAAGRTLGDADPGVPRPYDDHVPYLSTGGHPSSRRGGDGLLSHDLDPQEKGPRDACGVFGVWAPGEDVAKLTYFGLYALQHRGQESAGIAVSNGRQILVYKEMGLVSQVFDETTLASLNGHLAIGHCRYSTTGASTWQNAQPTFRPTADGSIALGHNGNLINTHELRELVEALPDPEGELPLHTRDVETSTNDTSLVTALLAHHPDTSLEQRALEVLPMLRGAFSFVWMDEDTLYAARDPQGIRPLVLGRLDRGWVVASEDAALATIGASVVREVEPGELIAIDEHGLRTHKFAEPARKGCVFEYVYLARPDATISGQSVHKARVEMGRELARQFPVEADLVMPVPESGTPAAAGYAEESXXXFGQGFVKNAYVGRTFIQPSQTLRQLGIRLKLNALEHMVRGKKLVVVDDSIVRGNTQRAQVRMLREAGALEVHVRISSPPVKWPCFYGIDFATRAELIANGLDDEEIRSSIGADSLGYISLEGMIAATDQASDALCTACFTGEYPIPLPDESLLGKHLLEATLVSPTLGRSLPVLNNP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2515154129 | Salinispora pacifica CNS103 | Isolate | Rhizosphere |
| 2 | 2515154202 | Salinispora pacifica CNT084 | Isolate | Rhizosphere |
| 3 | 2537561592 | Arthrobacter crystallopoietes BAB-32 | Isolate | Rhizosphere |
| 4 | 2547132111 | Streptomyces sp. TOR3209 | Isolate | Rhizosphere |
| 5 | 2554235005 | Streptomyces violaceusniger SPC6 | Isolate | Rhizosphere |
| 6 | 2554235227 | Arthrobacter sp. PAO19 | Isolate | Rhizosphere |
| 7 | 2558860112 | Pseudonocardia acaciae DSM 45401 | Isolate | Unclassified |
| 8 | 2565956761 | Rhodococcus qingshengii BKS 20-40 | Isolate | Rhizosphere |
| 9 | 2582580736 | Prauserella sp. Am3 | Isolate | Unclassified |
| 10 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 11 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 12 | 2585428094 | Herbiconiux sp. YR403 | Isolate | Rhizosphere |
| 13 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 14 | 2616644941 | Streptomyces atratus OK807 | Isolate | Rhizosphere |
| 15 | 2622736605 | Geodermatophilus ruber DSM 45317 | Isolate | Rhizosphere |
| 16 | 2622736626 | Micromonospora rhizosphaerae DSM 45431 | Isolate | Rhizosphere |
| 17 | 2643221548 | Streptomyces sp. Root55 | Isolate | Unclassified |
| 18 | 2643221561 | Nocardioides sp. Root151 | Isolate | Unclassified |
| 19 | 2643221576 | Nocardioides sp. Root614 | Isolate | Unclassified |
| 20 | 2643221578 | Streptomyces sp. Root63 | Isolate | Unclassified |
| 21 | 2643221587 | Streptomyces sp. Root66D1 | Isolate | Unclassified |
| 22 | 2643221590 | Nocardioides sp. Root682 | Isolate | Unclassified |
| 23 | 2643221604 | Nocardioides sp. Root190 | Isolate | Unclassified |
| 24 | 2643221613 | Oerskovia sp. Root22 | Isolate | Unclassified |
| 25 | 2643221615 | Nocardioides sp. Root224 | Isolate | Unclassified |
| 26 | 2643221616 | Leifsonia sp. Root227 | Isolate | Unclassified |
| 27 | 2643221617 | Nocardioides sp. Root79 | Isolate | Unclassified |
| 28 | 2643221620 | Nocardioides sp. Root240 | Isolate | Unclassified |
| 29 | 2643221632 | Leifsonia sp. Root112D2 | Isolate | Unclassified |
| 30 | 2643221641 | Nocardioides sp. Root122 | Isolate | Unclassified |
| 31 | 2643221647 | Streptomyces sp. Root369 | Isolate | Unclassified |
| 32 | 2643221649 | Leifsonia sp. Root4 | Isolate | Unclassified |
| 33 | 2643221657 | Nocardioides sp. Root1257 | Isolate | Unclassified |
| 34 | 2643221670 | Streptomyces sp. Root431 | Isolate | Unclassified |
| 35 | 2643221673 | Streptomyces sp. Root1295 | Isolate | Unclassified |
| 36 | 2643221677 | Streptomyces sp. Root1304 | Isolate | Unclassified |
| 37 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 38 | 2643221682 | Streptomyces sp. Root1319 | Isolate | Unclassified |
| 39 | 2643221687 | Mycobacterium sp. Root135 | Isolate | Unclassified |
| 40 | 2643221690 | Cellulomonas sp. Root485 | Isolate | Unclassified |
| 41 | 2643221692 | Nocardia sp. Root136 | Isolate | Unclassified |
| 42 | 2643221694 | Cellulomonas sp. Root137 | Isolate | Unclassified |
| 43 | 2643221696 | Nocardioides sp. Root140 | Isolate | Unclassified |
| 44 | 2643221711 | Terrabacter sp. Root85 | Isolate | Unclassified |
| 45 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 46 | 2643221715 | Mycobacterium sp. Root265 | Isolate | Unclassified |
| 47 | 2643221721 | Oerskovia sp. Root918 | Isolate | Unclassified |
| 48 | 2643221722 | Cellulomonas sp. Root930 | Isolate | Unclassified |
| 49 | 2654587600 | Glutamicibacter halophytocola KLBMP5180 | Isolate | Unclassified |
| 50 | 2738541264 | Mycobacterium sp. OK889 | Isolate | Unclassified |
| 51 | 2738541272 | Promicromonospora sp. AC04 | Isolate | Unclassified |
| 52 | 2738541274 | Mycobacterium sp. YR708 | Isolate | Unclassified |
| 53 | 2738541305 | Nocardioides sp. CF167 | Isolate | Unclassified |
| 54 | 2738541308 | Rhodococcus sp. OK551 | Isolate | Unclassified |
| 55 | 2738541356 | Mycobacterium sp. OK887 | Isolate | Unclassified |
| 56 | 2738543005 | Rhodococcus sp. OK519 | Isolate | Unclassified |
| 57 | 2738543011 | Rhodococcus sp. OK611 | Isolate | Unclassified |
| 58 | 2738543027 | Promicromonospora sp. CF082 | Isolate | Unclassified |
| 59 | 2738543028 | Mycobacterium sp. YR782 | Isolate | Unclassified |
| 60 | 2738543034 | Rhodococcus sp. OK269 | Isolate | Unclassified |
| 61 | 2739367898 | Nocardioides sp. CF479 | Isolate | Unclassified |
| 62 | 2744054611 | Aldersonia kunmingensis DSM 45001 | Isolate | Rhizosphere |
| 63 | 2751185725 | Microbispora sp. NRRL B-24597 | Isolate | Unclassified |
| 64 | 2751185782 | Actinoplanes subtropicus NRRL B-24665 | Isolate | Rhizosphere |
| 65 | 2751185792 | Kitasatospora arboriphila NRRL B-24581 | Isolate | Unclassified |
| 66 | 2758568522 | Promicromonospora thailandica SAI-039 | Isolate | Unclassified |
| 67 | 2758568621 | Promicromonospora sukumoe SAI-064 | Isolate | Unclassified |
| 68 | 2772190715 | Micromonospora chokoriensis NRRL B-24750 | Isolate | Unclassified |
| 69 | 2773857762 | Nocardioides sp. SAI-095 | Isolate | Unclassified |
| 70 | 2784132109 | Dermacoccus sp. DS28 SAI-028 | Isolate | Unclassified |
| 71 | 2784132148 | Streptomyces sp. E5N91 SAI-083 | Isolate | Unclassified |
| 72 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 73 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 74 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 75 | 2791354901 | Actinophytocola xanthii 11-183 | Isolate | Rhizosphere |
| 76 | 2791355406 | Streptomyces rhizosphaericus NRRL B-24304 | Isolate | Unclassified |
| 77 | 2795385470 | Labedaea rhizosphaerae DSM 45361 | Isolate | Rhizosphere |
| 78 | 2795385472 | Herbihabitans rhizosphaerae DSM 101727 | Isolate | Rhizosphere |
| 79 | 2802429296 | Streptomyces sampsonii KJ40 | Isolate | Rhizosphere |
| 80 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 81 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 82 | 2808606394 | Promicromonospora sp. C35 | Isolate | Unclassified |
| 83 | 2808606439 | Nocardioides sp. SLBN-172 | Isolate | Unclassified |
| 84 | 2808606448 | Streptomyces sp. 193411 | Isolate | Unclassified |
| 85 | 2808606982 | Streptomyces sp. SLBN-118 | Isolate | Unclassified |
| 86 | 2811994874 | Nocardioides sp. SLBN-35 | Isolate | Unclassified |
| 87 | 2811994878 | Nocardioides sp. SLBN-169 | Isolate | Unclassified |
| 88 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 89 | 2811994880 | Cellulomonas sp. SLBN-39 | Isolate | Unclassified |
| 90 | 2811994882 | Terrabacter sp. SLBN-196 | Isolate | Unclassified |
| 91 | 2811994917 | Streptomyces sp. SLBN-134 | Isolate | Unclassified |
| 92 | 2818991318 | Humibacillus xanthopallidus SLBN-155 | Isolate | Unclassified |
| 93 | 2818991458 | Terrabacter sp. 3211 | Isolate | Rhizosphere |
| 94 | 2818991462 | Terrabacter sp. 3264 | Isolate | Rhizosphere |
| 95 | 2818991463 | Streptomyces argenteolus 3259 | Isolate | Rhizosphere |
| 96 | 2818991469 | Terrabacter lapilli 3265 | Isolate | Rhizosphere |
| 97 | 2835188231 | Isoptericola variabilis JZ7 | Isolate | Unclassified |
| 98 | 2839986021 | Cellulosimicrobium cellulans JZ5 | Isolate | Unclassified |
| 99 | 2842134933 | Mycolicibacterium obuense SEMIA 442 | Isolate | Nodule |
| 100 | 2842888712 | Tsukamurella sp. R-71941 | Isolate | Unclassified |
| 101 | 2844841374 | Leifsonia soli DSM 23871 | Isolate | Rhizosphere |
| 102 | 2852635781 | Streptomyces sp. AK010 | Isolate | Rhizosphere |
| 103 | 2855386786 | Nocardioides ferulae EGI 63112 | Isolate | Unclassified |
| 104 | 2855683550 | Micromonospora sp. RP3T | Isolate | Unclassified |
| 105 | 2858902515 | Micromonospora sp. MW-13 | Isolate | Rhizosphere |
| 106 | 2861520306 | Phytomonospora endophytica DSM 45386 | Isolate | Unclassified |
| 107 | 2862178590 | Streptomyces sp. SDr-06 | Isolate | Rhizosphere |
| 108 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 109 | 2862290372 | Streptomyces triticagri NEAU-YY421 | Isolate | Rhizosphere |
| 110 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 111 | 2862507626 | Streptomyces sp. NWU339 | Isolate | Unclassified |
| 112 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 113 | 2862705112 | Streptomyces triticirhizae NEAU-YY642 | Isolate | Rhizosphere |
| 114 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 115 | 2866552031 | Saccharopolyspora rhizosphaerae H219 | Isolate | Unclassified |
| 116 | 2866612099 | Amycolatopsis suaedae 8-3EHSu | Isolate | Unclassified |
| 117 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 118 | 2867475112 | Streptomyces sp. TM32 | Isolate | Unclassified |
| 119 | 2867507094 | Micromonospora zingiberis PLAI 1-1 | Isolate | Unclassified |
| 120 | 2870721527 | Saccharothrix ecbatanensis DSM 45486 | Isolate | Rhizosphere |
| 121 | 2873151551 | Streptomyces silaceus ACCC40021 | Isolate | Rhizosphere |
| 122 | 2875391855 | Streptomyces cavourensis 1AS2a | Isolate | Rhizosphere |
| 123 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 124 | 2880495981 | Micromonospora vinacea DSM 101695 | Isolate | Unclassified |
| 125 | 2883821847 | Microlunatus elymi KUDC0627 | Isolate | Rhizosphere |
| 126 | 2884763398 | Leifsonia sp. PS1209 | Isolate | Stem Tuber |
| 127 | 2884994152 | Cellulomonas sp. H30R-01 | Isolate | Rhizosphere |
| 128 | 2887443736 | Ruania rhizosphaerae LNNU 22110 | Isolate | Rhizosphere |
| 129 | 2889300758 | Rhodococcus sp. PvR099 | Isolate | Rhizosphere |
| 130 | 2891968417 | Nocardioides luteus SAI-037 | Isolate | Unclassified |
| 131 | 2899359706 | Amycolatopsis anabasis EGI 650086 | Isolate | Unclassified |
| 132 | 2899370129 | Amycolatopsis alkalitolerans SYSUP0005 | Isolate | Stem Tuber |
| 133 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 134 | 2902799365 | Mycolicibacterium sp. P1-5 | Isolate | Unclassified |
| 135 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 136 | 2902837492 | Mycolicibacterium sp. P1-18 | Isolate | Unclassified |
| 137 | 2904535858 | Rhodococcus erythropolis 2017 | Isolate | Unclassified |
| 138 | 2904765812 | Rhodococcus fascians 1590 | Isolate | Rhizosphere |
| 139 | 2904770941 | Rhodococcus fascians 1339 | Isolate | Rhizosphere |
| 140 | 2908811453 | Rhodococcus sp. 1R11 | Isolate | Unclassified |
| 141 | 2912715099 | Streptomyces sp. Z423-1 | Isolate | Rhizosphere |
| 142 | 2912723979 | Streptomyces sp. NEAU-sy36 | Isolate | Rhizosphere |
| 143 | 2912757875 | Streptomyces sp. S4.7 | Isolate | Rhizosphere |
| 144 | 2917736166 | Amycolatopsis dendrobii DR6-1 | Isolate | Unclassified |
| 145 | 2918501144 | Streptomyces sp. PvR006 | Isolate | Rhizosphere |
| 146 | 2919055335 | Leifsonia sp. 1010 | Isolate | Rhizosphere |
| 147 | 2919420072 | Rhodococcus fascians 3241 | Isolate | Rhizosphere |
| 148 | 2919432681 | Rhodococcus sp. 3258 | Isolate | Rhizosphere |
| 149 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 150 | 2919523602 | Leifsonia shinshuensis 3821 | Isolate | Unclassified |
| 151 | 2922554459 | Rhodococcus sp. 66b | Isolate | Unclassified |
| 152 | 2928142448 | Prescottella equi DPS 2018 | Isolate | Unclassified |
| 153 | 2928153084 | Leifsonia sp. 563 | Isolate | Unclassified |
| 154 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 155 | 2929219909 | Micromonospora sp. R-75348 Hybrid assembly | Isolate | Unclassified |
| 156 | 2929226422 | Micromonospora sp. R-74116 Hybrid assembly | Isolate | Unclassified |
| 157 | 2932431166 | Cellulosimicrobium sp. 4261 | Isolate | Rhizosphere |
| 158 | 2935390628 | Streptomyces sp. PvR034 | Isolate | Rhizosphere |
| 159 | 2935890801 | Oerskovia enterophila 3230 | Isolate | Rhizosphere |
| 160 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 161 | 2939743619 | Rhodococcus sp. PvR044 | Isolate | Rhizosphere |
| 162 | 2946045630 | Streptomyces sp. W4I9-2 | Isolate | Rhizosphere |
| 163 | 2946064051 | Streptomyces luteogriseus W4I19-1 | Isolate | Rhizosphere |
| 164 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 165 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 166 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 167 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 168 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 169 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 170 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 171 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 172 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 173 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 174 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 175 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 176 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 177 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 178 | 2956939328 | Lolliginicoccus suaedae LNNU 331112 | Isolate | Rhizosphere |
| 179 | 2974315732 | Rhodococcus sp. SORGH_AS 301 | Isolate | Unclassified |
| 180 | 2984523437 | Rhodococcus sp. SORGH_AS303 | Isolate | Aerial Root |
| 181 | 2990044586 | Streptomyces sedi JCM 16909 | Isolate | Unclassified |
| 182 | 2990059506 | Streptomyces sp. CAP261 | Isolate | Unclassified |
| 183 | 2995463766 | Streptacidiphilus fuscans NEAU-YB345 | Isolate | Unclassified |
| 184 | 2996221748 | Micromonospora veneta CAP181 | Isolate | Unclassified |
| 185 | 2997600082 | Streptomyces coffeae CA1R205 | Isolate | Unclassified |
| 186 | 3001119090 | Lolliginicoccus lacisalsi G463 | Isolate | Rhizosphere |
| 187 | 3001889506 | Janibacter sp. YIM B02568 | Isolate | Unclassified |
| 188 | 3006321560 | Actinacidiphila epipremni PRB2-1 | Isolate | Unclassified |
| 189 | 3006425503 | Streptomyces zingiberis PLAI1-29 | Isolate | Unclassified |
| 190 | 3006486233 | Streptomyces sp. BR123 | Isolate | Rhizosphere |
| 191 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 192 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 193 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 194 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 195 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 196 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 197 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 198 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 199 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 200 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 201 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 202 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 203 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 204 | 3300003285 | Grassland soil microbial communities from Hopland, California, USA - Sample H3_Rhizo_39 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 205 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 206 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 207 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 208 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 209 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 210 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 211 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 212 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 213 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 214 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 215 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 216 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 217 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 218 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 219 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 220 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 221 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 222 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 223 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 224 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 225 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 226 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 227 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 228 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 229 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 230 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 231 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 232 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 233 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 234 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 235 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 236 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 237 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 238 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 239 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 240 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 241 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 242 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 243 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 244 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 245 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 246 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 247 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 248 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 249 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 250 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 251 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 252 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 253 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 254 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 255 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 256 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 257 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 258 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 259 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 260 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 261 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 262 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 263 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 264 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 265 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 266 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 267 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 268 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 269 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 270 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 271 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 272 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 273 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 274 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 275 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 276 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 277 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 278 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 279 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 280 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 281 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 282 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 283 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 284 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 285 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 286 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 287 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 288 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 289 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 290 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 291 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 292 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 293 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 294 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 295 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 296 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 297 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 298 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 299 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 300 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 301 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 302 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 303 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 304 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 305 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 306 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 307 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 308 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 309 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 310 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 311 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 312 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 313 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 314 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 315 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 316 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 317 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 318 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 319 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 320 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 321 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 322 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 323 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 324 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 325 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 326 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 327 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 328 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 329 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 330 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 331 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 332 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 333 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 334 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 335 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 336 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 337 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 338 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 339 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 340 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 341 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 342 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 343 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 344 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 345 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 346 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 347 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 348 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 349 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 350 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 351 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 352 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 353 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 354 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 355 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 356 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 357 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 358 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 359 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 360 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 361 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 362 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 363 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 364 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 365 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 366 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 367 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 368 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 369 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 370 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 371 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 372 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 373 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 374 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 375 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 376 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 377 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 378 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 379 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 380 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 381 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 382 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 383 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 384 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 385 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 386 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 387 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 388 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 389 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 390 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 391 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 392 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 393 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 394 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 395 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 396 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 397 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 398 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 399 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 400 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 401 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 402 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 403 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 404 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 405 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 406 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 407 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 408 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 409 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 410 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 411 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 412 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 413 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 414 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 415 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 416 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 417 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 418 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 419 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 420 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 421 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 422 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 423 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 424 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 425 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 426 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 427 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 428 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 429 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 430 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 431 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 432 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 433 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 434 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 435 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 436 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 437 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 438 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 439 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 440 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 441 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 442 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 443 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 444 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 445 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 446 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 447 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 448 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 449 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 450 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 451 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 452 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 453 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 454 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 455 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 456 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 457 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 458 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 459 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 460 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 461 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 462 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 463 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 464 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 465 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 466 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 467 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 468 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 469 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 470 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 471 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 472 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 473 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 474 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 475 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 476 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 477 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 478 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 479 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 480 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 481 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 482 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 483 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 484 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 485 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 486 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 487 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 488 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 489 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 490 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 491 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 492 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 493 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 494 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 495 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 496 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 497 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 498 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 499 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 500 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 501 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 502 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 503 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 504 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 505 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 506 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 507 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 508 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 509 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 510 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 511 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 512 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 513 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 514 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 515 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 516 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 517 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 518 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 519 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 520 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 521 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 522 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 523 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 524 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 525 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 526 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 527 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 528 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 529 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 530 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 531 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 532 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 533 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 534 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 535 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 536 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 537 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 538 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 539 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 540 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 541 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 542 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 543 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 544 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 545 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 546 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 547 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 548 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 549 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 550 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 551 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 552 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 553 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 554 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 555 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 556 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 557 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 558 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 559 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 560 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 561 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 562 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 563 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 564 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 565 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 566 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 567 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 568 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 569 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 570 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 571 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 572 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 573 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 574 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 575 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 576 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 577 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 578 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 579 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 580 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 581 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 582 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 583 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 584 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 585 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 586 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 587 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 588 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 589 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 590 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 591 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 592 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 593 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 594 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 595 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 596 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 597 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 598 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 599 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 600 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 601 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 602 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 603 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 604 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 605 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 606 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 607 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 608 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 609 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 610 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 611 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 612 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 613 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 614 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 615 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 616 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 617 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 618 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 619 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 620 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 621 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 622 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 623 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 624 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 625 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 626 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 627 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 628 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 629 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 630 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 631 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 632 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 633 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 634 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 635 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 636 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 637 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 638 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 639 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 640 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 641 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 642 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 643 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 644 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 645 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 646 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 647 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 648 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 649 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 650 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 651 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 652 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 653 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 654 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 655 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 656 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 657 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 658 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 659 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 660 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 661 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 662 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 663 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 664 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 665 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 666 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 667 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 668 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 669 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 670 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 671 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 672 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 673 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 674 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 675 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 676 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 677 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 678 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 679 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 680 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 681 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 682 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 683 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 684 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 685 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 686 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 687 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 688 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 689 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 690 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 691 | 3300053100 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere | Metagenome | Endosphere |
| 692 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 693 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 694 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 695 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 696 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 697 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 698 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 699 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 700 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 701 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 702 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 703 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 704 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 705 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 706 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 707 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 708 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 709 | 8001781756 | Catellatospora tritici NEAU-YM18 | Isolate | Rhizosphere |
| 710 | 8003314358 | Amycolatopsis sp. MtRt-6 | Isolate | Unclassified |
| 711 | 8003830390 | Micromonospora parastrephiae STR1_7 | Isolate | Rhizosphere |
| 712 | 8003870546 | Micromonospora tarensis STR1s_6 | Isolate | Rhizosphere |
| 713 | 8008485437 | Streptomyces mimosae 3MP-10 | Isolate | Unclassified |
| 714 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 715 | 8008574985 | Streptomyces sp. Jing01 | Isolate | Rhizosphere |
| 716 | 8023623736 | Streptomyces sp. 111WW2 | Isolate | Unclassified |
| 717 | 8025413630 | Streptomyces sp. CAI-17 | Isolate | Rhizosphere |
| 718 | 8025478263 | Streptomyces telluris AA8 | Isolate | Rhizosphere |
| 719 | 8025524527 | Streptomyces sp. 3MP-14 | Isolate | Unclassified |
| 720 | 8025530807 | Streptomyces sp. 4R-3d | Isolate | Unclassified |
| 721 | 8047710418 | Umezawaea endophytica DSM 103496 | Isolate | Unclassified |
| 722 | 8047893842 | Streptomyces cangkringensis DSM 41769 | Isolate | Rhizosphere |
| 723 | 8048127548 | Streptomyces samsunensis DSM 42010 | Isolate | Rhizosphere |
| 724 | 8048356638 | Streptomyces rhizosphaericus DSM 41760 | Isolate | Rhizosphere |
| 725 | 8048369669 | Streptomyces indonesiensis DSM 41759 | Isolate | Rhizoplane |
| 726 | 8048379754 | Streptomyces asiaticus DSM 41761 | Isolate | Rhizosphere |
| 727 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
| 728 | 8054160619 | Streptomyces rhizoryzae RS10V-4 | Isolate | Rhizosphere |
| 729 | 8054472261 | Pseudonocardia terrae RS11V-5 | Isolate | Rhizosphere |
| 730 | 8054609563 | Nocardioides astragali CGMCC 4.7327 | Isolate | Nodule |
| 731 | 8056054917 | Glycomyces luteolus NEAU-A15 | Isolate | Rhizosphere |
| 732 | 8056207758 | Saccharopolyspora indica KCTC 29208 | Isolate | Rhizosphere |
| 733 | 8056447290 | Streptomyces huiliensis SCA2-4 | Isolate | Rhizosphere |
| 734 | 8056579771 | Promicromonospora iranensis UTMC 00792 | Isolate | Rhizosphere |
| 735 | 8056667051 | Streptomyces sichuanensis SCA3-4 | Isolate | Rhizosphere |
| 736 | 8056829672 | Streptomyces barringtoniae JA03 | Isolate | Rhizosphere |
| 737 | 8057568493 | Actinorhabdospora filicis NBRC 111898 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 87.85 |
| Metatranscriptomes | 0.48 |
| Isolates | 11.67 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.05 |
| Bulb | 0 |
| Endosphere | 5.62 |
| Nodule | 0.32 |
| Rhizoplane | 7.59 |
| Rhizosphere | 75.01 |
| Stem | 0 |
| Stem Tuber | 0.11 |
| Unclassified | 11.3 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1000708 | 3300001977 | Bacteria | 5132 |
| 2 | JGI24740J21852_10011444 | 3300001979 | Bacteria | 3376 |
| 3 | JGI24739J22299_10014613 | 3300001989 | Bacteria | 2854 |
| 4 | JGI24739J22299_10018783 | 3300001989 | Bacteria | 2481 |
| 5 | JGI24737J22298_10004741 | 3300001990 | Bacteria | 4720 |
| 6 | JGI24737J22298_10006559 | 3300001990 | Bacteria | 3969 |
| 7 | JGI24743J22301_10001116 | 3300001991 | Bacteria | 3594 |
| 8 | JGI24735J21928_10017868 | 3300002067 | Bacteria | 2191 |
| 9 | JGI24745J21846_1003475 | 3300002073 | Bacteria | 1649 |
| 10 | JGI24742J22300_10001558 | 3300002244 | Bacteria | 3640 |
| 11 | JGI24751J29686_10000209 | 3300002459 | Bacteria | 25027 |
| 12 | JGI25164J39214_1001833 | 3300002772 | Bacteria | 4042 |
| 13 | JGI25406J46586_10000769 | 3300003203 | Bacteria | 15054 |
| 14 | JGI25406J46586_10018706 | 3300003203 | Bacteria | 2841 |
| 15 | JGI25165J46597_1000107 | 3300003214 | Bacteria | 150846 |
| 16 | Ga0007423J48922_100181 | 3300003285 | Bacteria | 5259 |
| 17 | rootH1_10007198 | 3300003323 | Bacteria | 3264 |
| 18 | JGI25407J50210_10003181 | 3300003373 | Bacteria | 3906 |
| 19 | Ga0006562J51391_1043768 | 3300003578 | Bacteria | 1770 |
| 20 | Ga0006562J51391_1058926 | 3300003578 | Bacteria | 6670 |
| 21 | Ga0006562J51391_1058927 | 3300003578 | Bacteria | 6811 |
| 22 | Ga0055539_1000019 | 3300003752 | Bacteria | 341727 |
| 23 | Ga0055533_1000023 | 3300003756 | Bacteria | 341727 |
| 24 | Ga0055527_1000025 | 3300003760 | Bacteria | 195817 |
| 25 | Ga0055542_1000048 | 3300003762 | Bacteria | 195800 |
| 26 | Ga0055529_1000057 | 3300003763 | Bacteria | 195807 |
| 27 | Ga0055540_1000071 | 3300003792 | Bacteria | 117607 |
| 28 | Ga0055540_1000645 | 3300003792 | Bacteria | 24587 |
| 29 | Ga0055540_1005868 | 3300003792 | Bacteria | 5029 |
| 30 | Ga0055541_1003256 | 3300003841 | Bacteria | 3077 |
| 31 | JGI25405J52794_10008121 | 3300003911 | Bacteria | 1952 |
| 32 | Ga0065714_10072535 | 3300005288 | Bacteria | 3350 |
| 33 | Ga0070658_10018256 | 3300005327 | Bacteria | 5614 |
| 34 | Ga0070658_10027987 | 3300005327 | Bacteria | 4524 |
| 35 | Ga0070676_10017998 | 3300005328 | Bacteria | 3913 |
| 36 | Ga0070676_10032460 | 3300005328 | Bacteria | 2991 |
| 37 | Ga0070676_10124627 | 3300005328 | Bacteria | 1621 |
| 38 | Ga0070683_100195291 | 3300005329 | Bacteria | 1921 |
| 39 | Ga0070690_100023491 | 3300005330 | Bacteria | 3781 |
| 40 | Ga0070670_100033934 | 3300005331 | Bacteria | 4393 |
| 41 | Ga0070670_100038607 | 3300005331 | Bacteria | 4106 |
| 42 | Ga0070670_100068315 | 3300005331 | Bacteria | 3050 |
| 43 | Ga0068869_100002932 | 3300005334 | Bacteria | 10356 |
| 44 | Ga0070666_10054980 | 3300005335 | Bacteria | 2686 |
| 45 | Ga0070666_10069481 | 3300005335 | Bacteria | 2395 |
| 46 | Ga0070682_100034083 | 3300005337 | Bacteria | 3098 |
| 47 | Ga0070682_100098095 | 3300005337 | Bacteria | 1929 |
| 48 | Ga0068868_100046911 | 3300005338 | Bacteria | 3382 |
| 49 | Ga0068868_100189404 | 3300005338 | Bacteria | 1710 |
| 50 | Ga0070660_100004498 | 3300005339 | Bacteria | 9634 |
| 51 | Ga0070689_100025015 | 3300005340 | Bacteria | 4483 |
| 52 | Ga0070691_10008186 | 3300005341 | Bacteria | 4791 |
| 53 | Ga0070687_100045972 | 3300005343 | Bacteria | 2232 |
| 54 | Ga0070692_10044824 | 3300005345 | Bacteria | 2280 |
| 55 | Ga0070668_100003761 | 3300005347 | Bacteria | 11196 |
| 56 | Ga0070668_100004067 | 3300005347 | Bacteria | 10833 |
| 57 | Ga0070668_100006625 | 3300005347 | Bacteria | 8583 |
| 58 | Ga0070668_100020933 | 3300005347 | Bacteria | 4941 |
| 59 | Ga0070675_100042140 | 3300005354 | Bacteria | 3729 |
| 60 | Ga0070675_100094591 | 3300005354 | Bacteria | 2507 |
| 61 | Ga0070671_100000175 | 3300005355 | Bacteria | 42569 |
| 62 | Ga0070671_100000693 | 3300005355 | Bacteria | 24230 |
| 63 | Ga0070671_100016400 | 3300005355 | Bacteria | 5991 |
| 64 | Ga0070674_100009143 | 3300005356 | Bacteria | 5926 |
| 65 | Ga0070674_100064986 | 3300005356 | Bacteria | 2559 |
| 66 | Ga0070674_100067572 | 3300005356 | Bacteria | 2515 |
| 67 | Ga0070674_100083445 | 3300005356 | Bacteria | 2288 |
| 68 | Ga0070688_100104321 | 3300005365 | Bacteria | 1874 |
| 69 | Ga0070659_100003265 | 3300005366 | Bacteria | 11535 |
| 70 | Ga0070659_100022487 | 3300005366 | Bacteria | 4814 |
| 71 | Ga0070659_100026863 | 3300005366 | Bacteria | 4430 |
| 72 | Ga0070659_100172705 | 3300005366 | Bacteria | 1771 |
| 73 | Ga0070659_100208152 | 3300005366 | Bacteria | 1611 |
| 74 | Ga0070667_100000960 | 3300005367 | Bacteria | 26531 |
| 75 | Ga0070667_100000995 | 3300005367 | Bacteria | 26025 |
| 76 | Ga0070667_100006339 | 3300005367 | Bacteria | 9832 |
| 77 | Ga0070667_100010135 | 3300005367 | Bacteria | 7796 |
| 78 | Ga0070667_100035109 | 3300005367 | Bacteria | 4200 |
| 79 | Ga0070667_100045890 | 3300005367 | Bacteria | 3675 |
| 80 | Ga0070703_10000050 | 3300005406 | Bacteria | 57436 |
| 81 | Ga0070709_10012282 | 3300005434 | Bacteria | 4791 |
| 82 | Ga0070714_100000126 | 3300005435 | Bacteria | 60425 |
| 83 | Ga0070714_100002231 | 3300005435 | Bacteria | 14270 |
| 84 | Ga0070714_100013034 | 3300005435 | Bacteria | 6651 |
| 85 | Ga0070714_100071252 | 3300005435 | Bacteria | 3005 |
| 86 | Ga0070714_100302751 | 3300005435 | Bacteria | 1491 |
| 87 | Ga0070710_10001385 | 3300005437 | Bacteria | 11439 |
| 88 | Ga0070710_10007135 | 3300005437 | Bacteria | 5398 |
| 89 | Ga0070701_10001222 | 3300005438 | Bacteria | 9419 |
| 90 | Ga0070701_10006381 | 3300005438 | Bacteria | 4960 |
| 91 | Ga0070701_10007222 | 3300005438 | Bacteria | 4729 |
| 92 | Ga0070711_100002751 | 3300005439 | Bacteria | 10083 |
| 93 | Ga0070711_100016193 | 3300005439 | Bacteria | 4731 |
| 94 | Ga0070705_100002793 | 3300005440 | Bacteria | 8698 |
| 95 | Ga0070705_100109810 | 3300005440 | Bacteria | 1760 |
| 96 | Ga0070705_100126453 | 3300005440 | Bacteria | 1660 |
| 97 | Ga0070705_100165590 | 3300005440 | Bacteria | 1482 |
| 98 | Ga0070700_100002767 | 3300005441 | Bacteria | 8967 |
| 99 | Ga0070700_100009980 | 3300005441 | Bacteria | 5227 |
| 100 | Ga0070700_100033994 | 3300005441 | Bacteria | 3075 |
| 101 | Ga0070708_100001634 | 3300005445 | Bacteria | 17181 |
| 102 | Ga0070708_100081920 | 3300005445 | Bacteria | 2922 |
| 103 | Ga0070708_100185454 | 3300005445 | Bacteria | 1945 |
| 104 | Ga0070708_100209049 | 3300005445 | Bacteria | 1828 |
| 105 | Ga0070663_100021613 | 3300005455 | Bacteria | 4283 |
| 106 | Ga0070663_100040375 | 3300005455 | Bacteria | 3266 |
| 107 | Ga0070678_100000629 | 3300005456 | Bacteria | 17329 |
| 108 | Ga0070678_100002337 | 3300005456 | Bacteria | 10354 |
| 109 | Ga0070678_100110041 | 3300005456 | Bacteria | 2154 |
| 110 | Ga0070662_100004566 | 3300005457 | Bacteria | 8767 |
| 111 | Ga0070662_100010075 | 3300005457 | Bacteria | 6192 |
| 112 | Ga0070662_100014118 | 3300005457 | Bacteria | 5328 |
| 113 | Ga0068867_100005051 | 3300005459 | Bacteria | 9313 |
| 114 | Ga0068867_100035193 | 3300005459 | Bacteria | 3632 |
| 115 | Ga0070685_10019185 | 3300005466 | Bacteria | 3687 |
| 116 | Ga0070706_100001603 | 3300005467 | Bacteria | 23576 |
| 117 | Ga0070706_100002425 | 3300005467 | Bacteria | 18781 |
| 118 | Ga0070706_100005928 | 3300005467 | Bacteria | 11566 |
| 119 | Ga0070706_100090432 | 3300005467 | Bacteria | 2838 |
| 120 | Ga0070707_100000324 | 3300005468 | Bacteria | 46880 |
| 121 | Ga0070707_100000970 | 3300005468 | Bacteria | 28392 |
| 122 | Ga0070698_100000293 | 3300005471 | Bacteria | 50987 |
| 123 | Ga0070698_100000372 | 3300005471 | Bacteria | 46727 |
| 124 | Ga0070698_100010138 | 3300005471 | Bacteria | 10067 |
| 125 | Ga0070698_100016904 | 3300005471 | Bacteria | 7693 |
| 126 | Ga0070698_100032044 | 3300005471 | Bacteria | 5446 |
| 127 | Ga0070698_100078423 | 3300005471 | Bacteria | 3301 |
| 128 | Ga0070698_100086268 | 3300005471 | Bacteria | 3125 |
| 129 | Ga0070698_100129954 | 3300005471 | Bacteria | 2475 |
| 130 | Ga0070698_100180339 | 3300005471 | Bacteria | 2051 |
| 131 | Ga0070699_100006304 | 3300005518 | Bacteria | 10348 |
| 132 | Ga0070679_100003617 | 3300005530 | Bacteria | 14128 |
| 133 | Ga0070684_100022248 | 3300005535 | Bacteria | 5284 |
| 134 | Ga0070697_100137220 | 3300005536 | Bacteria | 2054 |
| 135 | Ga0068853_100005838 | 3300005539 | Bacteria | 9695 |
| 136 | Ga0068853_100025071 | 3300005539 | Bacteria | 5003 |
| 137 | Ga0068853_100061206 | 3300005539 | Bacteria | 3255 |
| 138 | Ga0070672_100075639 | 3300005543 | Bacteria | 2689 |
| 139 | Ga0070672_100100113 | 3300005543 | Bacteria | 2350 |
| 140 | Ga0070672_100154411 | 3300005543 | Bacteria | 1901 |
| 141 | Ga0070686_100006816 | 3300005544 | Bacteria | 6360 |
| 142 | Ga0070686_100037792 | 3300005544 | Bacteria | 2997 |
| 143 | Ga0070686_100042248 | 3300005544 | Bacteria | 2855 |
| 144 | Ga0070696_100006372 | 3300005546 | Bacteria | 7894 |
| 145 | Ga0070696_100008936 | 3300005546 | Bacteria | 6704 |
| 146 | Ga0070693_100012317 | 3300005547 | Bacteria | 4326 |
| 147 | Ga0070665_100001439 | 3300005548 | Bacteria | 27904 |
| 148 | Ga0070665_100003390 | 3300005548 | Bacteria | 17043 |
| 149 | Ga0070665_100004418 | 3300005548 | Bacteria | 14773 |
| 150 | Ga0070665_100022040 | 3300005548 | Bacteria | 6409 |
| 151 | Ga0070665_100022884 | 3300005548 | Bacteria | 6291 |
| 152 | Ga0070665_100037988 | 3300005548 | Bacteria | 4841 |
| 153 | Ga0070665_100108196 | 3300005548 | Bacteria | 2782 |
| 154 | Ga0070665_100164564 | 3300005548 | Bacteria | 2220 |
| 155 | Ga0070665_100203863 | 3300005548 | Bacteria | 1978 |
| 156 | Ga0070704_100002771 | 3300005549 | Bacteria | 9918 |
| 157 | Ga0070704_100010596 | 3300005549 | Bacteria | 5613 |
| 158 | Ga0070704_100011659 | 3300005549 | Bacteria | 5398 |
| 159 | Ga0070704_100079868 | 3300005549 | Bacteria | 2404 |
| 160 | Ga0068855_100016329 | 3300005563 | Bacteria | 8928 |
| 161 | Ga0068855_100220046 | 3300005563 | Bacteria | 2130 |
| 162 | Ga0070664_100006163 | 3300005564 | Bacteria | 9694 |
| 163 | Ga0070664_100022615 | 3300005564 | Bacteria | 5184 |
| 164 | Ga0070664_100110472 | 3300005564 | Bacteria | 2399 |
| 165 | Ga0070664_100117944 | 3300005564 | Bacteria | 2321 |
| 166 | Ga0068857_100053854 | 3300005577 | Bacteria | 3569 |
| 167 | Ga0068857_100128672 | 3300005577 | Bacteria | 2283 |
| 168 | Ga0068854_100003641 | 3300005578 | Bacteria | 9642 |
| 169 | Ga0068856_100114923 | 3300005614 | Bacteria | 2690 |
| 170 | Ga0070702_100001386 | 3300005615 | Bacteria | 9902 |
| 171 | Ga0070702_100004590 | 3300005615 | Bacteria | 6325 |
| 172 | Ga0070702_100005972 | 3300005615 | Bacteria | 5728 |
| 173 | Ga0068852_100010514 | 3300005616 | Bacteria | 6921 |
| 174 | Ga0068859_100004535 | 3300005617 | Bacteria | 14163 |
| 175 | Ga0068859_100012411 | 3300005617 | Bacteria | 8572 |
| 176 | Ga0068859_100048278 | 3300005617 | Bacteria | 4276 |
| 177 | Ga0068859_100127831 | 3300005617 | Bacteria | 2612 |
| 178 | Ga0068859_100194686 | 3300005617 | Bacteria | 2111 |
| 179 | Ga0068864_100038615 | 3300005618 | Bacteria | 4079 |
| 180 | Ga0068864_100053011 | 3300005618 | Bacteria | 3498 |
| 181 | Ga0068864_100057253 | 3300005618 | Bacteria | 3367 |
| 182 | Ga0068864_100067923 | 3300005618 | Bacteria | 3096 |
| 183 | Ga0068866_10001953 | 3300005718 | Bacteria | 8594 |
| 184 | Ga0068866_10023813 | 3300005718 | Bacteria | 2853 |
| 185 | Ga0068866_10031366 | 3300005718 | Bacteria | 2559 |
| 186 | Ga0068861_100007802 | 3300005719 | Bacteria | 7355 |
| 187 | Ga0068861_100048451 | 3300005719 | Bacteria | 3212 |
| 188 | Ga0068861_100094605 | 3300005719 | Bacteria | 2364 |
| 189 | Ga0068851_10029524 | 3300005834 | Bacteria | 2715 |
| 190 | Ga0068870_10006734 | 3300005840 | Bacteria | 5087 |
| 191 | Ga0068863_100000105 | 3300005841 | Bacteria | 90388 |
| 192 | Ga0068863_100001135 | 3300005841 | Bacteria | 26616 |
| 193 | Ga0068863_100004403 | 3300005841 | Bacteria | 13889 |
| 194 | Ga0068863_100009010 | 3300005841 | Bacteria | 9743 |
| 195 | Ga0068863_100054883 | 3300005841 | Bacteria | 3774 |
| 196 | Ga0068863_100064794 | 3300005841 | Bacteria | 3456 |
| 197 | Ga0068858_100009323 | 3300005842 | Bacteria | 9371 |
| 198 | Ga0068858_100010352 | 3300005842 | Bacteria | 8832 |
| 199 | Ga0068858_100010474 | 3300005842 | Bacteria | 8783 |
| 200 | Ga0068858_100033716 | 3300005842 | Bacteria | 4749 |
| 201 | Ga0068858_100056289 | 3300005842 | Bacteria | 3635 |
| 202 | Ga0068860_100000209 | 3300005843 | Bacteria | 92811 |
| 203 | Ga0068860_100000261 | 3300005843 | Bacteria | 77163 |
| 204 | Ga0068860_100001858 | 3300005843 | Bacteria | 22473 |
| 205 | Ga0068860_100002620 | 3300005843 | Bacteria | 18701 |
| 206 | Ga0068860_100024061 | 3300005843 | Bacteria | 5888 |
| 207 | Ga0068860_100036357 | 3300005843 | Bacteria | 4720 |
| 208 | Ga0068862_100000400 | 3300005844 | Bacteria | 46788 |
| 209 | Ga0068862_100005740 | 3300005844 | Bacteria | 10354 |
| 210 | Ga0068862_100008410 | 3300005844 | Bacteria | 8538 |
| 211 | Ga0081455_10000290 | 3300005937 | Bacteria | 66541 |
| 212 | Ga0081455_10002415 | 3300005937 | Bacteria | 22283 |
| 213 | Ga0081455_10004439 | 3300005937 | Bacteria | 15744 |
| 214 | Ga0081455_10009174 | 3300005937 | Bacteria | 10195 |
| 215 | Ga0081455_10020571 | 3300005937 | Bacteria | 6210 |
| 216 | Ga0081455_10023343 | 3300005937 | Bacteria | 5757 |
| 217 | Ga0081455_10024363 | 3300005937 | Bacteria | 5606 |
| 218 | Ga0081455_10043329 | 3300005937 | Bacteria | 3937 |
| 219 | Ga0081455_10070877 | 3300005937 | Bacteria | 2892 |
| 220 | Ga0081455_10090545 | 3300005937 | Bacteria | 2480 |
| 221 | Ga0081538_10000367 | 3300005981 | Bacteria | 51530 |
| 222 | Ga0081540_1010259 | 3300005983 | Bacteria | 6361 |
| 223 | Ga0081540_1010699 | 3300005983 | Bacteria | 6183 |
| 224 | Ga0081540_1056433 | 3300005983 | Bacteria | 1906 |
| 225 | Ga0081539_10000474 | 3300005985 | Bacteria | 85045 |
| 226 | Ga0081539_10001780 | 3300005985 | Bacteria | 34234 |
| 227 | Ga0081539_10002475 | 3300005985 | Bacteria | 25990 |
| 228 | Ga0081539_10006896 | 3300005985 | Bacteria | 10595 |
| 229 | Ga0081539_10008770 | 3300005985 | Bacteria | 8675 |
| 230 | Ga0081539_10011550 | 3300005985 | Bacteria | 6964 |
| 231 | Ga0081539_10015464 | 3300005985 | Bacteria | 5544 |
| 232 | Ga0081539_10032775 | 3300005985 | Bacteria | 3176 |
| 233 | Ga0081539_10035770 | 3300005985 | Bacteria | 2980 |
| 234 | Ga0081539_10080860 | 3300005985 | Bacteria | 1708 |
| 235 | Ga0070717_10009137 | 3300006028 | Bacteria | 7446 |
| 236 | Ga0075365_10000552 | 3300006038 | Bacteria | 14463 |
| 237 | Ga0075365_10005206 | 3300006038 | Bacteria | 6995 |
| 238 | Ga0075365_10045154 | 3300006038 | Bacteria | 2889 |
| 239 | Ga0075365_10058072 | 3300006038 | Bacteria | 2575 |
| 240 | Ga0075365_10062129 | 3300006038 | Bacteria | 2497 |
| 241 | Ga0075365_10083932 | 3300006038 | Bacteria | 2161 |
| 242 | Ga0075363_100003661 | 3300006048 | Bacteria | 6600 |
| 243 | Ga0075363_100007170 | 3300006048 | Bacteria | 5104 |
| 244 | Ga0075363_100008051 | 3300006048 | Bacteria | 4887 |
| 245 | Ga0075363_100008798 | 3300006048 | Bacteria | 4721 |
| 246 | Ga0075363_100022474 | 3300006048 | Bacteria | 3188 |
| 247 | Ga0075363_100032455 | 3300006048 | Bacteria | 2712 |
| 248 | Ga0075364_10000646 | 3300006051 | Bacteria | 17975 |
| 249 | Ga0075364_10000830 | 3300006051 | Bacteria | 16299 |
| 250 | Ga0075364_10004234 | 3300006051 | Bacteria | 8237 |
| 251 | Ga0075364_10012091 | 3300006051 | Bacteria | 5267 |
| 252 | Ga0075364_10014121 | 3300006051 | Bacteria | 4929 |
| 253 | Ga0075364_10071602 | 3300006051 | Bacteria | 2284 |
| 254 | Ga0075364_10078862 | 3300006051 | Bacteria | 2176 |
| 255 | Ga0075432_10006628 | 3300006058 | Bacteria | 3940 |
| 256 | Ga0070716_100006287 | 3300006173 | Bacteria | 5795 |
| 257 | Ga0070712_100003408 | 3300006175 | Bacteria | 9782 |
| 258 | Ga0070712_100003957 | 3300006175 | Bacteria | 9111 |
| 259 | Ga0070712_100061058 | 3300006175 | Bacteria | 2661 |
| 260 | Ga0070712_100062868 | 3300006175 | Bacteria | 2626 |
| 261 | Ga0075367_10015626 | 3300006178 | Bacteria | 4131 |
| 262 | Ga0075367_10027016 | 3300006178 | Bacteria | 3261 |
| 263 | Ga0075367_10033445 | 3300006178 | Bacteria | 2963 |
| 264 | Ga0075367_10037719 | 3300006178 | Bacteria | 2809 |
| 265 | Ga0075369_10000684 | 3300006186 | Bacteria | 10833 |
| 266 | Ga0097621_100009223 | 3300006237 | Bacteria | 7156 |
| 267 | Ga0097621_100075892 | 3300006237 | Bacteria | 2787 |
| 268 | Ga0075370_10008168 | 3300006353 | Bacteria | 5372 |
| 269 | Ga0075370_10026952 | 3300006353 | Bacteria | 3186 |
| 270 | Ga0075428_100000203 | 3300006844 | Bacteria | 56882 |
| 271 | Ga0075428_100047731 | 3300006844 | Bacteria | 4702 |
| 272 | Ga0075428_100142137 | 3300006844 | Bacteria | 2609 |
| 273 | Ga0075428_100165929 | 3300006844 | Bacteria | 2395 |
| 274 | Ga0075430_100004467 | 3300006846 | Bacteria | 11799 |
| 275 | Ga0075430_100069161 | 3300006846 | Bacteria | 2962 |
| 276 | Ga0075431_100023915 | 3300006847 | Bacteria | 6254 |
| 277 | Ga0075431_100144417 | 3300006847 | Bacteria | 2452 |
| 278 | Ga0075433_10001584 | 3300006852 | Bacteria | 16851 |
| 279 | Ga0075433_10004531 | 3300006852 | Bacteria | 10836 |
| 280 | Ga0075433_10012177 | 3300006852 | Bacteria | 6936 |
| 281 | Ga0075433_10149382 | 3300006852 | Bacteria | 2078 |
| 282 | Ga0075434_100001999 | 3300006871 | Bacteria | 17701 |
| 283 | Ga0075434_100010168 | 3300006871 | Bacteria | 8814 |
| 284 | Ga0075434_100032417 | 3300006871 | Bacteria | 5152 |
| 285 | Ga0075434_100033684 | 3300006871 | Bacteria | 5057 |
| 286 | Ga0075429_100070269 | 3300006880 | Bacteria | 3048 |
| 287 | Ga0068865_100002783 | 3300006881 | Bacteria | 10391 |
| 288 | Ga0068865_100057694 | 3300006881 | Bacteria | 2709 |
| 289 | Ga0097620_100004535 | 3300006931 | Bacteria | 14163 |
| 290 | Ga0097620_100012409 | 3300006931 | Bacteria | 8572 |
| 291 | Ga0097620_100048278 | 3300006931 | Bacteria | 4276 |
| 292 | Ga0097620_100127828 | 3300006931 | Bacteria | 2612 |
| 293 | Ga0097620_100194683 | 3300006931 | Bacteria | 2111 |
| 294 | Ga0099826_10058892 | 3300006948 | Bacteria | 2515 |
| 295 | Ga0075435_100004935 | 3300007076 | Bacteria | 9254 |
| 296 | Ga0075435_100015051 | 3300007076 | Bacteria | 5805 |
| 297 | Ga0075435_100018987 | 3300007076 | Bacteria | 5239 |
| 298 | Ga0075435_100188495 | 3300007076 | Bacteria | 1745 |
| 299 | Ga0105251_10014758 | 3300009011 | Bacteria | 4302 |
| 300 | Ga0105240_10190176 | 3300009093 | Bacteria | 2414 |
| 301 | Ga0105240_10248131 | 3300009093 | Bacteria | 2060 |
| 302 | Ga0111539_10022303 | 3300009094 | Bacteria | 7782 |
| 303 | Ga0111539_10053720 | 3300009094 | Bacteria | 4795 |
| 304 | Ga0111539_10109140 | 3300009094 | Bacteria | 3247 |
| 305 | Ga0111539_10268440 | 3300009094 | Bacteria | 1986 |
| 306 | Ga0105245_10006580 | 3300009098 | Bacteria | 10200 |
| 307 | Ga0105245_10009833 | 3300009098 | Bacteria | 8333 |
| 308 | Ga0105245_10022661 | 3300009098 | Bacteria | 5513 |
| 309 | Ga0105245_10084225 | 3300009098 | Bacteria | 2912 |
| 310 | Ga0105245_10094732 | 3300009098 | Bacteria | 2753 |
| 311 | Ga0105245_10102396 | 3300009098 | Bacteria | 2652 |
| 312 | Ga0105245_10122666 | 3300009098 | Bacteria | 2429 |
| 313 | Ga0105247_10000141 | 3300009101 | Bacteria | 70210 |
| 314 | Ga0105247_10003401 | 3300009101 | Bacteria | 10399 |
| 315 | Ga0105247_10041004 | 3300009101 | Bacteria | 2831 |
| 316 | Ga0105247_10044546 | 3300009101 | Bacteria | 2721 |
| 317 | Ga0114129_10006795 | 3300009147 | Bacteria | 16241 |
| 318 | Ga0114129_10010215 | 3300009147 | Bacteria | 13386 |
| 319 | Ga0114129_10077685 | 3300009147 | Bacteria | 4617 |
| 320 | Ga0114129_10093729 | 3300009147 | Bacteria | 4159 |
| 321 | Ga0114129_10457563 | 3300009147 | Bacteria | 1673 |
| 322 | Ga0105243_10003636 | 3300009148 | Bacteria | 12410 |
| 323 | Ga0105243_10004875 | 3300009148 | Bacteria | 10531 |
| 324 | Ga0105243_10005454 | 3300009148 | Bacteria | 9925 |
| 325 | Ga0105243_10027652 | 3300009148 | Bacteria | 4348 |
| 326 | Ga0105243_10090292 | 3300009148 | Bacteria | 2521 |
| 327 | Ga0105242_10004138 | 3300009176 | Bacteria | 11293 |
| 328 | Ga0105242_10006982 | 3300009176 | Bacteria | 8716 |
| 329 | Ga0105242_10019706 | 3300009176 | Bacteria | 5287 |
| 330 | Ga0105242_10028160 | 3300009176 | Bacteria | 4469 |
| 331 | Ga0105242_10168970 | 3300009176 | Bacteria | 1920 |
| 332 | Ga0105242_10235487 | 3300009176 | Bacteria | 1643 |
| 333 | Ga0105248_10001091 | 3300009177 | Bacteria | 30053 |
| 334 | Ga0105248_10013543 | 3300009177 | Bacteria | 8977 |
| 335 | Ga0105248_10014779 | 3300009177 | Bacteria | 8596 |
| 336 | Ga0105248_10029514 | 3300009177 | Bacteria | 6118 |
| 337 | Ga0105248_10101734 | 3300009177 | Bacteria | 3238 |
| 338 | Ga0105248_10102450 | 3300009177 | Bacteria | 3226 |
| 339 | Ga0105248_10138281 | 3300009177 | Bacteria | 2748 |
| 340 | Ga0105248_10190584 | 3300009177 | Bacteria | 2310 |
| 341 | Ga0105237_10001867 | 3300009545 | Bacteria | 26871 |
| 342 | Ga0105237_10003741 | 3300009545 | Bacteria | 17926 |
| 343 | Ga0105237_10227152 | 3300009545 | Bacteria | 1867 |
| 344 | Ga0105238_10060551 | 3300009551 | Bacteria | 3790 |
| 345 | Ga0105249_10000031 | 3300009553 | Bacteria | 220006 |
| 346 | Ga0105249_10016677 | 3300009553 | Bacteria | 6520 |
| 347 | Ga0105249_10090233 | 3300009553 | Bacteria | 2865 |
| 348 | Ga0105249_10196957 | 3300009553 | Bacteria | 1969 |
| 349 | Ga0099796_10014198 | 3300010159 | Bacteria | 2295 |
| 350 | Ga0105239_10009568 | 3300010375 | Bacteria | 10904 |
| 351 | Ga0105239_10045403 | 3300010375 | Bacteria | 4815 |
| 352 | Ga0105239_10074964 | 3300010375 | Bacteria | 3720 |
| 353 | Ga0105239_10078456 | 3300010375 | Bacteria | 3634 |
| 354 | Ga0105239_10098373 | 3300010375 | Bacteria | 3234 |
| 355 | Ga0105246_10001651 | 3300011119 | Bacteria | 13303 |
| 356 | Ga0105246_10019564 | 3300011119 | Bacteria | 4328 |
| 357 | Ga0105246_10040589 | 3300011119 | Bacteria | 3141 |
| 358 | Ga0105246_10055379 | 3300011119 | Bacteria | 2737 |
| 359 | Ga0157370_10139237 | 3300013104 | Bacteria | 2261 |
| 360 | Ga0157369_10011357 | 3300013105 | Bacteria | 10115 |
| 361 | Ga0157369_10012786 | 3300013105 | Bacteria | 9517 |
| 362 | Ga0157369_10039453 | 3300013105 | Bacteria | 5160 |
| 363 | Ga0157369_10315700 | 3300013105 | Bacteria | 1625 |
| 364 | Ga0157374_10039291 | 3300013296 | Bacteria | 4355 |
| 365 | Ga0157378_10006854 | 3300013297 | Bacteria | 9936 |
| 366 | Ga0157378_10008086 | 3300013297 | Bacteria | 9179 |
| 367 | Ga0157378_10035746 | 3300013297 | Bacteria | 4396 |
| 368 | Ga0157378_10043288 | 3300013297 | Bacteria | 3997 |
| 369 | Ga0163162_10016218 | 3300013306 | Bacteria | 7286 |
| 370 | Ga0163162_10111716 | 3300013306 | Bacteria | 2831 |
| 371 | Ga0163162_10127905 | 3300013306 | Bacteria | 2648 |
| 372 | Ga0163162_10211394 | 3300013306 | Bacteria | 2070 |
| 373 | Ga0163162_10392924 | 3300013306 | Bacteria | 1519 |
| 374 | Ga0157372_10000131 | 3300013307 | Bacteria | 82235 |
| 375 | Ga0157372_10006674 | 3300013307 | Bacteria | 12276 |
| 376 | Ga0157372_10012663 | 3300013307 | Bacteria | 8985 |
| 377 | Ga0157372_10365711 | 3300013307 | Bacteria | 1681 |
| 378 | Ga0157375_10001251 | 3300013308 | Bacteria | 21991 |
| 379 | Ga0157375_10004579 | 3300013308 | Bacteria | 12013 |
| 380 | Ga0157375_10028262 | 3300013308 | Bacteria | 5254 |
| 381 | Ga0157375_10053546 | 3300013308 | Bacteria | 3971 |
| 382 | Ga0157375_10258580 | 3300013308 | Bacteria | 1902 |
| 383 | Ga0163163_10044765 | 3300014325 | Bacteria | 4342 |
| 384 | Ga0163163_10081878 | 3300014325 | Bacteria | 3231 |
| 385 | Ga0163163_10232732 | 3300014325 | Bacteria | 1892 |
| 386 | Ga0163163_10250054 | 3300014325 | Bacteria | 1823 |
| 387 | Ga0163163_10357907 | 3300014325 | Bacteria | 1516 |
| 388 | Ga0157380_10009826 | 3300014326 | Bacteria | 6868 |
| 389 | Ga0157380_10035216 | 3300014326 | Bacteria | 3866 |
| 390 | Ga0157380_10054693 | 3300014326 | Bacteria | 3168 |
| 391 | Ga0157380_10058555 | 3300014326 | Bacteria | 3071 |
| 392 | Ga0157380_10111892 | 3300014326 | Bacteria | 2296 |
| 393 | Ga0182008_10000766 | 3300014497 | Bacteria | 22531 |
| 394 | Ga0157377_10005202 | 3300014745 | Bacteria | 6090 |
| 395 | Ga0157379_10006578 | 3300014968 | Bacteria | 10030 |
| 396 | Ga0157379_10008367 | 3300014968 | Bacteria | 8990 |
| 397 | Ga0157379_10042614 | 3300014968 | Bacteria | 4053 |
| 398 | Ga0157379_10056310 | 3300014968 | Bacteria | 3513 |
| 399 | Ga0157379_10137423 | 3300014968 | Bacteria | 2202 |
| 400 | Ga0157376_10014307 | 3300014969 | Bacteria | 5950 |
| 401 | Ga0182007_10001033 | 3300015262 | Bacteria | 15217 |
| 402 | Ga0183367_1008 | 3300015688 | Bacteria | 490626 |
| 403 | Ga0163161_10046285 | 3300017792 | Bacteria | 3139 |
| 404 | Ga0197907_10311176 | 3300020069 | Bacteria | 4437 |
| 405 | Ga0206354_10723847 | 3300020081 | Bacteria | 2099 |
| 406 | Ga0206353_10371772 | 3300020082 | Bacteria | 10645 |
| 407 | Ga0206353_11970105 | 3300020082 | Bacteria | 2691 |
| 408 | Ga0206353_12064141 | 3300020082 | Bacteria | 5506 |
| 409 | Ga0213873_10000084 | 3300021358 | Bacteria | 19378 |
| 410 | Ga0213876_10001902 | 3300021384 | Bacteria | 12559 |
| 411 | Ga0213876_10066972 | 3300021384 | Bacteria | 1896 |
| 412 | Ga0213875_10000723 | 3300021388 | Bacteria | 25222 |
| 413 | Ga0213875_10007311 | 3300021388 | Bacteria | 5713 |
| 414 | Ga0209566_100031 | 3300025225 | Bacteria | 341555 |
| 415 | Ga0209674_100001 | 3300025226 | Bacteria | 4013750 |
| 416 | Ga0209672_100011 | 3300025228 | Bacteria | 856297 |
| 417 | Ga0209147_100619 | 3300025229 | Bacteria | 19317 |
| 418 | Ga0209563_100001 | 3300025230 | Bacteria | 4013775 |
| 419 | Ga0209563_100251 | 3300025230 | Bacteria | 25150 |
| 420 | Ga0207427_100028 | 3300025231 | Bacteria | 388949 |
| 421 | Ga0209437_100581 | 3300025233 | Bacteria | 23408 |
| 422 | Ga0209258_102077 | 3300025242 | Bacteria | 5672 |
| 423 | Ga0209677_100001 | 3300025253 | Bacteria | 4013787 |
| 424 | Ga0209677_101937 | 3300025253 | Bacteria | 8274 |
| 425 | Ga0209148_1000023 | 3300025254 | Bacteria | 680511 |
| 426 | Ga0209233_1000001 | 3300025261 | Bacteria | 2992747 |
| 427 | Ga0209455_1000023 | 3300025272 | Bacteria | 680449 |
| 428 | Ga0207426_1012267 | 3300025302 | Bacteria | 3225 |
| 429 | Ga0207426_1013677 | 3300025302 | Bacteria | 2997 |
| 430 | Ga0209051_1000033 | 3300025303 | Bacteria | 380540 |
| 431 | Ga0209051_1001934 | 3300025303 | Bacteria | 15989 |
| 432 | Ga0209051_1008041 | 3300025303 | Bacteria | 5650 |
| 433 | Ga0207653_10000062 | 3300025885 | Bacteria | 82254 |
| 434 | Ga0207653_10010318 | 3300025885 | Bacteria | 2913 |
| 435 | Ga0207692_10017637 | 3300025898 | Bacteria | 3187 |
| 436 | Ga0207692_10052702 | 3300025898 | Bacteria | 2069 |
| 437 | Ga0207642_10000179 | 3300025899 | Bacteria | 18334 |
| 438 | Ga0207642_10036319 | 3300025899 | Bacteria | 2113 |
| 439 | Ga0207710_10000164 | 3300025900 | Bacteria | 70180 |
| 440 | Ga0207710_10001390 | 3300025900 | Bacteria | 12141 |
| 441 | Ga0207710_10019598 | 3300025900 | Bacteria | 2886 |
| 442 | Ga0207688_10001929 | 3300025901 | Bacteria | 11111 |
| 443 | Ga0207688_10002258 | 3300025901 | Bacteria | 10371 |
| 444 | Ga0207688_10002697 | 3300025901 | Bacteria | 9613 |
| 445 | Ga0207688_10009599 | 3300025901 | Bacteria | 5269 |
| 446 | Ga0207688_10010060 | 3300025901 | Bacteria | 5145 |
| 447 | Ga0207688_10034165 | 3300025901 | Bacteria | 2815 |
| 448 | Ga0207680_10007714 | 3300025903 | Bacteria | 5261 |
| 449 | Ga0207680_10010715 | 3300025903 | Bacteria | 4599 |
| 450 | Ga0207680_10041780 | 3300025903 | Bacteria | 2678 |
| 451 | Ga0207647_10031692 | 3300025904 | Bacteria | 3400 |
| 452 | Ga0207647_10058703 | 3300025904 | Bacteria | 2356 |
| 453 | Ga0207647_10066759 | 3300025904 | Bacteria | 2181 |
| 454 | Ga0207685_10001306 | 3300025905 | Bacteria | 5123 |
| 455 | Ga0207685_10013931 | 3300025905 | Bacteria | 2503 |
| 456 | Ga0207645_10027362 | 3300025907 | Bacteria | 3683 |
| 457 | Ga0207645_10068103 | 3300025907 | Bacteria | 2276 |
| 458 | Ga0207643_10002462 | 3300025908 | Bacteria | 9994 |
| 459 | Ga0207643_10032559 | 3300025908 | Bacteria | 2912 |
| 460 | Ga0207684_10000325 | 3300025910 | Bacteria | 67308 |
| 461 | Ga0207684_10001691 | 3300025910 | Bacteria | 23442 |
| 462 | Ga0207684_10027081 | 3300025910 | Bacteria | 4889 |
| 463 | Ga0207684_10048508 | 3300025910 | Bacteria | 3601 |
| 464 | Ga0207654_10095284 | 3300025911 | Bacteria | 1823 |
| 465 | Ga0207695_10002209 | 3300025913 | Bacteria | 29277 |
| 466 | Ga0207671_10000910 | 3300025914 | Bacteria | 37314 |
| 467 | Ga0207671_10010542 | 3300025914 | Bacteria | 7613 |
| 468 | Ga0207693_10000726 | 3300025915 | Bacteria | 29700 |
| 469 | Ga0207693_10005747 | 3300025915 | Bacteria | 10294 |
| 470 | Ga0207693_10014795 | 3300025915 | Bacteria | 6269 |
| 471 | Ga0207693_10131086 | 3300025915 | Bacteria | 1971 |
| 472 | Ga0207663_10001527 | 3300025916 | Bacteria | 10827 |
| 473 | Ga0207663_10002588 | 3300025916 | Bacteria | 8701 |
| 474 | Ga0207663_10011316 | 3300025916 | Bacteria | 4788 |
| 475 | Ga0207663_10058299 | 3300025916 | Bacteria | 2436 |
| 476 | Ga0207657_10009678 | 3300025919 | Bacteria | 9671 |
| 477 | Ga0207657_10034643 | 3300025919 | Bacteria | 4538 |
| 478 | Ga0207657_10120542 | 3300025919 | Bacteria | 2158 |
| 479 | Ga0207646_10000600 | 3300025922 | Bacteria | 46885 |
| 480 | Ga0207646_10006936 | 3300025922 | Bacteria | 11627 |
| 481 | Ga0207681_10000456 | 3300025923 | Bacteria | 28674 |
| 482 | Ga0207681_10085473 | 3300025923 | Bacteria | 2239 |
| 483 | Ga0207694_10000405 | 3300025924 | Bacteria | 40220 |
| 484 | Ga0207694_10038163 | 3300025924 | Bacteria | 3693 |
| 485 | Ga0207650_10005383 | 3300025925 | Bacteria | 8728 |
| 486 | Ga0207650_10026865 | 3300025925 | Bacteria | 4113 |
| 487 | Ga0207650_10041192 | 3300025925 | Bacteria | 3383 |
| 488 | Ga0207659_10064067 | 3300025926 | Bacteria | 2659 |
| 489 | Ga0207687_10005294 | 3300025927 | Bacteria | 8550 |
| 490 | Ga0207687_10009711 | 3300025927 | Bacteria | 6295 |
| 491 | Ga0207687_10028702 | 3300025927 | Bacteria | 3739 |
| 492 | Ga0207687_10089023 | 3300025927 | Bacteria | 2247 |
| 493 | Ga0207687_10099407 | 3300025927 | Bacteria | 2138 |
| 494 | Ga0207700_10005737 | 3300025928 | Bacteria | 7456 |
| 495 | Ga0207700_10047047 | 3300025928 | Bacteria | 3195 |
| 496 | Ga0207664_10000082 | 3300025929 | Bacteria | 95257 |
| 497 | Ga0207664_10005356 | 3300025929 | Bacteria | 8764 |
| 498 | Ga0207664_10008129 | 3300025929 | Bacteria | 7299 |
| 499 | Ga0207664_10014402 | 3300025929 | Bacteria | 5709 |
| 500 | Ga0207664_10059043 | 3300025929 | Bacteria | 3054 |
| 501 | Ga0207644_10000564 | 3300025931 | Bacteria | 23737 |
| 502 | Ga0207644_10010594 | 3300025931 | Bacteria | 6079 |
| 503 | Ga0207644_10058466 | 3300025931 | Bacteria | 2787 |
| 504 | Ga0207644_10087035 | 3300025931 | Bacteria | 2321 |
| 505 | Ga0207690_10013667 | 3300025932 | Bacteria | 4885 |
| 506 | Ga0207706_10007345 | 3300025933 | Bacteria | 10187 |
| 507 | Ga0207706_10019235 | 3300025933 | Bacteria | 6141 |
| 508 | Ga0207686_10037575 | 3300025934 | Bacteria | 2923 |
| 509 | Ga0207709_10002137 | 3300025935 | Bacteria | 12664 |
| 510 | Ga0207709_10011590 | 3300025935 | Bacteria | 4863 |
| 511 | Ga0207709_10031082 | 3300025935 | Bacteria | 3114 |
| 512 | Ga0207670_10013218 | 3300025936 | Bacteria | 4858 |
| 513 | Ga0207670_10078538 | 3300025936 | Bacteria | 2302 |
| 514 | Ga0207669_10001598 | 3300025937 | Bacteria | 9649 |
| 515 | Ga0207669_10008741 | 3300025937 | Bacteria | 4776 |
| 516 | Ga0207669_10032739 | 3300025937 | Bacteria | 2924 |
| 517 | Ga0207669_10085760 | 3300025937 | Bacteria | 2034 |
| 518 | Ga0207669_10106313 | 3300025937 | Bacteria | 1869 |
| 519 | Ga0207704_10002309 | 3300025938 | Bacteria | 8573 |
| 520 | Ga0207704_10062815 | 3300025938 | Bacteria | 2311 |
| 521 | Ga0207665_10004580 | 3300025939 | Bacteria | 9178 |
| 522 | Ga0207665_10015744 | 3300025939 | Bacteria | 4963 |
| 523 | Ga0207665_10036942 | 3300025939 | Bacteria | 3250 |
| 524 | Ga0207665_10041490 | 3300025939 | Bacteria | 3074 |
| 525 | Ga0207691_10017365 | 3300025940 | Bacteria | 6826 |
| 526 | Ga0207691_10047852 | 3300025940 | Bacteria | 3923 |
| 527 | Ga0207691_10077702 | 3300025940 | Bacteria | 2989 |
| 528 | Ga0207711_10000196 | 3300025941 | Bacteria | 64910 |
| 529 | Ga0207711_10018619 | 3300025941 | Bacteria | 5774 |
| 530 | Ga0207711_10041264 | 3300025941 | Bacteria | 3929 |
| 531 | Ga0207711_10206317 | 3300025941 | Bacteria | 1794 |
| 532 | Ga0207689_10002479 | 3300025942 | Bacteria | 17159 |
| 533 | Ga0207689_10117628 | 3300025942 | Bacteria | 2185 |
| 534 | Ga0207661_10008291 | 3300025944 | Bacteria | 7425 |
| 535 | Ga0207661_10121816 | 3300025944 | Bacteria | 2221 |
| 536 | Ga0207679_10015063 | 3300025945 | Bacteria | 5098 |
| 537 | Ga0207679_10134134 | 3300025945 | Bacteria | 1991 |
| 538 | Ga0207667_10042028 | 3300025949 | Bacteria | 4862 |
| 539 | Ga0207667_10072320 | 3300025949 | Bacteria | 3585 |
| 540 | Ga0207667_10104289 | 3300025949 | Bacteria | 2925 |
| 541 | Ga0207667_10113164 | 3300025949 | Bacteria | 2798 |
| 542 | Ga0207712_10000029 | 3300025961 | Bacteria | 220014 |
| 543 | Ga0207712_10014228 | 3300025961 | Bacteria | 5111 |
| 544 | Ga0207668_10006881 | 3300025972 | Bacteria | 6748 |
| 545 | Ga0207668_10009927 | 3300025972 | Bacteria | 5724 |
| 546 | Ga0207668_10060365 | 3300025972 | Bacteria | 2661 |
| 547 | Ga0207640_10001076 | 3300025981 | Bacteria | 15126 |
| 548 | Ga0207640_10098135 | 3300025981 | Bacteria | 2047 |
| 549 | Ga0207658_10000517 | 3300025986 | Bacteria | 35169 |
| 550 | Ga0207658_10000850 | 3300025986 | Bacteria | 25516 |
| 551 | Ga0207658_10004057 | 3300025986 | Bacteria | 10224 |
| 552 | Ga0207658_10024654 | 3300025986 | Bacteria | 4210 |
| 553 | Ga0207658_10041620 | 3300025986 | Bacteria | 3328 |
| 554 | Ga0207677_10006454 | 3300026023 | Bacteria | 6437 |
| 555 | Ga0207677_10009603 | 3300026023 | Bacteria | 5445 |
| 556 | Ga0207677_10132116 | 3300026023 | Bacteria | 1897 |
| 557 | Ga0207677_10145946 | 3300026023 | Bacteria | 1818 |
| 558 | Ga0207703_10007260 | 3300026035 | Bacteria | 8811 |
| 559 | Ga0207703_10020636 | 3300026035 | Bacteria | 5153 |
| 560 | Ga0207703_10023378 | 3300026035 | Bacteria | 4854 |
| 561 | Ga0207703_10084282 | 3300026035 | Bacteria | 2657 |
| 562 | Ga0207678_10003353 | 3300026067 | Bacteria | 14451 |
| 563 | Ga0207678_10032351 | 3300026067 | Bacteria | 4558 |
| 564 | Ga0207678_10042275 | 3300026067 | Bacteria | 3949 |
| 565 | Ga0207678_10062387 | 3300026067 | Bacteria | 3204 |
| 566 | Ga0207678_10071753 | 3300026067 | Bacteria | 2969 |
| 567 | Ga0207678_10129254 | 3300026067 | Bacteria | 2154 |
| 568 | Ga0207708_10004753 | 3300026075 | Bacteria | 9994 |
| 569 | Ga0207708_10006787 | 3300026075 | Bacteria | 8471 |
| 570 | Ga0207708_10018905 | 3300026075 | Bacteria | 5189 |
| 571 | Ga0207708_10019809 | 3300026075 | Bacteria | 5073 |
| 572 | Ga0207708_10022689 | 3300026075 | Bacteria | 4739 |
| 573 | Ga0207708_10058417 | 3300026075 | Bacteria | 2943 |
| 574 | Ga0207708_10081222 | 3300026075 | Bacteria | 2491 |
| 575 | Ga0207708_10096280 | 3300026075 | Bacteria | 2287 |
| 576 | Ga0207702_10151189 | 3300026078 | Bacteria | 2112 |
| 577 | Ga0207641_10002103 | 3300026088 | Bacteria | 18819 |
| 578 | Ga0207641_10004316 | 3300026088 | Bacteria | 12349 |
| 579 | Ga0207641_10033440 | 3300026088 | Bacteria | 4271 |
| 580 | Ga0207641_10126229 | 3300026088 | Bacteria | 2291 |
| 581 | Ga0207648_10009508 | 3300026089 | Bacteria | 9301 |
| 582 | Ga0207648_10011289 | 3300026089 | Bacteria | 8422 |
| 583 | Ga0207648_10036581 | 3300026089 | Bacteria | 4325 |
| 584 | Ga0207648_10044017 | 3300026089 | Bacteria | 3918 |
| 585 | Ga0207676_10016796 | 3300026095 | Bacteria | 5298 |
| 586 | Ga0207676_10065671 | 3300026095 | Bacteria | 2890 |
| 587 | Ga0207674_10001198 | 3300026116 | Bacteria | 33773 |
| 588 | Ga0207674_10035199 | 3300026116 | Bacteria | 5227 |
| 589 | Ga0207674_10045935 | 3300026116 | Bacteria | 4488 |
| 590 | Ga0207674_10070254 | 3300026116 | Bacteria | 3520 |
| 591 | Ga0207675_100008196 | 3300026118 | Bacteria | 9845 |
| 592 | Ga0207675_100008622 | 3300026118 | Bacteria | 9586 |
| 593 | Ga0207675_100015055 | 3300026118 | Bacteria | 7217 |
| 594 | Ga0207675_100048519 | 3300026118 | Bacteria | 3963 |
| 595 | Ga0207675_100140274 | 3300026118 | Bacteria | 2296 |
| 596 | Ga0207675_100153081 | 3300026118 | Bacteria | 2196 |
| 597 | Ga0207683_10000327 | 3300026121 | Bacteria | 43250 |
| 598 | Ga0207683_10003687 | 3300026121 | Bacteria | 13311 |
| 599 | Ga0207683_10006112 | 3300026121 | Bacteria | 10312 |
| 600 | Ga0207683_10021432 | 3300026121 | Bacteria | 5532 |
| 601 | Ga0207683_10028085 | 3300026121 | Bacteria | 4865 |
| 602 | Ga0207683_10064171 | 3300026121 | Bacteria | 3236 |
| 603 | Ga0207683_10133096 | 3300026121 | Bacteria | 2237 |
| 604 | Ga0207698_10039588 | 3300026142 | Bacteria | 3494 |
| 605 | Ga0207698_10083442 | 3300026142 | Bacteria | 2586 |
| 606 | Ga0207698_10095781 | 3300026142 | Bacteria | 2444 |
| 607 | Ga0209813_10001694 | 3300027866 | Bacteria | 4967 |
| 608 | Ga0207428_10003736 | 3300027907 | Bacteria | 14611 |
| 609 | Ga0207428_10011116 | 3300027907 | Bacteria | 7993 |
| 610 | Ga0207428_10015628 | 3300027907 | Bacteria | 6560 |
| 611 | Ga0207428_10129333 | 3300027907 | Bacteria | 1933 |
| 612 | Ga0268266_10000937 | 3300028379 | Bacteria | 37178 |
| 613 | Ga0268266_10003055 | 3300028379 | Bacteria | 17117 |
| 614 | Ga0268266_10004718 | 3300028379 | Bacteria | 12965 |
| 615 | Ga0268266_10006438 | 3300028379 | Bacteria | 10754 |
| 616 | Ga0268266_10019587 | 3300028379 | Bacteria | 5765 |
| 617 | Ga0268266_10048502 | 3300028379 | Bacteria | 3641 |
| 618 | Ga0268266_10122086 | 3300028379 | Bacteria | 2319 |
| 619 | Ga0268266_10156730 | 3300028379 | Bacteria | 2057 |
| 620 | Ga0268266_10265384 | 3300028379 | Bacteria | 1592 |
| 621 | Ga0268265_10000389 | 3300028380 | Bacteria | 46920 |
| 622 | Ga0268265_10005881 | 3300028380 | Bacteria | 8360 |
| 623 | Ga0268265_10020870 | 3300028380 | Bacteria | 4579 |
| 624 | Ga0268265_10141224 | 3300028380 | Bacteria | 2017 |
| 625 | Ga0268264_10000017 | 3300028381 | Bacteria | 498037 |
| 626 | Ga0268264_10000226 | 3300028381 | Bacteria | 109817 |
| 627 | Ga0268264_10000315 | 3300028381 | Bacteria | 77227 |
| 628 | Ga0268264_10004905 | 3300028381 | Bacteria | 11335 |
| 629 | Ga0268264_10051850 | 3300028381 | Bacteria | 3420 |
| 630 | Ga0268264_10058926 | 3300028381 | Bacteria | 3217 |
| 631 | Ga0268264_10100118 | 3300028381 | Bacteria | 2517 |
| 632 | Ga0265334_10001828 | 3300028573 | Bacteria | 10137 |
| 633 | Ga0265336_10008877 | 3300028666 | Bacteria | 3504 |
| 634 | Ga0307517_10043175 | 3300028786 | Bacteria | 4809 |
| 635 | Ga0307515_10000596 | 3300028794 | Bacteria | 84243 |
| 636 | Ga0307515_10022623 | 3300028794 | Bacteria | 11066 |
| 637 | Ga0307515_10061782 | 3300028794 | Bacteria | 5304 |
| 638 | Ga0307515_10085100 | 3300028794 | Bacteria | 4051 |
| 639 | Ga0307515_10129515 | 3300028794 | Bacteria | 2790 |
| 640 | Ga0265338_10013968 | 3300028800 | Bacteria | 9004 |
| 641 | Ga0307511_10000678 | 3300030521 | Bacteria | 36277 |
| 642 | Ga0314311_1022273 | 3300030733 | Bacteria | 1784 |
| 643 | Ga0314311_1197083 | 3300030733 | Bacteria | 2098 |
| 644 | Ga0316179_1002615 | 3300030734 | Bacteria | 2369 |
| 645 | Ga0265340_10001252 | 3300031247 | Bacteria | 14590 |
| 646 | Ga0265327_10000001 | 3300031251 | Bacteria | 894475 |
| 647 | Ga0265327_10000131 | 3300031251 | Bacteria | 164189 |
| 648 | Ga0265327_10002081 | 3300031251 | Bacteria | 22359 |
| 649 | Ga0307513_10000002 | 3300031456 | Bacteria | 842612 |
| 650 | Ga0307513_10001948 | 3300031456 | Bacteria | 29204 |
| 651 | Ga0307513_10006778 | 3300031456 | Bacteria | 14939 |
| 652 | Ga0307513_10040019 | 3300031456 | Bacteria | 5188 |
| 653 | Ga0307509_10027386 | 3300031507 | Bacteria | 6342 |
| 654 | Ga0307509_10143685 | 3300031507 | Bacteria | 2316 |
| 655 | Ga0307408_100161678 | 3300031548 | Bacteria | 1779 |
| 656 | Ga0307408_100181541 | 3300031548 | Bacteria | 1688 |
| 657 | Ga0307508_10032770 | 3300031616 | Bacteria | 4691 |
| 658 | Ga0307508_10099965 | 3300031616 | Bacteria | 2495 |
| 659 | Ga0307514_10029291 | 3300031649 | Bacteria | 4431 |
| 660 | Ga0307514_10029464 | 3300031649 | Bacteria | 4414 |
| 661 | Ga0307514_10079903 | 3300031649 | Bacteria | 2422 |
| 662 | Ga0316575_10011016 | 3300031665 | Bacteria | 3336 |
| 663 | Ga0316579_10001001 | 3300031691 | Bacteria | 9921 |
| 664 | Ga0316579_10006084 | 3300031691 | Bacteria | 4904 |
| 665 | Ga0316576_10005277 | 3300031727 | Bacteria | 7871 |
| 666 | Ga0316576_10029031 | 3300031727 | Bacteria | 3904 |
| 667 | Ga0316578_10011617 | 3300031728 | Bacteria | 4615 |
| 668 | Ga0307516_10021393 | 3300031730 | Bacteria | 6657 |
| 669 | Ga0307516_10031960 | 3300031730 | Bacteria | 5304 |
| 670 | Ga0307413_10000162 | 3300031824 | Bacteria | 18383 |
| 671 | Ga0307407_10042698 | 3300031903 | Bacteria | 2544 |
| 672 | Ga0307407_10113467 | 3300031903 | Bacteria | 1705 |
| 673 | Ga0307412_10020923 | 3300031911 | Bacteria | 3988 |
| 674 | Ga0307412_10028201 | 3300031911 | Bacteria | 3510 |
| 675 | Ga0307412_10038793 | 3300031911 | Bacteria | 3070 |
| 676 | Ga0307412_10062426 | 3300031911 | Bacteria | 2509 |
| 677 | Ga0307409_100091232 | 3300031995 | Bacteria | 2496 |
| 678 | Ga0307409_100105187 | 3300031995 | Bacteria | 2352 |
| 679 | Ga0307409_100109826 | 3300031995 | Bacteria | 2310 |
| 680 | Ga0307416_100246945 | 3300032002 | Bacteria | 1734 |
| 681 | Ga0307416_100291362 | 3300032002 | Bacteria | 1616 |
| 682 | Ga0307411_10025869 | 3300032005 | Bacteria | 3523 |
| 683 | Ga0307411_10118824 | 3300032005 | Bacteria | 1908 |
| 684 | Ga0307415_100010986 | 3300032126 | Bacteria | 5156 |
| 685 | Ga0307415_100089708 | 3300032126 | Bacteria | 2221 |
| 686 | Ga0316583_10014076 | 3300032133 | Bacteria | 2886 |
| 687 | Ga0307507_10014930 | 3300033179 | Bacteria | 9197 |
| 688 | Ga0307507_10020073 | 3300033179 | Bacteria | 7496 |
| 689 | Ga0307507_10032404 | 3300033179 | Bacteria | 5456 |
| 690 | Ga0307507_10041417 | 3300033179 | Bacteria | 4609 |
| 691 | Ga0307510_10019664 | 3300033180 | Bacteria | 7912 |
| 692 | Ga0373948_0005457 | 3300034817 | Bacteria | 2065 |
| 693 | Ga0373938_0009642 | 3300034957 | Bacteria | 1755 |
| 694 | Ga0373934_0007586 | 3300035086 | Bacteria | 4030 |
| 695 | Ga0373940_0002605 | 3300035088 | Bacteria | 3542 |
| 696 | Ga0373944_0000004 | 3300035089 | Bacteria | 49340 |
| 697 | Ga0373949_0005799 | 3300035090 | Bacteria | 2747 |
| 698 | Ga0373951_0000009 | 3300035091 | Bacteria | 77764 |
| 699 | Ga0373952_0007530 | 3300035092 | Bacteria | 2043 |
| 700 | Ga0373932_0004489 | 3300035112 | Bacteria | 3296 |
| 701 | Ga0373932_0014282 | 3300035112 | Bacteria | 1993 |
| 702 | Ga0373936_0003475 | 3300035113 | Bacteria | 5917 |
| 703 | Ga0373936_0053612 | 3300035113 | Bacteria | 1635 |
| 704 | Ga0373941_0007526 | 3300035115 | Bacteria | 2667 |
| 705 | Ga0373945_0000904 | 3300035116 | Bacteria | 8780 |
| 706 | Ga0373953_0000384 | 3300035117 | Bacteria | 11972 |
| 707 | Ga0373953_0001003 | 3300035117 | Bacteria | 7954 |
| 708 | Ga0373956_0000352 | 3300035119 | Bacteria | 18674 |
| 709 | Ga0373956_0019543 | 3300035119 | Bacteria | 2874 |
| 710 | Ga0373957_0000060 | 3300035120 | Bacteria | 26353 |
| 711 | Ga0373960_0002465 | 3300035121 | Bacteria | 4157 |
| 712 | Ga0373960_0032669 | 3300035121 | Bacteria | 1463 |
| 713 | Ga0373955_0000023 | 3300035172 | Bacteria | 61144 |
| 714 | Ga0373955_0009263 | 3300035172 | Bacteria | 4610 |
| 715 | Ga0373961_0007126 | 3300035241 | Bacteria | 2696 |
| 716 | Ga0373962_0001917 | 3300035242 | Bacteria | 4957 |
| 717 | Ga0316574_0035536 | 3300035398 | Bacteria | 3046 |
| 718 | Ga0373924_0000690 | 3300035410 | Bacteria | 10499 |
| 719 | Ga0373931_0007778 | 3300035691 | Bacteria | 5064 |
| 720 | Ga0373931_0011048 | 3300035691 | Bacteria | 4354 |
| 721 | Ga0373931_0081546 | 3300035691 | Bacteria | 1786 |
| 722 | Ga0373935_0025341 | 3300035692 | Bacteria | 3655 |
| 723 | Ga0373935_0030183 | 3300035692 | Bacteria | 3358 |
| 724 | Ga0373935_0178000 | 3300035692 | Bacteria | 1459 |
| 725 | Ga0373927_0000623 | 3300035695 | Bacteria | 26873 |
| 726 | Ga0373927_0023872 | 3300035695 | Bacteria | 4001 |
| 727 | Ga0373933_0002530 | 3300035724 | Bacteria | 10257 |
| 728 | Ga0373933_0072026 | 3300035724 | Bacteria | 2104 |
| 729 | Ga0373947_0060929 | 3300035725 | Bacteria | 2292 |
| 730 | Ga0373937_0000002 | 3300036401 | Bacteria | 304133 |
| 731 | Ga0373937_0002929 | 3300036401 | Bacteria | 14272 |
| 732 | Ga0373937_0087626 | 3300036401 | Bacteria | 2881 |
| 733 | Ga0316582_0006156 | 3300036647 | Bacteria | 6267 |
| 734 | Ga0316582_0023811 | 3300036647 | Bacteria | 3653 |
| 735 | Ga0316584_0014503 | 3300036712 | Bacteria | 5611 |
| 736 | Ga0316584_0058453 | 3300036712 | Bacteria | 2887 |
| 737 | Ga0316584_0081727 | 3300036712 | Bacteria | 2420 |
| 738 | Ga0373925_0004553 | 3300037068 | Bacteria | 10473 |
| 739 | Ga0395899_0017915 | 3300037312 | Bacteria | 5390 |
| 740 | Ga0395899_0037345 | 3300037312 | Bacteria | 3641 |
| 741 | Ga0395899_0041209 | 3300037312 | Bacteria | 3451 |
| 742 | Ga0395899_0048862 | 3300037312 | Bacteria | 3146 |
| 743 | Ga0395899_0057395 | 3300037312 | Bacteria | 2874 |
| 744 | Ga0395900_0019737 | 3300037418 | Bacteria | 6870 |
| 745 | Ga0395900_0026863 | 3300037418 | Bacteria | 5891 |
| 746 | Ga0395900_0031138 | 3300037418 | Bacteria | 5480 |
| 747 | Ga0395900_0036187 | 3300037418 | Bacteria | 5088 |
| 748 | Ga0395900_0067014 | 3300037418 | Bacteria | 3689 |
| 749 | Ga0395900_0123683 | 3300037418 | Bacteria | 2653 |
| 750 | Ga0395900_0129368 | 3300037418 | Bacteria | 2588 |
| 751 | Ga0395900_0137597 | 3300037418 | Bacteria | 2502 |
| 752 | Ga0395900_0227765 | 3300037418 | Bacteria | 1876 |
| 753 | Ga0395898_0000100 | 3300037466 | Bacteria | 226446 |
| 754 | Ga0395898_0012933 | 3300037466 | Bacteria | 8609 |
| 755 | Ga0395898_0020175 | 3300037466 | Bacteria | 6771 |
| 756 | Ga0395898_0025730 | 3300037466 | Bacteria | 5927 |
| 757 | Ga0395898_0032692 | 3300037466 | Bacteria | 5193 |
| 758 | Ga0395898_0035131 | 3300037466 | Bacteria | 4988 |
| 759 | Ga0395905_0008024 | 3300037471 | Bacteria | 10431 |
| 760 | Ga0395905_0023340 | 3300037471 | Bacteria | 5848 |
| 761 | Ga0395905_0038124 | 3300037471 | Bacteria | 4509 |
| 762 | Ga0395905_0039722 | 3300037471 | Bacteria | 4415 |
| 763 | Ga0395905_0041867 | 3300037471 | Bacteria | 4299 |
| 764 | Ga0436364_0026322 | 3300037853 | Bacteria | 25266 |
| 765 | Ga0436364_0259237 | 3300037853 | Bacteria | 7822 |
| 766 | Ga0436364_0261085 | 3300037853 | Bacteria | 4123 |
| 767 | Ga0436364_0783642 | 3300037853 | Bacteria | 30576 |
| 768 | Ga0436364_1199653 | 3300037853 | Bacteria | 9773 |
| 769 | Ga0395901_0008790 | 3300038443 | Bacteria | 10220 |
| 770 | Ga0395901_0014492 | 3300038443 | Bacteria | 8019 |
| 771 | Ga0395901_0018796 | 3300038443 | Bacteria | 7062 |
| 772 | Ga0395901_0040004 | 3300038443 | Bacteria | 4853 |
| 773 | Ga0395901_0047917 | 3300038443 | Bacteria | 4437 |
| 774 | Ga0395901_0117749 | 3300038443 | Bacteria | 2791 |
| 775 | Ga0395901_0150997 | 3300038443 | Bacteria | 2441 |
| 776 | Ga0395901_0158121 | 3300038443 | Bacteria | 2380 |
| 777 | Ga0395901_0190418 | 3300038443 | Bacteria | 2151 |
| 778 | Ga0395901_0243584 | 3300038443 | Bacteria | 1874 |
| 779 | Ga0395901_0260734 | 3300038443 | Bacteria | 1804 |
| 780 | Ga0395901_0266107 | 3300038443 | Bacteria | 1784 |
| 781 | Ga0395901_0294517 | 3300038443 | Bacteria | 1683 |
| 782 | Ga0436365_0064456 | 3300039437 | Bacteria | 6568 |
| 783 | Ga0436365_0671847 | 3300039437 | Bacteria | 34209 |
| 784 | Ga0436365_1818399 | 3300039437 | Bacteria | 33160 |
| 785 | Ga0436365_1833781 | 3300039437 | Bacteria | 32006 |
| 786 | Ga0436363_1277403 | 3300039450 | Bacteria | 1782 |
| 787 | Ga0436362_0198821 | 3300039453 | Bacteria | 18109 |
| 788 | Ga0439436_0001616 | 3300041404 | Bacteria | 6561 |
| 789 | Ga0439436_0014584 | 3300041404 | Bacteria | 2368 |
| 790 | Ga0439438_011422 | 3300041405 | Bacteria | 2767 |
| 791 | Ga0439439_0001413 | 3300041406 | Bacteria | 4767 |
| 792 | Ga0439461_0000228 | 3300041410 | Bacteria | 7920 |
| 793 | Ga0439465_0007793 | 3300041413 | Bacteria | 3395 |
| 794 | Ga0439465_0012021 | 3300041413 | Bacteria | 2710 |
| 795 | Ga0451793_1845951 | 3300041452 | Bacteria | 2587 |
| 796 | Ga0451797_0041771 | 3300041453 | Bacteria | 1996 |
| 797 | Ga0451833_0032744 | 3300041491 | Bacteria | 3703 |
| 798 | Ga0451837_0514389 | 3300041494 | Bacteria | 6887 |
| 799 | Ga0451839_0137481 | 3300041496 | Bacteria | 3620 |
| 800 | Ga0451853_1798325 | 3300041512 | Bacteria | 2313 |
| 801 | Ga0451853_2403763 | 3300041512 | Bacteria | 4652 |
| 802 | Ga0439445_0000209 | 3300042004 | Bacteria | 10750 |
| 803 | Ga0439445_0015721 | 3300042004 | Bacteria | 1856 |
| 804 | Ga0439448_0002247 | 3300042005 | Bacteria | 5219 |
| 805 | Ga0439449_0000357 | 3300042007 | Bacteria | 16784 |
| 806 | Ga0439449_0026951 | 3300042007 | Bacteria | 2145 |
| 807 | Ga0439457_000476 | 3300042014 | Bacteria | 11566 |
| 808 | Ga0439457_008199 | 3300042014 | Bacteria | 2470 |
| 809 | Ga0439462_0001374 | 3300042015 | Bacteria | 5379 |
| 810 | Ga0450894_000050 | 3300042131 | Bacteria | 17933 |
| 811 | Ga0450898_000106 | 3300042134 | Bacteria | 7849 |
| 812 | Ga0450903_000683 | 3300042138 | Bacteria | 6784 |
| 813 | Ga0450906_001211 | 3300042145 | Bacteria | 5708 |
| 814 | Ga0450907_002846 | 3300042146 | Bacteria | 3194 |
| 815 | Ga0466969_0014647 | 3300044656 | Bacteria | 4122 |
| 816 | Ga0466969_0021118 | 3300044656 | Bacteria | 3369 |
| 817 | Ga0466969_0039214 | 3300044656 | Bacteria | 2380 |
| 818 | Ga0466972_0004069 | 3300044658 | Bacteria | 7299 |
| 819 | Ga0466972_0004237 | 3300044658 | Bacteria | 7170 |
| 820 | Ga0466972_0005148 | 3300044658 | Bacteria | 6546 |
| 821 | Ga0466972_0005236 | 3300044658 | Bacteria | 6493 |
| 822 | Ga0466972_0010726 | 3300044658 | Bacteria | 4599 |
| 823 | Ga0466972_0011660 | 3300044658 | Bacteria | 4414 |
| 824 | Ga0466972_0022424 | 3300044658 | Bacteria | 3145 |
| 825 | Ga0466972_0023719 | 3300044658 | Bacteria | 3049 |
| 826 | Ga0466972_0037778 | 3300044658 | Bacteria | 2360 |
| 827 | Ga0466972_0039065 | 3300044658 | Bacteria | 2317 |
| 828 | Ga0466972_0078250 | 3300044658 | Bacteria | 1575 |
| 829 | Ga0466965_0002025 | 3300044683 | Bacteria | 8489 |
| 830 | Ga0466965_0002597 | 3300044683 | Bacteria | 7726 |
| 831 | Ga0466965_0021752 | 3300044683 | Bacteria | 3090 |
| 832 | Ga0466965_0031149 | 3300044683 | Bacteria | 2600 |
| 833 | Ga0466966_0002442 | 3300044684 | Bacteria | 12148 |
| 834 | Ga0466966_0002752 | 3300044684 | Bacteria | 11550 |
| 835 | Ga0466966_0003595 | 3300044684 | Bacteria | 10233 |
| 836 | Ga0466966_0003942 | 3300044684 | Bacteria | 9803 |
| 837 | Ga0466966_0004948 | 3300044684 | Bacteria | 8756 |
| 838 | Ga0466966_0008977 | 3300044684 | Bacteria | 6625 |
| 839 | Ga0466966_0018090 | 3300044684 | Bacteria | 4652 |
| 840 | Ga0466966_0044570 | 3300044684 | Bacteria | 2839 |
| 841 | Ga0466966_0057069 | 3300044684 | Bacteria | 2469 |
| 842 | Ga0466966_0058042 | 3300044684 | Bacteria | 2446 |
| 843 | Ga0466966_0077943 | 3300044684 | Bacteria | 2067 |
| 844 | Ga0466961_0006450 | 3300044693 | Bacteria | 7450 |
| 845 | Ga0466961_0012392 | 3300044693 | Bacteria | 5452 |
| 846 | Ga0466961_0014592 | 3300044693 | Bacteria | 5047 |
| 847 | Ga0466961_0022060 | 3300044693 | Bacteria | 4097 |
| 848 | Ga0466961_0029038 | 3300044693 | Bacteria | 3556 |
| 849 | Ga0466961_0033106 | 3300044693 | Bacteria | 3322 |
| 850 | Ga0466961_0052076 | 3300044693 | Bacteria | 2612 |
| 851 | Ga0466961_0089131 | 3300044693 | Bacteria | 1948 |
| 852 | Ga0466963_0000277 | 3300044694 | Bacteria | 22841 |
| 853 | Ga0466963_0003366 | 3300044694 | Bacteria | 9128 |
| 854 | Ga0466963_0005946 | 3300044694 | Bacteria | 7187 |
| 855 | Ga0466963_0010205 | 3300044694 | Bacteria | 5681 |
| 856 | Ga0466963_0015792 | 3300044694 | Bacteria | 4685 |
| 857 | Ga0466963_0037685 | 3300044694 | Bacteria | 3159 |
| 858 | Ga0466963_0038588 | 3300044694 | Bacteria | 3124 |
| 859 | Ga0466963_0045188 | 3300044694 | Bacteria | 2900 |
| 860 | Ga0466963_0048494 | 3300044694 | Bacteria | 2806 |
| 861 | Ga0466963_0060153 | 3300044694 | Bacteria | 2536 |
| 862 | Ga0466963_0071200 | 3300044694 | Bacteria | 2340 |
| 863 | Ga0466963_0090605 | 3300044694 | Bacteria | 2082 |
| 864 | Ga0466964_0001054 | 3300044706 | Bacteria | 9206 |
| 865 | Ga0466964_0002951 | 3300044706 | Bacteria | 6147 |
| 866 | Ga0466964_0010248 | 3300044706 | Bacteria | 3535 |
| 867 | Ga0453684_0000719 | 3300044712 | Bacteria | 116945 |
| 868 | Ga0453684_0001079 | 3300044712 | Bacteria | 86824 |
| 869 | Ga0466971_0002024 | 3300044719 | Bacteria | 8581 |
| 870 | Ga0466971_0007929 | 3300044719 | Bacteria | 4627 |
| 871 | Ga0466971_0017094 | 3300044719 | Bacteria | 3205 |
| 872 | Ga0466971_0019147 | 3300044719 | Bacteria | 3038 |
| 873 | Ga0466971_0026675 | 3300044719 | Bacteria | 2583 |
| 874 | Ga0466968_0005739 | 3300044735 | Bacteria | 4657 |
| 875 | Ga0466968_0012560 | 3300044735 | Bacteria | 3318 |
| 876 | Ga0466968_0043542 | 3300044735 | Bacteria | 1901 |
| 877 | Ga0466970_0001383 | 3300044765 | Bacteria | 11691 |
| 878 | Ga0466970_0001467 | 3300044765 | Bacteria | 11385 |
| 879 | Ga0466970_0002516 | 3300044765 | Bacteria | 8838 |
| 880 | Ga0466970_0006080 | 3300044765 | Bacteria | 6017 |
| 881 | Ga0466970_0011760 | 3300044765 | Bacteria | 4465 |
| 882 | Ga0466970_0018686 | 3300044765 | Bacteria | 3591 |
| 883 | Ga0466970_0019119 | 3300044765 | Bacteria | 3550 |
| 884 | Ga0466970_0021255 | 3300044765 | Bacteria | 3379 |
| 885 | Ga0466970_0024087 | 3300044765 | Bacteria | 3182 |
| 886 | Ga0466970_0028270 | 3300044765 | Bacteria | 2945 |
| 887 | Ga0466970_0040679 | 3300044765 | Bacteria | 2468 |
| 888 | Ga0466970_0052778 | 3300044765 | Bacteria | 2170 |
| 889 | Ga0466957_0000471 | 3300044842 | Bacteria | 19989 |
| 890 | Ga0466957_0002105 | 3300044842 | Bacteria | 10647 |
| 891 | Ga0466957_0012124 | 3300044842 | Bacteria | 4987 |
| 892 | Ga0466957_0030972 | 3300044842 | Bacteria | 3195 |
| 893 | Ga0466957_0110635 | 3300044842 | Bacteria | 1741 |
| 894 | Ga0466960_0000683 | 3300044901 | Bacteria | 11808 |
| 895 | Ga0466960_0004914 | 3300044901 | Bacteria | 5260 |
| 896 | Ga0466960_0005920 | 3300044901 | Bacteria | 4876 |
| 897 | Ga0466960_0007257 | 3300044901 | Bacteria | 4491 |
| 898 | Ga0466960_0008436 | 3300044901 | Bacteria | 4220 |
| 899 | Ga0466960_0011368 | 3300044901 | Bacteria | 3723 |
| 900 | Ga0466960_0052912 | 3300044901 | Bacteria | 1966 |
| 901 | Ga0466960_0066334 | 3300044901 | Bacteria | 1784 |
| 902 | Ga0466960_0068193 | 3300044901 | Bacteria | 1764 |
| 903 | Ga0466960_0068435 | 3300044901 | Bacteria | 1761 |
| 904 | Ga0466960_0068807 | 3300044901 | Bacteria | 1757 |
| 905 | Ga0466959_0003472 | 3300045049 | Bacteria | 10320 |
| 906 | Ga0466959_0003956 | 3300045049 | Bacteria | 9845 |
| 907 | Ga0466959_0010256 | 3300045049 | Bacteria | 6688 |
| 908 | Ga0466959_0017352 | 3300045049 | Bacteria | 5276 |
| 909 | Ga0466959_0031087 | 3300045049 | Bacteria | 3951 |
| 910 | Ga0466959_0032390 | 3300045049 | Bacteria | 3869 |
| 911 | Ga0466959_0049923 | 3300045049 | Bacteria | 3073 |
| 912 | Ga0466959_0061768 | 3300045049 | Bacteria | 2724 |
| 913 | Ga0466959_0068249 | 3300045049 | Bacteria | 2577 |
| 914 | Ga0466959_0079611 | 3300045049 | Bacteria | 2362 |
| 915 | Ga0466959_0089206 | 3300045049 | Bacteria | 2215 |
| 916 | Ga0466958_0001073 | 3300045836 | Bacteria | 12562 |
| 917 | Ga0466958_0014838 | 3300045836 | Bacteria | 4453 |
| 918 | Ga0466958_0015631 | 3300045836 | Bacteria | 4353 |
| 919 | Ga0466958_0050742 | 3300045836 | Bacteria | 2511 |
| 920 | Ga0466967_0000302 | 3300045976 | Bacteria | 22184 |
| 921 | Ga0466967_0001526 | 3300045976 | Bacteria | 13538 |
| 922 | Ga0466967_0008914 | 3300045976 | Bacteria | 7404 |
| 923 | Ga0466967_0010313 | 3300045976 | Bacteria | 6998 |
| 924 | Ga0466967_0021383 | 3300045976 | Bacteria | 5253 |
| 925 | Ga0466967_0022734 | 3300045976 | Bacteria | 5124 |
| 926 | Ga0466967_0026462 | 3300045976 | Bacteria | 4806 |
| 927 | Ga0466967_0041240 | 3300045976 | Bacteria | 3978 |
| 928 | Ga0466967_0043325 | 3300045976 | Bacteria | 3896 |
| 929 | Ga0466967_0077492 | 3300045976 | Bacteria | 2992 |
| 930 | Ga0466967_0087802 | 3300045976 | Bacteria | 2820 |
| 931 | Ga0466967_0174189 | 3300045976 | Bacteria | 2026 |
| 932 | Ga0466967_0254873 | 3300045976 | Bacteria | 1677 |
| 933 | Ga0495592_0000003 | 3300046454 | Bacteria | 200744 |
| 934 | Ga0495592_0009084 | 3300046454 | Bacteria | 7477 |
| 935 | Ga0495592_0040124 | 3300046454 | Bacteria | 3513 |
| 936 | Ga0495592_0042690 | 3300046454 | Bacteria | 3395 |
| 937 | Ga0495603_0007070 | 3300046455 | Bacteria | 6733 |
| 938 | Ga0495603_0015069 | 3300046455 | Bacteria | 4675 |
| 939 | Ga0495603_0017507 | 3300046455 | Bacteria | 4336 |
| 940 | Ga0495603_0027400 | 3300046455 | Bacteria | 3439 |
| 941 | Ga0495603_0043891 | 3300046455 | Bacteria | 2668 |
| 942 | Ga0495603_0046681 | 3300046455 | Bacteria | 2580 |
| 943 | Ga0495603_0055917 | 3300046455 | Bacteria | 2338 |
| 944 | Ga0495603_0062597 | 3300046455 | Bacteria | 2196 |
| 945 | Ga0495603_0066075 | 3300046455 | Bacteria | 2130 |
| 946 | Ga0495629_0007553 | 3300046459 | Bacteria | 8011 |
| 947 | Ga0495629_0010908 | 3300046459 | Bacteria | 6611 |
| 948 | Ga0495629_0022040 | 3300046459 | Bacteria | 4542 |
| 949 | Ga0495629_0036411 | 3300046459 | Bacteria | 3473 |
| 950 | Ga0495629_0043733 | 3300046459 | Bacteria | 3144 |
| 951 | Ga0495629_0106228 | 3300046459 | Bacteria | 1958 |
| 952 | Ga0495641_0001496 | 3300046461 | Bacteria | 19912 |
| 953 | Ga0495651_0000031 | 3300046462 | Bacteria | 103122 |
| 954 | Ga0495651_0000760 | 3300046462 | Bacteria | 24943 |
| 955 | Ga0495651_0001189 | 3300046462 | Bacteria | 20109 |
| 956 | Ga0495651_0012598 | 3300046462 | Bacteria | 6525 |
| 957 | Ga0495651_0039002 | 3300046462 | Bacteria | 3698 |
| 958 | Ga0495651_0074795 | 3300046462 | Bacteria | 2569 |
| 959 | Ga0495653_0000906 | 3300046463 | Bacteria | 22944 |
| 960 | Ga0495653_0035517 | 3300046463 | Bacteria | 3932 |
| 961 | Ga0495580_0013508 | 3300046472 | Bacteria | 6226 |
| 962 | Ga0495580_0015227 | 3300046472 | Bacteria | 5810 |
| 963 | Ga0495582_0000196 | 3300046473 | Bacteria | 33588 |
| 964 | Ga0495582_0000400 | 3300046473 | Bacteria | 23636 |
| 965 | Ga0495605_0001970 | 3300046474 | Bacteria | 13015 |
| 966 | Ga0495639_0000497 | 3300046475 | Bacteria | 18571 |
| 967 | Ga0495639_0003060 | 3300046475 | Bacteria | 7279 |
| 968 | Ga0495639_0008853 | 3300046475 | Bacteria | 4313 |
| 969 | Ga0495662_0000427 | 3300046476 | Bacteria | 18850 |
| 970 | Ga0495662_0002136 | 3300046476 | Bacteria | 9916 |
| 971 | Ga0495662_0030356 | 3300046476 | Bacteria | 2609 |
| 972 | Ga0495664_0002595 | 3300046477 | Bacteria | 9716 |
| 973 | Ga0495664_0026825 | 3300046477 | Bacteria | 3356 |
| 974 | Ga0495664_0046621 | 3300046477 | Bacteria | 2572 |
| 975 | Ga0495585_0055572 | 3300046492 | Bacteria | 2187 |
| 976 | Ga0495594_0000230 | 3300046499 | Bacteria | 27077 |
| 977 | Ga0495594_0049423 | 3300046499 | Bacteria | 2311 |
| 978 | Ga0495594_0054321 | 3300046499 | Bacteria | 2207 |
| 979 | Ga0495607_0023399 | 3300046501 | Bacteria | 3868 |
| 980 | Ga0495583_0007209 | 3300046506 | Bacteria | 7051 |
| 981 | Ga0495606_0039733 | 3300046507 | Bacteria | 3167 |
| 982 | Ga0495608_0000018 | 3300046511 | Bacteria | 192512 |
| 983 | Ga0495608_0072806 | 3300046511 | Bacteria | 2241 |
| 984 | Ga0495610_0007745 | 3300046512 | Bacteria | 7089 |
| 985 | Ga0495616_0003636 | 3300046513 | Bacteria | 9849 |
| 986 | Ga0495618_0005624 | 3300046514 | Bacteria | 7619 |
| 987 | Ga0495628_0000020 | 3300046516 | Bacteria | 148606 |
| 988 | Ga0495628_0003309 | 3300046516 | Bacteria | 14411 |
| 989 | Ga0495628_0004113 | 3300046516 | Bacteria | 12945 |
| 990 | Ga0495628_0006282 | 3300046516 | Bacteria | 10374 |
| 991 | Ga0495630_0010924 | 3300046517 | Bacteria | 6560 |
| 992 | Ga0495630_0015558 | 3300046517 | Bacteria | 5556 |
| 993 | Ga0495630_0032538 | 3300046517 | Bacteria | 3886 |
| 994 | Ga0495630_0043531 | 3300046517 | Bacteria | 3354 |
| 995 | Ga0495637_0027517 | 3300046520 | Bacteria | 2542 |
| 996 | Ga0495643_0001354 | 3300046522 | Bacteria | 22981 |
| 997 | Ga0495644_0019174 | 3300046523 | Bacteria | 2611 |
| 998 | Ga0495644_0045775 | 3300046523 | Bacteria | 1645 |
| 999 | Ga0495648_0043149 | 3300046524 | Bacteria | 2830 |
| 1000 | Ga0495663_0003164 | 3300046525 | Bacteria | 4799 |
| 1001 | Ga0495666_0000236 | 3300046526 | Bacteria | 23671 |
| 1002 | Ga0495666_0008597 | 3300046526 | Bacteria | 5116 |
| 1003 | Ga0495666_0019217 | 3300046526 | Bacteria | 3393 |
| 1004 | Ga0495652_0000013 | 3300046529 | Bacteria | 238164 |
| 1005 | Ga0495652_0008621 | 3300046529 | Bacteria | 9291 |
| 1006 | Ga0495652_0019520 | 3300046529 | Bacteria | 6033 |
| 1007 | Ga0495652_0024673 | 3300046529 | Bacteria | 5320 |
| 1008 | Ga0495654_0024623 | 3300046530 | Bacteria | 3108 |
| 1009 | Ga0495665_0000161 | 3300046531 | Bacteria | 33493 |
| 1010 | Ga0495665_0001397 | 3300046531 | Bacteria | 12918 |
| 1011 | Ga0495665_0006330 | 3300046531 | Bacteria | 6387 |
| 1012 | Ga0495665_0006931 | 3300046531 | Bacteria | 6115 |
| 1013 | Ga0495665_0015108 | 3300046531 | Bacteria | 4162 |
| 1014 | Ga0495665_0019098 | 3300046531 | Bacteria | 3683 |
| 1015 | Ga0495640_0009109 | 3300046533 | Bacteria | 7748 |
| 1016 | Ga0495640_0025790 | 3300046533 | Bacteria | 4257 |
| 1017 | Ga0495640_0026924 | 3300046533 | Bacteria | 4149 |
| 1018 | Ga0495640_0084660 | 3300046533 | Bacteria | 2102 |
| 1019 | Ga0495587_0000014 | 3300046536 | Bacteria | 192100 |
| 1020 | Ga0495587_0001459 | 3300046536 | Bacteria | 15756 |
| 1021 | Ga0495587_0003571 | 3300046536 | Bacteria | 10363 |
| 1022 | Ga0495587_0030406 | 3300046536 | Bacteria | 3275 |
| 1023 | Ga0495598_0001568 | 3300046537 | Bacteria | 4583 |
| 1024 | Ga0495598_0009711 | 3300046537 | Bacteria | 2284 |
| 1025 | Ga0495609_0009249 | 3300046538 | Bacteria | 4774 |
| 1026 | Ga0495645_0031676 | 3300046543 | Bacteria | 3853 |
| 1027 | Ga0495645_0038272 | 3300046543 | Bacteria | 3498 |
| 1028 | Ga0495645_0046701 | 3300046543 | Bacteria | 3156 |
| 1029 | Ga0495645_0057476 | 3300046543 | Bacteria | 2823 |
| 1030 | Ga0495622_0062894 | 3300046557 | Bacteria | 1717 |
| 1031 | Ga0495633_0004238 | 3300046558 | Bacteria | 9180 |
| 1032 | Ga0495633_0026689 | 3300046558 | Bacteria | 2831 |
| 1033 | Ga0495667_0000014 | 3300046559 | Bacteria | 200767 |
| 1034 | Ga0495667_0005338 | 3300046559 | Bacteria | 8685 |
| 1035 | Ga0495667_0009690 | 3300046559 | Bacteria | 6525 |
| 1036 | Ga0495667_0026764 | 3300046559 | Bacteria | 3885 |
| 1037 | Ga0495656_0001451 | 3300046615 | Bacteria | 7753 |
| 1038 | Ga0495668_0007084 | 3300046616 | Bacteria | 7217 |
| 1039 | Ga0495668_0054633 | 3300046616 | Bacteria | 2207 |
| 1040 | Ga0495634_0001788 | 3300046642 | Bacteria | 18569 |
| 1041 | Ga0495634_0003800 | 3300046642 | Bacteria | 11996 |
| 1042 | Ga0495634_0007234 | 3300046642 | Bacteria | 8369 |
| 1043 | Ga0495634_0016773 | 3300046642 | Bacteria | 5232 |
| 1044 | Ga0495634_0033627 | 3300046642 | Bacteria | 3522 |
| 1045 | Ga0495611_0014929 | 3300046648 | Bacteria | 3318 |
| 1046 | Ga0495625_0008814 | 3300046660 | Bacteria | 8538 |
| 1047 | Ga0495635_0000747 | 3300046663 | Bacteria | 21036 |
| 1048 | Ga0495635_0004116 | 3300046663 | Bacteria | 10081 |
| 1049 | Ga0495635_0014661 | 3300046663 | Bacteria | 5483 |
| 1050 | Ga0495635_0014977 | 3300046663 | Bacteria | 5424 |
| 1051 | Ga0495635_0016360 | 3300046663 | Bacteria | 5178 |
| 1052 | Ga0495659_0009071 | 3300046664 | Bacteria | 3171 |
| 1053 | Ga0495659_0027791 | 3300046664 | Bacteria | 1954 |
| 1054 | Ga0495661_0015672 | 3300046665 | Bacteria | 5052 |
| 1055 | Ga0495588_0000691 | 3300046674 | Bacteria | 15544 |
| 1056 | Ga0495588_0007271 | 3300046674 | Bacteria | 5030 |
| 1057 | Ga0495588_0019232 | 3300046674 | Bacteria | 3344 |
| 1058 | Ga0495657_0000012 | 3300046675 | Bacteria | 197154 |
| 1059 | Ga0495657_0004444 | 3300046675 | Bacteria | 11201 |
| 1060 | Ga0495657_0008640 | 3300046675 | Bacteria | 7772 |
| 1061 | Ga0495657_0016167 | 3300046675 | Bacteria | 5441 |
| 1062 | Ga0495657_0031774 | 3300046675 | Bacteria | 3687 |
| 1063 | Ga0495599_0000071 | 3300046678 | Bacteria | 70833 |
| 1064 | Ga0495599_0007355 | 3300046678 | Bacteria | 6675 |
| 1065 | Ga0495599_0027668 | 3300046678 | Bacteria | 3552 |
| 1066 | Ga0495599_0078861 | 3300046678 | Bacteria | 2056 |
| 1067 | Ga0495623_0000066 | 3300046679 | Bacteria | 64935 |
| 1068 | Ga0495623_0006079 | 3300046679 | Bacteria | 7850 |
| 1069 | Ga0495623_0010547 | 3300046679 | Bacteria | 5978 |
| 1070 | Ga0495646_0008273 | 3300046680 | Bacteria | 6613 |
| 1071 | Ga0495646_0025526 | 3300046680 | Bacteria | 3716 |
| 1072 | Ga0495647_0001010 | 3300046681 | Bacteria | 8564 |
| 1073 | Ga0495647_0026356 | 3300046681 | Bacteria | 2129 |
| 1074 | Ga0495658_0000958 | 3300046683 | Bacteria | 15355 |
| 1075 | Ga0495658_0004221 | 3300046683 | Bacteria | 7071 |
| 1076 | Ga0495658_0016490 | 3300046683 | Bacteria | 3802 |
| 1077 | Ga0495658_0017175 | 3300046683 | Bacteria | 3735 |
| 1078 | Ga0495658_0060303 | 3300046683 | Bacteria | 2175 |
| 1079 | Ga0495669_0015550 | 3300046684 | Bacteria | 3259 |
| 1080 | Ga0495613_0001355 | 3300046689 | Bacteria | 18673 |
| 1081 | Ga0495613_0001873 | 3300046689 | Bacteria | 15975 |
| 1082 | Ga0495613_0073577 | 3300046689 | Bacteria | 2489 |
| 1083 | Ga0495613_0083708 | 3300046689 | Bacteria | 2316 |
| 1084 | Ga0495624_0001856 | 3300046690 | Bacteria | 16123 |
| 1085 | Ga0495624_0029032 | 3300046690 | Bacteria | 3611 |
| 1086 | Ga0495670_0017326 | 3300046691 | Bacteria | 3544 |
| 1087 | Ga0495670_0045453 | 3300046691 | Bacteria | 2192 |
| 1088 | Ga0495671_0015236 | 3300046692 | Bacteria | 4125 |
| 1089 | Ga0495589_0013451 | 3300046794 | Bacteria | 4221 |
| 1090 | Ga0495589_0052207 | 3300046794 | Bacteria | 2020 |
| 1091 | Ga0495600_0016669 | 3300046809 | Bacteria | 4668 |
| 1092 | Ga0495600_0044267 | 3300046809 | Bacteria | 2904 |
| 1093 | Ga0495600_0058016 | 3300046809 | Bacteria | 2528 |
| 1094 | Ga0495600_0075476 | 3300046809 | Bacteria | 2201 |
| 1095 | Ga0495600_0086567 | 3300046809 | Bacteria | 2044 |
| 1096 | Ga0495660_0027649 | 3300046810 | Bacteria | 3208 |
| 1097 | Ga0495581_0000415 | 3300047315 | Bacteria | 21545 |
| 1098 | Ga0495581_0003525 | 3300047315 | Bacteria | 8977 |
| 1099 | Ga0495581_0003576 | 3300047315 | Bacteria | 8930 |
| 1100 | Ga0495581_0016654 | 3300047315 | Bacteria | 4273 |
| 1101 | Ga0495581_0019055 | 3300047315 | Bacteria | 3982 |
| 1102 | Ga0495581_0028406 | 3300047315 | Bacteria | 3242 |
| 1103 | Ga0495581_0038302 | 3300047315 | Bacteria | 2774 |
| 1104 | Ga0495604_0000054 | 3300047317 | Bacteria | 101084 |
| 1105 | Ga0495604_0003123 | 3300047317 | Bacteria | 13240 |
| 1106 | Ga0495604_0005136 | 3300047317 | Bacteria | 10362 |
| 1107 | Ga0495604_0031714 | 3300047317 | Bacteria | 4191 |
| 1108 | Ga0495604_0072911 | 3300047317 | Bacteria | 2593 |
| 1109 | Ga0495636_0000786 | 3300047318 | Bacteria | 11685 |
| 1110 | Ga0495636_0014627 | 3300047318 | Bacteria | 3122 |
| 1111 | Ga0495674_0025277 | 3300047319 | Bacteria | 5447 |
| 1112 | Ga0495674_0049337 | 3300047319 | Bacteria | 3720 |
| 1113 | Ga0495674_0085720 | 3300047319 | Bacteria | 2698 |
| 1114 | Ga0495674_0139133 | 3300047319 | Bacteria | 2041 |
| 1115 | Ga0495676_0019222 | 3300047321 | Bacteria | 6010 |
| 1116 | Ga0495676_0043922 | 3300047321 | Bacteria | 3653 |
| 1117 | Ga0495676_0101095 | 3300047321 | Bacteria | 2134 |
| 1118 | Ga0495680_0000003 | 3300047322 | Bacteria | 172246 |
| 1119 | Ga0495680_0005012 | 3300047322 | Bacteria | 12530 |
| 1120 | Ga0495680_0057193 | 3300047322 | Bacteria | 3017 |
| 1121 | Ga0495687_002577 | 3300047443 | Bacteria | 14293 |
| 1122 | Ga0495687_004667 | 3300047443 | Bacteria | 9140 |
| 1123 | Ga0495687_015685 | 3300047443 | Bacteria | 3842 |
| 1124 | Ga0495675_0000220 | 3300047444 | Bacteria | 41470 |
| 1125 | Ga0495675_0009187 | 3300047444 | Bacteria | 6147 |
| 1126 | Ga0495675_0010833 | 3300047444 | Bacteria | 5714 |
| 1127 | Ga0495675_0021176 | 3300047444 | Bacteria | 4139 |
| 1128 | Ga0495675_0028220 | 3300047444 | Bacteria | 3578 |
| 1129 | Ga0495685_002361 | 3300047447 | Bacteria | 5903 |
| 1130 | Ga0495685_002450 | 3300047447 | Bacteria | 5815 |
| 1131 | Ga0495685_006206 | 3300047447 | Bacteria | 3908 |
| 1132 | Ga0495685_031524 | 3300047447 | Bacteria | 1821 |
| 1133 | Ga0495673_0000524 | 3300047469 | Bacteria | 40257 |
| 1134 | Ga0495681_0000554 | 3300047470 | Bacteria | 28651 |
| 1135 | Ga0495681_0012672 | 3300047470 | Bacteria | 4941 |
| 1136 | Ga0495681_0015522 | 3300047470 | Bacteria | 4304 |
| 1137 | Ga0495684_0021859 | 3300047471 | Bacteria | 4924 |
| 1138 | Ga0495684_0028076 | 3300047471 | Bacteria | 4322 |
| 1139 | Ga0495684_0041286 | 3300047471 | Bacteria | 3535 |
| 1140 | Ga0495686_0001901 | 3300047472 | Bacteria | 20865 |
| 1141 | Ga0495686_0037599 | 3300047472 | Bacteria | 3100 |
| 1142 | Ga0495686_0073202 | 3300047472 | Bacteria | 2105 |
| 1143 | Ga0495593_0001467 | 3300047673 | Bacteria | 13850 |
| 1144 | Ga0495593_0007108 | 3300047673 | Bacteria | 6563 |
| 1145 | Ga0495593_0019642 | 3300047673 | Bacteria | 3787 |
| 1146 | Ga0495593_0023010 | 3300047673 | Bacteria | 3467 |
| 1147 | Ga0495602_0000014 | 3300048088 | Bacteria | 193335 |
| 1148 | Ga0495602_0069059 | 3300048088 | Bacteria | 3031 |
| 1149 | Ga0495614_0001950 | 3300048089 | Bacteria | 9063 |
| 1150 | Ga0495614_0015275 | 3300048089 | Bacteria | 3347 |
| 1151 | Ga0495626_0006153 | 3300048091 | Bacteria | 6873 |
| 1152 | Ga0496100_0000090 | 3300048903 | Bacteria | 51781 |
| 1153 | Ga0496100_0001709 | 3300048903 | Bacteria | 10923 |
| 1154 | Ga0496100_0004442 | 3300048903 | Bacteria | 7436 |
| 1155 | Ga0496100_0004552 | 3300048903 | Bacteria | 7367 |
| 1156 | Ga0496100_0006094 | 3300048903 | Bacteria | 6554 |
| 1157 | Ga0496100_0006163 | 3300048903 | Bacteria | 6521 |
| 1158 | Ga0496100_0042606 | 3300048903 | Bacteria | 2899 |
| 1159 | Ga0496100_0046280 | 3300048903 | Bacteria | 2796 |
| 1160 | Ga0496100_0053592 | 3300048903 | Bacteria | 2627 |
| 1161 | Ga0496100_0076656 | 3300048903 | Bacteria | 2245 |
| 1162 | Ga0496100_0091651 | 3300048903 | Bacteria | 2075 |
| 1163 | Ga0496101_0000015 | 3300048904 | Bacteria | 252368 |
| 1164 | Ga0496101_0000031 | 3300048904 | Bacteria | 195195 |
| 1165 | Ga0496101_0000462 | 3300048904 | Bacteria | 25778 |
| 1166 | Ga0496101_0004267 | 3300048904 | Bacteria | 8963 |
| 1167 | Ga0496101_0007031 | 3300048904 | Bacteria | 7273 |
| 1168 | Ga0496101_0018263 | 3300048904 | Bacteria | 4767 |
| 1169 | Ga0496101_0022473 | 3300048904 | Bacteria | 4342 |
| 1170 | Ga0496101_0022875 | 3300048904 | Bacteria | 4309 |
| 1171 | Ga0496101_0030349 | 3300048904 | Bacteria | 3789 |
| 1172 | Ga0496101_0032927 | 3300048904 | Bacteria | 3652 |
| 1173 | Ga0496101_0038726 | 3300048904 | Bacteria | 3387 |
| 1174 | Ga0496101_0049579 | 3300048904 | Bacteria | 3021 |
| 1175 | Ga0496101_0067728 | 3300048904 | Bacteria | 2608 |
| 1176 | Ga0496101_0101765 | 3300048904 | Bacteria | 2151 |
| 1177 | Ga0496101_0111108 | 3300048904 | Bacteria | 2063 |
| 1178 | Ga0496102_0000065 | 3300048905 | Bacteria | 161370 |
| 1179 | Ga0496102_0000187 | 3300048905 | Bacteria | 84207 |
| 1180 | Ga0496102_0000387 | 3300048905 | Bacteria | 51915 |
| 1181 | Ga0496102_0000813 | 3300048905 | Bacteria | 30380 |
| 1182 | Ga0496102_0004258 | 3300048905 | Bacteria | 12095 |
| 1183 | Ga0496102_0012669 | 3300048905 | Bacteria | 7304 |
| 1184 | Ga0496102_0023596 | 3300048905 | Bacteria | 5465 |
| 1185 | Ga0496102_0024323 | 3300048905 | Bacteria | 5384 |
| 1186 | Ga0496102_0026240 | 3300048905 | Bacteria | 5194 |
| 1187 | Ga0496102_0036116 | 3300048905 | Bacteria | 4451 |
| 1188 | Ga0496102_0060254 | 3300048905 | Bacteria | 3472 |
| 1189 | Ga0496102_0082166 | 3300048905 | Bacteria | 2971 |
| 1190 | Ga0496102_0082354 | 3300048905 | Bacteria | 2967 |
| 1191 | Ga0496102_0083000 | 3300048905 | Bacteria | 2956 |
| 1192 | Ga0496102_0144725 | 3300048905 | Bacteria | 2230 |
| 1193 | Ga0496103_0000048 | 3300048906 | Bacteria | 160911 |
| 1194 | Ga0496103_0000126 | 3300048906 | Bacteria | 82291 |
| 1195 | Ga0496103_0000292 | 3300048906 | Bacteria | 46843 |
| 1196 | Ga0496103_0000886 | 3300048906 | Bacteria | 21631 |
| 1197 | Ga0496103_0011144 | 3300048906 | Bacteria | 5325 |
| 1198 | Ga0496103_0033374 | 3300048906 | Bacteria | 3144 |
| 1199 | Ga0496103_0058621 | 3300048906 | Bacteria | 2392 |
| 1200 | Ga0496103_0087885 | 3300048906 | Bacteria | 1960 |
| 1201 | Ga0496103_0108781 | 3300048906 | Bacteria | 1759 |
| 1202 | Ga0496104_0005891 | 3300048907 | Bacteria | 10734 |
| 1203 | Ga0496104_0011217 | 3300048907 | Bacteria | 8019 |
| 1204 | Ga0496104_0012856 | 3300048907 | Bacteria | 7539 |
| 1205 | Ga0496104_0013277 | 3300048907 | Bacteria | 7425 |
| 1206 | Ga0496104_0015265 | 3300048907 | Bacteria | 6955 |
| 1207 | Ga0496104_0069683 | 3300048907 | Bacteria | 3342 |
| 1208 | Ga0496104_0077221 | 3300048907 | Bacteria | 3173 |
| 1209 | Ga0496104_0189851 | 3300048907 | Bacteria | 1966 |
| 1210 | Ga0496105_0003893 | 3300048908 | Bacteria | 11157 |
| 1211 | Ga0496105_0004783 | 3300048908 | Bacteria | 10224 |
| 1212 | Ga0496105_0004853 | 3300048908 | Bacteria | 10155 |
| 1213 | Ga0496105_0007560 | 3300048908 | Bacteria | 8419 |
| 1214 | Ga0496105_0036304 | 3300048908 | Bacteria | 4060 |
| 1215 | Ga0496105_0049849 | 3300048908 | Bacteria | 3458 |
| 1216 | Ga0496105_0055343 | 3300048908 | Bacteria | 3276 |
| 1217 | Ga0496105_0073288 | 3300048908 | Bacteria | 2829 |
| 1218 | Ga0496105_0073860 | 3300048908 | Bacteria | 2817 |
| 1219 | Ga0496105_0122837 | 3300048908 | Bacteria | 2141 |
| 1220 | Ga0496105_0127550 | 3300048908 | Bacteria | 2097 |
| 1221 | Ga0496105_0130414 | 3300048908 | Bacteria | 2073 |
| 1222 | Ga0496106_0000390 | 3300048909 | Bacteria | 31290 |
| 1223 | Ga0496106_0004705 | 3300048909 | Bacteria | 10110 |
| 1224 | Ga0496106_0010190 | 3300048909 | Bacteria | 6944 |
| 1225 | Ga0496106_0011482 | 3300048909 | Bacteria | 6551 |
| 1226 | Ga0496106_0052286 | 3300048909 | Bacteria | 3081 |
| 1227 | Ga0496106_0052570 | 3300048909 | Bacteria | 3074 |
| 1228 | Ga0496106_0096005 | 3300048909 | Bacteria | 2293 |
| 1229 | Ga0496107_0000438 | 3300048910 | Bacteria | 22612 |
| 1230 | Ga0496107_0000521 | 3300048910 | Bacteria | 21374 |
| 1231 | Ga0496107_0005833 | 3300048910 | Bacteria | 8432 |
| 1232 | Ga0496107_0009225 | 3300048910 | Bacteria | 6836 |
| 1233 | Ga0496107_0017536 | 3300048910 | Bacteria | 5034 |
| 1234 | Ga0496107_0020054 | 3300048910 | Bacteria | 4721 |
| 1235 | Ga0496107_0030844 | 3300048910 | Bacteria | 3823 |
| 1236 | Ga0496107_0108634 | 3300048910 | Bacteria | 2037 |
| 1237 | Ga0496108_0000812 | 3300048911 | Bacteria | 24256 |
| 1238 | Ga0496108_0001313 | 3300048911 | Bacteria | 19543 |
| 1239 | Ga0496108_0018250 | 3300048911 | Bacteria | 5745 |
| 1240 | Ga0496108_0038094 | 3300048911 | Bacteria | 4005 |
| 1241 | Ga0496108_0075375 | 3300048911 | Bacteria | 2850 |
| 1242 | Ga0496108_0090404 | 3300048911 | Bacteria | 2603 |
| 1243 | Ga0496108_0103119 | 3300048911 | Bacteria | 2434 |
| 1244 | Ga0496108_0108561 | 3300048911 | Bacteria | 2371 |
| 1245 | Ga0496108_0176195 | 3300048911 | Bacteria | 1851 |
| 1246 | Ga0496109_0000134 | 3300048912 | Bacteria | 75662 |
| 1247 | Ga0496109_0003973 | 3300048912 | Bacteria | 12346 |
| 1248 | Ga0496109_0004707 | 3300048912 | Bacteria | 11391 |
| 1249 | Ga0496109_0005225 | 3300048912 | Bacteria | 10841 |
| 1250 | Ga0496109_0006669 | 3300048912 | Bacteria | 9720 |
| 1251 | Ga0496109_0023364 | 3300048912 | Bacteria | 5488 |
| 1252 | Ga0496109_0028903 | 3300048912 | Bacteria | 4963 |
| 1253 | Ga0496109_0045044 | 3300048912 | Bacteria | 4003 |
| 1254 | Ga0496109_0146857 | 3300048912 | Bacteria | 2207 |
| 1255 | Ga0496109_0182559 | 3300048912 | Bacteria | 1971 |
| 1256 | Ga0496110_0005768 | 3300048913 | Bacteria | 9728 |
| 1257 | Ga0496110_0012823 | 3300048913 | Bacteria | 6905 |
| 1258 | Ga0496110_0046606 | 3300048913 | Bacteria | 3793 |
| 1259 | Ga0496110_0048014 | 3300048913 | Bacteria | 3740 |
| 1260 | Ga0496110_0075463 | 3300048913 | Bacteria | 2995 |
| 1261 | Ga0496110_0107403 | 3300048913 | Bacteria | 2505 |
| 1262 | Ga0496110_0182982 | 3300048913 | Bacteria | 1903 |
| 1263 | Ga0496111_0000028 | 3300048914 | Bacteria | 58695 |
| 1264 | Ga0496111_0003079 | 3300048914 | Bacteria | 10246 |
| 1265 | Ga0496111_0046359 | 3300048914 | Bacteria | 3130 |
| 1266 | Ga0496111_0053846 | 3300048914 | Bacteria | 2907 |
| 1267 | Ga0496112_0006907 | 3300048915 | Bacteria | 10015 |
| 1268 | Ga0496112_0080300 | 3300048915 | Bacteria | 3225 |
| 1269 | Ga0496112_0105933 | 3300048915 | Bacteria | 2781 |
| 1270 | Ga0496113_0008778 | 3300048916 | Bacteria | 6602 |
| 1271 | Ga0496113_0021468 | 3300048916 | Bacteria | 4555 |
| 1272 | Ga0496113_0031697 | 3300048916 | Bacteria | 3838 |
| 1273 | Ga0496113_0100381 | 3300048916 | Bacteria | 2242 |
| 1274 | Ga0496114_0001198 | 3300048917 | Bacteria | 19604 |
| 1275 | Ga0496114_0002043 | 3300048917 | Bacteria | 15364 |
| 1276 | Ga0496114_0003634 | 3300048917 | Bacteria | 11866 |
| 1277 | Ga0496114_0004306 | 3300048917 | Bacteria | 11016 |
| 1278 | Ga0496114_0007157 | 3300048917 | Bacteria | 8801 |
| 1279 | Ga0496114_0008776 | 3300048917 | Bacteria | 8009 |
| 1280 | Ga0496114_0039075 | 3300048917 | Bacteria | 3927 |
| 1281 | Ga0496114_0040624 | 3300048917 | Bacteria | 3851 |
| 1282 | Ga0496114_0049896 | 3300048917 | Bacteria | 3482 |
| 1283 | Ga0496114_0074553 | 3300048917 | Bacteria | 2856 |
| 1284 | Ga0496114_0085423 | 3300048917 | Bacteria | 2673 |
| 1285 | Ga0496114_0091760 | 3300048917 | Bacteria | 2580 |
| 1286 | Ga0496115_0001385 | 3300048918 | Bacteria | 17323 |
| 1287 | Ga0496115_0003083 | 3300048918 | Bacteria | 11968 |
| 1288 | Ga0496115_0006246 | 3300048918 | Bacteria | 8716 |
| 1289 | Ga0496115_0024870 | 3300048918 | Bacteria | 4657 |
| 1290 | Ga0496115_0033275 | 3300048918 | Bacteria | 4069 |
| 1291 | Ga0496115_0033898 | 3300048918 | Bacteria | 4034 |
| 1292 | Ga0496116_0000125 | 3300048919 | Bacteria | 160885 |
| 1293 | Ga0496116_0000306 | 3300048919 | Bacteria | 82349 |
| 1294 | Ga0496116_0013915 | 3300048919 | Bacteria | 6448 |
| 1295 | Ga0496116_0036927 | 3300048919 | Bacteria | 3413 |
| 1296 | Ga0496117_0000111 | 3300048920 | Bacteria | 184570 |
| 1297 | Ga0496117_0000343 | 3300048920 | Bacteria | 82294 |
| 1298 | Ga0496117_0001572 | 3300048920 | Bacteria | 32413 |
| 1299 | Ga0496117_0040254 | 3300048920 | Bacteria | 3439 |
| 1300 | Ga0496117_0044935 | 3300048920 | Bacteria | 3195 |
| 1301 | Ga0496118_0000083 | 3300048921 | Bacteria | 184570 |
| 1302 | Ga0496118_0000192 | 3300048921 | Bacteria | 107736 |
| 1303 | Ga0496118_0000272 | 3300048921 | Bacteria | 91016 |
| 1304 | Ga0496118_0001353 | 3300048921 | Bacteria | 36982 |
| 1305 | Ga0496118_0005574 | 3300048921 | Bacteria | 14252 |
| 1306 | Ga0496118_0043314 | 3300048921 | Bacteria | 3540 |
| 1307 | Ga0496118_0057862 | 3300048921 | Bacteria | 2902 |
| 1308 | Ga0496119_0000764 | 3300048922 | Bacteria | 43175 |
| 1309 | Ga0496119_0002640 | 3300048922 | Bacteria | 19420 |
| 1310 | Ga0496119_0005422 | 3300048922 | Bacteria | 12237 |
| 1311 | Ga0496119_0046259 | 3300048922 | Bacteria | 2719 |
| 1312 | Ga0496119_0050948 | 3300048922 | Bacteria | 2548 |
| 1313 | Ga0496119_0076208 | 3300048922 | Bacteria | 1946 |
| 1314 | Ga0496120_0003415 | 3300048923 | Bacteria | 14522 |
| 1315 | Ga0496120_0013212 | 3300048923 | Bacteria | 5572 |
| 1316 | Ga0496121_0000004 | 3300048924 | Bacteria | 1139011 |
| 1317 | Ga0496121_0000728 | 3300048924 | Bacteria | 60874 |
| 1318 | Ga0496121_0002290 | 3300048924 | Bacteria | 29745 |
| 1319 | Ga0496121_0019873 | 3300048924 | Bacteria | 6687 |
| 1320 | Ga0496121_0028149 | 3300048924 | Bacteria | 5238 |
| 1321 | Ga0496121_0146522 | 3300048924 | Bacteria | 1744 |
| 1322 | Ga0496122_0000138 | 3300048925 | Bacteria | 169434 |
| 1323 | Ga0496122_0001030 | 3300048925 | Bacteria | 49002 |
| 1324 | Ga0496123_0007586 | 3300048926 | Bacteria | 10166 |
| 1325 | Ga0496123_0026721 | 3300048926 | Bacteria | 4316 |
| 1326 | Ga0496124_0000012 | 3300048927 | Bacteria | 512581 |
| 1327 | Ga0496124_0010783 | 3300048927 | Bacteria | 9211 |
| 1328 | Ga0496124_0029865 | 3300048927 | Bacteria | 4848 |
| 1329 | Ga0496125_0000003 | 3300048928 | Bacteria | 1189767 |
| 1330 | Ga0496125_0000066 | 3300048928 | Bacteria | 249043 |
| 1331 | Ga0496126_0000001 | 3300048929 | Bacteria | 1139011 |
| 1332 | Ga0496126_0000220 | 3300048929 | Bacteria | 124547 |
| 1333 | Ga0496126_0000433 | 3300048929 | Bacteria | 84020 |
| 1334 | Ga0496126_0001476 | 3300048929 | Bacteria | 36542 |
| 1335 | Ga0496126_0010644 | 3300048929 | Bacteria | 9618 |
| 1336 | Ga0496126_0016431 | 3300048929 | Bacteria | 7400 |
| 1337 | Ga0496126_0043333 | 3300048929 | Bacteria | 4152 |
| 1338 | Ga0495678_008909 | 3300049459 | Bacteria | 5017 |
| 1339 | Ga0501031_0001225 | 3300049568 | Bacteria | 15710 |
| 1340 | Ga0501031_0001837 | 3300049568 | Bacteria | 13351 |
| 1341 | Ga0501031_0027192 | 3300049568 | Bacteria | 3730 |
| 1342 | Ga0501031_0043372 | 3300049568 | Bacteria | 2935 |
| 1343 | Ga0501031_0046276 | 3300049568 | Bacteria | 2837 |
| 1344 | Ga0501031_0106572 | 3300049568 | Bacteria | 1829 |
| 1345 | Ga0501031_0157247 | 3300049568 | Bacteria | 1486 |
| 1346 | Ga0501032_0001562 | 3300049569 | Bacteria | 18274 |
| 1347 | Ga0501032_0004751 | 3300049569 | Bacteria | 10189 |
| 1348 | Ga0501032_0007217 | 3300049569 | Bacteria | 8129 |
| 1349 | Ga0501032_0010112 | 3300049569 | Bacteria | 6809 |
| 1350 | Ga0501032_0029189 | 3300049569 | Bacteria | 3787 |
| 1351 | Ga0501032_0035227 | 3300049569 | Bacteria | 3423 |
| 1352 | Ga0501032_0036228 | 3300049569 | Bacteria | 3369 |
| 1353 | Ga0501032_0048647 | 3300049569 | Bacteria | 2862 |
| 1354 | Ga0501032_0066955 | 3300049569 | Bacteria | 2400 |
| 1355 | Ga0501032_0095270 | 3300049569 | Bacteria | 1973 |
| 1356 | Ga0501033_0000572 | 3300049570 | Bacteria | 34349 |
| 1357 | Ga0501033_0006275 | 3300049570 | Bacteria | 9320 |
| 1358 | Ga0501033_0006403 | 3300049570 | Bacteria | 9222 |
| 1359 | Ga0501033_0010271 | 3300049570 | Bacteria | 7186 |
| 1360 | Ga0501033_0010969 | 3300049570 | Bacteria | 6943 |
| 1361 | Ga0501033_0022188 | 3300049570 | Bacteria | 4790 |
| 1362 | Ga0501033_0132077 | 3300049570 | Bacteria | 1808 |
| 1363 | Ga0501033_0140292 | 3300049570 | Bacteria | 1747 |
| 1364 | Ga0501034_0003044 | 3300049571 | Bacteria | 19383 |
| 1365 | Ga0501034_0004377 | 3300049571 | Bacteria | 15734 |
| 1366 | Ga0501034_0006026 | 3300049571 | Bacteria | 13104 |
| 1367 | Ga0501034_0016112 | 3300049571 | Bacteria | 7668 |
| 1368 | Ga0501034_0019446 | 3300049571 | Bacteria | 6947 |
| 1369 | Ga0501034_0023061 | 3300049571 | Bacteria | 6342 |
| 1370 | Ga0501034_0023927 | 3300049571 | Bacteria | 6216 |
| 1371 | Ga0501034_0032114 | 3300049571 | Bacteria | 5334 |
| 1372 | Ga0501034_0078537 | 3300049571 | Bacteria | 3304 |
| 1373 | Ga0501034_0079746 | 3300049571 | Bacteria | 3277 |
| 1374 | Ga0501034_0083609 | 3300049571 | Bacteria | 3194 |
| 1375 | Ga0501034_0226215 | 3300049571 | Bacteria | 1821 |
| 1376 | Ga0501036_0003307 | 3300049572 | Bacteria | 12869 |
| 1377 | Ga0501036_0003546 | 3300049572 | Bacteria | 12481 |
| 1378 | Ga0501036_0003794 | 3300049572 | Bacteria | 12120 |
| 1379 | Ga0501036_0004601 | 3300049572 | Bacteria | 11146 |
| 1380 | Ga0501036_0092187 | 3300049572 | Bacteria | 2559 |
| 1381 | Ga0501036_0099953 | 3300049572 | Bacteria | 2453 |
| 1382 | Ga0501036_0123903 | 3300049572 | Bacteria | 2183 |
| 1383 | Ga0501037_0000294 | 3300049573 | Bacteria | 42178 |
| 1384 | Ga0501037_0000401 | 3300049573 | Bacteria | 36095 |
| 1385 | Ga0501037_0009368 | 3300049573 | Bacteria | 7187 |
| 1386 | Ga0501037_0012379 | 3300049573 | Bacteria | 6281 |
| 1387 | Ga0501037_0035942 | 3300049573 | Bacteria | 3651 |
| 1388 | Ga0501038_0000303 | 3300049574 | Bacteria | 41854 |
| 1389 | Ga0501038_0003608 | 3300049574 | Bacteria | 14413 |
| 1390 | Ga0501038_0003845 | 3300049574 | Bacteria | 13961 |
| 1391 | Ga0501038_0004045 | 3300049574 | Bacteria | 13628 |
| 1392 | Ga0501038_0005757 | 3300049574 | Bacteria | 11484 |
| 1393 | Ga0501038_0010214 | 3300049574 | Bacteria | 8592 |
| 1394 | Ga0501038_0012474 | 3300049574 | Bacteria | 7765 |
| 1395 | Ga0501038_0016250 | 3300049574 | Bacteria | 6749 |
| 1396 | Ga0501038_0023327 | 3300049574 | Bacteria | 5533 |
| 1397 | Ga0501038_0029580 | 3300049574 | Bacteria | 4852 |
| 1398 | Ga0501039_0001815 | 3300049575 | Bacteria | 15779 |
| 1399 | Ga0501039_0004950 | 3300049575 | Bacteria | 10103 |
| 1400 | Ga0501039_0011640 | 3300049575 | Bacteria | 6699 |
| 1401 | Ga0501039_0011715 | 3300049575 | Bacteria | 6680 |
| 1402 | Ga0501039_0012192 | 3300049575 | Bacteria | 6553 |
| 1403 | Ga0501039_0021966 | 3300049575 | Bacteria | 4896 |
| 1404 | Ga0501039_0023772 | 3300049575 | Bacteria | 4703 |
| 1405 | Ga0501039_0046336 | 3300049575 | Bacteria | 3359 |
| 1406 | Ga0501040_0002552 | 3300049576 | Bacteria | 11746 |
| 1407 | Ga0501040_0020460 | 3300049576 | Bacteria | 4409 |
| 1408 | Ga0501040_0053493 | 3300049576 | Bacteria | 2765 |
| 1409 | Ga0501040_0096384 | 3300049576 | Bacteria | 2060 |
| 1410 | Ga0501040_0104452 | 3300049576 | Bacteria | 1978 |
| 1411 | Ga0501040_0148082 | 3300049576 | Bacteria | 1655 |
| 1412 | Ga0501041_0003443 | 3300049577 | Bacteria | 9107 |
| 1413 | Ga0501041_0166846 | 3300049577 | Bacteria | 1377 |
| 1414 | Ga0501042_0003823 | 3300049578 | Bacteria | 9519 |
| 1415 | Ga0501042_0011058 | 3300049578 | Bacteria | 6077 |
| 1416 | Ga0501042_0019805 | 3300049578 | Bacteria | 4677 |
| 1417 | Ga0501042_0033874 | 3300049578 | Bacteria | 3621 |
| 1418 | Ga0501042_0034233 | 3300049578 | Bacteria | 3603 |
| 1419 | Ga0501042_0069688 | 3300049578 | Bacteria | 2515 |
| 1420 | Ga0501042_0095302 | 3300049578 | Bacteria | 2138 |
| 1421 | Ga0501042_0098897 | 3300049578 | Bacteria | 2098 |
| 1422 | Ga0501043_0001613 | 3300049579 | Bacteria | 19644 |
| 1423 | Ga0501043_0001877 | 3300049579 | Bacteria | 18019 |
| 1424 | Ga0501043_0003544 | 3300049579 | Bacteria | 12825 |
| 1425 | Ga0501043_0004157 | 3300049579 | Bacteria | 11830 |
| 1426 | Ga0501043_0007764 | 3300049579 | Bacteria | 8487 |
| 1427 | Ga0501043_0008555 | 3300049579 | Bacteria | 8066 |
| 1428 | Ga0501043_0015165 | 3300049579 | Bacteria | 6033 |
| 1429 | Ga0501043_0037155 | 3300049579 | Bacteria | 3831 |
| 1430 | Ga0501046_0000236 | 3300049580 | Bacteria | 56950 |
| 1431 | Ga0501046_0000769 | 3300049580 | Bacteria | 31025 |
| 1432 | Ga0501046_0001725 | 3300049580 | Bacteria | 20856 |
| 1433 | Ga0501046_0003797 | 3300049580 | Bacteria | 13826 |
| 1434 | Ga0501046_0005803 | 3300049580 | Bacteria | 11015 |
| 1435 | Ga0501046_0054527 | 3300049580 | Bacteria | 3144 |
| 1436 | Ga0501047_0012990 | 3300049581 | Bacteria | 7885 |
| 1437 | Ga0501047_0014794 | 3300049581 | Bacteria | 7427 |
| 1438 | Ga0501047_0017157 | 3300049581 | Bacteria | 6927 |
| 1439 | Ga0501047_0017158 | 3300049581 | Bacteria | 6927 |
| 1440 | Ga0501047_0021848 | 3300049581 | Bacteria | 6145 |
| 1441 | Ga0501047_0024666 | 3300049581 | Bacteria | 5773 |
| 1442 | Ga0501047_0029588 | 3300049581 | Bacteria | 5280 |
| 1443 | Ga0501047_0032593 | 3300049581 | Bacteria | 5030 |
| 1444 | Ga0501047_0080301 | 3300049581 | Bacteria | 3134 |
| 1445 | Ga0501047_0122576 | 3300049581 | Bacteria | 2480 |
| 1446 | Ga0501047_0160331 | 3300049581 | Bacteria | 2121 |
| 1447 | Ga0501047_0317416 | 3300049581 | Bacteria | 1398 |
| 1448 | Ga0501048_0000093 | 3300049582 | Bacteria | 48141 |
| 1449 | Ga0501048_0004212 | 3300049582 | Bacteria | 10963 |
| 1450 | Ga0501048_0005329 | 3300049582 | Bacteria | 9788 |
| 1451 | Ga0501048_0012861 | 3300049582 | Bacteria | 6217 |
| 1452 | Ga0501048_0023521 | 3300049582 | Bacteria | 4501 |
| 1453 | Ga0501048_0038612 | 3300049582 | Bacteria | 3426 |
| 1454 | Ga0501048_0049259 | 3300049582 | Bacteria | 3002 |
| 1455 | Ga0501048_0106070 | 3300049582 | Bacteria | 1983 |
| 1456 | Ga0501067_0000770 | 3300049583 | Bacteria | 17225 |
| 1457 | Ga0501067_0002255 | 3300049583 | Bacteria | 10635 |
| 1458 | Ga0501067_0002330 | 3300049583 | Bacteria | 10499 |
| 1459 | Ga0501067_0005717 | 3300049583 | Bacteria | 6902 |
| 1460 | Ga0501067_0007863 | 3300049583 | Bacteria | 5925 |
| 1461 | Ga0501067_0030306 | 3300049583 | Bacteria | 3000 |
| 1462 | Ga0501067_0073085 | 3300049583 | Bacteria | 1900 |
| 1463 | Ga0501068_0003180 | 3300049584 | Bacteria | 8791 |
| 1464 | Ga0501068_0018151 | 3300049584 | Bacteria | 4072 |
| 1465 | Ga0501068_0056289 | 3300049584 | Bacteria | 2384 |
| 1466 | Ga0501069_0000897 | 3300049585 | Bacteria | 14203 |
| 1467 | Ga0501069_0001749 | 3300049585 | Bacteria | 10831 |
| 1468 | Ga0501069_0010191 | 3300049585 | Bacteria | 4971 |
| 1469 | Ga0501069_0018837 | 3300049585 | Bacteria | 3726 |
| 1470 | Ga0501069_0073049 | 3300049585 | Bacteria | 1923 |
| 1471 | Ga0501070_0000304 | 3300049586 | Bacteria | 45492 |
| 1472 | Ga0501070_0000985 | 3300049586 | Bacteria | 25575 |
| 1473 | Ga0501070_0001111 | 3300049586 | Bacteria | 24148 |
| 1474 | Ga0501070_0001285 | 3300049586 | Bacteria | 22529 |
| 1475 | Ga0501070_0021783 | 3300049586 | Bacteria | 5370 |
| 1476 | Ga0501070_0025023 | 3300049586 | Bacteria | 5006 |
| 1477 | Ga0501070_0052937 | 3300049586 | Bacteria | 3368 |
| 1478 | Ga0501070_0063145 | 3300049586 | Bacteria | 3068 |
| 1479 | Ga0501070_0099343 | 3300049586 | Bacteria | 2408 |
| 1480 | Ga0501071_0000525 | 3300049587 | Bacteria | 19591 |
| 1481 | Ga0501071_0008335 | 3300049587 | Bacteria | 6846 |
| 1482 | Ga0501071_0019867 | 3300049587 | Bacteria | 4664 |
| 1483 | Ga0501071_0042839 | 3300049587 | Bacteria | 3244 |
| 1484 | Ga0501071_0111312 | 3300049587 | Bacteria | 2024 |
| 1485 | Ga0501072_0011058 | 3300049588 | Bacteria | 6887 |
| 1486 | Ga0501072_0015730 | 3300049588 | Bacteria | 5799 |
| 1487 | Ga0501072_0023669 | 3300049588 | Bacteria | 4771 |
| 1488 | Ga0501072_0070039 | 3300049588 | Bacteria | 2769 |
| 1489 | Ga0501073_0002339 | 3300049589 | Bacteria | 14184 |
| 1490 | Ga0501073_0010335 | 3300049589 | Bacteria | 6851 |
| 1491 | Ga0501073_0026557 | 3300049589 | Bacteria | 4146 |
| 1492 | Ga0501073_0040761 | 3300049589 | Bacteria | 3284 |
| 1493 | Ga0501073_0042885 | 3300049589 | Bacteria | 3192 |
| 1494 | Ga0501073_0084060 | 3300049589 | Bacteria | 2215 |
| 1495 | Ga0501074_0000476 | 3300049590 | Bacteria | 24308 |
| 1496 | Ga0501074_0001111 | 3300049590 | Bacteria | 17546 |
| 1497 | Ga0501074_0003908 | 3300049590 | Bacteria | 10613 |
| 1498 | Ga0501074_0027609 | 3300049590 | Bacteria | 4115 |
| 1499 | Ga0501075_0005120 | 3300049591 | Bacteria | 8961 |
| 1500 | Ga0501075_0005138 | 3300049591 | Bacteria | 8950 |
| 1501 | Ga0501075_0115037 | 3300049591 | Bacteria | 2045 |
| 1502 | Ga0501076_0001890 | 3300049592 | Bacteria | 14270 |
| 1503 | Ga0501076_0008545 | 3300049592 | Bacteria | 7508 |
| 1504 | Ga0501076_0014706 | 3300049592 | Bacteria | 5901 |
| 1505 | Ga0501076_0015983 | 3300049592 | Bacteria | 5681 |
| 1506 | Ga0501076_0079955 | 3300049592 | Bacteria | 2623 |
| 1507 | Ga0501077_0008288 | 3300049593 | Bacteria | 6426 |
| 1508 | Ga0501077_0008984 | 3300049593 | Bacteria | 6201 |
| 1509 | Ga0501077_0019701 | 3300049593 | Bacteria | 4268 |
| 1510 | Ga0501077_0029666 | 3300049593 | Bacteria | 3478 |
| 1511 | Ga0501077_0092327 | 3300049593 | Bacteria | 1918 |
| 1512 | Ga0501079_0014762 | 3300049741 | Bacteria | 5955 |
| 1513 | Ga0501079_0022458 | 3300049741 | Bacteria | 4838 |
| 1514 | Ga0501080_0001133 | 3300049742 | Bacteria | 21938 |
| 1515 | Ga0501080_0013264 | 3300049742 | Bacteria | 7571 |
| 1516 | Ga0501080_0034656 | 3300049742 | Bacteria | 4714 |
| 1517 | Ga0501080_0035065 | 3300049742 | Bacteria | 4684 |
| 1518 | Ga0501080_0044785 | 3300049742 | Bacteria | 4118 |
| 1519 | Ga0501080_0083782 | 3300049742 | Bacteria | 2962 |
| 1520 | Ga0501081_0002611 | 3300049743 | Bacteria | 11389 |
| 1521 | Ga0501081_0030717 | 3300049743 | Bacteria | 3638 |
| 1522 | Ga0501083_0000728 | 3300049744 | Bacteria | 21449 |
| 1523 | Ga0501083_0003749 | 3300049744 | Bacteria | 10671 |
| 1524 | Ga0501083_0005510 | 3300049744 | Bacteria | 8969 |
| 1525 | Ga0501083_0031100 | 3300049744 | Bacteria | 3663 |
| 1526 | Ga0501083_0053364 | 3300049744 | Bacteria | 2714 |
| 1527 | Ga0501083_0063353 | 3300049744 | Bacteria | 2466 |
| 1528 | Ga0501035_0000886 | 3300049822 | Bacteria | 31764 |
| 1529 | Ga0501035_0002028 | 3300049822 | Bacteria | 20185 |
| 1530 | Ga0501035_0005446 | 3300049822 | Bacteria | 12038 |
| 1531 | Ga0501035_0005582 | 3300049822 | Bacteria | 11886 |
| 1532 | Ga0501035_0005745 | 3300049822 | Bacteria | 11701 |
| 1533 | Ga0501035_0006819 | 3300049822 | Bacteria | 10671 |
| 1534 | Ga0501035_0009131 | 3300049822 | Bacteria | 9219 |
| 1535 | Ga0501035_0009171 | 3300049822 | Bacteria | 9200 |
| 1536 | Ga0501035_0011863 | 3300049822 | Bacteria | 8068 |
| 1537 | Ga0501035_0030207 | 3300049822 | Bacteria | 4940 |
| 1538 | Ga0501035_0037091 | 3300049822 | Bacteria | 4415 |
| 1539 | Ga0501035_0060662 | 3300049822 | Bacteria | 3367 |
| 1540 | Ga0501035_0067088 | 3300049822 | Bacteria | 3184 |
| 1541 | Ga0501035_0113287 | 3300049822 | Bacteria | 2376 |
| 1542 | Ga0501035_0138241 | 3300049822 | Bacteria | 2119 |
| 1543 | Ga0501044_0000313 | 3300049823 | Bacteria | 61310 |
| 1544 | Ga0501044_0001800 | 3300049823 | Bacteria | 25001 |
| 1545 | Ga0501044_0002740 | 3300049823 | Bacteria | 20041 |
| 1546 | Ga0501044_0003836 | 3300049823 | Bacteria | 16861 |
| 1547 | Ga0501044_0010059 | 3300049823 | Bacteria | 10279 |
| 1548 | Ga0501044_0010545 | 3300049823 | Bacteria | 10024 |
| 1549 | Ga0501044_0011879 | 3300049823 | Bacteria | 9436 |
| 1550 | Ga0501044_0015546 | 3300049823 | Bacteria | 8198 |
| 1551 | Ga0501044_0015683 | 3300049823 | Bacteria | 8159 |
| 1552 | Ga0501044_0021072 | 3300049823 | Bacteria | 6958 |
| 1553 | Ga0501044_0044148 | 3300049823 | Bacteria | 4628 |
| 1554 | Ga0501044_0073156 | 3300049823 | Bacteria | 3484 |
| 1555 | Ga0501045_0029159 | 3300049824 | Bacteria | 3986 |
| 1556 | Ga0501045_0039918 | 3300049824 | Bacteria | 3415 |
| 1557 | Ga0501045_0041394 | 3300049824 | Bacteria | 3352 |
| 1558 | Ga0501045_0070788 | 3300049824 | Bacteria | 2566 |
| 1559 | Ga0501045_0138280 | 3300049824 | Bacteria | 1811 |
| 1560 | nmdc:mga03n38_1489_c1 | 3300050490 | Bacteria | 6754 |
| 1561 | nmdc:mga03n38_16294_c1 | 3300050490 | Bacteria | 2889 |
| 1562 | nmdc:mga03n38_3379_c1 | 3300050490 | Bacteria | 5116 |
| 1563 | nmdc:mga03n38_4805_c2 | 3300050490 | Bacteria | 1960 |
| 1564 | nmdc:mga03n38_5023_c1 | 3300050490 | Bacteria | 4459 |
| 1565 | nmdc:mga00v17_10338_c1 | 3300050491 | Bacteria | 5090 |
| 1566 | nmdc:mga00v17_14591_c1 | 3300050491 | Bacteria | 4389 |
| 1567 | nmdc:mga00v17_15246_c1 | 3300050491 | Bacteria | 4310 |
| 1568 | nmdc:mga00v17_16663_c1 | 3300050491 | Bacteria | 4145 |
| 1569 | nmdc:mga00v17_18980_c1 | 3300050491 | Bacteria | 3916 |
| 1570 | nmdc:mga00v17_2758_c1 | 3300050491 | Bacteria | 9012 |
| 1571 | nmdc:mga00v17_34200_c1 | 3300050491 | Bacteria | 3017 |
| 1572 | nmdc:mga00v17_3705_c2 | 3300050491 | Bacteria | 3444 |
| 1573 | nmdc:mga00v17_4239_c1 | 3300050491 | Bacteria | 7443 |
| 1574 | nmdc:mga0yw44_1056_c1 | 3300050492 | Bacteria | 10593 |
| 1575 | nmdc:mga0yw44_47032_c1 | 3300050492 | Bacteria | 2595 |
| 1576 | nmdc:mga0yw44_6400_c1 | 3300050492 | Bacteria | 5687 |
| 1577 | nmdc:mga0yw44_88127_c1 | 3300050492 | Bacteria | 1957 |
| 1578 | nmdc:mga06z11_15009_c1 | 3300050494 | Bacteria | 3448 |
| 1579 | nmdc:mga04h51_3331_c1 | 3300050495 | Bacteria | 3467 |
| 1580 | nmdc:mga07m45_12427_c1 | 3300050496 | Bacteria | 4501 |
| 1581 | nmdc:mga07m45_13457_c1 | 3300050496 | Bacteria | 4343 |
| 1582 | nmdc:mga07m45_15847_c1 | 3300050496 | Bacteria | 4029 |
| 1583 | nmdc:mga07m45_21100_c1 | 3300050496 | Bacteria | 3543 |
| 1584 | nmdc:mga07m45_51136_c1 | 3300050496 | Bacteria | 2330 |
| 1585 | nmdc:mga05p37_1749_c1 | 3300050507 | Bacteria | 25357 |
| 1586 | nmdc:mga05p37_17911_c1 | 3300050507 | Bacteria | 8550 |
| 1587 | nmdc:mga05p37_358218_c1 | 3300050507 | Bacteria | 1716 |
| 1588 | nmdc:mga05p37_60787_c1 | 3300050507 | Bacteria | 4652 |
| 1589 | nmdc:mga05p37_67807_c1 | 3300050507 | Bacteria | 4389 |
| 1590 | nmdc:mga05p37_95379_c1 | 3300050507 | Bacteria | 3665 |
| 1591 | nmdc:mga09592_23705_c1 | 3300050508 | Bacteria | 5070 |
| 1592 | nmdc:mga09592_64236_c1 | 3300050508 | Bacteria | 3107 |
| 1593 | nmdc:mga09592_83537_c1 | 3300050508 | Bacteria | 2722 |
| 1594 | nmdc:mga0qj67_12587_c1 | 3300050509 | Bacteria | 6377 |
| 1595 | nmdc:mga0qj67_131927_c1 | 3300050509 | Bacteria | 2023 |
| 1596 | nmdc:mga0qj67_5924_c1 | 3300050509 | Bacteria | 8957 |
| 1597 | nmdc:mga06r32_1952_c2 | 3300050510 | Bacteria | 8936 |
| 1598 | nmdc:mga08y16_138593_c1 | 3300050511 | Bacteria | 2529 |
| 1599 | nmdc:mga08y16_139438_c1 | 3300050511 | Bacteria | 2521 |
| 1600 | nmdc:mga08y16_161465_c1 | 3300050511 | Bacteria | 2329 |
| 1601 | nmdc:mga08y16_82680_c1 | 3300050511 | Bacteria | 3347 |
| 1602 | nmdc:mga0n895_18283_c1 | 3300050512 | Bacteria | 6482 |
| 1603 | nmdc:mga0n895_1840_c1 | 3300050512 | Bacteria | 16182 |
| 1604 | nmdc:mga0n895_214400_c1 | 3300050512 | Bacteria | 1955 |
| 1605 | nmdc:mga0n895_228170_c1 | 3300050512 | Bacteria | 1890 |
| 1606 | nmdc:mga0rr50_129887_c1 | 3300050513 | Bacteria | 2016 |
| 1607 | nmdc:mga0rr50_208809_c1 | 3300050513 | Bacteria | 1608 |
| 1608 | nmdc:mga0rr50_29549_c1 | 3300050513 | Bacteria | 3868 |
| 1609 | nmdc:mga0a205_34549_c1 | 3300050515 | Bacteria | 4850 |
| 1610 | nmdc:mga0a205_41002_c1 | 3300050515 | Bacteria | 4458 |
| 1611 | nmdc:mga0a205_44535_c1 | 3300050515 | Bacteria | 4278 |
| 1612 | nmdc:mga0a205_6663_c1 | 3300050515 | Bacteria | 10451 |
| 1613 | nmdc:mga0sz30_1079_c1 | 3300050516 | Bacteria | 9816 |
| 1614 | nmdc:mga0sz30_4196_c1 | 3300050516 | Bacteria | 5190 |
| 1615 | nmdc:mga0sz30_5141_c1 | 3300050516 | Bacteria | 4787 |
| 1616 | Ga0495601_0009156 | 3300053077 | Bacteria | 5848 |
| 1617 | Ga0495601_0019856 | 3300053077 | Bacteria | 4101 |
| 1618 | Ga0495612_0001552 | 3300053078 | Bacteria | 9469 |
| 1619 | Ga0495612_0051640 | 3300053078 | Bacteria | 1690 |
| 1620 | Ga0500610_0011170 | 3300053079 | Bacteria | 4079 |
| 1621 | Ga0500610_0025768 | 3300053079 | Bacteria | 2937 |
| 1622 | Ga0500635_0000075 | 3300053080 | Bacteria | 64005 |
| 1623 | Ga0495655_0003171 | 3300053083 | Bacteria | 2687 |
| 1624 | Ga0495619_0000287 | 3300053085 | Bacteria | 35945 |
| 1625 | Ga0495619_0005700 | 3300053085 | Bacteria | 7897 |
| 1626 | Ga0495619_0006349 | 3300053085 | Bacteria | 7494 |
| 1627 | Ga0495619_0045475 | 3300053085 | Bacteria | 2884 |
| 1628 | Ga0495619_0047871 | 3300053085 | Bacteria | 2817 |
| 1629 | Ga0500643_003235 | 3300053087 | Bacteria | 7931 |
| 1630 | Ga0500644_0000203 | 3300053088 | Bacteria | 35985 |
| 1631 | Ga0500644_0005211 | 3300053088 | Bacteria | 3273 |
| 1632 | Ga0500654_017380 | 3300053099 | Bacteria | 4694 |
| 1633 | Ga0500660_019742 | 3300053100 | Bacteria | 3601 |
| 1634 | Ga0500556_0000883 | 3300053104 | Bacteria | 16859 |
| 1635 | Ga0500569_017708 | 3300053109 | Bacteria | 1826 |
| 1636 | Ga0500593_001072 | 3300053117 | Bacteria | 9891 |
| 1637 | Ga0500614_011358 | 3300053123 | Bacteria | 1926 |
| 1638 | Ga0500652_001141 | 3300053131 | Bacteria | 8524 |
| 1639 | Ga0500652_025994 | 3300053131 | Bacteria | 2249 |
| 1640 | Ga0500559_0002237 | 3300053136 | Bacteria | 10225 |
| 1641 | Ga0500573_0024525 | 3300053140 | Bacteria | 3467 |
| 1642 | Ga0500600_0008867 | 3300053149 | Bacteria | 6064 |
| 1643 | Ga0500616_0030958 | 3300053153 | Bacteria | 2935 |
| 1644 | Ga0500624_001618 | 3300053157 | Bacteria | 3414 |
| 1645 | Ga0500630_040150 | 3300053159 | Bacteria | 2285 |
| 1646 | Ga0500633_0006523 | 3300053160 | Bacteria | 2868 |
| 1647 | Ga0501084_0002183 | 3300054114 | Bacteria | 15695 |
| 1648 | Ga0501084_0007824 | 3300054114 | Bacteria | 8795 |
| 1649 | Ga0501084_0009070 | 3300054114 | Bacteria | 8229 |
| 1650 | Ga0501084_0027049 | 3300054114 | Bacteria | 4792 |
| 1651 | Ga0501084_0029803 | 3300054114 | Bacteria | 4564 |
| 1652 | Ga0501084_0036552 | 3300054114 | Bacteria | 4102 |
| 1653 | Ga0590074_004035 | 3300059423 | Bacteria | 2426 |
| 1654 | Ga0501082_0007309 | 3300060353 | Bacteria | 9530 |
| 1655 | Ga0501082_0032214 | 3300060353 | Bacteria | 4520 |
| 1656 | Ga0501082_0123092 | 3300060353 | Bacteria | 2249 |
| 1657 | Ga0501082_0197435 | 3300060353 | Bacteria | 1750 |
| 1658 | Ga0466962_0002734 | 3300061719 | Bacteria | 8378 |
| 1659 | Ga0466962_0004115 | 3300061719 | Bacteria | 6966 |
| 1660 | Ga0530510_0009221 | 3300061734 | Bacteria | 6917 |
| 1661 | Ga0530510_0015569 | 3300061734 | Bacteria | 5376 |
| 1662 | Ga0530510_0022754 | 3300061734 | Bacteria | 4465 |
| 1663 | Ga0530510_0105651 | 3300061734 | Bacteria | 2061 |
| 1664 | Ga0530510_0106557 | 3300061734 | Bacteria | 2051 |
| 1665 | Ga0530510_0119442 | 3300061734 | Bacteria | 1934 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013306 | Ga0163162_10392924 | Ga0163162_103929242 | 404 |
| 2 | 3300026023 | Ga0207677_10132116 | Ga0207677_101321162 | 404 |
| 3 | 3300025907 | Ga0207645_10027362 | Ga0207645_100273622 | 416 |
| 4 | 3300035121 | Ga0373960_0032669 | Ga0373960_0032669_176_1450 | 419 |
| 5 | 3300037418 | Ga0395900_0123683 | Ga0395900_0123683_1189_2463 | 419 |
| 6 | 3300038443 | Ga0395901_0150997 | Ga0395901_0150997_844_2118 | 419 |
| 7 | 3300049577 | Ga0501041_0166846 | Ga0501041_0166846_33_1307 | 419 |
| 8 | 3300050508 | nmdc:mga09592_83537_c1 | nmdc:mga09592_83537_c1_22_1437 | 424 |
| 9 | 3300003323 | rootH1_10007198 | rootH1_100071982 | 425 |
| 10 | 3300006175 | Ga0070712_100061058 | Ga0070712_1000610582 | 430 |
| 11 | iso_pu_bacteria | 2875391855 | 2875395402 | 432 |
| 12 | 3300046533 | Ga0495640_0026924 | Ga0495640_0026924_357_1703 | 433 |
| 13 | 3300049581 | Ga0501047_0317416 | Ga0501047_0317416_38_1384 | 433 |
| 14 | 3300053153 | Ga0500616_0030958 | Ga0500616_0030958_1550_2899 | 433 |
| 15 | 3300005543 | Ga0070672_100075639 | Ga0070672_1000756392 | 435 |
| 16 | 3300009177 | Ga0105248_10101734 | Ga0105248_101017342 | 435 |
| 17 | 3300011119 | Ga0105246_10055379 | Ga0105246_100553793 | 435 |
| 18 | 3300026121 | Ga0207683_10028085 | Ga0207683_100280854 | 435 |
| 19 | 3300049574 | Ga0501038_0029580 | Ga0501038_0029580_2234_3799 | 436 |
| 20 | 3300049576 | Ga0501040_0020460 | Ga0501040_0020460_2237_3802 | 436 |
| 21 | 3300049578 | Ga0501042_0019805 | Ga0501042_0019805_581_2146 | 436 |
| 22 | 3300049744 | Ga0501083_0063353 | Ga0501083_0063353_393_1958 | 436 |
| 23 | 3300054114 | Ga0501084_0007824 | Ga0501084_0007824_4739_6304 | 436 |
| 24 | 3300046525 | Ga0495663_0003164 | Ga0495663_0003164_2809_4221 | 437 |
| 25 | 3300046537 | Ga0495598_0001568 | Ga0495598_0001568_1061_2473 | 437 |
| 26 | 3300046615 | Ga0495656_0001451 | Ga0495656_0001451_556_1968 | 437 |
| 27 | 3300046664 | Ga0495659_0009071 | Ga0495659_0009071_273_1685 | 437 |
| 28 | 3300046691 | Ga0495670_0017326 | Ga0495670_0017326_409_1821 | 437 |
| 29 | 3300046794 | Ga0495589_0013451 | Ga0495589_0013451_1759_3171 | 437 |
| 30 | 3300046809 | Ga0495600_0086567 | Ga0495600_0086567_77_1474 | 437 |
| 31 | 3300006237 | Ga0097621_100075892 | Ga0097621_1000758923 | 438 |
| 32 | 3300009177 | Ga0105248_10138281 | Ga0105248_101382812 | 438 |
| 33 | 3300026075 | Ga0207708_10058417 | Ga0207708_100584173 | 438 |
| 34 | 3300026088 | Ga0207641_10126229 | Ga0207641_101262292 | 438 |
| 35 | 3300026089 | Ga0207648_10044017 | Ga0207648_100440172 | 438 |
| 36 | 3300026118 | Ga0207675_100140274 | Ga0207675_1001402742 | 438 |
| 37 | 3300005328 | Ga0070676_10124627 | Ga0070676_101246272 | 440 |
| 38 | 3300005331 | Ga0070670_100068315 | Ga0070670_1000683153 | 440 |
| 39 | 3300005354 | Ga0070675_100042140 | Ga0070675_1000421402 | 440 |
| 40 | 3300005365 | Ga0070688_100104321 | Ga0070688_1001043212 | 440 |
| 41 | 3300005366 | Ga0070659_100208152 | Ga0070659_1002081521 | 440 |
| 42 | 3300005614 | Ga0068856_100114923 | Ga0068856_1001149232 | 440 |
| 43 | 3300005617 | Ga0068859_100194686 | Ga0068859_1001946862 | 440 |
| 44 | 3300005719 | Ga0068861_100094605 | Ga0068861_1000946052 | 440 |
| 45 | 3300005834 | Ga0068851_10029524 | Ga0068851_100295243 | 440 |
| 46 | 3300005842 | Ga0068858_100056289 | Ga0068858_1000562892 | 440 |
| 47 | 3300006931 | Ga0097620_100194683 | Ga0097620_1001946833 | 440 |
| 48 | 3300009094 | Ga0111539_10268440 | Ga0111539_102684401 | 440 |
| 49 | 3300009176 | Ga0105242_10168970 | Ga0105242_101689702 | 440 |
| 50 | 3300025901 | Ga0207688_10034165 | Ga0207688_100341652 | 440 |
| 51 | 3300025908 | Ga0207643_10032559 | Ga0207643_100325592 | 440 |
| 52 | 3300025935 | Ga0207709_10031082 | Ga0207709_100310822 | 440 |
| 53 | 3300025942 | Ga0207689_10117628 | Ga0207689_101176281 | 440 |
| 54 | 3300026067 | Ga0207678_10042275 | Ga0207678_100422752 | 440 |
| 55 | 3300026121 | Ga0207683_10133096 | Ga0207683_101330962 | 440 |
| 56 | 3300026142 | Ga0207698_10095781 | Ga0207698_100957813 | 440 |
| 57 | 3300028379 | Ga0268266_10265384 | Ga0268266_102653842 | 440 |
| 58 | 3300028381 | Ga0268264_10100118 | Ga0268264_101001182 | 440 |
| 59 | 3300035092 | Ga0373952_0007530 | Ga0373952_0007530_523_1914 | 440 |
| 60 | 3300035241 | Ga0373961_0007126 | Ga0373961_0007126_1157_2548 | 440 |
| 61 | 3300048908 | Ga0496105_0055343 | Ga0496105_0055343_1267_2658 | 440 |
| 62 | 3300050511 | nmdc:mga08y16_161465_c1 | nmdc:mga08y16_161465_c1_648_2039 | 440 |
| 63 | 3300031247 | Ga0265340_10001252 | Ga0265340_1000125213 | 441 |
| 64 | 3300050507 | nmdc:mga05p37_358218_c1 | nmdc:mga05p37_358218_c1_59_1408 | 442 |
| 65 | 3300050515 | nmdc:mga0a205_34549_c1 | nmdc:mga0a205_34549_c1_3475_4827 | 443 |
| 66 | 3300005471 | Ga0070698_100078423 | Ga0070698_1000784232 | 444 |
| 67 | 3300005440 | Ga0070705_100126453 | Ga0070705_1001264532 | 445 |
| 68 | 3300025927 | Ga0207687_10089023 | Ga0207687_100890232 | 445 |
| 69 | 3300047321 | Ga0495676_0043922 | Ga0495676_0043922_818_2167 | 445 |
| 70 | 3300037418 | Ga0395900_0137597 | Ga0395900_0137597_412_1770 | 447 |
| 71 | 3300049576 | Ga0501040_0053493 | Ga0501040_0053493_241_1611 | 449 |
| 72 | 3300009098 | Ga0105245_10094732 | Ga0105245_100947322 | 450 |
| 73 | 3300046455 | Ga0495603_0055917 | Ga0495603_0055917_240_1625 | 450 |
| 74 | 3300046516 | Ga0495628_0003309 | Ga0495628_0003309_2870_4375 | 450 |
| 75 | 3300046517 | Ga0495630_0015558 | Ga0495630_0015558_955_2460 | 450 |
| 76 | 3300046526 | Ga0495666_0008597 | Ga0495666_0008597_954_2459 | 450 |
| 77 | 3300046683 | Ga0495658_0004221 | Ga0495658_0004221_580_2085 | 450 |
| 78 | 3300047471 | Ga0495684_0028076 | Ga0495684_0028076_1489_2994 | 450 |
| 79 | 3300048904 | Ga0496101_0067728 | Ga0496101_0067728_444_1829 | 450 |
| 80 | 3300048907 | Ga0496104_0189851 | Ga0496104_0189851_29_1414 | 450 |
| 81 | 3300048908 | Ga0496105_0122837 | Ga0496105_0122837_631_2016 | 450 |
| 82 | 3300005544 | Ga0070686_100042248 | Ga0070686_1000422482 | 451 |
| 83 | 3300009553 | Ga0105249_10196957 | Ga0105249_101969572 | 451 |
| 84 | 3300013105 | Ga0157369_10011357 | Ga0157369_100113573 | 451 |
| 85 | 3300025936 | Ga0207670_10078538 | Ga0207670_100785382 | 451 |
| 86 | 3300025949 | Ga0207667_10104289 | Ga0207667_101042892 | 451 |
| 87 | 3300037068 | Ga0373925_0004553 | Ga0373925_0004553_3291_4679 | 451 |
| 88 | 3300044658 | Ga0466972_0004237 | Ga0466972_0004237_3708_5105 | 451 |
| 89 | 3300044683 | Ga0466965_0002597 | Ga0466965_0002597_4597_5994 | 451 |
| 90 | 3300044694 | Ga0466963_0005946 | Ga0466963_0005946_4567_5967 | 451 |
| 91 | 3300044735 | Ga0466968_0005739 | Ga0466968_0005739_1526_2923 | 451 |
| 92 | 3300044901 | Ga0466960_0004914 | Ga0466960_0004914_331_1728 | 451 |
| 93 | 3300046462 | Ga0495651_0000760 | Ga0495651_0000760_6363_7769 | 451 |
| 94 | 3300046511 | Ga0495608_0072806 | Ga0495608_0072806_167_1573 | 451 |
| 95 | 3300046517 | Ga0495630_0043531 | Ga0495630_0043531_1886_3292 | 451 |
| 96 | 3300046533 | Ga0495640_0025790 | Ga0495640_0025790_374_1762 | 451 |
| 97 | 3300046536 | Ga0495587_0003571 | Ga0495587_0003571_2052_3458 | 451 |
| 98 | 3300046543 | Ga0495645_0057476 | Ga0495645_0057476_269_1657 | 451 |
| 99 | 3300046559 | Ga0495667_0026764 | Ga0495667_0026764_2256_3662 | 451 |
| 100 | 3300046642 | Ga0495634_0016773 | Ga0495634_0016773_1729_3135 | 451 |
| 101 | 3300046663 | Ga0495635_0014661 | Ga0495635_0014661_4057_5445 | 451 |
| 102 | 3300046678 | Ga0495599_0007355 | Ga0495599_0007355_4471_5877 | 451 |
| 103 | 3300047319 | Ga0495674_0139133 | Ga0495674_0139133_161_1567 | 451 |
| 104 | 3300047471 | Ga0495684_0041286 | Ga0495684_0041286_1879_3285 | 451 |
| 105 | 3300048088 | Ga0495602_0069059 | Ga0495602_0069059_1567_2955 | 451 |
| 106 | 3300053077 | Ga0495601_0009156 | Ga0495601_0009156_4132_5538 | 451 |
| 107 | 3300005536 | Ga0070697_100137220 | Ga0070697_1001372201 | 452 |
| 108 | 3300035692 | Ga0373935_0178000 | Ga0373935_0178000_14_1372 | 452 |
| 109 | 3300053083 | Ga0495655_0003171 | Ga0495655_0003171_1290_2654 | 452 |
| 110 | 3300005338 | Ga0068868_100046911 | Ga0068868_1000469112 | 453 |
| 111 | 3300005367 | Ga0070667_100006339 | Ga0070667_10000633910 | 453 |
| 112 | 3300005467 | Ga0070706_100001603 | Ga0070706_10000160315 | 453 |
| 113 | 3300005471 | Ga0070698_100032044 | Ga0070698_1000320444 | 453 |
| 114 | 3300006028 | Ga0070717_10009137 | Ga0070717_100091374 | 453 |
| 115 | 3300013105 | Ga0157369_10315700 | Ga0157369_103157002 | 453 |
| 116 | 3300013307 | Ga0157372_10365711 | Ga0157372_103657112 | 453 |
| 117 | 3300025910 | Ga0207684_10001691 | Ga0207684_1000169110 | 453 |
| 118 | 3300025986 | Ga0207658_10004057 | Ga0207658_100040579 | 453 |
| 119 | 3300035725 | Ga0373947_0060929 | Ga0373947_0060929_41_1462 | 453 |
| 120 | 3300037466 | Ga0395898_0032692 | Ga0395898_0032692_30_1397 | 453 |
| 121 | 3300038443 | Ga0395901_0040004 | Ga0395901_0040004_30_1397 | 453 |
| 122 | 3300046459 | Ga0495629_0007553 | Ga0495629_0007553_6097_7518 | 453 |
| 123 | 3300046473 | Ga0495582_0000196 | Ga0495582_0000196_18861_20282 | 453 |
| 124 | 3300046475 | Ga0495639_0003060 | Ga0495639_0003060_1556_2977 | 453 |
| 125 | 3300046681 | Ga0495647_0026356 | Ga0495647_0026356_255_1676 | 453 |
| 126 | 3300046683 | Ga0495658_0000958 | Ga0495658_0000958_12952_14373 | 453 |
| 127 | 3300046689 | Ga0495613_0001873 | Ga0495613_0001873_9864_11285 | 453 |
| 128 | 3300047315 | Ga0495581_0016654 | Ga0495581_0016654_269_1690 | 453 |
| 129 | 3300049583 | Ga0501067_0000770 | Ga0501067_0000770_6505_7881 | 453 |
| 130 | 3300049585 | Ga0501069_0010191 | Ga0501069_0010191_1799_3175 | 453 |
| 131 | 3300049586 | Ga0501070_0099343 | Ga0501070_0099343_221_1597 | 453 |
| 132 | 3300061734 | Ga0530510_0009221 | Ga0530510_0009221_1803_3179 | 453 |
| 133 | 3300005445 | Ga0070708_100209049 | Ga0070708_1002090493 | 454 |
| 134 | 3300005467 | Ga0070706_100090432 | Ga0070706_1000904322 | 454 |
| 135 | 3300005471 | Ga0070698_100086268 | Ga0070698_1000862682 | 454 |
| 136 | 3300009098 | Ga0105245_10122666 | Ga0105245_101226662 | 454 |
| 137 | 3300025910 | Ga0207684_10048508 | Ga0207684_100485084 | 454 |
| 138 | 3300025915 | Ga0207693_10131086 | Ga0207693_101310862 | 454 |
| 139 | 3300025928 | Ga0207700_10005737 | Ga0207700_100057373 | 454 |
| 140 | 3300037418 | Ga0395900_0019737 | Ga0395900_0019737_3203_4645 | 454 |
| 141 | 3300046678 | Ga0495599_0078861 | Ga0495599_0078861_633_2030 | 454 |
| 142 | 3300047317 | Ga0495604_0072911 | Ga0495604_0072911_1170_2567 | 454 |
| 143 | 3300005440 | Ga0070705_100165590 | Ga0070705_1001655901 | 455 |
| 144 | 3300005549 | Ga0070704_100010596 | Ga0070704_1000105965 | 455 |
| 145 | 3300005985 | Ga0081539_10002475 | Ga0081539_1000247524 | 455 |
| 146 | 3300009147 | Ga0114129_10093729 | Ga0114129_100937295 | 455 |
| 147 | 3300037418 | Ga0395900_0026863 | Ga0395900_0026863_4460_5839 | 455 |
| 148 | 3300038443 | Ga0395901_0008790 | Ga0395901_0008790_159_1538 | 455 |
| 149 | 3300038443 | Ga0395901_0294517 | Ga0395901_0294517_160_1539 | 455 |
| 150 | 3300050507 | nmdc:mga05p37_95379_c1 | nmdc:mga05p37_95379_c1_833_2212 | 455 |
| 151 | 3300050512 | nmdc:mga0n895_228170_c1 | nmdc:mga0n895_228170_c1_394_1773 | 455 |
| 152 | 3300005440 | Ga0070705_100109810 | Ga0070705_1001098102 | 456 |
| 153 | 3300005471 | Ga0070698_100129954 | Ga0070698_1001299542 | 456 |
| 154 | 3300005518 | Ga0070699_100006304 | Ga0070699_1000063042 | 456 |
| 155 | 3300005719 | Ga0068861_100048451 | Ga0068861_1000484513 | 456 |
| 156 | 3300005937 | Ga0081455_10020571 | Ga0081455_100205712 | 456 |
| 157 | 3300005937 | Ga0081455_10043329 | Ga0081455_100433292 | 456 |
| 158 | 3300005937 | Ga0081455_10070877 | Ga0081455_100708773 | 456 |
| 159 | 3300006038 | Ga0075365_10062129 | Ga0075365_100621292 | 456 |
| 160 | 3300006844 | Ga0075428_100142137 | Ga0075428_1001421372 | 456 |
| 161 | 3300006846 | Ga0075430_100069161 | Ga0075430_1000691612 | 456 |
| 162 | 3300006852 | Ga0075433_10149382 | Ga0075433_101493822 | 456 |
| 163 | 3300006871 | Ga0075434_100033684 | Ga0075434_1000336844 | 456 |
| 164 | 3300006880 | Ga0075429_100070269 | Ga0075429_1000702692 | 456 |
| 165 | 3300007076 | Ga0075435_100188495 | Ga0075435_1001884951 | 456 |
| 166 | 3300009011 | Ga0105251_10014758 | Ga0105251_100147581 | 456 |
| 167 | 3300009094 | Ga0111539_10109140 | Ga0111539_101091402 | 456 |
| 168 | 3300009148 | Ga0105243_10005454 | Ga0105243_100054544 | 456 |
| 169 | 3300011119 | Ga0105246_10019564 | Ga0105246_100195642 | 456 |
| 170 | 3300014326 | Ga0157380_10111892 | Ga0157380_101118922 | 456 |
| 171 | 3300026118 | Ga0207675_100015055 | Ga0207675_1000150554 | 456 |
| 172 | 3300026121 | Ga0207683_10003687 | Ga0207683_100036873 | 456 |
| 173 | 3300027907 | Ga0207428_10015628 | Ga0207428_100156283 | 456 |
| 174 | 3300032002 | Ga0307416_100291362 | Ga0307416_1002913621 | 456 |
| 175 | 3300035113 | Ga0373936_0053612 | Ga0373936_0053612_62_1537 | 456 |
| 176 | 3300035691 | Ga0373931_0081546 | Ga0373931_0081546_325_1725 | 456 |
| 177 | 3300037312 | Ga0395899_0048862 | Ga0395899_0048862_1393_2775 | 456 |
| 178 | 3300037418 | Ga0395900_0031138 | Ga0395900_0031138_3143_4525 | 456 |
| 179 | 3300037466 | Ga0395898_0025730 | Ga0395898_0025730_3817_5199 | 456 |
| 180 | 3300037471 | Ga0395905_0008024 | Ga0395905_0008024_7541_8941 | 456 |
| 181 | 3300037471 | Ga0395905_0039722 | Ga0395905_0039722_1052_2434 | 456 |
| 182 | 3300038443 | Ga0395901_0014492 | Ga0395901_0014492_88_1488 | 456 |
| 183 | 3300038443 | Ga0395901_0018796 | Ga0395901_0018796_2045_3427 | 456 |
| 184 | 3300046523 | Ga0495644_0019174 | Ga0495644_0019174_318_1718 | 456 |
| 185 | 3300046664 | Ga0495659_0027791 | Ga0495659_0027791_39_1439 | 456 |
| 186 | 3300047318 | Ga0495636_0014627 | Ga0495636_0014627_254_1654 | 456 |
| 187 | 3300048903 | Ga0496100_0042606 | Ga0496100_0042606_960_2345 | 456 |
| 188 | 3300048909 | Ga0496106_0052286 | Ga0496106_0052286_117_1502 | 456 |
| 189 | 3300048912 | Ga0496109_0023364 | Ga0496109_0023364_1427_2827 | 456 |
| 190 | 3300048912 | Ga0496109_0146857 | Ga0496109_0146857_643_2025 | 456 |
| 191 | 3300048918 | Ga0496115_0024870 | Ga0496115_0024870_1693_3078 | 456 |
| 192 | 3300049576 | Ga0501040_0148082 | Ga0501040_0148082_211_1611 | 456 |
| 193 | 3300049578 | Ga0501042_0003823 | Ga0501042_0003823_6353_7753 | 456 |
| 194 | 3300049582 | Ga0501048_0038612 | Ga0501048_0038612_67_1467 | 456 |
| 195 | 3300049587 | Ga0501071_0111312 | Ga0501071_0111312_430_1830 | 456 |
| 196 | 3300049588 | Ga0501072_0015730 | Ga0501072_0015730_3905_5305 | 456 |
| 197 | 3300049592 | Ga0501076_0014706 | Ga0501076_0014706_4418_5818 | 456 |
| 198 | 3300049824 | Ga0501045_0029159 | Ga0501045_0029159_2542_3942 | 456 |
| 199 | 3300050492 | nmdc:mga0yw44_6400_c1 | nmdc:mga0yw44_6400_c1_610_1992 | 456 |
| 200 | 3300050508 | nmdc:mga09592_23705_c1 | nmdc:mga09592_23705_c1_1130_2530 | 456 |
| 201 | 3300050509 | nmdc:mga0qj67_12587_c1 | nmdc:mga0qj67_12587_c1_997_2397 | 456 |
| 202 | 3300050509 | nmdc:mga0qj67_131927_c1 | nmdc:mga0qj67_131927_c1_581_1981 | 456 |
| 203 | 3300050511 | nmdc:mga08y16_139438_c1 | nmdc:mga08y16_139438_c1_701_2101 | 456 |
| 204 | 3300050512 | nmdc:mga0n895_18283_c1 | nmdc:mga0n895_18283_c1_4086_5486 | 456 |
| 205 | 3300050513 | nmdc:mga0rr50_208809_c1 | nmdc:mga0rr50_208809_c1_180_1565 | 456 |
| 206 | 3300050515 | nmdc:mga0a205_41002_c1 | nmdc:mga0a205_41002_c1_225_1625 | 456 |
| 207 | 3300053077 | Ga0495601_0019856 | Ga0495601_0019856_2375_3781 | 456 |
| 208 | 3300061734 | Ga0530510_0015569 | Ga0530510_0015569_111_1511 | 456 |
| 209 | 3300002459 | JGI24751J29686_10000209 | JGI24751J29686_1000020919 | 457 |
| 210 | 3300005331 | Ga0070670_100033934 | Ga0070670_1000339342 | 457 |
| 211 | 3300005331 | Ga0070670_100038607 | Ga0070670_1000386075 | 457 |
| 212 | 3300005441 | Ga0070700_100033994 | Ga0070700_1000339941 | 457 |
| 213 | 3300005471 | Ga0070698_100180339 | Ga0070698_1001803391 | 457 |
| 214 | 3300005549 | Ga0070704_100079868 | Ga0070704_1000798681 | 457 |
| 215 | 3300005564 | Ga0070664_100006163 | Ga0070664_1000061636 | 457 |
| 216 | 3300005618 | Ga0068864_100067923 | Ga0068864_1000679233 | 457 |
| 217 | 3300005840 | Ga0068870_10006734 | Ga0068870_100067346 | 457 |
| 218 | 3300005841 | Ga0068863_100004403 | Ga0068863_1000044034 | 457 |
| 219 | 3300005844 | Ga0068862_100008410 | Ga0068862_1000084109 | 457 |
| 220 | 3300005937 | Ga0081455_10090545 | Ga0081455_100905452 | 457 |
| 221 | 3300005985 | Ga0081539_10032775 | Ga0081539_100327752 | 457 |
| 222 | 3300006844 | Ga0075428_100165929 | Ga0075428_1001659292 | 457 |
| 223 | 3300025885 | Ga0207653_10010318 | Ga0207653_100103182 | 457 |
| 224 | 3300025908 | Ga0207643_10002462 | Ga0207643_100024622 | 457 |
| 225 | 3300025925 | Ga0207650_10005383 | Ga0207650_100053836 | 457 |
| 226 | 3300025925 | Ga0207650_10026865 | Ga0207650_100268655 | 457 |
| 227 | 3300025945 | Ga0207679_10134134 | Ga0207679_101341342 | 457 |
| 228 | 3300026075 | Ga0207708_10004753 | Ga0207708_100047534 | 457 |
| 229 | 3300026095 | Ga0207676_10016796 | Ga0207676_100167962 | 457 |
| 230 | 3300026116 | Ga0207674_10001198 | Ga0207674_1000119811 | 457 |
| 231 | 3300027907 | Ga0207428_10129333 | Ga0207428_101293332 | 457 |
| 232 | 3300028380 | Ga0268265_10020870 | Ga0268265_100208705 | 457 |
| 233 | 3300044712 | Ga0453684_0000719 | Ga0453684_0000719_47414_48850 | 457 |
| 234 | 3300005435 | Ga0070714_100302751 | Ga0070714_1003027511 | 458 |
| 235 | 3300005441 | Ga0070700_100009980 | Ga0070700_1000099804 | 458 |
| 236 | 3300005459 | Ga0068867_100035193 | Ga0068867_1000351932 | 458 |
| 237 | 3300005471 | Ga0070698_100010138 | Ga0070698_1000101383 | 458 |
| 238 | 3300005985 | Ga0081539_10006896 | Ga0081539_1000689611 | 458 |
| 239 | 3300005985 | Ga0081539_10035770 | Ga0081539_100357704 | 458 |
| 240 | 3300006871 | Ga0075434_100010168 | Ga0075434_1000101687 | 458 |
| 241 | 3300009094 | Ga0111539_10053720 | Ga0111539_100537204 | 458 |
| 242 | 3300009147 | Ga0114129_10010215 | Ga0114129_100102156 | 458 |
| 243 | 3300009147 | Ga0114129_10457563 | Ga0114129_104575632 | 458 |
| 244 | 3300014325 | Ga0163163_10357907 | Ga0163163_103579071 | 458 |
| 245 | 3300014326 | Ga0157380_10058555 | Ga0157380_100585552 | 458 |
| 246 | 3300026075 | Ga0207708_10018905 | Ga0207708_100189053 | 458 |
| 247 | 3300027907 | Ga0207428_10003736 | Ga0207428_100037362 | 458 |
| 248 | 3300032002 | Ga0307416_100246945 | Ga0307416_1002469451 | 458 |
| 249 | 3300046455 | Ga0495603_0015069 | Ga0495603_0015069_1816_3222 | 458 |
| 250 | 3300048907 | Ga0496104_0013277 | Ga0496104_0013277_4415_5890 | 458 |
| 251 | 3300050507 | nmdc:mga05p37_67807_c1 | nmdc:mga05p37_67807_c1_1825_3237 | 458 |
| 252 | 3300050508 | nmdc:mga09592_64236_c1 | nmdc:mga09592_64236_c1_725_2137 | 458 |
| 253 | 3300005328 | Ga0070676_10032460 | Ga0070676_100324602 | 459 |
| 254 | 3300005330 | Ga0070690_100023491 | Ga0070690_1000234912 | 459 |
| 255 | 3300005345 | Ga0070692_10044824 | Ga0070692_100448242 | 459 |
| 256 | 3300005406 | Ga0070703_10000050 | Ga0070703_1000005012 | 459 |
| 257 | 3300005438 | Ga0070701_10007222 | Ga0070701_100072222 | 459 |
| 258 | 3300005439 | Ga0070711_100016193 | Ga0070711_1000161932 | 459 |
| 259 | 3300005445 | Ga0070708_100001634 | Ga0070708_10000163411 | 459 |
| 260 | 3300005445 | Ga0070708_100081920 | Ga0070708_1000819204 | 459 |
| 261 | 3300005456 | Ga0070678_100000629 | Ga0070678_1000006293 | 459 |
| 262 | 3300005467 | Ga0070706_100002425 | Ga0070706_10000242520 | 459 |
| 263 | 3300005471 | Ga0070698_100016904 | Ga0070698_1000169041 | 459 |
| 264 | 3300005544 | Ga0070686_100006816 | Ga0070686_1000068162 | 459 |
| 265 | 3300005546 | Ga0070696_100008936 | Ga0070696_1000089365 | 459 |
| 266 | 3300005549 | Ga0070704_100002771 | Ga0070704_1000027719 | 459 |
| 267 | 3300005615 | Ga0070702_100001386 | Ga0070702_1000013862 | 459 |
| 268 | 3300005618 | Ga0068864_100038615 | Ga0068864_1000386154 | 459 |
| 269 | 3300005718 | Ga0068866_10023813 | Ga0068866_100238132 | 459 |
| 270 | 3300005842 | Ga0068858_100033716 | Ga0068858_1000337164 | 459 |
| 271 | 3300005937 | Ga0081455_10002415 | Ga0081455_1000241521 | 459 |
| 272 | 3300005937 | Ga0081455_10009174 | Ga0081455_1000917410 | 459 |
| 273 | 3300005937 | Ga0081455_10024363 | Ga0081455_100243634 | 459 |
| 274 | 3300006058 | Ga0075432_10006628 | Ga0075432_100066282 | 459 |
| 275 | 3300006175 | Ga0070712_100062868 | Ga0070712_1000628683 | 459 |
| 276 | 3300006237 | Ga0097621_100009223 | Ga0097621_1000092234 | 459 |
| 277 | 3300006852 | Ga0075433_10001584 | Ga0075433_1000158412 | 459 |
| 278 | 3300006852 | Ga0075433_10004531 | Ga0075433_100045317 | 459 |
| 279 | 3300006871 | Ga0075434_100001999 | Ga0075434_10000199917 | 459 |
| 280 | 3300007076 | Ga0075435_100004935 | Ga0075435_1000049358 | 459 |
| 281 | 3300009094 | Ga0111539_10022303 | Ga0111539_100223037 | 459 |
| 282 | 3300009098 | Ga0105245_10102396 | Ga0105245_101023962 | 459 |
| 283 | 3300009101 | Ga0105247_10044546 | Ga0105247_100445462 | 459 |
| 284 | 3300009147 | Ga0114129_10006795 | Ga0114129_1000679518 | 459 |
| 285 | 3300009148 | Ga0105243_10003636 | Ga0105243_100036367 | 459 |
| 286 | 3300009148 | Ga0105243_10004875 | Ga0105243_1000487512 | 459 |
| 287 | 3300009148 | Ga0105243_10027652 | Ga0105243_100276525 | 459 |
| 288 | 3300009176 | Ga0105242_10006982 | Ga0105242_100069822 | 459 |
| 289 | 3300009176 | Ga0105242_10019706 | Ga0105242_100197064 | 459 |
| 290 | 3300009176 | Ga0105242_10028160 | Ga0105242_100281606 | 459 |
| 291 | 3300009177 | Ga0105248_10013543 | Ga0105248_100135439 | 459 |
| 292 | 3300009177 | Ga0105248_10014779 | Ga0105248_100147797 | 459 |
| 293 | 3300013297 | Ga0157378_10006854 | Ga0157378_100068542 | 459 |
| 294 | 3300013297 | Ga0157378_10008086 | Ga0157378_1000808611 | 459 |
| 295 | 3300013297 | Ga0157378_10043288 | Ga0157378_100432883 | 459 |
| 296 | 3300013306 | Ga0163162_10111716 | Ga0163162_101117162 | 459 |
| 297 | 3300013308 | Ga0157375_10028262 | Ga0157375_100282626 | 459 |
| 298 | 3300014968 | Ga0157379_10006578 | Ga0157379_100065788 | 459 |
| 299 | 3300014968 | Ga0157379_10137423 | Ga0157379_101374232 | 459 |
| 300 | 3300014969 | Ga0157376_10014307 | Ga0157376_100143075 | 459 |
| 301 | 3300025885 | Ga0207653_10000062 | Ga0207653_1000006277 | 459 |
| 302 | 3300025899 | Ga0207642_10036319 | Ga0207642_100363192 | 459 |
| 303 | 3300025905 | Ga0207685_10001306 | Ga0207685_100013062 | 459 |
| 304 | 3300025910 | Ga0207684_10000325 | Ga0207684_1000032541 | 459 |
| 305 | 3300025915 | Ga0207693_10000726 | Ga0207693_1000072613 | 459 |
| 306 | 3300025916 | Ga0207663_10058299 | Ga0207663_100582992 | 459 |
| 307 | 3300025919 | Ga0207657_10120542 | Ga0207657_101205422 | 459 |
| 308 | 3300025922 | Ga0207646_10006936 | Ga0207646_1000693610 | 459 |
| 309 | 3300025927 | Ga0207687_10009711 | Ga0207687_100097115 | 459 |
| 310 | 3300025927 | Ga0207687_10028702 | Ga0207687_100287026 | 459 |
| 311 | 3300025931 | Ga0207644_10087035 | Ga0207644_100870352 | 459 |
| 312 | 3300025937 | Ga0207669_10085760 | Ga0207669_100857602 | 459 |
| 313 | 3300025938 | Ga0207704_10062815 | Ga0207704_100628152 | 459 |
| 314 | 3300025940 | Ga0207691_10047852 | Ga0207691_100478522 | 459 |
| 315 | 3300025941 | Ga0207711_10206317 | Ga0207711_102063172 | 459 |
| 316 | 3300026023 | Ga0207677_10009603 | Ga0207677_100096036 | 459 |
| 317 | 3300026067 | Ga0207678_10071753 | Ga0207678_100717532 | 459 |
| 318 | 3300026075 | Ga0207708_10019809 | Ga0207708_100198094 | 459 |
| 319 | 3300026089 | Ga0207648_10009508 | Ga0207648_100095089 | 459 |
| 320 | 3300026095 | Ga0207676_10065671 | Ga0207676_100656712 | 459 |
| 321 | 3300026118 | Ga0207675_100048519 | Ga0207675_1000485193 | 459 |
| 322 | 3300026121 | Ga0207683_10000327 | Ga0207683_100003273 | 459 |
| 323 | 3300026121 | Ga0207683_10021432 | Ga0207683_100214322 | 459 |
| 324 | 3300027907 | Ga0207428_10011116 | Ga0207428_100111166 | 459 |
| 325 | 3300035089 | Ga0373944_0000004 | Ga0373944_0000004_40675_42087 | 459 |
| 326 | 3300035113 | Ga0373936_0003475 | Ga0373936_0003475_2573_3985 | 459 |
| 327 | 3300035116 | Ga0373945_0000904 | Ga0373945_0000904_4588_6000 | 459 |
| 328 | 3300035695 | Ga0373927_0000623 | Ga0373927_0000623_11911_13323 | 459 |
| 329 | 3300036712 | Ga0316584_0081727 | Ga0316584_0081727_970_2388 | 459 |
| 330 | 3300037418 | Ga0395900_0129368 | Ga0395900_0129368_243_1655 | 459 |
| 331 | 3300037466 | Ga0395898_0035131 | Ga0395898_0035131_760_2190 | 459 |
| 332 | 3300038443 | Ga0395901_0190418 | Ga0395901_0190418_308_1720 | 459 |
| 333 | 3300038443 | Ga0395901_0243584 | Ga0395901_0243584_56_1486 | 459 |
| 334 | 3300046455 | Ga0495603_0017507 | Ga0495603_0017507_2319_3731 | 459 |
| 335 | 3300046455 | Ga0495603_0027400 | Ga0495603_0027400_1909_3324 | 459 |
| 336 | 3300046461 | Ga0495641_0001496 | Ga0495641_0001496_14815_16227 | 459 |
| 337 | 3300046472 | Ga0495580_0013508 | Ga0495580_0013508_3719_5131 | 459 |
| 338 | 3300046473 | Ga0495582_0000400 | Ga0495582_0000400_9252_10664 | 459 |
| 339 | 3300046475 | Ga0495639_0000497 | Ga0495639_0000497_3346_4758 | 459 |
| 340 | 3300046476 | Ga0495662_0002136 | Ga0495662_0002136_5881_7293 | 459 |
| 341 | 3300046517 | Ga0495630_0032538 | Ga0495630_0032538_1276_2688 | 459 |
| 342 | 3300046523 | Ga0495644_0045775 | Ga0495644_0045775_141_1562 | 459 |
| 343 | 3300046526 | Ga0495666_0019217 | Ga0495666_0019217_1411_2823 | 459 |
| 344 | 3300046531 | Ga0495665_0000161 | Ga0495665_0000161_25496_26908 | 459 |
| 345 | 3300046531 | Ga0495665_0006330 | Ga0495665_0006330_4269_5681 | 459 |
| 346 | 3300046537 | Ga0495598_0009711 | Ga0495598_0009711_25_1446 | 459 |
| 347 | 3300046558 | Ga0495633_0026689 | Ga0495633_0026689_466_1887 | 459 |
| 348 | 3300046642 | Ga0495634_0001788 | Ga0495634_0001788_3806_5218 | 459 |
| 349 | 3300046663 | Ga0495635_0004116 | Ga0495635_0004116_4082_5494 | 459 |
| 350 | 3300046674 | Ga0495588_0000691 | Ga0495588_0000691_13921_15333 | 459 |
| 351 | 3300046681 | Ga0495647_0001010 | Ga0495647_0001010_566_1978 | 459 |
| 352 | 3300046683 | Ga0495658_0060303 | Ga0495658_0060303_613_2025 | 459 |
| 353 | 3300046690 | Ga0495624_0001856 | Ga0495624_0001856_14391_15803 | 459 |
| 354 | 3300046691 | Ga0495670_0045453 | Ga0495670_0045453_593_2014 | 459 |
| 355 | 3300047315 | Ga0495581_0000415 | Ga0495581_0000415_12518_13930 | 459 |
| 356 | 3300047319 | Ga0495674_0025277 | Ga0495674_0025277_2067_3479 | 459 |
| 357 | 3300047321 | Ga0495676_0101095 | Ga0495676_0101095_635_2047 | 459 |
| 358 | 3300047673 | Ga0495593_0001467 | Ga0495593_0001467_9173_10585 | 459 |
| 359 | 3300048903 | Ga0496100_0004552 | Ga0496100_0004552_3420_4832 | 459 |
| 360 | 3300048903 | Ga0496100_0006163 | Ga0496100_0006163_725_2116 | 459 |
| 361 | 3300048903 | Ga0496100_0076656 | Ga0496100_0076656_457_1872 | 459 |
| 362 | 3300048904 | Ga0496101_0007031 | Ga0496101_0007031_1839_3251 | 459 |
| 363 | 3300048904 | Ga0496101_0022473 | Ga0496101_0022473_2184_3575 | 459 |
| 364 | 3300048904 | Ga0496101_0101765 | Ga0496101_0101765_385_1800 | 459 |
| 365 | 3300048905 | Ga0496102_0023596 | Ga0496102_0023596_3295_4686 | 459 |
| 366 | 3300048905 | Ga0496102_0036116 | Ga0496102_0036116_1033_2445 | 459 |
| 367 | 3300048905 | Ga0496102_0060254 | Ga0496102_0060254_1908_3323 | 459 |
| 368 | 3300048905 | Ga0496102_0083000 | Ga0496102_0083000_1384_2796 | 459 |
| 369 | 3300048906 | Ga0496103_0058621 | Ga0496103_0058621_722_2134 | 459 |
| 370 | 3300048907 | Ga0496104_0005891 | Ga0496104_0005891_566_1957 | 459 |
| 371 | 3300048908 | Ga0496105_0127550 | Ga0496105_0127550_581_1972 | 459 |
| 372 | 3300048909 | Ga0496106_0010190 | Ga0496106_0010190_3992_5407 | 459 |
| 373 | 3300048910 | Ga0496107_0009225 | Ga0496107_0009225_1415_2830 | 459 |
| 374 | 3300048911 | Ga0496108_0090404 | Ga0496108_0090404_1056_2468 | 459 |
| 375 | 3300048911 | Ga0496108_0176195 | Ga0496108_0176195_23_1444 | 459 |
| 376 | 3300048912 | Ga0496109_0005225 | Ga0496109_0005225_5265_6677 | 459 |
| 377 | 3300048914 | Ga0496111_0003079 | Ga0496111_0003079_4186_5598 | 459 |
| 378 | 3300048915 | Ga0496112_0080300 | Ga0496112_0080300_54_1466 | 459 |
| 379 | 3300048917 | Ga0496114_0001198 | Ga0496114_0001198_433_1845 | 459 |
| 380 | 3300048917 | Ga0496114_0049896 | Ga0496114_0049896_1334_2725 | 459 |
| 381 | 3300049568 | Ga0501031_0157247 | Ga0501031_0157247_60_1451 | 459 |
| 382 | 3300049576 | Ga0501040_0096384 | Ga0501040_0096384_474_1865 | 459 |
| 383 | 3300049592 | Ga0501076_0015983 | Ga0501076_0015983_3155_4546 | 459 |
| 384 | 3300049593 | Ga0501077_0092327 | Ga0501077_0092327_333_1748 | 459 |
| 385 | 3300050507 | nmdc:mga05p37_60787_c1 | nmdc:mga05p37_60787_c1_1482_2927 | 459 |
| 386 | 3300050512 | nmdc:mga0n895_1840_c1 | nmdc:mga0n895_1840_c1_1449_2864 | 459 |
| 387 | 3300050513 | nmdc:mga0rr50_29549_c1 | nmdc:mga0rr50_29549_c1_1942_3357 | 459 |
| 388 | 3300050515 | nmdc:mga0a205_6663_c1 | nmdc:mga0a205_6663_c1_5833_7278 | 459 |
| 389 | 3300053078 | Ga0495612_0001552 | Ga0495612_0001552_5473_6954 | 459 |
| 390 | 3300053085 | Ga0495619_0000287 | Ga0495619_0000287_11021_12433 | 459 |
| 391 | 3300053085 | Ga0495619_0005700 | Ga0495619_0005700_2184_3665 | 459 |
| 392 | 3300060353 | Ga0501082_0197435 | Ga0501082_0197435_265_1689 | 459 |
| 393 | 3300003373 | JGI25407J50210_10003181 | JGI25407J50210_100031812 | 460 |
| 394 | 3300005981 | Ga0081538_10000367 | Ga0081538_1000036712 | 460 |
| 395 | 3300006846 | Ga0075430_100004467 | Ga0075430_1000044674 | 460 |
| 396 | 3300009147 | Ga0114129_10077685 | Ga0114129_100776853 | 460 |
| 397 | 3300014325 | Ga0163163_10232732 | Ga0163163_102327322 | 460 |
| 398 | 3300028380 | Ga0268265_10141224 | Ga0268265_101412242 | 460 |
| 399 | 3300032126 | Ga0307415_100010986 | Ga0307415_1000109862 | 460 |
| 400 | 3300044712 | Ga0453684_0001079 | Ga0453684_0001079_77126_78622 | 460 |
| 401 | 3300049570 | Ga0501033_0006275 | Ga0501033_0006275_3680_5098 | 460 |
| 402 | 3300049570 | Ga0501033_0132077 | Ga0501033_0132077_351_1769 | 460 |
| 403 | 3300049571 | Ga0501034_0023927 | Ga0501034_0023927_1013_2431 | 460 |
| 404 | 3300049573 | Ga0501037_0035942 | Ga0501037_0035942_1219_2637 | 460 |
| 405 | 3300049575 | Ga0501039_0021966 | Ga0501039_0021966_1753_3171 | 460 |
| 406 | 3300049582 | Ga0501048_0049259 | Ga0501048_0049259_1496_2914 | 460 |
| 407 | 3300049585 | Ga0501069_0001749 | Ga0501069_0001749_810_2228 | 460 |
| 408 | 3300049586 | Ga0501070_0001285 | Ga0501070_0001285_14347_15765 | 460 |
| 409 | 3300049587 | Ga0501071_0008335 | Ga0501071_0008335_738_2156 | 460 |
| 410 | 3300049588 | Ga0501072_0070039 | Ga0501072_0070039_1195_2613 | 460 |
| 411 | 3300049589 | Ga0501073_0040761 | Ga0501073_0040761_673_2091 | 460 |
| 412 | 3300049591 | Ga0501075_0005120 | Ga0501075_0005120_1975_3393 | 460 |
| 413 | 3300049591 | Ga0501075_0005138 | Ga0501075_0005138_2051_3469 | 460 |
| 414 | 3300049592 | Ga0501076_0001890 | Ga0501076_0001890_7348_8766 | 460 |
| 415 | 3300049592 | Ga0501076_0079955 | Ga0501076_0079955_957_2375 | 460 |
| 416 | 3300049593 | Ga0501077_0008984 | Ga0501077_0008984_1003_2421 | 460 |
| 417 | 3300049741 | Ga0501079_0022458 | Ga0501079_0022458_2407_3825 | 460 |
| 418 | 3300049742 | Ga0501080_0044785 | Ga0501080_0044785_2240_3658 | 460 |
| 419 | 3300049743 | Ga0501081_0002611 | Ga0501081_0002611_4849_6267 | 460 |
| 420 | 3300049744 | Ga0501083_0000728 | Ga0501083_0000728_8183_9601 | 460 |
| 421 | 3300049822 | Ga0501035_0006819 | Ga0501035_0006819_907_2325 | 460 |
| 422 | 3300049822 | Ga0501035_0030207 | Ga0501035_0030207_1451_2869 | 460 |
| 423 | 3300049823 | Ga0501044_0003836 | Ga0501044_0003836_10881_12299 | 460 |
| 424 | 3300050507 | nmdc:mga05p37_17911_c1 | nmdc:mga05p37_17911_c1_85_1563 | 460 |
| 425 | 3300050509 | nmdc:mga0qj67_5924_c1 | nmdc:mga0qj67_5924_c1_596_2074 | 460 |
| 426 | 3300054114 | Ga0501084_0009070 | Ga0501084_0009070_4067_5485 | 460 |
| 427 | 3300061734 | Ga0530510_0022754 | Ga0530510_0022754_1935_3353 | 460 |
| 428 | 3300005548 | Ga0070665_100203863 | Ga0070665_1002038632 | 461 |
| 429 | 3300005563 | Ga0068855_100016329 | Ga0068855_1000163297 | 461 |
| 430 | 3300005616 | Ga0068852_100010514 | Ga0068852_1000105142 | 461 |
| 431 | 3300009093 | Ga0105240_10190176 | Ga0105240_101901762 | 461 |
| 432 | 3300009551 | Ga0105238_10060551 | Ga0105238_100605513 | 461 |
| 433 | 3300025911 | Ga0207654_10095284 | Ga0207654_100952841 | 461 |
| 434 | 3300025913 | Ga0207695_10002209 | Ga0207695_1000220921 | 461 |
| 435 | 3300025914 | Ga0207671_10000910 | Ga0207671_1000091021 | 461 |
| 436 | 3300025924 | Ga0207694_10000405 | Ga0207694_1000040516 | 461 |
| 437 | 3300025949 | Ga0207667_10113164 | Ga0207667_101131642 | 461 |
| 438 | 3300026078 | Ga0207702_10151189 | Ga0207702_101511892 | 461 |
| 439 | 3300026142 | Ga0207698_10083442 | Ga0207698_100834422 | 461 |
| 440 | 3300028379 | Ga0268266_10156730 | Ga0268266_101567302 | 461 |
| 441 | 3300044656 | Ga0466969_0039214 | Ga0466969_0039214_324_1841 | 461 |
| 442 | 3300044693 | Ga0466961_0029038 | Ga0466961_0029038_237_1754 | 461 |
| 443 | 3300045049 | Ga0466959_0079611 | Ga0466959_0079611_747_2264 | 461 |
| 444 | 3300045976 | Ga0466967_0041240 | Ga0466967_0041240_20_1471 | 461 |
| 445 | 3300046462 | Ga0495651_0001189 | Ga0495651_0001189_3572_5089 | 461 |
| 446 | 3300046516 | Ga0495628_0004113 | Ga0495628_0004113_3219_4736 | 461 |
| 447 | 3300046529 | Ga0495652_0008621 | Ga0495652_0008621_5025_6542 | 461 |
| 448 | 3300046543 | Ga0495645_0038272 | Ga0495645_0038272_102_1619 | 461 |
| 449 | 3300059423 | Ga0590074_004035 | Ga0590074_004035_198_1640 | 461 |
| 450 | 3300037471 | Ga0395905_0038124 | Ga0395905_0038124_990_2453 | 462 |
| 451 | 3300044765 | Ga0466970_0011760 | Ga0466970_0011760_1852_3315 | 462 |
| 452 | 3300005445 | Ga0070708_100185454 | Ga0070708_1001854542 | 463 |
| 453 | 3300005467 | Ga0070706_100005928 | Ga0070706_10000592812 | 463 |
| 454 | 3300005468 | Ga0070707_100000970 | Ga0070707_1000009707 | 463 |
| 455 | 3300009098 | Ga0105245_10084225 | Ga0105245_100842253 | 463 |
| 456 | 3300009177 | Ga0105248_10102450 | Ga0105248_101024503 | 463 |
| 457 | 3300013104 | Ga0157370_10139237 | Ga0157370_101392372 | 463 |
| 458 | 3300014325 | Ga0163163_10044765 | Ga0163163_100447652 | 463 |
| 459 | 3300025910 | Ga0207684_10027081 | Ga0207684_100270812 | 463 |
| 460 | 3300026116 | Ga0207674_10070254 | Ga0207674_100702542 | 463 |
| 461 | 3300031903 | Ga0307407_10042698 | Ga0307407_100426982 | 463 |
| 462 | 3300048911 | Ga0496108_0103119 | Ga0496108_0103119_258_1733 | 463 |
| 463 | 3300048915 | Ga0496112_0105933 | Ga0496112_0105933_882_2342 | 463 |
| 464 | 3300049584 | Ga0501068_0003180 | Ga0501068_0003180_2184_3623 | 463 |
| 465 | 3300050512 | nmdc:mga0n895_214400_c1 | nmdc:mga0n895_214400_c1_386_1867 | 463 |
| 466 | 3300005335 | Ga0070666_10054980 | Ga0070666_100549802 | 465 |
| 467 | 3300014968 | Ga0157379_10056310 | Ga0157379_100563102 | 465 |
| 468 | 3300037312 | Ga0395899_0057395 | Ga0395899_0057395_146_1663 | 465 |
| 469 | 3300037466 | Ga0395898_0000100 | Ga0395898_0000100_186803_188320 | 465 |
| 470 | 3300044765 | Ga0466970_0028270 | Ga0466970_0028270_748_2166 | 466 |
| 471 | 3300048917 | Ga0496114_0003634 | Ga0496114_0003634_7970_9427 | 466 |
| 472 | 3300005468 | Ga0070707_100000324 | Ga0070707_10000032453 | 467 |
| 473 | 3300005471 | Ga0070698_100000372 | Ga0070698_1000003723 | 467 |
| 474 | 3300007076 | Ga0075435_100018987 | Ga0075435_1000189873 | 467 |
| 475 | 3300025905 | Ga0207685_10013931 | Ga0207685_100139312 | 467 |
| 476 | 3300025916 | Ga0207663_10011316 | Ga0207663_100113161 | 467 |
| 477 | 3300025922 | Ga0207646_10000600 | Ga0207646_100006003 | 467 |
| 478 | 3300025929 | Ga0207664_10008129 | Ga0207664_100081294 | 467 |
| 479 | 3300025939 | Ga0207665_10036942 | Ga0207665_100369423 | 467 |
| 480 | 3300030733 | Ga0314311_1197083 | Ga0314311_11970832 | 467 |
| 481 | 3300034817 | Ga0373948_0005457 | Ga0373948_0005457_233_1702 | 467 |
| 482 | 3300034957 | Ga0373938_0009642 | Ga0373938_0009642_31_1500 | 467 |
| 483 | 3300035086 | Ga0373934_0007586 | Ga0373934_0007586_703_2172 | 467 |
| 484 | 3300035112 | Ga0373932_0014282 | Ga0373932_0014282_216_1685 | 467 |
| 485 | 3300035117 | Ga0373953_0000384 | Ga0373953_0000384_3674_5143 | 467 |
| 486 | 3300035117 | Ga0373953_0001003 | Ga0373953_0001003_2277_3746 | 467 |
| 487 | 3300035119 | Ga0373956_0000352 | Ga0373956_0000352_5034_6503 | 467 |
| 488 | 3300035119 | Ga0373956_0019543 | Ga0373956_0019543_1344_2810 | 467 |
| 489 | 3300035120 | Ga0373957_0000060 | Ga0373957_0000060_20497_21966 | 467 |
| 490 | 3300035172 | Ga0373955_0000023 | Ga0373955_0000023_33093_34562 | 467 |
| 491 | 3300035172 | Ga0373955_0009263 | Ga0373955_0009263_2065_3534 | 467 |
| 492 | 3300035410 | Ga0373924_0000690 | Ga0373924_0000690_7321_8790 | 467 |
| 493 | 3300035692 | Ga0373935_0030183 | Ga0373935_0030183_1781_3250 | 467 |
| 494 | 3300035724 | Ga0373933_0002530 | Ga0373933_0002530_3032_4501 | 467 |
| 495 | 3300035724 | Ga0373933_0072026 | Ga0373933_0072026_170_1636 | 467 |
| 496 | 3300036401 | Ga0373937_0000002 | Ga0373937_0000002_251053_252522 | 467 |
| 497 | 3300036401 | Ga0373937_0002929 | Ga0373937_0002929_1454_2923 | 467 |
| 498 | 3300036401 | Ga0373937_0087626 | Ga0373937_0087626_1338_2804 | 467 |
| 499 | 3300037853 | Ga0436364_0783642 | Ga0436364_0783642_11705_13126 | 467 |
| 500 | 3300041404 | Ga0439436_0014584 | Ga0439436_0014584_560_2077 | 467 |
| 501 | 3300041406 | Ga0439439_0001413 | Ga0439439_0001413_1006_2523 | 467 |
| 502 | 3300042014 | Ga0439457_008199 | Ga0439457_008199_537_2054 | 467 |
| 503 | 3300042146 | Ga0450907_002846 | Ga0450907_002846_1558_3075 | 467 |
| 504 | 3300046454 | Ga0495592_0000003 | Ga0495592_0000003_147693_149162 | 467 |
| 505 | 3300046455 | Ga0495603_0043891 | Ga0495603_0043891_62_1531 | 467 |
| 506 | 3300046462 | Ga0495651_0000031 | Ga0495651_0000031_51609_53078 | 467 |
| 507 | 3300046462 | Ga0495651_0039002 | Ga0495651_0039002_233_1699 | 467 |
| 508 | 3300046463 | Ga0495653_0000906 | Ga0495653_0000906_15381_16850 | 467 |
| 509 | 3300046475 | Ga0495639_0008853 | Ga0495639_0008853_557_2026 | 467 |
| 510 | 3300046477 | Ga0495664_0002595 | Ga0495664_0002595_6656_8125 | 467 |
| 511 | 3300046511 | Ga0495608_0000018 | Ga0495608_0000018_147689_149158 | 467 |
| 512 | 3300046516 | Ga0495628_0000020 | Ga0495628_0000020_112821_114290 | 467 |
| 513 | 3300046529 | Ga0495652_0000013 | Ga0495652_0000013_45103_46572 | 467 |
| 514 | 3300046531 | Ga0495665_0019098 | Ga0495665_0019098_758_2227 | 467 |
| 515 | 3300046533 | Ga0495640_0084660 | Ga0495640_0084660_257_1726 | 467 |
| 516 | 3300046536 | Ga0495587_0000014 | Ga0495587_0000014_147677_149146 | 467 |
| 517 | 3300046536 | Ga0495587_0001459 | Ga0495587_0001459_1313_2782 | 467 |
| 518 | 3300046559 | Ga0495667_0000014 | Ga0495667_0000014_51606_53075 | 467 |
| 519 | 3300046559 | Ga0495667_0005338 | Ga0495667_0005338_1563_3029 | 467 |
| 520 | 3300046642 | Ga0495634_0033627 | Ga0495634_0033627_1326_2795 | 467 |
| 521 | 3300046675 | Ga0495657_0000012 | Ga0495657_0000012_49030_50499 | 467 |
| 522 | 3300046675 | Ga0495657_0016167 | Ga0495657_0016167_822_2288 | 467 |
| 523 | 3300046675 | Ga0495657_0031774 | Ga0495657_0031774_1314_2783 | 467 |
| 524 | 3300046678 | Ga0495599_0000071 | Ga0495599_0000071_24266_25735 | 467 |
| 525 | 3300046679 | Ga0495623_0000066 | Ga0495623_0000066_49034_50503 | 467 |
| 526 | 3300046680 | Ga0495646_0008273 | Ga0495646_0008273_4939_6408 | 467 |
| 527 | 3300046809 | Ga0495600_0058016 | Ga0495600_0058016_807_2276 | 467 |
| 528 | 3300047315 | Ga0495581_0038302 | Ga0495581_0038302_937_2406 | 467 |
| 529 | 3300047317 | Ga0495604_0000054 | Ga0495604_0000054_54455_55924 | 467 |
| 530 | 3300047322 | Ga0495680_0000003 | Ga0495680_0000003_125608_127077 | 467 |
| 531 | 3300047444 | Ga0495675_0000220 | Ga0495675_0000220_24530_25999 | 467 |
| 532 | 3300047444 | Ga0495675_0009187 | Ga0495675_0009187_3484_4953 | 467 |
| 533 | 3300047673 | Ga0495593_0019642 | Ga0495593_0019642_915_2384 | 467 |
| 534 | 3300048088 | Ga0495602_0000014 | Ga0495602_0000014_146706_148175 | 467 |
| 535 | 3300048907 | Ga0496104_0069683 | Ga0496104_0069683_337_1806 | 467 |
| 536 | 3300048910 | Ga0496107_0030844 | Ga0496107_0030844_2063_3532 | 467 |
| 537 | 3300049581 | Ga0501047_0160331 | Ga0501047_0160331_372_1808 | 467 |
| 538 | 3300050513 | nmdc:mga0rr50_129887_c1 | nmdc:mga0rr50_129887_c1_45_1514 | 467 |
| 539 | 3300005843 | Ga0068860_100001858 | Ga0068860_1000018583 | 468 |
| 540 | 3300028381 | Ga0268264_10000226 | Ga0268264_1000022693 | 468 |
| 541 | 3300031456 | Ga0307513_10000002 | Ga0307513_10000002100 | 468 |
| 542 | 3300049571 | Ga0501034_0016112 | Ga0501034_0016112_1880_3487 | 468 |
| 543 | 3300049574 | Ga0501038_0003845 | Ga0501038_0003845_2435_3982 | 468 |
| 544 | 3300049578 | Ga0501042_0069688 | Ga0501042_0069688_398_1945 | 468 |
| 545 | 3300049581 | Ga0501047_0080301 | Ga0501047_0080301_402_1949 | 468 |
| 546 | 3300049586 | Ga0501070_0001111 | Ga0501070_0001111_11370_12812 | 468 |
| 547 | 3300049589 | Ga0501073_0084060 | Ga0501073_0084060_557_1999 | 468 |
| 548 | 3300049742 | Ga0501080_0035065 | Ga0501080_0035065_1248_2690 | 468 |
| 549 | 3300049822 | Ga0501035_0009131 | Ga0501035_0009131_3444_4991 | 468 |
| 550 | 3300049823 | Ga0501044_0002740 | Ga0501044_0002740_2884_4431 | 468 |
| 551 | 3300049824 | Ga0501045_0070788 | Ga0501045_0070788_301_1794 | 469 |
| 552 | 3300061734 | Ga0530510_0105651 | Ga0530510_0105651_529_2022 | 469 |
| 553 | iso_pu_bacteria | 2643221632 | 2644182084 | 469 |
| 554 | 3300025924 | Ga0207694_10038163 | Ga0207694_100381632 | 470 |
| 555 | 3300028666 | Ga0265336_10008877 | Ga0265336_100088773 | 470 |
| 556 | 3300028800 | Ga0265338_10013968 | Ga0265338_100139684 | 470 |
| 557 | 3300037853 | Ga0436364_0259237 | Ga0436364_0259237_736_2319 | 470 |
| 558 | iso_pu_bacteria | 2643221576 | 2643890456 | 470 |
| 559 | iso_pu_bacteria | 2643221590 | 2643959512 | 470 |
| 560 | iso_pu_bacteria | 2643221604 | 2644033020 | 470 |
| 561 | iso_pu_bacteria | 2643221617 | 2644099986 | 470 |
| 562 | iso_pu_bacteria | 2643221620 | 2644117592 | 470 |
| 563 | iso_pu_bacteria | 2738541305 | 2738871869 | 470 |
| 564 | iso_pu_bacteria | 2811994874 | 2812331029 | 470 |
| 565 | 3300006038 | Ga0075365_10005206 | Ga0075365_100052062 | 471 |
| 566 | 3300006038 | Ga0075365_10083932 | Ga0075365_100839321 | 471 |
| 567 | 3300048908 | Ga0496105_0036304 | Ga0496105_0036304_17_1450 | 471 |
| 568 | 3300049572 | Ga0501036_0123903 | Ga0501036_0123903_471_1922 | 471 |
| 569 | 3300049583 | Ga0501067_0002330 | Ga0501067_0002330_1638_3089 | 471 |
| 570 | 3300049589 | Ga0501073_0002339 | Ga0501073_0002339_10352_11803 | 471 |
| 571 | 3300049590 | Ga0501074_0001111 | Ga0501074_0001111_14807_16258 | 471 |
| 572 | 3300049742 | Ga0501080_0083782 | Ga0501080_0083782_138_1589 | 471 |
| 573 | 3300050491 | nmdc:mga00v17_3705_c2 | nmdc:mga00v17_3705_c2_666_2120 | 471 |
| 574 | 3300050492 | nmdc:mga0yw44_88127_c1 | nmdc:mga0yw44_88127_c1_68_1522 | 471 |
| 575 | 3300050496 | nmdc:mga07m45_12427_c1 | nmdc:mga07m45_12427_c1_1883_3337 | 471 |
| 576 | 3300053088 | Ga0500644_0000203 | Ga0500644_0000203_18699_20153 | 471 |
| 577 | 3300054114 | Ga0501084_0029803 | Ga0501084_0029803_2577_4028 | 471 |
| 578 | 3300060353 | Ga0501082_0007309 | Ga0501082_0007309_7185_8636 | 471 |
| 579 | 3300061734 | Ga0530510_0119442 | Ga0530510_0119442_139_1608 | 471 |
| 580 | iso_pu_bacteria | 2554235227 | 2555228993 | 471 |
| 581 | iso_pu_bacteria | 2654587600 | 2655033476 | 471 |
| 582 | 3300003203 | JGI25406J46586_10000769 | JGI25406J46586_100007697 | 472 |
| 583 | 3300041491 | Ga0451833_0032744 | Ga0451833_0032744_1220_2689 | 472 |
| 584 | 3300045976 | Ga0466967_0010313 | Ga0466967_0010313_4030_5481 | 472 |
| 585 | 3300042007 | Ga0439449_0026951 | Ga0439449_0026951_552_2048 | 473 |
| 586 | 3300044658 | Ga0466972_0078250 | Ga0466972_0078250_72_1529 | 473 |
| 587 | 3300044765 | Ga0466970_0001467 | Ga0466970_0001467_6424_7881 | 473 |
| 588 | 3300044901 | Ga0466960_0066334 | Ga0466960_0066334_12_1469 | 473 |
| 589 | iso_pu_bacteria | 2558860112 | 2558911891 | 473 |
| 590 | 3300003578 | Ga0006562J51391_1043768 | Ga0006562J51391_10437682 | 474 |
| 591 | 3300025904 | Ga0207647_10058703 | Ga0207647_100587032 | 474 |
| 592 | 3300031911 | Ga0307412_10038793 | Ga0307412_100387932 | 474 |
| 593 | 3300037853 | Ga0436364_1199653 | Ga0436364_1199653_2498_3982 | 474 |
| 594 | 3300047319 | Ga0495674_0085720 | Ga0495674_0085720_535_2064 | 474 |
| 595 | 3300047322 | Ga0495680_0057193 | Ga0495680_0057193_223_1752 | 474 |
| 596 | 3300049568 | Ga0501031_0001225 | Ga0501031_0001225_3986_5533 | 474 |
| 597 | 3300049569 | Ga0501032_0001562 | Ga0501032_0001562_13582_15129 | 474 |
| 598 | 3300049569 | Ga0501032_0004751 | Ga0501032_0004751_5798_7339 | 474 |
| 599 | 3300049570 | Ga0501033_0000572 | Ga0501033_0000572_10014_11561 | 474 |
| 600 | 3300049571 | Ga0501034_0006026 | Ga0501034_0006026_6746_8293 | 474 |
| 601 | 3300049572 | Ga0501036_0003307 | Ga0501036_0003307_6788_8335 | 474 |
| 602 | 3300049572 | Ga0501036_0004601 | Ga0501036_0004601_2038_3579 | 474 |
| 603 | 3300049573 | Ga0501037_0000294 | Ga0501037_0000294_8986_10527 | 474 |
| 604 | 3300049574 | Ga0501038_0003608 | Ga0501038_0003608_9721_11268 | 474 |
| 605 | 3300049574 | Ga0501038_0005757 | Ga0501038_0005757_8038_9579 | 474 |
| 606 | 3300049575 | Ga0501039_0001815 | Ga0501039_0001815_3350_4891 | 474 |
| 607 | 3300049575 | Ga0501039_0004950 | Ga0501039_0004950_5412_6959 | 474 |
| 608 | 3300049578 | Ga0501042_0011058 | Ga0501042_0011058_1874_3415 | 474 |
| 609 | 3300049579 | Ga0501043_0001877 | Ga0501043_0001877_7744_9291 | 474 |
| 610 | 3300049579 | Ga0501043_0004157 | Ga0501043_0004157_1691_3232 | 474 |
| 611 | 3300049580 | Ga0501046_0000236 | Ga0501046_0000236_23226_24773 | 474 |
| 612 | 3300049580 | Ga0501046_0001725 | Ga0501046_0001725_18045_19586 | 474 |
| 613 | 3300049581 | Ga0501047_0017158 | Ga0501047_0017158_4812_6359 | 474 |
| 614 | 3300049581 | Ga0501047_0029588 | Ga0501047_0029588_2116_3657 | 474 |
| 615 | 3300049582 | Ga0501048_0000093 | Ga0501048_0000093_30208_31755 | 474 |
| 616 | 3300049582 | Ga0501048_0005329 | Ga0501048_0005329_7792_9333 | 474 |
| 617 | 3300049583 | Ga0501067_0030306 | Ga0501067_0030306_919_2466 | 474 |
| 618 | 3300049585 | Ga0501069_0000897 | Ga0501069_0000897_4788_6335 | 474 |
| 619 | 3300049585 | Ga0501069_0073049 | Ga0501069_0073049_299_1759 | 474 |
| 620 | 3300049589 | Ga0501073_0010335 | Ga0501073_0010335_4650_6197 | 474 |
| 621 | 3300049590 | Ga0501074_0000476 | Ga0501074_0000476_2533_4080 | 474 |
| 622 | 3300049742 | Ga0501080_0001133 | Ga0501080_0001133_16293_17840 | 474 |
| 623 | 3300049742 | Ga0501080_0034656 | Ga0501080_0034656_1908_3449 | 474 |
| 624 | 3300049744 | Ga0501083_0053364 | Ga0501083_0053364_139_1686 | 474 |
| 625 | 3300049822 | Ga0501035_0005446 | Ga0501035_0005446_10179_11726 | 474 |
| 626 | 3300049822 | Ga0501035_0005745 | Ga0501035_0005745_1911_3452 | 474 |
| 627 | 3300049823 | Ga0501044_0001800 | Ga0501044_0001800_4602_6143 | 474 |
| 628 | 3300049823 | Ga0501044_0010545 | Ga0501044_0010545_1732_3279 | 474 |
| 629 | 3300050491 | nmdc:mga00v17_14591_c1 | nmdc:mga00v17_14591_c1_696_2156 | 474 |
| 630 | 3300053085 | Ga0495619_0006349 | Ga0495619_0006349_1517_3046 | 474 |
| 631 | 3300054114 | Ga0501084_0002183 | Ga0501084_0002183_9454_11001 | 474 |
| 632 | 3300005435 | Ga0070714_100002231 | Ga0070714_10000223110 | 475 |
| 633 | 3300021358 | Ga0213873_10000084 | Ga0213873_1000008410 | 475 |
| 634 | 3300025923 | Ga0207681_10085473 | Ga0207681_100854732 | 475 |
| 635 | 3300025929 | Ga0207664_10005356 | Ga0207664_100053564 | 475 |
| 636 | 3300038443 | Ga0395901_0266107 | Ga0395901_0266107_240_1706 | 475 |
| 637 | 3300039453 | Ga0436362_0198821 | Ga0436362_0198821_4448_5953 | 475 |
| 638 | 3300044694 | Ga0466963_0048494 | Ga0466963_0048494_726_2240 | 475 |
| 639 | 3300045976 | Ga0466967_0021383 | Ga0466967_0021383_644_2158 | 475 |
| 640 | 3300045976 | Ga0466967_0022734 | Ga0466967_0022734_194_1732 | 475 |
| 641 | 3300053085 | Ga0495619_0045475 | Ga0495619_0045475_86_1591 | 475 |
| 642 | iso_pu_bacteria | 2870721527 | 2870727855 | 475 |
| 643 | iso_pu_bacteria | 8057568493 | 8057573816 | 475 |
| 644 | 3300006048 | Ga0075363_100008798 | Ga0075363_1000087982 | 476 |
| 645 | 3300006051 | Ga0075364_10004234 | Ga0075364_100042342 | 476 |
| 646 | 3300006178 | Ga0075367_10037719 | Ga0075367_100377192 | 476 |
| 647 | 3300006353 | Ga0075370_10026952 | Ga0075370_100269522 | 476 |
| 648 | 3300009148 | Ga0105243_10090292 | Ga0105243_100902922 | 476 |
| 649 | 3300013308 | Ga0157375_10258580 | Ga0157375_102585801 | 476 |
| 650 | 3300044683 | Ga0466965_0031149 | Ga0466965_0031149_670_2214 | 476 |
| 651 | 3300044694 | Ga0466963_0090605 | Ga0466963_0090605_42_1583 | 476 |
| 652 | 3300048927 | Ga0496124_0010783 | Ga0496124_0010783_1781_3271 | 476 |
| 653 | 3300049575 | Ga0501039_0046336 | Ga0501039_0046336_1691_3235 | 476 |
| 654 | 3300050490 | nmdc:mga03n38_3379_c1 | nmdc:mga03n38_3379_c1_1498_2997 | 476 |
| 655 | 3300050491 | nmdc:mga00v17_16663_c1 | nmdc:mga00v17_16663_c1_1405_2904 | 476 |
| 656 | 3300050496 | nmdc:mga07m45_13457_c1 | nmdc:mga07m45_13457_c1_2411_3910 | 476 |
| 657 | iso_pu_bacteria | 2643221587 | 2643947749 | 476 |
| 658 | iso_pu_bacteria | 2643221670 | 2644390819 | 476 |
| 659 | iso_pu_bacteria | 2643221677 | 2644433614 | 476 |
| 660 | 3300005471 | Ga0070698_100000293 | Ga0070698_10000029341 | 477 |
| 661 | 3300009093 | Ga0105240_10248131 | Ga0105240_102481312 | 477 |
| 662 | 3300009545 | Ga0105237_10227152 | Ga0105237_102271522 | 477 |
| 663 | 3300010375 | Ga0105239_10078456 | Ga0105239_100784562 | 477 |
| 664 | 3300025949 | Ga0207667_10042028 | Ga0207667_100420283 | 477 |
| 665 | 3300031616 | Ga0307508_10099965 | Ga0307508_100999652 | 477 |
| 666 | 3300044684 | Ga0466966_0044570 | Ga0466966_0044570_1200_2714 | 477 |
| 667 | 3300044694 | Ga0466963_0060153 | Ga0466963_0060153_628_2142 | 477 |
| 668 | 3300044706 | Ga0466964_0001054 | Ga0466964_0001054_3122_4636 | 477 |
| 669 | 3300044901 | Ga0466960_0068435 | Ga0466960_0068435_221_1735 | 477 |
| 670 | 3300045049 | Ga0466959_0068249 | Ga0466959_0068249_525_2039 | 477 |
| 671 | 3300045976 | Ga0466967_0000302 | Ga0466967_0000302_10696_12213 | 477 |
| 672 | 3300046679 | Ga0495623_0010547 | Ga0495623_0010547_1269_2846 | 477 |
| 673 | 3300048905 | Ga0496102_0000813 | Ga0496102_0000813_8947_10476 | 477 |
| 674 | 3300049823 | Ga0501044_0010059 | Ga0501044_0010059_64_1572 | 477 |
| 675 | 3300050507 | nmdc:mga05p37_1749_c1 | nmdc:mga05p37_1749_c1_8006_9529 | 477 |
| 676 | iso_pu_bacteria | 8056054917 | 8056055921 | 477 |
| 677 | 3300002073 | JGI24745J21846_1003475 | JGI24745J21846_10034752 | 478 |
| 678 | 3300005327 | Ga0070658_10027987 | Ga0070658_100279873 | 478 |
| 679 | 3300005343 | Ga0070687_100045972 | Ga0070687_1000459722 | 478 |
| 680 | 3300005347 | Ga0070668_100020933 | Ga0070668_1000209332 | 478 |
| 681 | 3300005366 | Ga0070659_100172705 | Ga0070659_1001727052 | 478 |
| 682 | 3300005455 | Ga0070663_100040375 | Ga0070663_1000403752 | 478 |
| 683 | 3300005466 | Ga0070685_10019185 | Ga0070685_100191852 | 478 |
| 684 | 3300005564 | Ga0070664_100117944 | Ga0070664_1001179442 | 478 |
| 685 | 3300005577 | Ga0068857_100053854 | Ga0068857_1000538543 | 478 |
| 686 | 3300005841 | Ga0068863_100064794 | Ga0068863_1000647942 | 478 |
| 687 | 3300009098 | Ga0105245_10022661 | Ga0105245_100226616 | 478 |
| 688 | 3300009177 | Ga0105248_10190584 | Ga0105248_101905842 | 478 |
| 689 | 3300011119 | Ga0105246_10040589 | Ga0105246_100405892 | 478 |
| 690 | 3300013306 | Ga0163162_10211394 | Ga0163162_102113942 | 478 |
| 691 | 3300025901 | Ga0207688_10002697 | Ga0207688_100026976 | 478 |
| 692 | 3300025904 | Ga0207647_10066759 | Ga0207647_100667592 | 478 |
| 693 | 3300025907 | Ga0207645_10068103 | Ga0207645_100681032 | 478 |
| 694 | 3300025919 | Ga0207657_10034643 | Ga0207657_100346432 | 478 |
| 695 | 3300026023 | Ga0207677_10145946 | Ga0207677_101459461 | 478 |
| 696 | 3300026075 | Ga0207708_10096280 | Ga0207708_100962802 | 478 |
| 697 | 3300026089 | Ga0207648_10036581 | Ga0207648_100365812 | 478 |
| 698 | 3300026116 | Ga0207674_10045935 | Ga0207674_100459352 | 478 |
| 699 | 3300048903 | Ga0496100_0091651 | Ga0496100_0091651_128_1621 | 478 |
| 700 | 3300049568 | Ga0501031_0001837 | Ga0501031_0001837_10979_12622 | 478 |
| 701 | 3300049568 | Ga0501031_0027192 | Ga0501031_0027192_1929_3452 | 478 |
| 702 | 3300049569 | Ga0501032_0035227 | Ga0501032_0035227_1707_3230 | 478 |
| 703 | 3300049571 | Ga0501034_0078537 | Ga0501034_0078537_1244_2887 | 478 |
| 704 | 3300049571 | Ga0501034_0226215 | Ga0501034_0226215_260_1783 | 478 |
| 705 | 3300049572 | Ga0501036_0003794 | Ga0501036_0003794_447_2090 | 478 |
| 706 | 3300049573 | Ga0501037_0012379 | Ga0501037_0012379_1327_2970 | 478 |
| 707 | 3300049574 | Ga0501038_0004045 | Ga0501038_0004045_9588_11111 | 478 |
| 708 | 3300049579 | Ga0501043_0008555 | Ga0501043_0008555_4503_6026 | 478 |
| 709 | 3300049579 | Ga0501043_0015165 | Ga0501043_0015165_1553_3064 | 478 |
| 710 | 3300049580 | Ga0501046_0054527 | Ga0501046_0054527_729_2372 | 478 |
| 711 | 3300049581 | Ga0501047_0122576 | Ga0501047_0122576_384_1907 | 478 |
| 712 | 3300049582 | Ga0501048_0004212 | Ga0501048_0004212_5669_7192 | 478 |
| 713 | 3300049586 | Ga0501070_0021783 | Ga0501070_0021783_1967_3490 | 478 |
| 714 | 3300049586 | Ga0501070_0052937 | Ga0501070_0052937_418_2061 | 478 |
| 715 | 3300049822 | Ga0501035_0009171 | Ga0501035_0009171_6272_7795 | 478 |
| 716 | 3300050511 | nmdc:mga08y16_138593_c1 | nmdc:mga08y16_138593_c1_752_2245 | 478 |
| 717 | iso_pu_bacteria | 2537561592 | 2537899737 | 478 |
| 718 | iso_pu_bacteria | 2802429296 | 2804846481 | 478 |
| 719 | iso_pu_bacteria | 2808606982 | 2811849314 | 478 |
| 720 | iso_pu_bacteria | 2899370129 | 2899376959 | 478 |
| 721 | iso_pu_bacteria | 2912757875 | 2912761074 | 478 |
| 722 | iso_pu_bacteria | 3006321560 | 3006324677 | 478 |
| 723 | iso_pu_bacteria | 3006486233 | 3006493761 | 478 |
| 724 | iso_pu_bacteria | 8025478263 | 8025484632 | 478 |
| 725 | iso_pu_bacteria | 8025530807 | 8025536353 | 478 |
| 726 | iso_pu_bacteria | 8056447290 | 8056451925 | 478 |
| 727 | iso_pu_bacteria | 8056667051 | 8056669273 | 478 |
| 728 | 3300013307 | Ga0157372_10000131 | Ga0157372_1000013128 | 479 |
| 729 | 3300021388 | Ga0213875_10007311 | Ga0213875_100073112 | 479 |
| 730 | 3300031456 | Ga0307513_10001948 | Ga0307513_1000194824 | 479 |
| 731 | 3300044684 | Ga0466966_0003942 | Ga0466966_0003942_2313_3827 | 479 |
| 732 | 3300044693 | Ga0466961_0006450 | Ga0466961_0006450_4267_5781 | 479 |
| 733 | 3300045049 | Ga0466959_0017352 | Ga0466959_0017352_1628_3142 | 479 |
| 734 | 3300048917 | Ga0496114_0091760 | Ga0496114_0091760_14_1468 | 479 |
| 735 | iso_pu_bacteria | 2773857762 | 2774396137 | 479 |
| 736 | iso_pu_bacteria | 2808606439 | 2809197775 | 479 |
| 737 | iso_pu_bacteria | 2811994878 | 2812347734 | 479 |
| 738 | iso_pu_bacteria | 2861520306 | 2861523706 | 479 |
| 739 | iso_pu_bacteria | 2883821847 | 2883826584 | 479 |
| 740 | iso_pu_bacteria | 2891968417 | 2891968856 | 479 |
| 741 | 3300005339 | Ga0070660_100004498 | Ga0070660_1000044985 | 480 |
| 742 | 3300005356 | Ga0070674_100067572 | Ga0070674_1000675722 | 480 |
| 743 | 3300005366 | Ga0070659_100003265 | Ga0070659_1000032653 | 480 |
| 744 | 3300005563 | Ga0068855_100220046 | Ga0068855_1002200461 | 480 |
| 745 | 3300005985 | Ga0081539_10000474 | Ga0081539_1000047476 | 480 |
| 746 | 3300013105 | Ga0157369_10039453 | Ga0157369_100394532 | 480 |
| 747 | 3300014326 | Ga0157380_10035216 | Ga0157380_100352163 | 480 |
| 748 | 3300025919 | Ga0207657_10009678 | Ga0207657_100096784 | 480 |
| 749 | 3300028794 | Ga0307515_10129515 | Ga0307515_101295152 | 480 |
| 750 | 3300031507 | Ga0307509_10143685 | Ga0307509_101436851 | 480 |
| 751 | 3300041405 | Ga0439438_011422 | Ga0439438_011422_236_1792 | 480 |
| 752 | 3300046454 | Ga0495592_0040124 | Ga0495592_0040124_1796_3313 | 480 |
| 753 | 3300046459 | Ga0495629_0010908 | Ga0495629_0010908_2730_4247 | 480 |
| 754 | 3300046459 | Ga0495629_0036411 | Ga0495629_0036411_861_2378 | 480 |
| 755 | 3300046462 | Ga0495651_0074795 | Ga0495651_0074795_808_2325 | 480 |
| 756 | 3300046514 | Ga0495618_0005624 | Ga0495618_0005624_2847_4364 | 480 |
| 757 | 3300046522 | Ga0495643_0001354 | Ga0495643_0001354_1317_2837 | 480 |
| 758 | 3300046529 | Ga0495652_0024673 | Ga0495652_0024673_3562_5079 | 480 |
| 759 | 3300046642 | Ga0495634_0007234 | Ga0495634_0007234_6221_7738 | 480 |
| 760 | 3300046683 | Ga0495658_0017175 | Ga0495658_0017175_1964_3484 | 480 |
| 761 | 3300046690 | Ga0495624_0029032 | Ga0495624_0029032_135_1652 | 480 |
| 762 | 3300046794 | Ga0495589_0052207 | Ga0495589_0052207_96_1616 | 480 |
| 763 | 3300046809 | Ga0495600_0075476 | Ga0495600_0075476_329_1846 | 480 |
| 764 | 3300047317 | Ga0495604_0031714 | Ga0495604_0031714_2444_3961 | 480 |
| 765 | 3300047321 | Ga0495676_0019222 | Ga0495676_0019222_2128_3645 | 480 |
| 766 | 3300047447 | Ga0495685_002361 | Ga0495685_002361_1293_2813 | 480 |
| 767 | 3300047470 | Ga0495681_0015522 | Ga0495681_0015522_989_2509 | 480 |
| 768 | 3300048903 | Ga0496100_0053592 | Ga0496100_0053592_935_2416 | 480 |
| 769 | 3300048904 | Ga0496101_0038726 | Ga0496101_0038726_1711_3192 | 480 |
| 770 | 3300048905 | Ga0496102_0024323 | Ga0496102_0024323_2097_3623 | 480 |
| 771 | 3300048905 | Ga0496102_0082166 | Ga0496102_0082166_1165_2646 | 480 |
| 772 | 3300048906 | Ga0496103_0108781 | Ga0496103_0108781_144_1670 | 480 |
| 773 | 3300048909 | Ga0496106_0011482 | Ga0496106_0011482_3692_5173 | 480 |
| 774 | 3300048913 | Ga0496110_0107403 | Ga0496110_0107403_579_2060 | 480 |
| 775 | 3300048914 | Ga0496111_0053846 | Ga0496111_0053846_340_1821 | 480 |
| 776 | 3300048916 | Ga0496113_0100381 | Ga0496113_0100381_50_1531 | 480 |
| 777 | 3300048924 | Ga0496121_0028149 | Ga0496121_0028149_808_2334 | 480 |
| 778 | 3300049568 | Ga0501031_0043372 | Ga0501031_0043372_42_1559 | 480 |
| 779 | 3300049568 | Ga0501031_0106572 | Ga0501031_0106572_265_1794 | 480 |
| 780 | 3300049569 | Ga0501032_0007217 | Ga0501032_0007217_1403_2920 | 480 |
| 781 | 3300049569 | Ga0501032_0029189 | Ga0501032_0029189_1639_3156 | 480 |
| 782 | 3300049570 | Ga0501033_0006403 | Ga0501033_0006403_7281_8798 | 480 |
| 783 | 3300049571 | Ga0501034_0019446 | Ga0501034_0019446_2388_3905 | 480 |
| 784 | 3300049571 | Ga0501034_0079746 | Ga0501034_0079746_1525_3042 | 480 |
| 785 | 3300049572 | Ga0501036_0003546 | Ga0501036_0003546_6000_7517 | 480 |
| 786 | 3300049572 | Ga0501036_0099953 | Ga0501036_0099953_214_1731 | 480 |
| 787 | 3300049573 | Ga0501037_0009368 | Ga0501037_0009368_1282_2799 | 480 |
| 788 | 3300049574 | Ga0501038_0012474 | Ga0501038_0012474_1050_2567 | 480 |
| 789 | 3300049574 | Ga0501038_0016250 | Ga0501038_0016250_3071_4588 | 480 |
| 790 | 3300049575 | Ga0501039_0011715 | Ga0501039_0011715_4600_6129 | 480 |
| 791 | 3300049575 | Ga0501039_0012192 | Ga0501039_0012192_4175_5692 | 480 |
| 792 | 3300049575 | Ga0501039_0023772 | Ga0501039_0023772_781_2298 | 480 |
| 793 | 3300049576 | Ga0501040_0002552 | Ga0501040_0002552_1752_3269 | 480 |
| 794 | 3300049576 | Ga0501040_0104452 | Ga0501040_0104452_37_1566 | 480 |
| 795 | 3300049577 | Ga0501041_0003443 | Ga0501041_0003443_2587_4104 | 480 |
| 796 | 3300049578 | Ga0501042_0033874 | Ga0501042_0033874_170_1699 | 480 |
| 797 | 3300049579 | Ga0501043_0003544 | Ga0501043_0003544_1377_2894 | 480 |
| 798 | 3300049580 | Ga0501046_0003797 | Ga0501046_0003797_233_1750 | 480 |
| 799 | 3300049581 | Ga0501047_0017157 | Ga0501047_0017157_5210_6727 | 480 |
| 800 | 3300049581 | Ga0501047_0032593 | Ga0501047_0032593_1975_3492 | 480 |
| 801 | 3300049582 | Ga0501048_0012861 | Ga0501048_0012861_1163_2692 | 480 |
| 802 | 3300049583 | Ga0501067_0002255 | Ga0501067_0002255_7573_9090 | 480 |
| 803 | 3300049583 | Ga0501067_0007863 | Ga0501067_0007863_110_1591 | 480 |
| 804 | 3300049584 | Ga0501068_0018151 | Ga0501068_0018151_1409_2926 | 480 |
| 805 | 3300049584 | Ga0501068_0056289 | Ga0501068_0056289_501_1982 | 480 |
| 806 | 3300049585 | Ga0501069_0018837 | Ga0501069_0018837_146_1663 | 480 |
| 807 | 3300049586 | Ga0501070_0025023 | Ga0501070_0025023_2446_3963 | 480 |
| 808 | 3300049587 | Ga0501071_0000525 | Ga0501071_0000525_6710_8227 | 480 |
| 809 | 3300049587 | Ga0501071_0019867 | Ga0501071_0019867_33_1550 | 480 |
| 810 | 3300049587 | Ga0501071_0042839 | Ga0501071_0042839_1553_3082 | 480 |
| 811 | 3300049588 | Ga0501072_0023669 | Ga0501072_0023669_268_1785 | 480 |
| 812 | 3300049590 | Ga0501074_0027609 | Ga0501074_0027609_535_2052 | 480 |
| 813 | 3300049591 | Ga0501075_0115037 | Ga0501075_0115037_445_1974 | 480 |
| 814 | 3300049592 | Ga0501076_0008545 | Ga0501076_0008545_4119_5648 | 480 |
| 815 | 3300049593 | Ga0501077_0019701 | Ga0501077_0019701_2341_3858 | 480 |
| 816 | 3300049593 | Ga0501077_0029666 | Ga0501077_0029666_1534_3063 | 480 |
| 817 | 3300049741 | Ga0501079_0014762 | Ga0501079_0014762_922_2439 | 480 |
| 818 | 3300049743 | Ga0501081_0030717 | Ga0501081_0030717_440_1969 | 480 |
| 819 | 3300049744 | Ga0501083_0031100 | Ga0501083_0031100_395_1912 | 480 |
| 820 | 3300049822 | Ga0501035_0002028 | Ga0501035_0002028_12651_14168 | 480 |
| 821 | 3300049822 | Ga0501035_0011863 | Ga0501035_0011863_2437_3954 | 480 |
| 822 | 3300049822 | Ga0501035_0037091 | Ga0501035_0037091_1503_3020 | 480 |
| 823 | 3300049822 | Ga0501035_0067088 | Ga0501035_0067088_880_2409 | 480 |
| 824 | 3300049823 | Ga0501044_0021072 | Ga0501044_0021072_233_1750 | 480 |
| 825 | 3300049824 | Ga0501045_0039918 | Ga0501045_0039918_162_1679 | 480 |
| 826 | 3300049824 | Ga0501045_0041394 | Ga0501045_0041394_1534_3063 | 480 |
| 827 | 3300049824 | Ga0501045_0138280 | Ga0501045_0138280_217_1734 | 480 |
| 828 | 3300053099 | Ga0500654_017380 | Ga0500654_017380_1173_2693 | 480 |
| 829 | 3300053100 | Ga0500660_019742 | Ga0500660_019742_1232_2752 | 480 |
| 830 | 3300053109 | Ga0500569_017708 | Ga0500569_017708_252_1772 | 480 |
| 831 | 3300053123 | Ga0500614_011358 | Ga0500614_011358_131_1651 | 480 |
| 832 | 3300053140 | Ga0500573_0024525 | Ga0500573_0024525_639_2162 | 480 |
| 833 | 3300053149 | Ga0500600_0008867 | Ga0500600_0008867_3074_4594 | 480 |
| 834 | 3300053160 | Ga0500633_0006523 | Ga0500633_0006523_317_1837 | 480 |
| 835 | 3300054114 | Ga0501084_0027049 | Ga0501084_0027049_3043_4560 | 480 |
| 836 | 3300060353 | Ga0501082_0123092 | Ga0501082_0123092_118_1647 | 480 |
| 837 | 3300061734 | Ga0530510_0106557 | Ga0530510_0106557_440_1969 | 480 |
| 838 | iso_pu_bacteria | 2844841374 | 2844843695 | 480 |
| 839 | iso_pu_bacteria | 2919055335 | 2919055698 | 480 |
| 840 | iso_pu_bacteria | 2919523602 | 2919525789 | 480 |
| 841 | iso_pu_bacteria | 2928153084 | 2928153837 | 480 |
| 842 | iso_pu_bacteria | 2935390628 | 2935390951 | 480 |
| 843 | iso_pu_bacteria | 8025413630 | 8025413662 | 480 |
| 844 | 3300006844 | Ga0075428_100000203 | Ga0075428_10000020356 | 481 |
| 845 | 3300031548 | Ga0307408_100181541 | Ga0307408_1001815411 | 481 |
| 846 | 3300031730 | Ga0307516_10031960 | Ga0307516_100319604 | 481 |
| 847 | 3300031995 | Ga0307409_100091232 | Ga0307409_1000912322 | 481 |
| 848 | 3300038443 | Ga0395901_0047917 | Ga0395901_0047917_2307_3857 | 481 |
| 849 | 3300046477 | Ga0495664_0046621 | Ga0495664_0046621_581_2068 | 481 |
| 850 | 3300053078 | Ga0495612_0051640 | Ga0495612_0051640_28_1515 | 481 |
| 851 | iso_pu_bacteria | 2547132111 | 2547412484 | 481 |
| 852 | iso_pu_bacteria | 2554235005 | 2554257360 | 481 |
| 853 | iso_pu_bacteria | 2582581313 | 2585310632 | 481 |
| 854 | iso_pu_bacteria | 2582581314 | 2585314398 | 481 |
| 855 | iso_pu_bacteria | 2616644814 | 2616700200 | 481 |
| 856 | iso_pu_bacteria | 2643221548 | 2643762984 | 481 |
| 857 | iso_pu_bacteria | 2643221578 | 2643899929 | 481 |
| 858 | iso_pu_bacteria | 2643221647 | 2644263027 | 481 |
| 859 | iso_pu_bacteria | 2643221673 | 2644405848 | 481 |
| 860 | iso_pu_bacteria | 2643221682 | 2644464158 | 481 |
| 861 | iso_pu_bacteria | 2784132148 | 2784588870 | 481 |
| 862 | iso_pu_bacteria | 2784746763 | 2785343017 | 481 |
| 863 | iso_pu_bacteria | 2784746768 | 2785369811 | 481 |
| 864 | iso_pu_bacteria | 2786546132 | 2786670900 | 481 |
| 865 | iso_pu_bacteria | 2808606375 | 2808920839 | 481 |
| 866 | iso_pu_bacteria | 2808606448 | 2809232483 | 481 |
| 867 | iso_pu_bacteria | 2811994879 | 2812357801 | 481 |
| 868 | iso_pu_bacteria | 2811994917 | 2812480273 | 481 |
| 869 | iso_pu_bacteria | 2818991463 | 2819697155 | 481 |
| 870 | iso_pu_bacteria | 2852635781 | 2852637073 | 481 |
| 871 | iso_pu_bacteria | 2855683550 | 2855685531 | 481 |
| 872 | iso_pu_bacteria | 2862178590 | 2862183397 | 481 |
| 873 | iso_pu_bacteria | 2862281513 | 2862285930 | 481 |
| 874 | iso_pu_bacteria | 2862290372 | 2862291256 | 481 |
| 875 | iso_pu_bacteria | 2862382967 | 2862388325 | 481 |
| 876 | iso_pu_bacteria | 2862507626 | 2862507986 | 481 |
| 877 | iso_pu_bacteria | 2862574272 | 2862578978 | 481 |
| 878 | iso_pu_bacteria | 2863404153 | 2863404281 | 481 |
| 879 | iso_pu_bacteria | 2867428634 | 2867436800 | 481 |
| 880 | iso_pu_bacteria | 2873151551 | 2873155466 | 481 |
| 881 | iso_pu_bacteria | 2877676314 | 2877680828 | 481 |
| 882 | iso_pu_bacteria | 2912715099 | 2912719639 | 481 |
| 883 | iso_pu_bacteria | 2912723979 | 2912731302 | 481 |
| 884 | iso_pu_bacteria | 2918501144 | 2918505310 | 481 |
| 885 | iso_pu_bacteria | 2919468124 | 2919472009 | 481 |
| 886 | iso_pu_bacteria | 2946045630 | 2946049718 | 481 |
| 887 | iso_pu_bacteria | 2946064051 | 2946068065 | 481 |
| 888 | iso_pu_bacteria | 2947224130 | 2947228888 | 481 |
| 889 | iso_pu_bacteria | 2954002825 | 2954006650 | 481 |
| 890 | iso_pu_bacteria | 2954380949 | 2954385927 | 481 |
| 891 | iso_pu_bacteria | 2954673503 | 2954677226 | 481 |
| 892 | iso_pu_bacteria | 2954682443 | 2954686929 | 481 |
| 893 | iso_pu_bacteria | 2954691527 | 2954696579 | 481 |
| 894 | iso_pu_bacteria | 2954701450 | 2954705645 | 481 |
| 895 | iso_pu_bacteria | 2954711539 | 2954715938 | 481 |
| 896 | iso_pu_bacteria | 2954721474 | 2954725877 | 481 |
| 897 | iso_pu_bacteria | 2954731030 | 2954735921 | 481 |
| 898 | iso_pu_bacteria | 2954740390 | 2954744815 | 481 |
| 899 | iso_pu_bacteria | 2954749733 | 2954754784 | 481 |
| 900 | iso_pu_bacteria | 2954759201 | 2954763800 | 481 |
| 901 | iso_pu_bacteria | 2990059506 | 2990065647 | 481 |
| 902 | iso_pu_bacteria | 3006493962 | 3006499262 | 481 |
| 903 | iso_pu_bacteria | 8008558824 | 8008566970 | 481 |
| 904 | iso_pu_bacteria | 8008574985 | 8008578643 | 481 |
| 905 | iso_pu_bacteria | 8048406513 | 8048412635 | 481 |
| 906 | iso_pu_bacteria | 8056829672 | 8056833396 | 481 |
| 907 | 3300005435 | Ga0070714_100000126 | Ga0070714_10000012621 | 482 |
| 908 | 3300025929 | Ga0207664_10000082 | Ga0207664_1000008259 | 482 |
| 909 | 3300044658 | Ga0466972_0039065 | Ga0466972_0039065_612_2060 | 482 |
| 910 | 3300044684 | Ga0466966_0018090 | Ga0466966_0018090_104_1552 | 482 |
| 911 | 3300044693 | Ga0466961_0012392 | Ga0466961_0012392_3227_4675 | 482 |
| 912 | 3300044765 | Ga0466970_0006080 | Ga0466970_0006080_3675_5123 | 482 |
| 913 | 3300044842 | Ga0466957_0030972 | Ga0466957_0030972_278_1726 | 482 |
| 914 | 3300045049 | Ga0466959_0003472 | Ga0466959_0003472_2850_4298 | 482 |
| 915 | 3300047315 | Ga0495581_0003525 | Ga0495581_0003525_5992_7563 | 482 |
| 916 | 3300048904 | Ga0496101_0111108 | Ga0496101_0111108_36_1505 | 482 |
| 917 | 3300048909 | Ga0496106_0052570 | Ga0496106_0052570_460_1929 | 482 |
| 918 | 3300048917 | Ga0496114_0002043 | Ga0496114_0002043_13892_15349 | 482 |
| 919 | 3300048922 | Ga0496119_0002640 | Ga0496119_0002640_17788_19245 | 482 |
| 920 | 3300048926 | Ga0496123_0026721 | Ga0496123_0026721_14_1471 | 482 |
| 921 | iso_pu_bacteria | 2643221616 | 2644097867 | 482 |
| 922 | iso_pu_bacteria | 2884763398 | 2884766868 | 482 |
| 923 | iso_pu_bacteria | 8001781756 | 8001789502 | 482 |
| 924 | 3300001979 | JGI24740J21852_10011444 | JGI24740J21852_100114442 | 483 |
| 925 | 3300001989 | JGI24739J22299_10014613 | JGI24739J22299_100146132 | 483 |
| 926 | 3300001989 | JGI24739J22299_10018783 | JGI24739J22299_100187832 | 483 |
| 927 | 3300001990 | JGI24737J22298_10004741 | JGI24737J22298_100047413 | 483 |
| 928 | 3300001990 | JGI24737J22298_10006559 | JGI24737J22298_100065593 | 483 |
| 929 | 3300002067 | JGI24735J21928_10017868 | JGI24735J21928_100178681 | 483 |
| 930 | 3300003578 | Ga0006562J51391_1058926 | Ga0006562J51391_10589265 | 483 |
| 931 | 3300003578 | Ga0006562J51391_1058927 | Ga0006562J51391_10589274 | 483 |
| 932 | 3300003752 | Ga0055539_1000019 | Ga0055539_1000019320 | 483 |
| 933 | 3300003756 | Ga0055533_1000023 | Ga0055533_10000235 | 483 |
| 934 | 3300003760 | Ga0055527_1000025 | Ga0055527_100002578 | 483 |
| 935 | 3300003762 | Ga0055542_1000048 | Ga0055542_100004878 | 483 |
| 936 | 3300003763 | Ga0055529_1000057 | Ga0055529_1000057103 | 483 |
| 937 | 3300003841 | Ga0055541_1003256 | Ga0055541_10032562 | 483 |
| 938 | 3300005539 | Ga0068853_100025071 | Ga0068853_1000250714 | 483 |
| 939 | 3300005543 | Ga0070672_100154411 | Ga0070672_1001544112 | 483 |
| 940 | 3300005937 | Ga0081455_10023343 | Ga0081455_100233432 | 483 |
| 941 | 3300005983 | Ga0081540_1010699 | Ga0081540_10106994 | 483 |
| 942 | 3300006038 | Ga0075365_10045154 | Ga0075365_100451542 | 483 |
| 943 | 3300006178 | Ga0075367_10015626 | Ga0075367_100156261 | 483 |
| 944 | 3300006353 | Ga0075370_10008168 | Ga0075370_100081682 | 483 |
| 945 | 3300006948 | Ga0099826_10058892 | Ga0099826_100588922 | 483 |
| 946 | 3300009553 | Ga0105249_10090233 | Ga0105249_100902332 | 483 |
| 947 | 3300011119 | Ga0105246_10001651 | Ga0105246_100016514 | 483 |
| 948 | 3300014497 | Ga0182008_10000766 | Ga0182008_1000076618 | 483 |
| 949 | 3300015262 | Ga0182007_10001033 | Ga0182007_100010332 | 483 |
| 950 | 3300015688 | Ga0183367_1008 | Ga0183367_1008421 | 483 |
| 951 | 3300020069 | Ga0197907_10311176 | Ga0197907_103111762 | 483 |
| 952 | 3300020081 | Ga0206354_10723847 | Ga0206354_107238471 | 483 |
| 953 | 3300020082 | Ga0206353_12064141 | Ga0206353_120641415 | 483 |
| 954 | 3300021388 | Ga0213875_10000723 | Ga0213875_100007236 | 483 |
| 955 | 3300025225 | Ga0209566_100031 | Ga0209566_1000315 | 483 |
| 956 | 3300025226 | Ga0209674_100001 | Ga0209674_1000012146 | 483 |
| 957 | 3300025228 | Ga0209672_100011 | Ga0209672_100011736 | 483 |
| 958 | 3300025229 | Ga0209147_100619 | Ga0209147_1006194 | 483 |
| 959 | 3300025230 | Ga0209563_100001 | Ga0209563_1000012146 | 483 |
| 960 | 3300025230 | Ga0209563_100251 | Ga0209563_10025114 | 483 |
| 961 | 3300025242 | Ga0209258_102077 | Ga0209258_1020774 | 483 |
| 962 | 3300025253 | Ga0209677_100001 | Ga0209677_1000012146 | 483 |
| 963 | 3300025253 | Ga0209677_101937 | Ga0209677_1019376 | 483 |
| 964 | 3300025254 | Ga0209148_1000023 | Ga0209148_1000023574 | 483 |
| 965 | 3300025272 | Ga0209455_1000023 | Ga0209455_1000023574 | 483 |
| 966 | 3300025302 | Ga0207426_1013677 | Ga0207426_10136772 | 483 |
| 967 | 3300028786 | Ga0307517_10043175 | Ga0307517_100431754 | 483 |
| 968 | 3300028794 | Ga0307515_10000596 | Ga0307515_100005963 | 483 |
| 969 | 3300028794 | Ga0307515_10022623 | Ga0307515_100226239 | 483 |
| 970 | 3300028794 | Ga0307515_10085100 | Ga0307515_100851003 | 483 |
| 971 | 3300030521 | Ga0307511_10000678 | Ga0307511_1000067814 | 483 |
| 972 | 3300031456 | Ga0307513_10040019 | Ga0307513_100400192 | 483 |
| 973 | 3300031649 | Ga0307514_10029291 | Ga0307514_100292912 | 483 |
| 974 | 3300031649 | Ga0307514_10079903 | Ga0307514_100799032 | 483 |
| 975 | 3300031995 | Ga0307409_100109826 | Ga0307409_1001098261 | 483 |
| 976 | 3300033179 | Ga0307507_10032404 | Ga0307507_100324043 | 483 |
| 977 | 3300033179 | Ga0307507_10041417 | Ga0307507_100414173 | 483 |
| 978 | 3300037312 | Ga0395899_0037345 | Ga0395899_0037345_794_2365 | 483 |
| 979 | 3300037466 | Ga0395898_0012933 | Ga0395898_0012933_2850_4379 | 483 |
| 980 | 3300037466 | Ga0395898_0020175 | Ga0395898_0020175_4268_5797 | 483 |
| 981 | 3300037471 | Ga0395905_0023340 | Ga0395905_0023340_114_1676 | 483 |
| 982 | 3300037853 | Ga0436364_0026322 | Ga0436364_0026322_18508_20076 | 483 |
| 983 | 3300038443 | Ga0395901_0117749 | Ga0395901_0117749_254_1816 | 483 |
| 984 | 3300038443 | Ga0395901_0260734 | Ga0395901_0260734_81_1652 | 483 |
| 985 | 3300039437 | Ga0436365_0064456 | Ga0436365_0064456_3871_5439 | 483 |
| 986 | 3300041404 | Ga0439436_0001616 | Ga0439436_0001616_4643_6169 | 483 |
| 987 | 3300041512 | Ga0451853_1798325 | Ga0451853_1798325_332_1861 | 483 |
| 988 | 3300041512 | Ga0451853_2403763 | Ga0451853_2403763_237_1766 | 483 |
| 989 | 3300042005 | Ga0439448_0002247 | Ga0439448_0002247_2626_4152 | 483 |
| 990 | 3300042007 | Ga0439449_0000357 | Ga0439449_0000357_4225_5751 | 483 |
| 991 | 3300042014 | Ga0439457_000476 | Ga0439457_000476_5398_6924 | 483 |
| 992 | 3300042015 | Ga0439462_0001374 | Ga0439462_0001374_1739_3268 | 483 |
| 993 | 3300042131 | Ga0450894_000050 | Ga0450894_000050_10975_12501 | 483 |
| 994 | 3300042134 | Ga0450898_000106 | Ga0450898_000106_531_2057 | 483 |
| 995 | 3300042138 | Ga0450903_000683 | Ga0450903_000683_2638_4164 | 483 |
| 996 | 3300042145 | Ga0450906_001211 | Ga0450906_001211_632_2158 | 483 |
| 997 | 3300044656 | Ga0466969_0021118 | Ga0466969_0021118_1434_2960 | 483 |
| 998 | 3300044658 | Ga0466972_0004069 | Ga0466972_0004069_5656_7185 | 483 |
| 999 | 3300044658 | Ga0466972_0005148 | Ga0466972_0005148_468_1997 | 483 |
| 1000 | 3300044658 | Ga0466972_0022424 | Ga0466972_0022424_464_2035 | 483 |
| 1001 | 3300044658 | Ga0466972_0023719 | Ga0466972_0023719_240_1766 | 483 |
| 1002 | 3300044684 | Ga0466966_0004948 | Ga0466966_0004948_1374_2903 | 483 |
| 1003 | 3300044684 | Ga0466966_0077943 | Ga0466966_0077943_23_1549 | 483 |
| 1004 | 3300044693 | Ga0466961_0022060 | Ga0466961_0022060_492_2021 | 483 |
| 1005 | 3300044693 | Ga0466961_0033106 | Ga0466961_0033106_989_2560 | 483 |
| 1006 | 3300044694 | Ga0466963_0000277 | Ga0466963_0000277_492_2021 | 483 |
| 1007 | 3300044706 | Ga0466964_0010248 | Ga0466964_0010248_991_2520 | 483 |
| 1008 | 3300044719 | Ga0466971_0002024 | Ga0466971_0002024_1281_2810 | 483 |
| 1009 | 3300044735 | Ga0466968_0012560 | Ga0466968_0012560_412_1938 | 483 |
| 1010 | 3300044765 | Ga0466970_0001383 | Ga0466970_0001383_5817_7346 | 483 |
| 1011 | 3300044765 | Ga0466970_0002516 | Ga0466970_0002516_3960_5546 | 483 |
| 1012 | 3300044765 | Ga0466970_0018686 | Ga0466970_0018686_1598_3169 | 483 |
| 1013 | 3300044765 | Ga0466970_0040679 | Ga0466970_0040679_391_1968 | 483 |
| 1014 | 3300044842 | Ga0466957_0000471 | Ga0466957_0000471_16003_17532 | 483 |
| 1015 | 3300044901 | Ga0466960_0008436 | Ga0466960_0008436_987_2516 | 483 |
| 1016 | 3300044901 | Ga0466960_0011368 | Ga0466960_0011368_747_2318 | 483 |
| 1017 | 3300044901 | Ga0466960_0052912 | Ga0466960_0052912_269_1840 | 483 |
| 1018 | 3300045049 | Ga0466959_0003956 | Ga0466959_0003956_6368_7897 | 483 |
| 1019 | 3300045049 | Ga0466959_0089206 | Ga0466959_0089206_609_2180 | 483 |
| 1020 | 3300045836 | Ga0466958_0014838 | Ga0466958_0014838_1949_3478 | 483 |
| 1021 | 3300045976 | Ga0466967_0043325 | Ga0466967_0043325_1234_2763 | 483 |
| 1022 | 3300046454 | Ga0495592_0042690 | Ga0495592_0042690_1203_2729 | 483 |
| 1023 | 3300046455 | Ga0495603_0007070 | Ga0495603_0007070_1610_3136 | 483 |
| 1024 | 3300046455 | Ga0495603_0046681 | Ga0495603_0046681_690_2216 | 483 |
| 1025 | 3300046455 | Ga0495603_0066075 | Ga0495603_0066075_105_1631 | 483 |
| 1026 | 3300046459 | Ga0495629_0022040 | Ga0495629_0022040_1545_3071 | 483 |
| 1027 | 3300046459 | Ga0495629_0043733 | Ga0495629_0043733_605_2131 | 483 |
| 1028 | 3300046459 | Ga0495629_0106228 | Ga0495629_0106228_172_1698 | 483 |
| 1029 | 3300046474 | Ga0495605_0001970 | Ga0495605_0001970_7994_9520 | 483 |
| 1030 | 3300046477 | Ga0495664_0026825 | Ga0495664_0026825_198_1724 | 483 |
| 1031 | 3300046492 | Ga0495585_0055572 | Ga0495585_0055572_407_1933 | 483 |
| 1032 | 3300046499 | Ga0495594_0000230 | Ga0495594_0000230_4798_6324 | 483 |
| 1033 | 3300046499 | Ga0495594_0049423 | Ga0495594_0049423_43_1569 | 483 |
| 1034 | 3300046499 | Ga0495594_0054321 | Ga0495594_0054321_627_2153 | 483 |
| 1035 | 3300046501 | Ga0495607_0023399 | Ga0495607_0023399_224_1750 | 483 |
| 1036 | 3300046506 | Ga0495583_0007209 | Ga0495583_0007209_4637_6163 | 483 |
| 1037 | 3300046512 | Ga0495610_0007745 | Ga0495610_0007745_1101_2627 | 483 |
| 1038 | 3300046513 | Ga0495616_0003636 | Ga0495616_0003636_4837_6363 | 483 |
| 1039 | 3300046520 | Ga0495637_0027517 | Ga0495637_0027517_35_1561 | 483 |
| 1040 | 3300046524 | Ga0495648_0043149 | Ga0495648_0043149_870_2396 | 483 |
| 1041 | 3300046530 | Ga0495654_0024623 | Ga0495654_0024623_426_1952 | 483 |
| 1042 | 3300046531 | Ga0495665_0015108 | Ga0495665_0015108_2493_4019 | 483 |
| 1043 | 3300046538 | Ga0495609_0009249 | Ga0495609_0009249_2119_3645 | 483 |
| 1044 | 3300046557 | Ga0495622_0062894 | Ga0495622_0062894_117_1643 | 483 |
| 1045 | 3300046558 | Ga0495633_0004238 | Ga0495633_0004238_561_2087 | 483 |
| 1046 | 3300046616 | Ga0495668_0007084 | Ga0495668_0007084_5181_6707 | 483 |
| 1047 | 3300046642 | Ga0495634_0003800 | Ga0495634_0003800_328_1854 | 483 |
| 1048 | 3300046648 | Ga0495611_0014929 | Ga0495611_0014929_224_1750 | 483 |
| 1049 | 3300046660 | Ga0495625_0008814 | Ga0495625_0008814_5545_7071 | 483 |
| 1050 | 3300046663 | Ga0495635_0000747 | Ga0495635_0000747_4747_6273 | 483 |
| 1051 | 3300046663 | Ga0495635_0014977 | Ga0495635_0014977_1604_3130 | 483 |
| 1052 | 3300046665 | Ga0495661_0015672 | Ga0495661_0015672_3441_4967 | 483 |
| 1053 | 3300046674 | Ga0495588_0007271 | Ga0495588_0007271_1930_3456 | 483 |
| 1054 | 3300046675 | Ga0495657_0008640 | Ga0495657_0008640_1580_3106 | 483 |
| 1055 | 3300046680 | Ga0495646_0025526 | Ga0495646_0025526_728_2254 | 483 |
| 1056 | 3300046683 | Ga0495658_0016490 | Ga0495658_0016490_1601_3127 | 483 |
| 1057 | 3300046689 | Ga0495613_0001355 | Ga0495613_0001355_15065_16591 | 483 |
| 1058 | 3300046689 | Ga0495613_0083708 | Ga0495613_0083708_68_1594 | 483 |
| 1059 | 3300046692 | Ga0495671_0015236 | Ga0495671_0015236_1158_2684 | 483 |
| 1060 | 3300046809 | Ga0495600_0016669 | Ga0495600_0016669_1618_3144 | 483 |
| 1061 | 3300046810 | Ga0495660_0027649 | Ga0495660_0027649_1459_2985 | 483 |
| 1062 | 3300047315 | Ga0495581_0019055 | Ga0495581_0019055_961_2487 | 483 |
| 1063 | 3300047317 | Ga0495604_0005136 | Ga0495604_0005136_4505_6031 | 483 |
| 1064 | 3300047318 | Ga0495636_0000786 | Ga0495636_0000786_1600_3126 | 483 |
| 1065 | 3300047319 | Ga0495674_0049337 | Ga0495674_0049337_547_2073 | 483 |
| 1066 | 3300047322 | Ga0495680_0005012 | Ga0495680_0005012_4621_6147 | 483 |
| 1067 | 3300047443 | Ga0495687_002577 | Ga0495687_002577_7301_8827 | 483 |
| 1068 | 3300047443 | Ga0495687_004667 | Ga0495687_004667_4436_5965 | 483 |
| 1069 | 3300047443 | Ga0495687_015685 | Ga0495687_015685_1428_2954 | 483 |
| 1070 | 3300047444 | Ga0495675_0028220 | Ga0495675_0028220_1149_2675 | 483 |
| 1071 | 3300047447 | Ga0495685_002450 | Ga0495685_002450_244_1770 | 483 |
| 1072 | 3300047447 | Ga0495685_006206 | Ga0495685_006206_1305_2831 | 483 |
| 1073 | 3300047447 | Ga0495685_031524 | Ga0495685_031524_51_1577 | 483 |
| 1074 | 3300047470 | Ga0495681_0000554 | Ga0495681_0000554_25805_27331 | 483 |
| 1075 | 3300047470 | Ga0495681_0012672 | Ga0495681_0012672_2079_3605 | 483 |
| 1076 | 3300047472 | Ga0495686_0037599 | Ga0495686_0037599_422_1948 | 483 |
| 1077 | 3300047673 | Ga0495593_0007108 | Ga0495593_0007108_1470_2996 | 483 |
| 1078 | 3300048089 | Ga0495614_0001950 | Ga0495614_0001950_5443_6969 | 483 |
| 1079 | 3300048089 | Ga0495614_0015275 | Ga0495614_0015275_1487_3013 | 483 |
| 1080 | 3300048091 | Ga0495626_0006153 | Ga0495626_0006153_511_2037 | 483 |
| 1081 | 3300048904 | Ga0496101_0030349 | Ga0496101_0030349_865_2451 | 483 |
| 1082 | 3300048907 | Ga0496104_0077221 | Ga0496104_0077221_263_1825 | 483 |
| 1083 | 3300048908 | Ga0496105_0130414 | Ga0496105_0130414_521_2047 | 483 |
| 1084 | 3300048912 | Ga0496109_0006669 | Ga0496109_0006669_4130_5656 | 483 |
| 1085 | 3300048917 | Ga0496114_0074553 | Ga0496114_0074553_1237_2823 | 483 |
| 1086 | 3300048917 | Ga0496114_0085423 | Ga0496114_0085423_442_2004 | 483 |
| 1087 | 3300048921 | Ga0496118_0005574 | Ga0496118_0005574_11222_12799 | 483 |
| 1088 | 3300048922 | Ga0496119_0076208 | Ga0496119_0076208_76_1662 | 483 |
| 1089 | 3300048924 | Ga0496121_0146522 | Ga0496121_0146522_76_1662 | 483 |
| 1090 | 3300049459 | Ga0495678_008909 | Ga0495678_008909_1126_2631 | 483 |
| 1091 | 3300049568 | Ga0501031_0046276 | Ga0501031_0046276_260_1786 | 483 |
| 1092 | 3300049569 | Ga0501032_0036228 | Ga0501032_0036228_1584_3110 | 483 |
| 1093 | 3300049569 | Ga0501032_0066955 | Ga0501032_0066955_267_1796 | 483 |
| 1094 | 3300049570 | Ga0501033_0010969 | Ga0501033_0010969_4390_5919 | 483 |
| 1095 | 3300049570 | Ga0501033_0140292 | Ga0501033_0140292_57_1583 | 483 |
| 1096 | 3300049571 | Ga0501034_0023061 | Ga0501034_0023061_3687_5216 | 483 |
| 1097 | 3300049574 | Ga0501038_0000303 | Ga0501038_0000303_9297_10826 | 483 |
| 1098 | 3300049574 | Ga0501038_0010214 | Ga0501038_0010214_4577_6103 | 483 |
| 1099 | 3300049578 | Ga0501042_0034233 | Ga0501042_0034233_992_2518 | 483 |
| 1100 | 3300049579 | Ga0501043_0007764 | Ga0501043_0007764_1064_2590 | 483 |
| 1101 | 3300049581 | Ga0501047_0014794 | Ga0501047_0014794_2120_3649 | 483 |
| 1102 | 3300049586 | Ga0501070_0000304 | Ga0501070_0000304_5821_7425 | 483 |
| 1103 | 3300049822 | Ga0501035_0060662 | Ga0501035_0060662_336_1922 | 483 |
| 1104 | 3300049822 | Ga0501035_0113287 | Ga0501035_0113287_62_1591 | 483 |
| 1105 | 3300049822 | Ga0501035_0138241 | Ga0501035_0138241_212_1741 | 483 |
| 1106 | 3300049823 | Ga0501044_0011879 | Ga0501044_0011879_3380_4909 | 483 |
| 1107 | 3300049823 | Ga0501044_0044148 | Ga0501044_0044148_1577_3106 | 483 |
| 1108 | 3300050494 | nmdc:mga06z11_15009_c1 | nmdc:mga06z11_15009_c1_352_1881 | 483 |
| 1109 | 3300050495 | nmdc:mga04h51_3331_c1 | nmdc:mga04h51_3331_c1_480_2009 | 483 |
| 1110 | 3300050496 | nmdc:mga07m45_15847_c1 | nmdc:mga07m45_15847_c1_356_1909 | 483 |
| 1111 | 3300053079 | Ga0500610_0011170 | Ga0500610_0011170_2334_3860 | 483 |
| 1112 | 3300053157 | Ga0500624_001618 | Ga0500624_001618_54_1580 | 483 |
| 1113 | 3300061719 | Ga0466962_0004115 | Ga0466962_0004115_4297_5826 | 483 |
| 1114 | iso_pu_bacteria | 2616644941 | 2616905286 | 483 |
| 1115 | iso_pu_bacteria | 2643221678 | 2644443242 | 483 |
| 1116 | iso_pu_bacteria | 2643221714 | 2644626946 | 483 |
| 1117 | iso_pu_bacteria | 2808606359 | 2808842315 | 483 |
| 1118 | iso_pu_bacteria | 2858902515 | 2858904711 | 483 |
| 1119 | iso_pu_bacteria | 2946072368 | 2946076168 | 483 |
| 1120 | iso_pu_bacteria | 8023623736 | 8023629439 | 483 |
| 1121 | 3300005937 | Ga0081455_10004439 | Ga0081455_1000443919 | 484 |
| 1122 | 3300049583 | Ga0501067_0073085 | Ga0501067_0073085_47_1564 | 484 |
| 1123 | iso_pu_bacteria | 2622736626 | 2623585996 | 484 |
| 1124 | iso_pu_bacteria | 2643221615 | 2644092983 | 484 |
| 1125 | iso_pu_bacteria | 2643221657 | 2644322596 | 484 |
| 1126 | iso_pu_bacteria | 2739367898 | 2740165904 | 484 |
| 1127 | iso_pu_bacteria | 2772190715 | 2772646805 | 484 |
| 1128 | iso_pu_bacteria | 2855386786 | 2855389582 | 484 |
| 1129 | iso_pu_bacteria | 2880495981 | 2880498057 | 484 |
| 1130 | iso_pu_bacteria | 2929219909 | 2929220093 | 484 |
| 1131 | iso_pu_bacteria | 2929226422 | 2929226620 | 484 |
| 1132 | iso_pu_bacteria | 8003830390 | 8003832865 | 484 |
| 1133 | iso_pu_bacteria | 8003870546 | 8003870687 | 484 |
| 1134 | iso_pu_bacteria | 8054609563 | 8054609710 | 484 |
| 1135 | 3300002772 | JGI25164J39214_1001833 | JGI25164J39214_10018333 | 485 |
| 1136 | 3300003214 | JGI25165J46597_1000107 | JGI25165J46597_1000107104 | 485 |
| 1137 | 3300005530 | Ga0070679_100003617 | Ga0070679_10000361712 | 485 |
| 1138 | 3300005535 | Ga0070684_100022248 | Ga0070684_1000222484 | 485 |
| 1139 | 3300005548 | Ga0070665_100001439 | Ga0070665_1000014399 | 485 |
| 1140 | 3300005577 | Ga0068857_100128672 | Ga0068857_1001286722 | 485 |
| 1141 | 3300005843 | Ga0068860_100036357 | Ga0068860_1000363572 | 485 |
| 1142 | 3300013307 | Ga0157372_10006674 | Ga0157372_100066749 | 485 |
| 1143 | 3300013308 | Ga0157375_10004579 | Ga0157375_100045797 | 485 |
| 1144 | 3300014968 | Ga0157379_10042614 | Ga0157379_100426143 | 485 |
| 1145 | 3300025231 | Ga0207427_100028 | Ga0207427_100028204 | 485 |
| 1146 | 3300025233 | Ga0209437_100581 | Ga0209437_10058117 | 485 |
| 1147 | 3300025261 | Ga0209233_1000001 | Ga0209233_1000001702 | 485 |
| 1148 | 3300025904 | Ga0207647_10031692 | Ga0207647_100316924 | 485 |
| 1149 | 3300025941 | Ga0207711_10018619 | Ga0207711_100186194 | 485 |
| 1150 | 3300025944 | Ga0207661_10121816 | Ga0207661_101218162 | 485 |
| 1151 | 3300028379 | Ga0268266_10000937 | Ga0268266_1000093724 | 485 |
| 1152 | 3300028381 | Ga0268264_10058926 | Ga0268264_100589263 | 485 |
| 1153 | 3300031691 | Ga0316579_10001001 | Ga0316579_100010018 | 485 |
| 1154 | 3300037312 | Ga0395899_0041209 | Ga0395899_0041209_1326_2909 | 485 |
| 1155 | 3300037418 | Ga0395900_0036187 | Ga0395900_0036187_3126_4709 | 485 |
| 1156 | 3300037471 | Ga0395905_0041867 | Ga0395905_0041867_907_2490 | 485 |
| 1157 | 3300038443 | Ga0395901_0158121 | Ga0395901_0158121_477_1985 | 485 |
| 1158 | 3300044901 | Ga0466960_0005920 | Ga0466960_0005920_1088_2650 | 485 |
| 1159 | 3300045976 | Ga0466967_0077492 | Ga0466967_0077492_288_1865 | 485 |
| 1160 | 3300048905 | Ga0496102_0012669 | Ga0496102_0012669_437_1975 | 485 |
| 1161 | 3300048912 | Ga0496109_0004707 | Ga0496109_0004707_8278_9816 | 485 |
| 1162 | 3300048913 | Ga0496110_0005768 | Ga0496110_0005768_4447_5985 | 485 |
| 1163 | 3300049578 | Ga0501042_0095302 | Ga0501042_0095302_542_2089 | 485 |
| 1164 | 3300049582 | Ga0501048_0106070 | Ga0501048_0106070_110_1657 | 485 |
| 1165 | iso_pu_bacteria | 2515154129 | 2515722647 | 485 |
| 1166 | iso_pu_bacteria | 2515154202 | 2516084724 | 485 |
| 1167 | iso_pu_bacteria | 2995463766 | 2995468990 | 485 |
| 1168 | 3300005985 | Ga0081539_10080860 | Ga0081539_100808601 | 486 |
| 1169 | 3300006038 | Ga0075365_10000552 | Ga0075365_100005524 | 486 |
| 1170 | 3300006048 | Ga0075363_100007170 | Ga0075363_1000071705 | 486 |
| 1171 | 3300006051 | Ga0075364_10014121 | Ga0075364_100141212 | 486 |
| 1172 | 3300006178 | Ga0075367_10027016 | Ga0075367_100270162 | 486 |
| 1173 | 3300006178 | Ga0075367_10033445 | Ga0075367_100334452 | 486 |
| 1174 | 3300014325 | Ga0163163_10250054 | Ga0163163_102500541 | 486 |
| 1175 | 3300026118 | Ga0207675_100153081 | Ga0207675_1001530812 | 486 |
| 1176 | 3300027866 | Ga0209813_10001694 | Ga0209813_100016942 | 486 |
| 1177 | 3300037312 | Ga0395899_0017915 | Ga0395899_0017915_914_2482 | 486 |
| 1178 | 3300037418 | Ga0395900_0227765 | Ga0395900_0227765_36_1604 | 486 |
| 1179 | 3300041452 | Ga0451793_1845951 | Ga0451793_1845951_611_2140 | 486 |
| 1180 | 3300041494 | Ga0451837_0514389 | Ga0451837_0514389_403_1932 | 486 |
| 1181 | 3300041496 | Ga0451839_0137481 | Ga0451839_0137481_1186_2715 | 486 |
| 1182 | 3300044684 | Ga0466966_0003595 | Ga0466966_0003595_4681_6231 | 486 |
| 1183 | 3300044693 | Ga0466961_0052076 | Ga0466961_0052076_404_1972 | 486 |
| 1184 | 3300044693 | Ga0466961_0089131 | Ga0466961_0089131_365_1909 | 486 |
| 1185 | 3300044694 | Ga0466963_0003366 | Ga0466963_0003366_4943_6493 | 486 |
| 1186 | 3300044694 | Ga0466963_0045188 | Ga0466963_0045188_21_1565 | 486 |
| 1187 | 3300044706 | Ga0466964_0002951 | Ga0466964_0002951_2973_4517 | 486 |
| 1188 | 3300044719 | Ga0466971_0017094 | Ga0466971_0017094_490_2040 | 486 |
| 1189 | 3300044735 | Ga0466968_0043542 | Ga0466968_0043542_295_1839 | 486 |
| 1190 | 3300044765 | Ga0466970_0019119 | Ga0466970_0019119_948_2516 | 486 |
| 1191 | 3300044842 | Ga0466957_0002105 | Ga0466957_0002105_6657_8207 | 486 |
| 1192 | 3300044842 | Ga0466957_0110635 | Ga0466957_0110635_24_1568 | 486 |
| 1193 | 3300044901 | Ga0466960_0007257 | Ga0466960_0007257_633_2177 | 486 |
| 1194 | 3300045049 | Ga0466959_0032390 | Ga0466959_0032390_1840_3408 | 486 |
| 1195 | 3300045836 | Ga0466958_0001073 | Ga0466958_0001073_10660_12210 | 486 |
| 1196 | 3300045836 | Ga0466958_0050742 | Ga0466958_0050742_884_2428 | 486 |
| 1197 | 3300045976 | Ga0466967_0087802 | Ga0466967_0087802_1226_2806 | 486 |
| 1198 | 3300048905 | Ga0496102_0082354 | Ga0496102_0082354_1316_2857 | 486 |
| 1199 | 3300048906 | Ga0496103_0033374 | Ga0496103_0033374_582_2123 | 486 |
| 1200 | 3300048909 | Ga0496106_0096005 | Ga0496106_0096005_258_1799 | 486 |
| 1201 | 3300048910 | Ga0496107_0108634 | Ga0496107_0108634_163_1704 | 486 |
| 1202 | 3300048912 | Ga0496109_0045044 | Ga0496109_0045044_1572_3113 | 486 |
| 1203 | 3300048913 | Ga0496110_0182982 | Ga0496110_0182982_81_1640 | 486 |
| 1204 | 3300048917 | Ga0496114_0040624 | Ga0496114_0040624_1261_2802 | 486 |
| 1205 | 3300048918 | Ga0496115_0033898 | Ga0496115_0033898_1354_2895 | 486 |
| 1206 | 3300048920 | Ga0496117_0040254 | Ga0496117_0040254_653_2143 | 486 |
| 1207 | 3300049571 | Ga0501034_0032114 | Ga0501034_0032114_2495_4036 | 486 |
| 1208 | 3300049583 | Ga0501067_0005717 | Ga0501067_0005717_1282_2823 | 486 |
| 1209 | 3300049588 | Ga0501072_0011058 | Ga0501072_0011058_4151_5692 | 486 |
| 1210 | 3300049589 | Ga0501073_0026557 | Ga0501073_0026557_1133_2674 | 486 |
| 1211 | 3300049590 | Ga0501074_0003908 | Ga0501074_0003908_7787_9328 | 486 |
| 1212 | 3300049593 | Ga0501077_0008288 | Ga0501077_0008288_1343_2884 | 486 |
| 1213 | 3300049742 | Ga0501080_0013264 | Ga0501080_0013264_3512_5053 | 486 |
| 1214 | 3300049744 | Ga0501083_0005510 | Ga0501083_0005510_6421_7962 | 486 |
| 1215 | 3300050492 | nmdc:mga0yw44_1056_c1 | nmdc:mga0yw44_1056_c1_3311_5014 | 486 |
| 1216 | 3300053104 | Ga0500556_0000883 | Ga0500556_0000883_5099_6643 | 486 |
| 1217 | 3300053117 | Ga0500593_001072 | Ga0500593_001072_5485_7029 | 486 |
| 1218 | 3300060353 | Ga0501082_0032214 | Ga0501082_0032214_1672_3213 | 486 |
| 1219 | iso_pu_bacteria | 2585428094 | 2587861606 | 486 |
| 1220 | iso_pu_bacteria | 2643221613 | 2644084233 | 486 |
| 1221 | iso_pu_bacteria | 2643221641 | 2644228409 | 486 |
| 1222 | iso_pu_bacteria | 2643221649 | 2644278161 | 486 |
| 1223 | iso_pu_bacteria | 2643221721 | 2644666501 | 486 |
| 1224 | iso_pu_bacteria | 2791355406 | 2793983499 | 486 |
| 1225 | iso_pu_bacteria | 2795385470 | 2795781104 | 486 |
| 1226 | iso_pu_bacteria | 2839986021 | 2839988503 | 486 |
| 1227 | iso_pu_bacteria | 2862705112 | 2862709023 | 486 |
| 1228 | iso_pu_bacteria | 2867475112 | 2867476096 | 486 |
| 1229 | iso_pu_bacteria | 2935890801 | 2935893415 | 486 |
| 1230 | iso_pu_bacteria | 2990044586 | 2990048999 | 486 |
| 1231 | iso_pu_bacteria | 2996221748 | 2996226068 | 486 |
| 1232 | iso_pu_bacteria | 3006425503 | 3006428337 | 486 |
| 1233 | iso_pu_bacteria | 8008485437 | 8008487040 | 486 |
| 1234 | iso_pu_bacteria | 8025524527 | 8025525199 | 486 |
| 1235 | iso_pu_bacteria | 8047893842 | 8047897309 | 486 |
| 1236 | iso_pu_bacteria | 8048127548 | 8048128222 | 486 |
| 1237 | iso_pu_bacteria | 8048356638 | 8048361634 | 486 |
| 1238 | iso_pu_bacteria | 8048369669 | 8048374297 | 486 |
| 1239 | iso_pu_bacteria | 8048379754 | 8048383926 | 486 |
| 1240 | 3300006051 | Ga0075364_10078862 | Ga0075364_100788622 | 487 |
| 1241 | 3300028573 | Ga0265334_10001828 | Ga0265334_100018284 | 487 |
| 1242 | 3300031649 | Ga0307514_10029464 | Ga0307514_100294641 | 487 |
| 1243 | 3300035695 | Ga0373927_0023872 | Ga0373927_0023872_2292_3806 | 487 |
| 1244 | 3300044656 | Ga0466969_0014647 | Ga0466969_0014647_1287_2864 | 487 |
| 1245 | 3300044684 | Ga0466966_0002752 | Ga0466966_0002752_3911_5488 | 487 |
| 1246 | 3300044684 | Ga0466966_0058042 | Ga0466966_0058042_494_2089 | 487 |
| 1247 | 3300045049 | Ga0466959_0061768 | Ga0466959_0061768_1136_2713 | 487 |
| 1248 | 3300046454 | Ga0495592_0009084 | Ga0495592_0009084_3716_5299 | 487 |
| 1249 | 3300046462 | Ga0495651_0012598 | Ga0495651_0012598_942_2525 | 487 |
| 1250 | 3300046463 | Ga0495653_0035517 | Ga0495653_0035517_186_1769 | 487 |
| 1251 | 3300046472 | Ga0495580_0015227 | Ga0495580_0015227_2179_3762 | 487 |
| 1252 | 3300046476 | Ga0495662_0000427 | Ga0495662_0000427_1773_3356 | 487 |
| 1253 | 3300046516 | Ga0495628_0006282 | Ga0495628_0006282_8028_9611 | 487 |
| 1254 | 3300046517 | Ga0495630_0010924 | Ga0495630_0010924_2554_4137 | 487 |
| 1255 | 3300046526 | Ga0495666_0000236 | Ga0495666_0000236_21019_22602 | 487 |
| 1256 | 3300046529 | Ga0495652_0019520 | Ga0495652_0019520_3019_4602 | 487 |
| 1257 | 3300046531 | Ga0495665_0001397 | Ga0495665_0001397_2244_3827 | 487 |
| 1258 | 3300046533 | Ga0495640_0009109 | Ga0495640_0009109_2322_3905 | 487 |
| 1259 | 3300046536 | Ga0495587_0030406 | Ga0495587_0030406_1154_2737 | 487 |
| 1260 | 3300046543 | Ga0495645_0031676 | Ga0495645_0031676_1550_3133 | 487 |
| 1261 | 3300046559 | Ga0495667_0009690 | Ga0495667_0009690_4001_5584 | 487 |
| 1262 | 3300046663 | Ga0495635_0016360 | Ga0495635_0016360_2164_3747 | 487 |
| 1263 | 3300046675 | Ga0495657_0004444 | Ga0495657_0004444_2523_4106 | 487 |
| 1264 | 3300046678 | Ga0495599_0027668 | Ga0495599_0027668_1377_2960 | 487 |
| 1265 | 3300046679 | Ga0495623_0006079 | Ga0495623_0006079_3844_5427 | 487 |
| 1266 | 3300046689 | Ga0495613_0073577 | Ga0495613_0073577_186_1769 | 487 |
| 1267 | 3300046809 | Ga0495600_0044267 | Ga0495600_0044267_601_2184 | 487 |
| 1268 | 3300047315 | Ga0495581_0003576 | Ga0495581_0003576_5294_6877 | 487 |
| 1269 | 3300047317 | Ga0495604_0003123 | Ga0495604_0003123_6945_8528 | 487 |
| 1270 | 3300047444 | Ga0495675_0010833 | Ga0495675_0010833_2883_4466 | 487 |
| 1271 | 3300047471 | Ga0495684_0021859 | Ga0495684_0021859_1910_3493 | 487 |
| 1272 | 3300047673 | Ga0495593_0023010 | Ga0495593_0023010_954_2537 | 487 |
| 1273 | 3300053080 | Ga0500635_0000075 | Ga0500635_0000075_13507_15090 | 487 |
| 1274 | 3300061719 | Ga0466962_0002734 | Ga0466962_0002734_963_2558 | 487 |
| 1275 | iso_pu_bacteria | 2867507094 | 2867510178 | 487 |
| 1276 | iso_pu_bacteria | 2887443736 | 2887447299 | 487 |
| 1277 | 3300005548 | Ga0070665_100022040 | Ga0070665_1000220402 | 488 |
| 1278 | 3300005618 | Ga0068864_100053011 | Ga0068864_1000530112 | 488 |
| 1279 | 3300005841 | Ga0068863_100009010 | Ga0068863_1000090104 | 488 |
| 1280 | 3300025302 | Ga0207426_1012267 | Ga0207426_10122672 | 488 |
| 1281 | 3300025928 | Ga0207700_10047047 | Ga0207700_100470473 | 488 |
| 1282 | 3300026121 | Ga0207683_10064171 | Ga0207683_100641714 | 488 |
| 1283 | 3300028379 | Ga0268266_10019587 | Ga0268266_100195874 | 488 |
| 1284 | 3300031616 | Ga0307508_10032770 | Ga0307508_100327704 | 488 |
| 1285 | 3300031824 | Ga0307413_10000162 | Ga0307413_1000016220 | 488 |
| 1286 | 3300044684 | Ga0466966_0002442 | Ga0466966_0002442_10504_12006 | 488 |
| 1287 | 3300046543 | Ga0495645_0046701 | Ga0495645_0046701_1005_2591 | 488 |
| 1288 | 3300047444 | Ga0495675_0021176 | Ga0495675_0021176_1562_3148 | 488 |
| 1289 | 3300048921 | Ga0496118_0057862 | Ga0496118_0057862_1120_2628 | 488 |
| 1290 | 3300048929 | Ga0496126_0016431 | Ga0496126_0016431_3993_5501 | 488 |
| 1291 | iso_pu_bacteria | 2997600082 | 2997604404 | 488 |
| 1292 | iso_pu_bacteria | 8054160619 | 8054162961 | 488 |
| 1293 | 3300003911 | JGI25405J52794_10008121 | JGI25405J52794_100081212 | 489 |
| 1294 | 3300005356 | Ga0070674_100083445 | Ga0070674_1000834452 | 489 |
| 1295 | 3300005438 | Ga0070701_10006381 | Ga0070701_100063812 | 489 |
| 1296 | 3300005440 | Ga0070705_100002793 | Ga0070705_1000027937 | 489 |
| 1297 | 3300005457 | Ga0070662_100014118 | Ga0070662_1000141183 | 489 |
| 1298 | 3300005539 | Ga0068853_100005838 | Ga0068853_1000058382 | 489 |
| 1299 | 3300005543 | Ga0070672_100100113 | Ga0070672_1001001132 | 489 |
| 1300 | 3300005544 | Ga0070686_100037792 | Ga0070686_1000377922 | 489 |
| 1301 | 3300005548 | Ga0070665_100108196 | Ga0070665_1001081962 | 489 |
| 1302 | 3300005564 | Ga0070664_100110472 | Ga0070664_1001104722 | 489 |
| 1303 | 3300005617 | Ga0068859_100127831 | Ga0068859_1001278312 | 489 |
| 1304 | 3300005618 | Ga0068864_100057253 | Ga0068864_1000572532 | 489 |
| 1305 | 3300005841 | Ga0068863_100054883 | Ga0068863_1000548833 | 489 |
| 1306 | 3300005937 | Ga0081455_10000290 | Ga0081455_1000029024 | 489 |
| 1307 | 3300005983 | Ga0081540_1056433 | Ga0081540_10564332 | 489 |
| 1308 | 3300005985 | Ga0081539_10011550 | Ga0081539_100115503 | 489 |
| 1309 | 3300006852 | Ga0075433_10012177 | Ga0075433_100121776 | 489 |
| 1310 | 3300006871 | Ga0075434_100032417 | Ga0075434_1000324173 | 489 |
| 1311 | 3300006931 | Ga0097620_100127828 | Ga0097620_1001278282 | 489 |
| 1312 | 3300007076 | Ga0075435_100015051 | Ga0075435_1000150512 | 489 |
| 1313 | 3300009101 | Ga0105247_10041004 | Ga0105247_100410042 | 489 |
| 1314 | 3300009553 | Ga0105249_10016677 | Ga0105249_100166772 | 489 |
| 1315 | 3300013105 | Ga0157369_10012786 | Ga0157369_100127862 | 489 |
| 1316 | 3300013296 | Ga0157374_10039291 | Ga0157374_100392914 | 489 |
| 1317 | 3300013308 | Ga0157375_10053546 | Ga0157375_100535462 | 489 |
| 1318 | 3300014326 | Ga0157380_10054693 | Ga0157380_100546933 | 489 |
| 1319 | 3300025901 | Ga0207688_10009599 | Ga0207688_100095992 | 489 |
| 1320 | 3300025915 | Ga0207693_10014795 | Ga0207693_100147954 | 489 |
| 1321 | 3300025916 | Ga0207663_10001527 | Ga0207663_100015277 | 489 |
| 1322 | 3300025933 | Ga0207706_10007345 | Ga0207706_100073458 | 489 |
| 1323 | 3300025935 | Ga0207709_10011590 | Ga0207709_100115902 | 489 |
| 1324 | 3300025940 | Ga0207691_10077702 | Ga0207691_100777022 | 489 |
| 1325 | 3300025949 | Ga0207667_10072320 | Ga0207667_100723204 | 489 |
| 1326 | 3300026067 | Ga0207678_10003353 | Ga0207678_100033539 | 489 |
| 1327 | 3300026075 | Ga0207708_10022689 | Ga0207708_100226894 | 489 |
| 1328 | 3300026088 | Ga0207641_10004316 | Ga0207641_100043166 | 489 |
| 1329 | 3300028379 | Ga0268266_10048502 | Ga0268266_100485023 | 489 |
| 1330 | 3300035088 | Ga0373940_0002605 | Ga0373940_0002605_721_2241 | 489 |
| 1331 | 3300035090 | Ga0373949_0005799 | Ga0373949_0005799_403_1923 | 489 |
| 1332 | 3300035091 | Ga0373951_0000009 | Ga0373951_0000009_55708_57294 | 489 |
| 1333 | 3300035112 | Ga0373932_0004489 | Ga0373932_0004489_858_2378 | 489 |
| 1334 | 3300035115 | Ga0373941_0007526 | Ga0373941_0007526_57_1577 | 489 |
| 1335 | 3300035121 | Ga0373960_0002465 | Ga0373960_0002465_2473_3993 | 489 |
| 1336 | 3300044658 | Ga0466972_0011660 | Ga0466972_0011660_1338_2930 | 489 |
| 1337 | 3300044658 | Ga0466972_0037778 | Ga0466972_0037778_501_2069 | 489 |
| 1338 | 3300044683 | Ga0466965_0002025 | Ga0466965_0002025_4659_6251 | 489 |
| 1339 | 3300044684 | Ga0466966_0057069 | Ga0466966_0057069_588_2126 | 489 |
| 1340 | 3300044693 | Ga0466961_0014592 | Ga0466961_0014592_2238_3806 | 489 |
| 1341 | 3300044694 | Ga0466963_0037685 | Ga0466963_0037685_91_1659 | 489 |
| 1342 | 3300044719 | Ga0466971_0019147 | Ga0466971_0019147_1184_2752 | 489 |
| 1343 | 3300044765 | Ga0466970_0021255 | Ga0466970_0021255_117_1709 | 489 |
| 1344 | 3300044765 | Ga0466970_0024087 | Ga0466970_0024087_1212_2780 | 489 |
| 1345 | 3300045836 | Ga0466958_0015631 | Ga0466958_0015631_1224_2792 | 489 |
| 1346 | 3300045976 | Ga0466967_0254873 | Ga0466967_0254873_90_1643 | 489 |
| 1347 | 3300048903 | Ga0496100_0001709 | Ga0496100_0001709_7291_8874 | 489 |
| 1348 | 3300048904 | Ga0496101_0022875 | Ga0496101_0022875_2516_4036 | 489 |
| 1349 | 3300048905 | Ga0496102_0000187 | Ga0496102_0000187_6275_7870 | 489 |
| 1350 | 3300048905 | Ga0496102_0026240 | Ga0496102_0026240_2666_4180 | 489 |
| 1351 | 3300048905 | Ga0496102_0144725 | Ga0496102_0144725_42_1541 | 489 |
| 1352 | 3300048906 | Ga0496103_0000126 | Ga0496103_0000126_74422_76017 | 489 |
| 1353 | 3300048906 | Ga0496103_0087885 | Ga0496103_0087885_315_1829 | 489 |
| 1354 | 3300048907 | Ga0496104_0012856 | Ga0496104_0012856_86_1606 | 489 |
| 1355 | 3300048908 | Ga0496105_0003893 | Ga0496105_0003893_2352_3866 | 489 |
| 1356 | 3300048908 | Ga0496105_0004853 | Ga0496105_0004853_2445_3965 | 489 |
| 1357 | 3300048908 | Ga0496105_0007560 | Ga0496105_0007560_2962_4560 | 489 |
| 1358 | 3300048910 | Ga0496107_0005833 | Ga0496107_0005833_6527_8047 | 489 |
| 1359 | 3300048911 | Ga0496108_0000812 | Ga0496108_0000812_1864_3378 | 489 |
| 1360 | 3300048911 | Ga0496108_0038094 | Ga0496108_0038094_1354_2874 | 489 |
| 1361 | 3300048911 | Ga0496108_0108561 | Ga0496108_0108561_675_2189 | 489 |
| 1362 | 3300048912 | Ga0496109_0003973 | Ga0496109_0003973_796_2310 | 489 |
| 1363 | 3300048912 | Ga0496109_0182559 | Ga0496109_0182559_85_1680 | 489 |
| 1364 | 3300048913 | Ga0496110_0046606 | Ga0496110_0046606_249_1832 | 489 |
| 1365 | 3300048913 | Ga0496110_0048014 | Ga0496110_0048014_1307_2827 | 489 |
| 1366 | 3300048913 | Ga0496110_0075463 | Ga0496110_0075463_383_1897 | 489 |
| 1367 | 3300048914 | Ga0496111_0000028 | Ga0496111_0000028_39794_41308 | 489 |
| 1368 | 3300048916 | Ga0496113_0008778 | Ga0496113_0008778_3835_5355 | 489 |
| 1369 | 3300048916 | Ga0496113_0031697 | Ga0496113_0031697_1278_2792 | 489 |
| 1370 | 3300048917 | Ga0496114_0008776 | Ga0496114_0008776_2637_4151 | 489 |
| 1371 | 3300048919 | Ga0496116_0000306 | Ga0496116_0000306_74480_76075 | 489 |
| 1372 | 3300048920 | Ga0496117_0000343 | Ga0496117_0000343_74285_75880 | 489 |
| 1373 | 3300048921 | Ga0496118_0000192 | Ga0496118_0000192_31744_33339 | 489 |
| 1374 | 3300048921 | Ga0496118_0000272 | Ga0496118_0000272_47890_49389 | 489 |
| 1375 | 3300048922 | Ga0496119_0000764 | Ga0496119_0000764_39952_41550 | 489 |
| 1376 | 3300048923 | Ga0496120_0003415 | Ga0496120_0003415_1736_3334 | 489 |
| 1377 | 3300048924 | Ga0496121_0002290 | Ga0496121_0002290_25534_27117 | 489 |
| 1378 | 3300048929 | Ga0496126_0000433 | Ga0496126_0000433_76151_77746 | 489 |
| 1379 | 3300048929 | Ga0496126_0043333 | Ga0496126_0043333_857_2362 | 489 |
| 1380 | 3300050515 | nmdc:mga0a205_44535_c1 | nmdc:mga0a205_44535_c1_1453_2973 | 489 |
| 1381 | 3300053088 | Ga0500644_0005211 | Ga0500644_0005211_1127_2716 | 489 |
| 1382 | 3300053131 | Ga0500652_025994 | Ga0500652_025994_556_2145 | 489 |
| 1383 | 3300053159 | Ga0500630_040150 | Ga0500630_040150_269_1858 | 489 |
| 1384 | 3300001991 | JGI24743J22301_10001116 | JGI24743J22301_100011162 | 490 |
| 1385 | 3300005329 | Ga0070683_100195291 | Ga0070683_1001952911 | 490 |
| 1386 | 3300005355 | Ga0070671_100000175 | Ga0070671_10000017522 | 490 |
| 1387 | 3300005355 | Ga0070671_100016400 | Ga0070671_1000164001 | 490 |
| 1388 | 3300005356 | Ga0070674_100064986 | Ga0070674_1000649863 | 490 |
| 1389 | 3300005367 | Ga0070667_100035109 | Ga0070667_1000351094 | 490 |
| 1390 | 3300005548 | Ga0070665_100003390 | Ga0070665_1000033902 | 490 |
| 1391 | 3300005548 | Ga0070665_100004418 | Ga0070665_1000044183 | 490 |
| 1392 | 3300005841 | Ga0068863_100001135 | Ga0068863_10000113510 | 490 |
| 1393 | 3300005843 | Ga0068860_100000261 | Ga0068860_10000026159 | 490 |
| 1394 | 3300005843 | Ga0068860_100002620 | Ga0068860_10000262021 | 490 |
| 1395 | 3300025903 | Ga0207680_10041780 | Ga0207680_100417802 | 490 |
| 1396 | 3300025931 | Ga0207644_10000564 | Ga0207644_1000056415 | 490 |
| 1397 | 3300025931 | Ga0207644_10058466 | Ga0207644_100584662 | 490 |
| 1398 | 3300025937 | Ga0207669_10032739 | Ga0207669_100327393 | 490 |
| 1399 | 3300025972 | Ga0207668_10060365 | Ga0207668_100603652 | 490 |
| 1400 | 3300025986 | Ga0207658_10024654 | Ga0207658_100246542 | 490 |
| 1401 | 3300026035 | Ga0207703_10084282 | Ga0207703_100842822 | 490 |
| 1402 | 3300026088 | Ga0207641_10002103 | Ga0207641_100021036 | 490 |
| 1403 | 3300028379 | Ga0268266_10003055 | Ga0268266_100030552 | 490 |
| 1404 | 3300028379 | Ga0268266_10004718 | Ga0268266_1000471811 | 490 |
| 1405 | 3300028381 | Ga0268264_10000315 | Ga0268264_1000031560 | 490 |
| 1406 | iso_pu_bacteria | 2784132109 | 2784473137 | 490 |
| 1407 | iso_pu_bacteria | 2791354901 | 2791917294 | 490 |
| 1408 | iso_pu_bacteria | 2811994882 | 2812373105 | 490 |
| 1409 | iso_pu_bacteria | 2818991318 | 2819425886 | 490 |
| 1410 | iso_pu_bacteria | 2818991458 | 2819664968 | 490 |
| 1411 | iso_pu_bacteria | 2818991462 | 2819689376 | 490 |
| 1412 | iso_pu_bacteria | 2818991469 | 2819727087 | 490 |
| 1413 | iso_pu_bacteria | 8054472261 | 8054479066 | 490 |
| 1414 | 3300003203 | JGI25406J46586_10018706 | JGI25406J46586_100187062 | 491 |
| 1415 | 3300005288 | Ga0065714_10072535 | Ga0065714_100725352 | 491 |
| 1416 | 3300005327 | Ga0070658_10018256 | Ga0070658_100182562 | 491 |
| 1417 | 3300005347 | Ga0070668_100003761 | Ga0070668_1000037616 | 491 |
| 1418 | 3300005985 | Ga0081539_10008770 | Ga0081539_100087703 | 491 |
| 1419 | 3300005985 | Ga0081539_10015464 | Ga0081539_100154642 | 491 |
| 1420 | 3300009098 | Ga0105245_10009833 | Ga0105245_100098335 | 491 |
| 1421 | 3300020082 | Ga0206353_10371772 | Ga0206353_103717725 | 491 |
| 1422 | 3300020082 | Ga0206353_11970105 | Ga0206353_119701053 | 491 |
| 1423 | 3300025927 | Ga0207687_10099407 | Ga0207687_100994072 | 491 |
| 1424 | 3300025972 | Ga0207668_10006881 | Ga0207668_100068814 | 491 |
| 1425 | 3300026142 | Ga0207698_10039588 | Ga0207698_100395883 | 491 |
| 1426 | 3300031548 | Ga0307408_100161678 | Ga0307408_1001616782 | 491 |
| 1427 | 3300031911 | Ga0307412_10062426 | Ga0307412_100624263 | 491 |
| 1428 | 3300033179 | Ga0307507_10020073 | Ga0307507_100200735 | 491 |
| 1429 | 3300033180 | Ga0307510_10019664 | Ga0307510_100196647 | 491 |
| 1430 | 3300045976 | Ga0466967_0001526 | Ga0466967_0001526_10734_12350 | 491 |
| 1431 | 3300048908 | Ga0496105_0049849 | Ga0496105_0049849_729_2339 | 491 |
| 1432 | 3300048912 | Ga0496109_0028903 | Ga0496109_0028903_2488_4023 | 491 |
| 1433 | 3300048918 | Ga0496115_0033275 | Ga0496115_0033275_1386_2996 | 491 |
| 1434 | 3300053085 | Ga0495619_0047871 | Ga0495619_0047871_715_2277 | 491 |
| 1435 | iso_pu_bacteria | 2582580736 | 2583152130 | 491 |
| 1436 | iso_pu_bacteria | 2622736605 | 2623497905 | 491 |
| 1437 | iso_pu_bacteria | 2643221690 | 2644502508 | 491 |
| 1438 | iso_pu_bacteria | 2643221694 | 2644524901 | 491 |
| 1439 | iso_pu_bacteria | 2643221722 | 2644668987 | 491 |
| 1440 | iso_pu_bacteria | 2738541272 | 2738696957 | 491 |
| 1441 | iso_pu_bacteria | 2738543027 | 2739324133 | 491 |
| 1442 | iso_pu_bacteria | 2758568522 | 2760305120 | 491 |
| 1443 | iso_pu_bacteria | 2758568621 | 2760621072 | 491 |
| 1444 | iso_pu_bacteria | 2808606394 | 2809025862 | 491 |
| 1445 | iso_pu_bacteria | 2811994880 | 2812364030 | 491 |
| 1446 | iso_pu_bacteria | 2835188231 | 2835191729 | 491 |
| 1447 | iso_pu_bacteria | 2866612099 | 2866616307 | 491 |
| 1448 | iso_pu_bacteria | 2884994152 | 2884998179 | 491 |
| 1449 | iso_pu_bacteria | 2899359706 | 2899369158 | 491 |
| 1450 | iso_pu_bacteria | 2932431166 | 2932431295 | 491 |
| 1451 | iso_pu_bacteria | 3001889506 | 3001890225 | 491 |
| 1452 | iso_pu_bacteria | 8003314358 | 8003315079 | 491 |
| 1453 | iso_pu_bacteria | 8056579771 | 8056580041 | 491 |
| 1454 | 3300005347 | Ga0070668_100004067 | Ga0070668_1000040675 | 492 |
| 1455 | 3300005564 | Ga0070664_100022615 | Ga0070664_1000226154 | 492 |
| 1456 | 3300006847 | Ga0075431_100023915 | Ga0075431_1000239155 | 492 |
| 1457 | 3300025944 | Ga0207661_10008291 | Ga0207661_100082915 | 492 |
| 1458 | 3300025945 | Ga0207679_10015063 | Ga0207679_100150633 | 492 |
| 1459 | 3300026116 | Ga0207674_10035199 | Ga0207674_100351993 | 492 |
| 1460 | 3300028794 | Ga0307515_10061782 | Ga0307515_100617823 | 492 |
| 1461 | 3300031730 | Ga0307516_10021393 | Ga0307516_100213934 | 492 |
| 1462 | 3300037418 | Ga0395900_0067014 | Ga0395900_0067014_1053_2609 | 492 |
| 1463 | 3300050510 | nmdc:mga06r32_1952_c2 | nmdc:mga06r32_1952_c2_6181_7713 | 492 |
| 1464 | 3300053131 | Ga0500652_001141 | Ga0500652_001141_4606_6105 | 492 |
| 1465 | iso_pu_bacteria | 2643221561 | 2643827221 | 492 |
| 1466 | iso_pu_bacteria | 2643221696 | 2644533952 | 492 |
| 1467 | iso_pu_bacteria | 8047710418 | 8047716275 | 492 |
| 1468 | 3300010375 | Ga0105239_10098373 | Ga0105239_100983732 | 493 |
| 1469 | 3300026067 | Ga0207678_10129254 | Ga0207678_101292542 | 493 |
| 1470 | 3300031456 | Ga0307513_10006778 | Ga0307513_100067783 | 493 |
| 1471 | 3300031665 | Ga0316575_10011016 | Ga0316575_100110161 | 493 |
| 1472 | 3300031691 | Ga0316579_10006084 | Ga0316579_100060845 | 493 |
| 1473 | 3300031727 | Ga0316576_10005277 | Ga0316576_100052777 | 493 |
| 1474 | 3300031727 | Ga0316576_10029031 | Ga0316576_100290312 | 493 |
| 1475 | 3300031728 | Ga0316578_10011617 | Ga0316578_100116174 | 493 |
| 1476 | 3300031911 | Ga0307412_10020923 | Ga0307412_100209232 | 493 |
| 1477 | 3300032133 | Ga0316583_10014076 | Ga0316583_100140762 | 493 |
| 1478 | 3300035242 | Ga0373962_0001917 | Ga0373962_0001917_1684_3243 | 493 |
| 1479 | 3300035398 | Ga0316574_0035536 | Ga0316574_0035536_771_2384 | 493 |
| 1480 | 3300035692 | Ga0373935_0025341 | Ga0373935_0025341_1912_3492 | 493 |
| 1481 | 3300036647 | Ga0316582_0006156 | Ga0316582_0006156_3922_5535 | 493 |
| 1482 | 3300036647 | Ga0316582_0023811 | Ga0316582_0023811_260_1873 | 493 |
| 1483 | 3300036712 | Ga0316584_0014503 | Ga0316584_0014503_964_2577 | 493 |
| 1484 | 3300036712 | Ga0316584_0058453 | Ga0316584_0058453_623_2236 | 493 |
| 1485 | 3300046684 | Ga0495669_0015550 | Ga0495669_0015550_191_1738 | 493 |
| 1486 | 3300048908 | Ga0496105_0073860 | Ga0496105_0073860_688_2313 | 493 |
| 1487 | 3300048917 | Ga0496114_0039075 | Ga0496114_0039075_1077_2702 | 493 |
| 1488 | iso_pu_bacteria | 2643221711 | 2644607897 | 493 |
| 1489 | iso_pu_bacteria | 2751185782 | 2753267192 | 493 |
| 1490 | 3300003285 | Ga0007423J48922_100181 | Ga0007423J48922_1001815 | 494 |
| 1491 | 3300005615 | Ga0070702_100004590 | Ga0070702_1000045906 | 494 |
| 1492 | 3300006881 | Ga0068865_100057694 | Ga0068865_1000576942 | 494 |
| 1493 | 3300025934 | Ga0207686_10037575 | Ga0207686_100375752 | 494 |
| 1494 | 3300030733 | Ga0314311_1022273 | Ga0314311_10222731 | 494 |
| 1495 | 3300030734 | Ga0316179_1002615 | Ga0316179_10026152 | 494 |
| 1496 | 3300044658 | Ga0466972_0005236 | Ga0466972_0005236_4642_6243 | 494 |
| 1497 | 3300044719 | Ga0466971_0007929 | Ga0466971_0007929_1626_3188 | 494 |
| 1498 | 3300045976 | Ga0466967_0008914 | Ga0466967_0008914_1177_2766 | 494 |
| 1499 | 3300048908 | Ga0496105_0073288 | Ga0496105_0073288_913_2484 | 494 |
| 1500 | 3300048921 | Ga0496118_0043314 | Ga0496118_0043314_360_1907 | 494 |
| 1501 | 3300048922 | Ga0496119_0046259 | Ga0496119_0046259_979_2526 | 494 |
| 1502 | 3300048925 | Ga0496122_0001030 | Ga0496122_0001030_21302_22849 | 494 |
| 1503 | 3300048928 | Ga0496125_0000066 | Ga0496125_0000066_87364_88911 | 494 |
| 1504 | 3300049569 | Ga0501032_0010112 | Ga0501032_0010112_1129_2679 | 494 |
| 1505 | 3300049580 | Ga0501046_0005803 | Ga0501046_0005803_2254_3804 | 494 |
| 1506 | 3300049581 | Ga0501047_0024666 | Ga0501047_0024666_1103_2653 | 494 |
| 1507 | 3300049586 | Ga0501070_0063145 | Ga0501070_0063145_348_1898 | 494 |
| 1508 | 3300049744 | Ga0501083_0003749 | Ga0501083_0003749_5104_6654 | 494 |
| 1509 | 3300049822 | Ga0501035_0005582 | Ga0501035_0005582_6341_7891 | 494 |
| 1510 | 3300049823 | Ga0501044_0015546 | Ga0501044_0015546_5628_7178 | 494 |
| 1511 | 3300054114 | Ga0501084_0036552 | Ga0501084_0036552_2070_3620 | 494 |
| 1512 | iso_pu_bacteria | 2795385472 | 2795793955 | 494 |
| 1513 | iso_pu_bacteria | 2917736166 | 2917744005 | 494 |
| 1514 | iso_pu_bacteria | 2956939328 | 2956942098 | 494 |
| 1515 | iso_pu_bacteria | 3001119090 | 3001119448 | 494 |
| 1516 | iso_pu_bacteria | 8056207758 | 8056214036 | 494 |
| 1517 | 3300025937 | Ga0207669_10106313 | Ga0207669_101063132 | 495 |
| 1518 | 3300026067 | Ga0207678_10062387 | Ga0207678_100623872 | 495 |
| 1519 | 3300041453 | Ga0451797_0041771 | Ga0451797_0041771_66_1643 | 495 |
| 1520 | 3300050511 | nmdc:mga08y16_82680_c1 | nmdc:mga08y16_82680_c1_1085_2629 | 495 |
| 1521 | 3300005548 | Ga0070665_100164564 | Ga0070665_1001645642 | 496 |
| 1522 | 3300005842 | Ga0068858_100010474 | Ga0068858_1000104744 | 496 |
| 1523 | 3300005983 | Ga0081540_1010259 | Ga0081540_10102593 | 496 |
| 1524 | 3300005985 | Ga0081539_10001780 | Ga0081539_100017805 | 496 |
| 1525 | 3300025986 | Ga0207658_10041620 | Ga0207658_100416203 | 496 |
| 1526 | 3300026035 | Ga0207703_10020636 | Ga0207703_100206363 | 496 |
| 1527 | 3300028381 | Ga0268264_10051850 | Ga0268264_100518503 | 496 |
| 1528 | 3300031507 | Ga0307509_10027386 | Ga0307509_100273864 | 496 |
| 1529 | 3300031903 | Ga0307407_10113467 | Ga0307407_101134671 | 496 |
| 1530 | 3300031911 | Ga0307412_10028201 | Ga0307412_100282012 | 496 |
| 1531 | 3300031995 | Ga0307409_100105187 | Ga0307409_1001051872 | 496 |
| 1532 | 3300032126 | Ga0307415_100089708 | Ga0307415_1000897082 | 496 |
| 1533 | 3300033179 | Ga0307507_10014930 | Ga0307507_100149306 | 496 |
| 1534 | 3300049569 | Ga0501032_0095270 | Ga0501032_0095270_60_1595 | 496 |
| 1535 | 3300049570 | Ga0501033_0010271 | Ga0501033_0010271_2926_4461 | 496 |
| 1536 | 3300049571 | Ga0501034_0083609 | Ga0501034_0083609_649_2184 | 496 |
| 1537 | 3300049581 | Ga0501047_0021848 | Ga0501047_0021848_259_1794 | 496 |
| 1538 | 3300049822 | Ga0501035_0000886 | Ga0501035_0000886_17374_18909 | 496 |
| 1539 | 3300049823 | Ga0501044_0000313 | Ga0501044_0000313_2752_4287 | 496 |
| 1540 | iso_pu_bacteria | 2744054611 | 2744955201 | 496 |
| 1541 | iso_pu_bacteria | 2866552031 | 2866555853 | 496 |
| 1542 | 3300005435 | Ga0070714_100013034 | Ga0070714_1000130343 | 497 |
| 1543 | 3300005435 | Ga0070714_100071252 | Ga0070714_1000712522 | 497 |
| 1544 | 3300025898 | Ga0207692_10052702 | Ga0207692_100527022 | 497 |
| 1545 | 3300025901 | Ga0207688_10010060 | Ga0207688_100100602 | 497 |
| 1546 | 3300025929 | Ga0207664_10014402 | Ga0207664_100144024 | 497 |
| 1547 | 3300025929 | Ga0207664_10059043 | Ga0207664_100590433 | 497 |
| 1548 | 3300039437 | Ga0436365_0671847 | Ga0436365_0671847_11620_13146 | 497 |
| 1549 | 3300044694 | Ga0466963_0010205 | Ga0466963_0010205_405_1958 | 497 |
| 1550 | 3300044694 | Ga0466963_0038588 | Ga0466963_0038588_120_1646 | 497 |
| 1551 | 3300044719 | Ga0466971_0026675 | Ga0466971_0026675_169_1704 | 497 |
| 1552 | 3300044901 | Ga0466960_0000683 | Ga0466960_0000683_9366_10892 | 497 |
| 1553 | 3300045976 | Ga0466967_0026462 | Ga0466967_0026462_1008_2534 | 497 |
| 1554 | 3300048929 | Ga0496126_0001476 | Ga0496126_0001476_21358_22884 | 497 |
| 1555 | 3300049570 | Ga0501033_0022188 | Ga0501033_0022188_2170_3696 | 497 |
| 1556 | 3300049571 | Ga0501034_0004377 | Ga0501034_0004377_7855_9381 | 497 |
| 1557 | 3300049579 | Ga0501043_0037155 | Ga0501043_0037155_1577_3103 | 497 |
| 1558 | 3300049580 | Ga0501046_0000769 | Ga0501046_0000769_21127_22653 | 497 |
| 1559 | 3300049581 | Ga0501047_0012990 | Ga0501047_0012990_4053_5579 | 497 |
| 1560 | 3300049582 | Ga0501048_0023521 | Ga0501048_0023521_249_1775 | 497 |
| 1561 | 3300049586 | Ga0501070_0000985 | Ga0501070_0000985_12706_14232 | 497 |
| 1562 | 3300021384 | Ga0213876_10066972 | Ga0213876_100669721 | 498 |
| 1563 | 3300031251 | Ga0265327_10000131 | Ga0265327_10000131115 | 498 |
| 1564 | 3300039437 | Ga0436365_1833781 | Ga0436365_1833781_28485_30035 | 498 |
| 1565 | 3300049578 | Ga0501042_0098897 | Ga0501042_0098897_221_1843 | 498 |
| 1566 | 3300005355 | Ga0070671_100000693 | Ga0070671_10000069316 | 499 |
| 1567 | 3300005367 | Ga0070667_100010135 | Ga0070667_1000101354 | 499 |
| 1568 | 3300006048 | Ga0075363_100022474 | Ga0075363_1000224742 | 499 |
| 1569 | 3300006051 | Ga0075364_10000830 | Ga0075364_1000083015 | 499 |
| 1570 | 3300006186 | Ga0075369_10000684 | Ga0075369_100006846 | 499 |
| 1571 | 3300006844 | Ga0075428_100047731 | Ga0075428_1000477313 | 499 |
| 1572 | 3300006847 | Ga0075431_100144417 | Ga0075431_1001444173 | 499 |
| 1573 | 3300013306 | Ga0163162_10127905 | Ga0163162_101279052 | 499 |
| 1574 | 3300014325 | Ga0163163_10081878 | Ga0163163_100818781 | 499 |
| 1575 | 3300021384 | Ga0213876_10001902 | Ga0213876_100019025 | 499 |
| 1576 | 3300025925 | Ga0207650_10041192 | Ga0207650_100411923 | 499 |
| 1577 | 3300025981 | Ga0207640_10098135 | Ga0207640_100981352 | 499 |
| 1578 | 3300026088 | Ga0207641_10033440 | Ga0207641_100334404 | 499 |
| 1579 | 3300037853 | Ga0436364_0261085 | Ga0436364_0261085_1148_2686 | 499 |
| 1580 | 3300039437 | Ga0436365_1818399 | Ga0436365_1818399_28082_29620 | 499 |
| 1581 | 3300042004 | Ga0439445_0015721 | Ga0439445_0015721_104_1627 | 499 |
| 1582 | 3300044684 | Ga0466966_0008977 | Ga0466966_0008977_1454_2983 | 499 |
| 1583 | 3300044694 | Ga0466963_0015792 | Ga0466963_0015792_2064_3593 | 499 |
| 1584 | 3300044765 | Ga0466970_0052778 | Ga0466970_0052778_382_1911 | 499 |
| 1585 | 3300045049 | Ga0466959_0031087 | Ga0466959_0031087_1454_2983 | 499 |
| 1586 | 3300048904 | Ga0496101_0032927 | Ga0496101_0032927_1616_3142 | 499 |
| 1587 | 3300048907 | Ga0496104_0015265 | Ga0496104_0015265_5342_6868 | 499 |
| 1588 | 3300048911 | Ga0496108_0075375 | Ga0496108_0075375_1014_2537 | 499 |
| 1589 | 3300048914 | Ga0496111_0046359 | Ga0496111_0046359_1070_2596 | 499 |
| 1590 | 3300048915 | Ga0496112_0006907 | Ga0496112_0006907_5185_6711 | 499 |
| 1591 | 3300050490 | nmdc:mga03n38_4805_c2 | nmdc:mga03n38_4805_c2_190_1713 | 499 |
| 1592 | 3300050491 | nmdc:mga00v17_18980_c1 | nmdc:mga00v17_18980_c1_685_2208 | 499 |
| 1593 | 3300050491 | nmdc:mga00v17_2758_c1 | nmdc:mga00v17_2758_c1_3914_5440 | 499 |
| 1594 | 3300050496 | nmdc:mga07m45_21100_c1 | nmdc:mga07m45_21100_c1_963_2486 | 499 |
| 1595 | 3300050516 | nmdc:mga0sz30_1079_c1 | nmdc:mga0sz30_1079_c1_1310_2833 | 499 |
| 1596 | 3300050516 | nmdc:mga0sz30_4196_c1 | nmdc:mga0sz30_4196_c1_1620_3146 | 499 |
| 1597 | iso_pu_bacteria | 2738541264 | 2738667342 | 499 |
| 1598 | iso_pu_bacteria | 2738541356 | 2739146185 | 499 |
| 1599 | iso_pu_bacteria | 2929212328 | 2929217885 | 499 |
| 1600 | 3300053136 | Ga0500559_0002237 | Ga0500559_0002237_514_2094 | 500 |
| 1601 | iso_pu_bacteria | 2738541274 | 2738706335 | 500 |
| 1602 | iso_pu_bacteria | 2738543028 | 2739328825 | 500 |
| 1603 | iso_pu_bacteria | 2902799365 | 2902804115 | 500 |
| 1604 | iso_pu_bacteria | 2643221687 | 2644491253 | 501 |
| 1605 | iso_pu_bacteria | 2902837492 | 2902842961 | 501 |
| 1606 | iso_pu_bacteria | 2939582691 | 2939585114 | 501 |
| 1607 | 3300025939 | Ga0207665_10041490 | Ga0207665_100414902 | 502 |
| 1608 | 3300046616 | Ga0495668_0054633 | Ga0495668_0054633_212_1789 | 502 |
| 1609 | iso_pu_bacteria | 2565956761 | 2566995802 | 502 |
| 1610 | iso_pu_bacteria | 2643221692 | 2644515595 | 502 |
| 1611 | iso_pu_bacteria | 2738541308 | 2738888702 | 502 |
| 1612 | iso_pu_bacteria | 2738543005 | 2739204594 | 502 |
| 1613 | iso_pu_bacteria | 2904535858 | 2904537592 | 502 |
| 1614 | iso_pu_bacteria | 2904765812 | 2904766769 | 502 |
| 1615 | iso_pu_bacteria | 2904770941 | 2904775219 | 502 |
| 1616 | iso_pu_bacteria | 2908811453 | 2908814463 | 502 |
| 1617 | iso_pu_bacteria | 2919420072 | 2919420795 | 502 |
| 1618 | iso_pu_bacteria | 2919432681 | 2919433447 | 502 |
| 1619 | iso_pu_bacteria | 2922554459 | 2922558763 | 502 |
| 1620 | iso_pu_bacteria | 2928142448 | 2928145429 | 502 |
| 1621 | 3300003792 | Ga0055540_1000071 | Ga0055540_100007164 | 503 |
| 1622 | 3300005335 | Ga0070666_10069481 | Ga0070666_100694812 | 503 |
| 1623 | 3300005367 | Ga0070667_100000995 | Ga0070667_10000099525 | 503 |
| 1624 | 3300005456 | Ga0070678_100110041 | Ga0070678_1001100411 | 503 |
| 1625 | 3300009545 | Ga0105237_10003741 | Ga0105237_100037414 | 503 |
| 1626 | 3300010375 | Ga0105239_10009568 | Ga0105239_100095689 | 503 |
| 1627 | 3300025303 | Ga0209051_1000033 | Ga0209051_1000033296 | 503 |
| 1628 | 3300025903 | Ga0207680_10007714 | Ga0207680_100077141 | 503 |
| 1629 | 3300025914 | Ga0207671_10010542 | Ga0207671_100105424 | 503 |
| 1630 | 3300025937 | Ga0207669_10008741 | Ga0207669_100087414 | 503 |
| 1631 | 3300025986 | Ga0207658_10000850 | Ga0207658_1000085025 | 503 |
| 1632 | 3300031251 | Ga0265327_10002081 | Ga0265327_1000208115 | 503 |
| 1633 | 3300046531 | Ga0495665_0006931 | Ga0495665_0006931_4153_5736 | 503 |
| 1634 | 3300046674 | Ga0495588_0019232 | Ga0495588_0019232_383_1966 | 503 |
| 1635 | 3300047315 | Ga0495581_0028406 | Ga0495581_0028406_1097_2680 | 503 |
| 1636 | 3300048903 | Ga0496100_0000090 | Ga0496100_0000090_41613_43142 | 503 |
| 1637 | 3300048904 | Ga0496101_0000015 | Ga0496101_0000015_13835_15364 | 503 |
| 1638 | 3300048904 | Ga0496101_0004267 | Ga0496101_0004267_4656_6185 | 503 |
| 1639 | 3300048906 | Ga0496103_0000886 | Ga0496103_0000886_6044_7573 | 503 |
| 1640 | 3300048907 | Ga0496104_0011217 | Ga0496104_0011217_5830_7359 | 503 |
| 1641 | 3300048908 | Ga0496105_0004783 | Ga0496105_0004783_3891_5420 | 503 |
| 1642 | 3300048909 | Ga0496106_0000390 | Ga0496106_0000390_12562_14091 | 503 |
| 1643 | 3300048910 | Ga0496107_0000438 | Ga0496107_0000438_12943_14472 | 503 |
| 1644 | 3300048910 | Ga0496107_0017536 | Ga0496107_0017536_2891_4420 | 503 |
| 1645 | 3300048911 | Ga0496108_0001313 | Ga0496108_0001313_15581_17110 | 503 |
| 1646 | 3300048912 | Ga0496109_0000134 | Ga0496109_0000134_32495_34024 | 503 |
| 1647 | 3300048917 | Ga0496114_0004306 | Ga0496114_0004306_5990_7519 | 503 |
| 1648 | 3300048918 | Ga0496115_0003083 | Ga0496115_0003083_8962_10491 | 503 |
| 1649 | 3300048918 | Ga0496115_0006246 | Ga0496115_0006246_6859_8388 | 503 |
| 1650 | 3300048919 | Ga0496116_0013915 | Ga0496116_0013915_2937_4466 | 503 |
| 1651 | 3300048920 | Ga0496117_0044935 | Ga0496117_0044935_288_1817 | 503 |
| 1652 | 3300048922 | Ga0496119_0005422 | Ga0496119_0005422_8797_10326 | 503 |
| 1653 | 3300048924 | Ga0496121_0000004 | Ga0496121_0000004_548965_550494 | 503 |
| 1654 | 3300048925 | Ga0496122_0000138 | Ga0496122_0000138_50948_52477 | 503 |
| 1655 | 3300048927 | Ga0496124_0000012 | Ga0496124_0000012_273758_275287 | 503 |
| 1656 | 3300048928 | Ga0496125_0000003 | Ga0496125_0000003_639274_640803 | 503 |
| 1657 | 3300048929 | Ga0496126_0000001 | Ga0496126_0000001_548965_550494 | 503 |
| 1658 | 3300050491 | nmdc:mga00v17_34200_c1 | nmdc:mga00v17_34200_c1_651_2216 | 503 |
| 1659 | 3300053079 | Ga0500610_0025768 | Ga0500610_0025768_636_2165 | 503 |
| 1660 | iso_pu_bacteria | 2643221715 | 2644636565 | 503 |
| 1661 | iso_pu_bacteria | 2738543034 | 2739364534 | 503 |
| 1662 | iso_pu_bacteria | 2902792274 | 2902797209 | 503 |
| 1663 | iso_pu_bacteria | 2902810491 | 2902814525 | 503 |
| 1664 | iso_pu_bacteria | 2974315732 | 2974318750 | 503 |
| 1665 | iso_pu_bacteria | 2984523437 | 2984527025 | 503 |
| 1666 | 3300044683 | Ga0466965_0021752 | Ga0466965_0021752_807_2330 | 504 |
| 1667 | 3300044901 | Ga0466960_0068193 | Ga0466960_0068193_72_1595 | 504 |
| 1668 | 3300045976 | Ga0466967_0174189 | Ga0466967_0174189_48_1571 | 504 |
| 1669 | 3300050516 | nmdc:mga0sz30_5141_c1 | nmdc:mga0sz30_5141_c1_2945_4471 | 504 |
| 1670 | iso_pu_bacteria | 2842134933 | 2842139510 | 504 |
| 1671 | 3300003792 | Ga0055540_1000645 | Ga0055540_100064516 | 505 |
| 1672 | 3300003792 | Ga0055540_1005868 | Ga0055540_10058682 | 505 |
| 1673 | 3300006051 | Ga0075364_10071602 | Ga0075364_100716021 | 505 |
| 1674 | 3300025303 | Ga0209051_1001934 | Ga0209051_10019349 | 505 |
| 1675 | 3300025303 | Ga0209051_1008041 | Ga0209051_10080412 | 505 |
| 1676 | 3300044658 | Ga0466972_0010726 | Ga0466972_0010726_2921_4483 | 505 |
| 1677 | 3300044694 | Ga0466963_0071200 | Ga0466963_0071200_51_1595 | 505 |
| 1678 | 3300044842 | Ga0466957_0012124 | Ga0466957_0012124_3055_4599 | 505 |
| 1679 | 3300044901 | Ga0466960_0068807 | Ga0466960_0068807_55_1617 | 505 |
| 1680 | 3300047472 | Ga0495686_0001901 | Ga0495686_0001901_18266_19807 | 505 |
| 1681 | 3300050491 | nmdc:mga00v17_10338_c1 | nmdc:mga00v17_10338_c1_101_1639 | 505 |
| 1682 | iso_pu_bacteria | 2738543011 | 2739237905 | 505 |
| 1683 | iso_pu_bacteria | 2751185725 | 2753039040 | 505 |
| 1684 | iso_pu_bacteria | 2751185792 | 2753327401 | 505 |
| 1685 | iso_pu_bacteria | 2889300758 | 2889303582 | 505 |
| 1686 | iso_pu_bacteria | 2939743619 | 2939747367 | 505 |
| 1687 | 3300031251 | Ga0265327_10000001 | Ga0265327_10000001725 | 506 |
| 1688 | 3300049569 | Ga0501032_0048647 | Ga0501032_0048647_14_1546 | 506 |
| 1689 | 3300049571 | Ga0501034_0003044 | Ga0501034_0003044_9792_11324 | 506 |
| 1690 | 3300049572 | Ga0501036_0092187 | Ga0501036_0092187_329_1861 | 506 |
| 1691 | 3300049573 | Ga0501037_0000401 | Ga0501037_0000401_29594_31126 | 506 |
| 1692 | 3300049574 | Ga0501038_0023327 | Ga0501038_0023327_2717_4249 | 506 |
| 1693 | 3300049575 | Ga0501039_0011640 | Ga0501039_0011640_4666_6198 | 506 |
| 1694 | 3300049579 | Ga0501043_0001613 | Ga0501043_0001613_15589_17121 | 506 |
| 1695 | 3300049823 | Ga0501044_0015683 | Ga0501044_0015683_6121_7680 | 506 |
| 1696 | 3300049823 | Ga0501044_0073156 | Ga0501044_0073156_508_2040 | 506 |
| 1697 | 3300001977 | JGI24746J21847_1000708 | JGI24746J21847_10007086 | 507 |
| 1698 | 3300002244 | JGI24742J22300_10001558 | JGI24742J22300_100015583 | 507 |
| 1699 | 3300005328 | Ga0070676_10017998 | Ga0070676_100179982 | 507 |
| 1700 | 3300005334 | Ga0068869_100002932 | Ga0068869_1000029328 | 507 |
| 1701 | 3300005337 | Ga0070682_100034083 | Ga0070682_1000340832 | 507 |
| 1702 | 3300005337 | Ga0070682_100098095 | Ga0070682_1000980951 | 507 |
| 1703 | 3300005338 | Ga0068868_100189404 | Ga0068868_1001894041 | 507 |
| 1704 | 3300005340 | Ga0070689_100025015 | Ga0070689_1000250152 | 507 |
| 1705 | 3300005341 | Ga0070691_10008186 | Ga0070691_100081865 | 507 |
| 1706 | 3300005347 | Ga0070668_100006625 | Ga0070668_1000066253 | 507 |
| 1707 | 3300005354 | Ga0070675_100094591 | Ga0070675_1000945912 | 507 |
| 1708 | 3300005356 | Ga0070674_100009143 | Ga0070674_1000091433 | 507 |
| 1709 | 3300005366 | Ga0070659_100022487 | Ga0070659_1000224876 | 507 |
| 1710 | 3300005366 | Ga0070659_100026863 | Ga0070659_1000268634 | 507 |
| 1711 | 3300005367 | Ga0070667_100000960 | Ga0070667_10000096015 | 507 |
| 1712 | 3300005367 | Ga0070667_100045890 | Ga0070667_1000458903 | 507 |
| 1713 | 3300005434 | Ga0070709_10012282 | Ga0070709_100122824 | 507 |
| 1714 | 3300005437 | Ga0070710_10001385 | Ga0070710_100013857 | 507 |
| 1715 | 3300005437 | Ga0070710_10007135 | Ga0070710_100071352 | 507 |
| 1716 | 3300005438 | Ga0070701_10001222 | Ga0070701_100012226 | 507 |
| 1717 | 3300005439 | Ga0070711_100002751 | Ga0070711_1000027517 | 507 |
| 1718 | 3300005441 | Ga0070700_100002767 | Ga0070700_1000027673 | 507 |
| 1719 | 3300005455 | Ga0070663_100021613 | Ga0070663_1000216133 | 507 |
| 1720 | 3300005456 | Ga0070678_100002337 | Ga0070678_1000023374 | 507 |
| 1721 | 3300005457 | Ga0070662_100004566 | Ga0070662_1000045665 | 507 |
| 1722 | 3300005457 | Ga0070662_100010075 | Ga0070662_1000100751 | 507 |
| 1723 | 3300005459 | Ga0068867_100005051 | Ga0068867_1000050514 | 507 |
| 1724 | 3300005539 | Ga0068853_100061206 | Ga0068853_1000612062 | 507 |
| 1725 | 3300005546 | Ga0070696_100006372 | Ga0070696_1000063727 | 507 |
| 1726 | 3300005547 | Ga0070693_100012317 | Ga0070693_1000123174 | 507 |
| 1727 | 3300005548 | Ga0070665_100022884 | Ga0070665_1000228843 | 507 |
| 1728 | 3300005548 | Ga0070665_100037988 | Ga0070665_1000379884 | 507 |
| 1729 | 3300005549 | Ga0070704_100011659 | Ga0070704_1000116591 | 507 |
| 1730 | 3300005578 | Ga0068854_100003641 | Ga0068854_1000036417 | 507 |
| 1731 | 3300005615 | Ga0070702_100005972 | Ga0070702_1000059723 | 507 |
| 1732 | 3300005617 | Ga0068859_100004535 | Ga0068859_1000045358 | 507 |
| 1733 | 3300005617 | Ga0068859_100012411 | Ga0068859_1000124114 | 507 |
| 1734 | 3300005617 | Ga0068859_100048278 | Ga0068859_1000482784 | 507 |
| 1735 | 3300005718 | Ga0068866_10001953 | Ga0068866_100019533 | 507 |
| 1736 | 3300005718 | Ga0068866_10031366 | Ga0068866_100313662 | 507 |
| 1737 | 3300005719 | Ga0068861_100007802 | Ga0068861_1000078026 | 507 |
| 1738 | 3300005841 | Ga0068863_100000105 | Ga0068863_10000010516 | 507 |
| 1739 | 3300005842 | Ga0068858_100009323 | Ga0068858_1000093237 | 507 |
| 1740 | 3300005842 | Ga0068858_100010352 | Ga0068858_1000103523 | 507 |
| 1741 | 3300005843 | Ga0068860_100000209 | Ga0068860_10000020915 | 507 |
| 1742 | 3300005843 | Ga0068860_100024061 | Ga0068860_1000240614 | 507 |
| 1743 | 3300005844 | Ga0068862_100000400 | Ga0068862_10000040016 | 507 |
| 1744 | 3300005844 | Ga0068862_100005740 | Ga0068862_1000057407 | 507 |
| 1745 | 3300006038 | Ga0075365_10058072 | Ga0075365_100580722 | 507 |
| 1746 | 3300006048 | Ga0075363_100003661 | Ga0075363_1000036614 | 507 |
| 1747 | 3300006048 | Ga0075363_100008051 | Ga0075363_1000080514 | 507 |
| 1748 | 3300006048 | Ga0075363_100032455 | Ga0075363_1000324553 | 507 |
| 1749 | 3300006051 | Ga0075364_10000646 | Ga0075364_100006466 | 507 |
| 1750 | 3300006051 | Ga0075364_10012091 | Ga0075364_100120913 | 507 |
| 1751 | 3300006173 | Ga0070716_100006287 | Ga0070716_1000062873 | 507 |
| 1752 | 3300006175 | Ga0070712_100003408 | Ga0070712_1000034086 | 507 |
| 1753 | 3300006175 | Ga0070712_100003957 | Ga0070712_1000039573 | 507 |
| 1754 | 3300006881 | Ga0068865_100002783 | Ga0068865_1000027834 | 507 |
| 1755 | 3300006931 | Ga0097620_100004535 | Ga0097620_1000045358 | 507 |
| 1756 | 3300006931 | Ga0097620_100012409 | Ga0097620_1000124095 | 507 |
| 1757 | 3300006931 | Ga0097620_100048278 | Ga0097620_1000482782 | 507 |
| 1758 | 3300009098 | Ga0105245_10006580 | Ga0105245_100065804 | 507 |
| 1759 | 3300009101 | Ga0105247_10000141 | Ga0105247_1000014113 | 507 |
| 1760 | 3300009101 | Ga0105247_10003401 | Ga0105247_100034017 | 507 |
| 1761 | 3300009176 | Ga0105242_10004138 | Ga0105242_100041384 | 507 |
| 1762 | 3300009176 | Ga0105242_10235487 | Ga0105242_102354871 | 507 |
| 1763 | 3300009177 | Ga0105248_10001091 | Ga0105248_1000109114 | 507 |
| 1764 | 3300009177 | Ga0105248_10029514 | Ga0105248_100295141 | 507 |
| 1765 | 3300009545 | Ga0105237_10001867 | Ga0105237_1000186710 | 507 |
| 1766 | 3300009553 | Ga0105249_10000031 | Ga0105249_10000031216 | 507 |
| 1767 | 3300010159 | Ga0099796_10014198 | Ga0099796_100141983 | 507 |
| 1768 | 3300010375 | Ga0105239_10045403 | Ga0105239_100454033 | 507 |
| 1769 | 3300010375 | Ga0105239_10074964 | Ga0105239_100749643 | 507 |
| 1770 | 3300013297 | Ga0157378_10035746 | Ga0157378_100357461 | 507 |
| 1771 | 3300013306 | Ga0163162_10016218 | Ga0163162_100162184 | 507 |
| 1772 | 3300013307 | Ga0157372_10012663 | Ga0157372_100126636 | 507 |
| 1773 | 3300013308 | Ga0157375_10001251 | Ga0157375_100012514 | 507 |
| 1774 | 3300014326 | Ga0157380_10009826 | Ga0157380_100098262 | 507 |
| 1775 | 3300014745 | Ga0157377_10005202 | Ga0157377_100052023 | 507 |
| 1776 | 3300014968 | Ga0157379_10008367 | Ga0157379_100083673 | 507 |
| 1777 | 3300017792 | Ga0163161_10046285 | Ga0163161_100462851 | 507 |
| 1778 | 3300025898 | Ga0207692_10017637 | Ga0207692_100176371 | 507 |
| 1779 | 3300025899 | Ga0207642_10000179 | Ga0207642_1000017920 | 507 |
| 1780 | 3300025900 | Ga0207710_10000164 | Ga0207710_1000016413 | 507 |
| 1781 | 3300025900 | Ga0207710_10001390 | Ga0207710_100013904 | 507 |
| 1782 | 3300025900 | Ga0207710_10019598 | Ga0207710_100195983 | 507 |
| 1783 | 3300025901 | Ga0207688_10001929 | Ga0207688_100019297 | 507 |
| 1784 | 3300025901 | Ga0207688_10002258 | Ga0207688_100022587 | 507 |
| 1785 | 3300025903 | Ga0207680_10010715 | Ga0207680_100107154 | 507 |
| 1786 | 3300025915 | Ga0207693_10005747 | Ga0207693_100057477 | 507 |
| 1787 | 3300025916 | Ga0207663_10002588 | Ga0207663_100025888 | 507 |
| 1788 | 3300025923 | Ga0207681_10000456 | Ga0207681_1000045611 | 507 |
| 1789 | 3300025926 | Ga0207659_10064067 | Ga0207659_100640672 | 507 |
| 1790 | 3300025927 | Ga0207687_10005294 | Ga0207687_100052944 | 507 |
| 1791 | 3300025931 | Ga0207644_10010594 | Ga0207644_100105944 | 507 |
| 1792 | 3300025932 | Ga0207690_10013667 | Ga0207690_100136674 | 507 |
| 1793 | 3300025933 | Ga0207706_10019235 | Ga0207706_100192354 | 507 |
| 1794 | 3300025935 | Ga0207709_10002137 | Ga0207709_100021375 | 507 |
| 1795 | 3300025936 | Ga0207670_10013218 | Ga0207670_100132182 | 507 |
| 1796 | 3300025937 | Ga0207669_10001598 | Ga0207669_100015983 | 507 |
| 1797 | 3300025938 | Ga0207704_10002309 | Ga0207704_100023093 | 507 |
| 1798 | 3300025939 | Ga0207665_10004580 | Ga0207665_100045804 | 507 |
| 1799 | 3300025939 | Ga0207665_10015744 | Ga0207665_100157442 | 507 |
| 1800 | 3300025940 | Ga0207691_10017365 | Ga0207691_100173657 | 507 |
| 1801 | 3300025941 | Ga0207711_10000196 | Ga0207711_1000019654 | 507 |
| 1802 | 3300025941 | Ga0207711_10041264 | Ga0207711_100412641 | 507 |
| 1803 | 3300025942 | Ga0207689_10002479 | Ga0207689_100024797 | 507 |
| 1804 | 3300025961 | Ga0207712_10000029 | Ga0207712_10000029216 | 507 |
| 1805 | 3300025961 | Ga0207712_10014228 | Ga0207712_100142285 | 507 |
| 1806 | 3300025972 | Ga0207668_10009927 | Ga0207668_100099274 | 507 |
| 1807 | 3300025981 | Ga0207640_10001076 | Ga0207640_100010764 | 507 |
| 1808 | 3300025986 | Ga0207658_10000517 | Ga0207658_1000051725 | 507 |
| 1809 | 3300026023 | Ga0207677_10006454 | Ga0207677_100064544 | 507 |
| 1810 | 3300026035 | Ga0207703_10007260 | Ga0207703_100072607 | 507 |
| 1811 | 3300026035 | Ga0207703_10023378 | Ga0207703_100233782 | 507 |
| 1812 | 3300026067 | Ga0207678_10032351 | Ga0207678_100323514 | 507 |
| 1813 | 3300026075 | Ga0207708_10006787 | Ga0207708_100067875 | 507 |
| 1814 | 3300026075 | Ga0207708_10081222 | Ga0207708_100812221 | 507 |
| 1815 | 3300026089 | Ga0207648_10011289 | Ga0207648_100112894 | 507 |
| 1816 | 3300026118 | Ga0207675_100008196 | Ga0207675_1000081964 | 507 |
| 1817 | 3300026118 | Ga0207675_100008622 | Ga0207675_1000086227 | 507 |
| 1818 | 3300026121 | Ga0207683_10006112 | Ga0207683_100061127 | 507 |
| 1819 | 3300028379 | Ga0268266_10006438 | Ga0268266_100064383 | 507 |
| 1820 | 3300028379 | Ga0268266_10122086 | Ga0268266_101220861 | 507 |
| 1821 | 3300028380 | Ga0268265_10000389 | Ga0268265_1000038915 | 507 |
| 1822 | 3300028380 | Ga0268265_10005881 | Ga0268265_100058814 | 507 |
| 1823 | 3300028381 | Ga0268264_10000017 | Ga0268264_10000017160 | 507 |
| 1824 | 3300028381 | Ga0268264_10004905 | Ga0268264_100049054 | 507 |
| 1825 | 3300032005 | Ga0307411_10025869 | Ga0307411_100258694 | 507 |
| 1826 | 3300032005 | Ga0307411_10118824 | Ga0307411_101188242 | 507 |
| 1827 | 3300035691 | Ga0373931_0007778 | Ga0373931_0007778_1488_3011 | 507 |
| 1828 | 3300035691 | Ga0373931_0011048 | Ga0373931_0011048_960_2492 | 507 |
| 1829 | 3300039450 | Ga0436363_1277403 | Ga0436363_1277403_155_1678 | 507 |
| 1830 | 3300041410 | Ga0439461_0000228 | Ga0439461_0000228_4918_6468 | 507 |
| 1831 | 3300041413 | Ga0439465_0007793 | Ga0439465_0007793_732_2255 | 507 |
| 1832 | 3300041413 | Ga0439465_0012021 | Ga0439465_0012021_701_2251 | 507 |
| 1833 | 3300042004 | Ga0439445_0000209 | Ga0439445_0000209_1684_3234 | 507 |
| 1834 | 3300045049 | Ga0466959_0010256 | Ga0466959_0010256_1934_3529 | 507 |
| 1835 | 3300045049 | Ga0466959_0049923 | Ga0466959_0049923_736_2259 | 507 |
| 1836 | 3300046455 | Ga0495603_0062597 | Ga0495603_0062597_428_1951 | 507 |
| 1837 | 3300046476 | Ga0495662_0030356 | Ga0495662_0030356_352_1875 | 507 |
| 1838 | 3300046507 | Ga0495606_0039733 | Ga0495606_0039733_1405_2955 | 507 |
| 1839 | 3300047469 | Ga0495673_0000524 | Ga0495673_0000524_8653_10203 | 507 |
| 1840 | 3300047472 | Ga0495686_0073202 | Ga0495686_0073202_24_1574 | 507 |
| 1841 | 3300048903 | Ga0496100_0004442 | Ga0496100_0004442_4256_5806 | 507 |
| 1842 | 3300048903 | Ga0496100_0006094 | Ga0496100_0006094_225_1772 | 507 |
| 1843 | 3300048903 | Ga0496100_0046280 | Ga0496100_0046280_668_2200 | 507 |
| 1844 | 3300048904 | Ga0496101_0000031 | Ga0496101_0000031_60807_62357 | 507 |
| 1845 | 3300048904 | Ga0496101_0000462 | Ga0496101_0000462_5229_6761 | 507 |
| 1846 | 3300048904 | Ga0496101_0018263 | Ga0496101_0018263_2721_4244 | 507 |
| 1847 | 3300048904 | Ga0496101_0049579 | Ga0496101_0049579_1389_2936 | 507 |
| 1848 | 3300048905 | Ga0496102_0000065 | Ga0496102_0000065_107368_108918 | 507 |
| 1849 | 3300048905 | Ga0496102_0000387 | Ga0496102_0000387_38731_40278 | 507 |
| 1850 | 3300048905 | Ga0496102_0004258 | Ga0496102_0004258_6812_8344 | 507 |
| 1851 | 3300048906 | Ga0496103_0000048 | Ga0496103_0000048_106909_108459 | 507 |
| 1852 | 3300048906 | Ga0496103_0000292 | Ga0496103_0000292_33057_34604 | 507 |
| 1853 | 3300048906 | Ga0496103_0011144 | Ga0496103_0011144_3707_5239 | 507 |
| 1854 | 3300048909 | Ga0496106_0004705 | Ga0496106_0004705_5678_7210 | 507 |
| 1855 | 3300048910 | Ga0496107_0000521 | Ga0496107_0000521_14770_16302 | 507 |
| 1856 | 3300048910 | Ga0496107_0020054 | Ga0496107_0020054_1393_2940 | 507 |
| 1857 | 3300048911 | Ga0496108_0018250 | Ga0496108_0018250_92_1615 | 507 |
| 1858 | 3300048913 | Ga0496110_0012823 | Ga0496110_0012823_734_2257 | 507 |
| 1859 | 3300048916 | Ga0496113_0021468 | Ga0496113_0021468_336_1871 | 507 |
| 1860 | 3300048917 | Ga0496114_0007157 | Ga0496114_0007157_5186_6718 | 507 |
| 1861 | 3300048918 | Ga0496115_0001385 | Ga0496115_0001385_13656_15188 | 507 |
| 1862 | 3300048919 | Ga0496116_0000125 | Ga0496116_0000125_52453_54003 | 507 |
| 1863 | 3300048919 | Ga0496116_0036927 | Ga0496116_0036927_22_1569 | 507 |
| 1864 | 3300048920 | Ga0496117_0000111 | Ga0496117_0000111_52453_54003 | 507 |
| 1865 | 3300048920 | Ga0496117_0001572 | Ga0496117_0001572_19229_20776 | 507 |
| 1866 | 3300048921 | Ga0496118_0000083 | Ga0496118_0000083_52453_54003 | 507 |
| 1867 | 3300048921 | Ga0496118_0001353 | Ga0496118_0001353_32938_34485 | 507 |
| 1868 | 3300048922 | Ga0496119_0050948 | Ga0496119_0050948_899_2449 | 507 |
| 1869 | 3300048923 | Ga0496120_0013212 | Ga0496120_0013212_894_2444 | 507 |
| 1870 | 3300048924 | Ga0496121_0000728 | Ga0496121_0000728_37968_39518 | 507 |
| 1871 | 3300048924 | Ga0496121_0019873 | Ga0496121_0019873_3627_5174 | 507 |
| 1872 | 3300048926 | Ga0496123_0007586 | Ga0496123_0007586_4871_6406 | 507 |
| 1873 | 3300048927 | Ga0496124_0029865 | Ga0496124_0029865_3025_4572 | 507 |
| 1874 | 3300048929 | Ga0496126_0000220 | Ga0496126_0000220_64843_66393 | 507 |
| 1875 | 3300048929 | Ga0496126_0010644 | Ga0496126_0010644_3446_4981 | 507 |
| 1876 | 3300049589 | Ga0501073_0042885 | Ga0501073_0042885_449_1981 | 507 |
| 1877 | 3300050490 | nmdc:mga03n38_1489_c1 | nmdc:mga03n38_1489_c1_1343_2944 | 507 |
| 1878 | 3300050490 | nmdc:mga03n38_16294_c1 | nmdc:mga03n38_16294_c1_78_1616 | 507 |
| 1879 | 3300050490 | nmdc:mga03n38_5023_c1 | nmdc:mga03n38_5023_c1_641_2173 | 507 |
| 1880 | 3300050491 | nmdc:mga00v17_15246_c1 | nmdc:mga00v17_15246_c1_1204_2736 | 507 |
| 1881 | 3300050491 | nmdc:mga00v17_4239_c1 | nmdc:mga00v17_4239_c1_3926_5527 | 507 |
| 1882 | 3300050492 | nmdc:mga0yw44_47032_c1 | nmdc:mga0yw44_47032_c1_72_1610 | 507 |
| 1883 | 3300050496 | nmdc:mga07m45_51136_c1 | nmdc:mga07m45_51136_c1_157_1689 | 507 |
| 1884 | 3300053087 | Ga0500643_003235 | Ga0500643_003235_4328_5878 | 507 |
| 1885 | iso_pu_bacteria | 2842888712 | 2842890046 | 507 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6lbp-assembly1.cif.gz_A | structure of the glutamine phosphoribosylpyrophosphate amidotransferase from arabidopsis thaliana | 0.9401 | 14 | 468 |
| 1gph-assembly1.cif.gz_1 | structure of the allosteric regulatory enzyme of purine biosynthesis | 0.932 | 14 | 471 |
| 1ao0-assembly1.cif.gz_C | glutamine phosphoribosylpyrophosphate (prpp) amidotransferase from b. subtilis complexed with adp and gmp | 0.9284 | 14 | 472 |
| 1ao0-assembly1.cif.gz_C | glutamine phosphoribosylpyrophosphate (prpp) amidotransferase from b. subtilis complexed with adp and gmp | 0.9126 | 14 | 472 |
| 6lbp-assembly1.cif.gz_A | structure of the glutamine phosphoribosylpyrophosphate amidotransferase from arabidopsis thaliana | 0.9083 | 14 | 468 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P87171_221_328_3.40.50.2020 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9731 | 355 | 392 | 3.40.50.2020 |
| 1ao0B02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9606 | 280 | 447 | 3.40.50.2020 |
| 1gph401 | Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain | 0.9401 | 14 | 277 | 3.60.20.10 |
| af_Q22134_287_448_3.40.50.2020 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9398 | 281 | 445 | 3.40.50.2020 |
| 1ao0B02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9393 | 280 | 447 | 3.40.50.2020 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7X8ZZX5-F1-model_v4 | Amidophosphoribosyltransferase (EC 2.4.2.14) | 0.9749 | 213 | 471 |
GO:0004044
|
| AF-A0A368T3L3-F1-model_v4 | Amidophosphoribosyltransferase (ATase) (EC 2.4.2.14) (Glutamine phosphoribosylpyrophosphate amidotransferase) (GPATase) | 0.9715 | 5 | 481 |
GO:0000287
GO:0004044 GO:0006189 GO:0009113 GO:0051539 |
| AF-X8E076-F1-model_v4 | Amidophosphoribosyltransferase (ATase) (EC 2.4.2.14) (Glutamine phosphoribosylpyrophosphate amidotransferase) (GPATase) | 0.9706 | 1 | 386 |
GO:0000287
GO:0004044 GO:0006189 GO:0009113 |
| AF-A0A538FGE0-F1-model_v4 | Amidophosphoribosyltransferase (EC 2.4.2.14) | 0.9705 | 14 | 459 |
GO:0004044
GO:0006189 GO:0009113 GO:0046872 |
| AF-A0A6L6E638-F1-model_v4 | Amidophosphoribosyltransferase (EC 2.4.2.14) | 0.9676 | 7 | 415 |
GO:0004044
GO:0006189 GO:0009113 GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar