F495970

General Info

Members Datasets Scaffolds Average Seq Length
1885 737 1665 499

Family's Representative Sequence

Representative Sequence 3300050492|nmdc:mga0yw44_1056_c1|nmdc:mga0yw44_1056_c1_3311_5014
Length 567
Sequence MKRELQSGYVLVNVVSGDCVTAPGPLRRAAGRTLGDADPGVPRPYDDHVPYLSTGGHPSSRRGGDGLLSHDLDPQEKGPRDACGVFGVWAPGEDVAKLTYFGLYALQHRGQESAGIAVSNGRQILVYKEMGLVSQVFDETTLASLNGHLAIGHCRYSTTGASTWQNAQPTFRPTADGSIALGHNGNLINTHELRELVEALPDPEGELPLHTRDVETSTNDTSLVTALLAHHPDTSLEQRALEVLPMLRGAFSFVWMDEDTLYAARDPQGIRPLVLGRLDRGWVVASEDAALATIGASVVREVEPGELIAIDEHGLRTHKFAEPARKGCVFEYVYLARPDATISGQSVHKARVEMGRELARQFPVEADLVMPVPESGTPAAAGYAEESXXXFGQGFVKNAYVGRTFIQPSQTLRQLGIRLKLNALEHMVRGKKLVVVDDSIVRGNTQRAQVRMLREAGALEVHVRISSPPVKWPCFYGIDFATRAELIANGLDDEEIRSSIGADSLGYISLEGMIAATDQASDALCTACFTGEYPIPLPDESLLGKHLLEATLVSPTLGRSLPVLNNP

Samples

Sample ID Description Type Environment
1 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
2 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
3 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
4 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
5 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
6 2554235227 Arthrobacter sp. PAO19 Isolate Rhizosphere
7 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
8 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
9 2582580736 Prauserella sp. Am3 Isolate Unclassified
10 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
11 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
12 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
13 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
14 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
15 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
16 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
17 2643221548 Streptomyces sp. Root55 Isolate Unclassified
18 2643221561 Nocardioides sp. Root151 Isolate Unclassified
19 2643221576 Nocardioides sp. Root614 Isolate Unclassified
20 2643221578 Streptomyces sp. Root63 Isolate Unclassified
21 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
22 2643221590 Nocardioides sp. Root682 Isolate Unclassified
23 2643221604 Nocardioides sp. Root190 Isolate Unclassified
24 2643221613 Oerskovia sp. Root22 Isolate Unclassified
25 2643221615 Nocardioides sp. Root224 Isolate Unclassified
26 2643221616 Leifsonia sp. Root227 Isolate Unclassified
27 2643221617 Nocardioides sp. Root79 Isolate Unclassified
28 2643221620 Nocardioides sp. Root240 Isolate Unclassified
29 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
30 2643221641 Nocardioides sp. Root122 Isolate Unclassified
31 2643221647 Streptomyces sp. Root369 Isolate Unclassified
32 2643221649 Leifsonia sp. Root4 Isolate Unclassified
33 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
34 2643221670 Streptomyces sp. Root431 Isolate Unclassified
35 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
36 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
37 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
38 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
39 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
40 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
41 2643221692 Nocardia sp. Root136 Isolate Unclassified
42 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
43 2643221696 Nocardioides sp. Root140 Isolate Unclassified
44 2643221711 Terrabacter sp. Root85 Isolate Unclassified
45 2643221714 Streptomyces sp. Root264 Isolate Unclassified
46 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
47 2643221721 Oerskovia sp. Root918 Isolate Unclassified
48 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
49 2654587600 Glutamicibacter halophytocola KLBMP5180 Isolate Unclassified
50 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
51 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
52 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
53 2738541305 Nocardioides sp. CF167 Isolate Unclassified
54 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
55 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
56 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
57 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
58 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
59 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
60 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
61 2739367898 Nocardioides sp. CF479 Isolate Unclassified
62 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
63 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
64 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
65 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
66 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
67 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
68 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
69 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
70 2784132109 Dermacoccus sp. DS28 SAI-028 Isolate Unclassified
71 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
72 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
73 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
74 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
75 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
76 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
77 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
78 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
79 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
80 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
81 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
82 2808606394 Promicromonospora sp. C35 Isolate Unclassified
83 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
84 2808606448 Streptomyces sp. 193411 Isolate Unclassified
85 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
86 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
87 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
88 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
89 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
90 2811994882 Terrabacter sp. SLBN-196 Isolate Unclassified
91 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
92 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
93 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
94 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
95 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
96 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
97 2835188231 Isoptericola variabilis JZ7 Isolate Unclassified
98 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
99 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
100 2842888712 Tsukamurella sp. R-71941 Isolate Unclassified
101 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
102 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
103 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
104 2855683550 Micromonospora sp. RP3T Isolate Unclassified
105 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
106 2861520306 Phytomonospora endophytica DSM 45386 Isolate Unclassified
107 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
108 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
109 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
110 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
111 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
112 2862574272 Streptomyces sp. AcE210 Isolate Nodule
113 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
114 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
115 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
116 2866612099 Amycolatopsis suaedae 8-3EHSu Isolate Unclassified
117 2867428634 Streptomyces sp. RP5T Isolate Unclassified
118 2867475112 Streptomyces sp. TM32 Isolate Unclassified
119 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
120 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
121 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
122 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
123 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
124 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
125 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
126 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
127 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
128 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
129 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
130 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
131 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
132 2899370129 Amycolatopsis alkalitolerans SYSUP0005 Isolate Stem Tuber
133 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
134 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
135 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
136 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
137 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
138 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
139 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
140 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
141 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
142 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
143 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
144 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
145 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
146 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
147 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
148 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
149 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
150 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
151 2922554459 Rhodococcus sp. 66b Isolate Unclassified
152 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
153 2928153084 Leifsonia sp. 563 Isolate Unclassified
154 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
155 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
156 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
157 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
158 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
159 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
160 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
161 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
162 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
163 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
164 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
165 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
166 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
167 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
168 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
169 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
170 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
171 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
172 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
173 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
174 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
175 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
176 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
177 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
178 2956939328 Lolliginicoccus suaedae LNNU 331112 Isolate Rhizosphere
179 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
180 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
181 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
182 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
183 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
184 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
185 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
186 3001119090 Lolliginicoccus lacisalsi G463 Isolate Rhizosphere
187 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified
188 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
189 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
190 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
191 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
192 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
193 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
194 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
195 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
196 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
197 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
198 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
199 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
200 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
201 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
202 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
203 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
204 3300003285 Grassland soil microbial communities from Hopland, California, USA - Sample H3_Rhizo_39 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
205 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
206 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
207 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
208 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
209 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
210 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
211 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
212 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
213 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
214 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
215 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
216 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
217 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
218 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
219 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
220 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
221 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
222 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
223 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
224 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
225 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
226 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
227 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
228 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
229 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
230 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
231 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
232 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
233 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
234 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
235 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
236 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
237 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
238 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
239 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
240 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
241 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
242 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
243 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
244 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
245 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
246 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
247 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
248 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
249 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
250 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
251 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
252 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
253 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
254 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
255 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
256 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
257 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
258 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
259 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
260 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
261 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
262 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
263 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
264 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
265 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
266 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
267 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
268 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
269 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
270 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
271 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
272 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
273 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
274 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
275 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
276 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
277 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
278 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
279 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
280 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
281 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
282 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
283 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
284 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
285 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
286 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
287 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
288 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
289 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
290 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
291 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
292 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
293 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
294 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
295 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
296 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
297 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
298 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
299 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
300 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
301 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
302 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
303 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
304 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
305 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
306 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
307 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
308 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
309 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
310 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
311 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
312 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
313 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
314 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
315 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
316 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
317 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
318 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
319 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
320 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
321 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
322 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
323 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
324 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
325 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
326 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
327 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
328 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
329 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
330 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
331 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
332 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
333 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
334 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
335 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
336 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
337 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
338 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
339 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
340 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
341 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
342 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
343 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
344 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
345 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
346 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
347 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
348 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
349 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
350 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
351 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
352 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
353 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
354 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
355 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
356 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
357 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
358 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
359 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
360 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
361 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
362 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
363 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
364 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
365 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
366 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
367 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
368 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
369 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
370 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
371 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
372 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
373 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
374 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
375 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
376 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
377 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
378 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
379 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
380 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
381 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
382 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
383 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
384 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
385 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
386 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
387 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
388 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
389 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
390 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
391 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
392 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
393 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
394 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
395 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
396 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
397 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
398 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
399 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
400 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
401 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
402 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
403 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
404 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
405 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
406 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
407 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
408 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
409 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
410 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
411 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
412 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
413 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
414 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
415 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
416 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
417 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
418 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
419 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
420 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
421 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
422 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
423 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
424 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
425 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
426 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
427 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
428 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
429 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
430 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
431 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
432 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
433 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
434 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
435 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
436 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
437 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
438 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
439 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
440 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
441 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
442 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
443 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
444 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
445 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
446 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
447 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
448 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
449 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
450 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
451 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
452 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
453 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
454 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
455 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
456 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
457 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
458 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
459 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
460 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
461 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
462 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
463 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
464 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
465 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
466 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
467 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
468 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
469 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
470 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
471 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
472 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
473 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
474 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
475 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
476 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
477 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
478 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
479 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
480 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
481 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
482 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
483 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
484 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
485 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
486 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
487 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
488 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
489 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
490 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
491 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
492 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
493 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
494 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
495 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
496 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
497 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
498 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
499 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
500 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
501 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
502 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
503 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
504 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
505 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
506 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
507 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
508 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
509 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
510 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
511 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
512 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
513 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
514 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
515 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
516 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
517 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
518 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
519 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
520 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
521 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
522 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
523 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
524 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
525 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
526 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
527 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
528 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
529 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
530 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
531 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
532 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
533 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
534 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
535 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
536 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
537 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
538 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
539 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
540 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
541 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
542 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
543 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
544 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
545 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
546 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
547 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
548 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
549 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
550 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
551 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
552 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
553 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
554 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
555 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
556 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
557 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
558 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
559 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
560 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
561 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
562 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
563 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
564 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
565 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
566 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
567 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
568 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
569 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
570 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
571 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
572 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
573 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
574 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
575 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
576 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
577 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
578 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
579 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
580 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
581 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
582 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
583 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
584 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
585 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
586 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
587 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
588 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
589 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
590 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
591 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
592 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
593 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
594 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
595 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
596 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
597 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
598 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
599 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
600 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
601 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
602 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
603 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
604 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
605 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
606 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
607 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
608 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
609 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
610 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
611 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
612 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
613 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
614 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
615 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
616 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
617 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
618 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
619 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
620 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
621 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
622 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
623 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
624 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
625 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
626 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
627 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
628 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
629 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
630 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
631 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
632 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
633 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
634 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
635 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
636 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
637 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
638 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
639 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
640 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
641 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
642 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
643 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
644 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
645 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
646 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
647 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
648 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
649 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
650 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
651 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
652 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
653 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
654 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
655 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
656 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
657 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
658 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
659 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
660 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
661 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
662 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
663 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
664 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
665 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
666 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
667 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
668 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
669 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
670 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
671 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
672 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
673 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
674 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
675 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
676 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
677 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
678 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
679 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
680 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
681 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
682 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
683 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
684 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
685 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
686 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
687 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
688 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
689 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
690 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
691 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
692 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
693 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
694 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
695 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
696 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
697 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
698 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
699 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
700 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
701 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
702 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
703 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
704 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
705 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
706 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
707 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
708 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
709 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
710 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
711 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
712 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
713 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
714 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
715 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
716 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
717 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
718 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
719 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
720 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
721 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
722 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
723 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
724 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
725 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
726 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
727 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
728 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
729 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
730 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule
731 8056054917 Glycomyces luteolus NEAU-A15 Isolate Rhizosphere
732 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere
733 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
734 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere
735 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
736 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere
737 8057568493 Actinorhabdospora filicis NBRC 111898 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.85
Metatranscriptomes 0.48
Isolates 11.67

Biome Distribution

Category Percentage (%)
Aerial Root 0.05
Bulb 0
Endosphere 5.62
Nodule 0.32
Rhizoplane 7.59
Rhizosphere 75.01
Stem 0
Stem Tuber 0.11
Unclassified 11.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1000708 3300001977 Bacteria 5132
2 JGI24740J21852_10011444 3300001979 Bacteria 3376
3 JGI24739J22299_10014613 3300001989 Bacteria 2854
4 JGI24739J22299_10018783 3300001989 Bacteria 2481
5 JGI24737J22298_10004741 3300001990 Bacteria 4720
6 JGI24737J22298_10006559 3300001990 Bacteria 3969
7 JGI24743J22301_10001116 3300001991 Bacteria 3594
8 JGI24735J21928_10017868 3300002067 Bacteria 2191
9 JGI24745J21846_1003475 3300002073 Bacteria 1649
10 JGI24742J22300_10001558 3300002244 Bacteria 3640
11 JGI24751J29686_10000209 3300002459 Bacteria 25027
12 JGI25164J39214_1001833 3300002772 Bacteria 4042
13 JGI25406J46586_10000769 3300003203 Bacteria 15054
14 JGI25406J46586_10018706 3300003203 Bacteria 2841
15 JGI25165J46597_1000107 3300003214 Bacteria 150846
16 Ga0007423J48922_100181 3300003285 Bacteria 5259
17 rootH1_10007198 3300003323 Bacteria 3264
18 JGI25407J50210_10003181 3300003373 Bacteria 3906
19 Ga0006562J51391_1043768 3300003578 Bacteria 1770
20 Ga0006562J51391_1058926 3300003578 Bacteria 6670
21 Ga0006562J51391_1058927 3300003578 Bacteria 6811
22 Ga0055539_1000019 3300003752 Bacteria 341727
23 Ga0055533_1000023 3300003756 Bacteria 341727
24 Ga0055527_1000025 3300003760 Bacteria 195817
25 Ga0055542_1000048 3300003762 Bacteria 195800
26 Ga0055529_1000057 3300003763 Bacteria 195807
27 Ga0055540_1000071 3300003792 Bacteria 117607
28 Ga0055540_1000645 3300003792 Bacteria 24587
29 Ga0055540_1005868 3300003792 Bacteria 5029
30 Ga0055541_1003256 3300003841 Bacteria 3077
31 JGI25405J52794_10008121 3300003911 Bacteria 1952
32 Ga0065714_10072535 3300005288 Bacteria 3350
33 Ga0070658_10018256 3300005327 Bacteria 5614
34 Ga0070658_10027987 3300005327 Bacteria 4524
35 Ga0070676_10017998 3300005328 Bacteria 3913
36 Ga0070676_10032460 3300005328 Bacteria 2991
37 Ga0070676_10124627 3300005328 Bacteria 1621
38 Ga0070683_100195291 3300005329 Bacteria 1921
39 Ga0070690_100023491 3300005330 Bacteria 3781
40 Ga0070670_100033934 3300005331 Bacteria 4393
41 Ga0070670_100038607 3300005331 Bacteria 4106
42 Ga0070670_100068315 3300005331 Bacteria 3050
43 Ga0068869_100002932 3300005334 Bacteria 10356
44 Ga0070666_10054980 3300005335 Bacteria 2686
45 Ga0070666_10069481 3300005335 Bacteria 2395
46 Ga0070682_100034083 3300005337 Bacteria 3098
47 Ga0070682_100098095 3300005337 Bacteria 1929
48 Ga0068868_100046911 3300005338 Bacteria 3382
49 Ga0068868_100189404 3300005338 Bacteria 1710
50 Ga0070660_100004498 3300005339 Bacteria 9634
51 Ga0070689_100025015 3300005340 Bacteria 4483
52 Ga0070691_10008186 3300005341 Bacteria 4791
53 Ga0070687_100045972 3300005343 Bacteria 2232
54 Ga0070692_10044824 3300005345 Bacteria 2280
55 Ga0070668_100003761 3300005347 Bacteria 11196
56 Ga0070668_100004067 3300005347 Bacteria 10833
57 Ga0070668_100006625 3300005347 Bacteria 8583
58 Ga0070668_100020933 3300005347 Bacteria 4941
59 Ga0070675_100042140 3300005354 Bacteria 3729
60 Ga0070675_100094591 3300005354 Bacteria 2507
61 Ga0070671_100000175 3300005355 Bacteria 42569
62 Ga0070671_100000693 3300005355 Bacteria 24230
63 Ga0070671_100016400 3300005355 Bacteria 5991
64 Ga0070674_100009143 3300005356 Bacteria 5926
65 Ga0070674_100064986 3300005356 Bacteria 2559
66 Ga0070674_100067572 3300005356 Bacteria 2515
67 Ga0070674_100083445 3300005356 Bacteria 2288
68 Ga0070688_100104321 3300005365 Bacteria 1874
69 Ga0070659_100003265 3300005366 Bacteria 11535
70 Ga0070659_100022487 3300005366 Bacteria 4814
71 Ga0070659_100026863 3300005366 Bacteria 4430
72 Ga0070659_100172705 3300005366 Bacteria 1771
73 Ga0070659_100208152 3300005366 Bacteria 1611
74 Ga0070667_100000960 3300005367 Bacteria 26531
75 Ga0070667_100000995 3300005367 Bacteria 26025
76 Ga0070667_100006339 3300005367 Bacteria 9832
77 Ga0070667_100010135 3300005367 Bacteria 7796
78 Ga0070667_100035109 3300005367 Bacteria 4200
79 Ga0070667_100045890 3300005367 Bacteria 3675
80 Ga0070703_10000050 3300005406 Bacteria 57436
81 Ga0070709_10012282 3300005434 Bacteria 4791
82 Ga0070714_100000126 3300005435 Bacteria 60425
83 Ga0070714_100002231 3300005435 Bacteria 14270
84 Ga0070714_100013034 3300005435 Bacteria 6651
85 Ga0070714_100071252 3300005435 Bacteria 3005
86 Ga0070714_100302751 3300005435 Bacteria 1491
87 Ga0070710_10001385 3300005437 Bacteria 11439
88 Ga0070710_10007135 3300005437 Bacteria 5398
89 Ga0070701_10001222 3300005438 Bacteria 9419
90 Ga0070701_10006381 3300005438 Bacteria 4960
91 Ga0070701_10007222 3300005438 Bacteria 4729
92 Ga0070711_100002751 3300005439 Bacteria 10083
93 Ga0070711_100016193 3300005439 Bacteria 4731
94 Ga0070705_100002793 3300005440 Bacteria 8698
95 Ga0070705_100109810 3300005440 Bacteria 1760
96 Ga0070705_100126453 3300005440 Bacteria 1660
97 Ga0070705_100165590 3300005440 Bacteria 1482
98 Ga0070700_100002767 3300005441 Bacteria 8967
99 Ga0070700_100009980 3300005441 Bacteria 5227
100 Ga0070700_100033994 3300005441 Bacteria 3075
101 Ga0070708_100001634 3300005445 Bacteria 17181
102 Ga0070708_100081920 3300005445 Bacteria 2922
103 Ga0070708_100185454 3300005445 Bacteria 1945
104 Ga0070708_100209049 3300005445 Bacteria 1828
105 Ga0070663_100021613 3300005455 Bacteria 4283
106 Ga0070663_100040375 3300005455 Bacteria 3266
107 Ga0070678_100000629 3300005456 Bacteria 17329
108 Ga0070678_100002337 3300005456 Bacteria 10354
109 Ga0070678_100110041 3300005456 Bacteria 2154
110 Ga0070662_100004566 3300005457 Bacteria 8767
111 Ga0070662_100010075 3300005457 Bacteria 6192
112 Ga0070662_100014118 3300005457 Bacteria 5328
113 Ga0068867_100005051 3300005459 Bacteria 9313
114 Ga0068867_100035193 3300005459 Bacteria 3632
115 Ga0070685_10019185 3300005466 Bacteria 3687
116 Ga0070706_100001603 3300005467 Bacteria 23576
117 Ga0070706_100002425 3300005467 Bacteria 18781
118 Ga0070706_100005928 3300005467 Bacteria 11566
119 Ga0070706_100090432 3300005467 Bacteria 2838
120 Ga0070707_100000324 3300005468 Bacteria 46880
121 Ga0070707_100000970 3300005468 Bacteria 28392
122 Ga0070698_100000293 3300005471 Bacteria 50987
123 Ga0070698_100000372 3300005471 Bacteria 46727
124 Ga0070698_100010138 3300005471 Bacteria 10067
125 Ga0070698_100016904 3300005471 Bacteria 7693
126 Ga0070698_100032044 3300005471 Bacteria 5446
127 Ga0070698_100078423 3300005471 Bacteria 3301
128 Ga0070698_100086268 3300005471 Bacteria 3125
129 Ga0070698_100129954 3300005471 Bacteria 2475
130 Ga0070698_100180339 3300005471 Bacteria 2051
131 Ga0070699_100006304 3300005518 Bacteria 10348
132 Ga0070679_100003617 3300005530 Bacteria 14128
133 Ga0070684_100022248 3300005535 Bacteria 5284
134 Ga0070697_100137220 3300005536 Bacteria 2054
135 Ga0068853_100005838 3300005539 Bacteria 9695
136 Ga0068853_100025071 3300005539 Bacteria 5003
137 Ga0068853_100061206 3300005539 Bacteria 3255
138 Ga0070672_100075639 3300005543 Bacteria 2689
139 Ga0070672_100100113 3300005543 Bacteria 2350
140 Ga0070672_100154411 3300005543 Bacteria 1901
141 Ga0070686_100006816 3300005544 Bacteria 6360
142 Ga0070686_100037792 3300005544 Bacteria 2997
143 Ga0070686_100042248 3300005544 Bacteria 2855
144 Ga0070696_100006372 3300005546 Bacteria 7894
145 Ga0070696_100008936 3300005546 Bacteria 6704
146 Ga0070693_100012317 3300005547 Bacteria 4326
147 Ga0070665_100001439 3300005548 Bacteria 27904
148 Ga0070665_100003390 3300005548 Bacteria 17043
149 Ga0070665_100004418 3300005548 Bacteria 14773
150 Ga0070665_100022040 3300005548 Bacteria 6409
151 Ga0070665_100022884 3300005548 Bacteria 6291
152 Ga0070665_100037988 3300005548 Bacteria 4841
153 Ga0070665_100108196 3300005548 Bacteria 2782
154 Ga0070665_100164564 3300005548 Bacteria 2220
155 Ga0070665_100203863 3300005548 Bacteria 1978
156 Ga0070704_100002771 3300005549 Bacteria 9918
157 Ga0070704_100010596 3300005549 Bacteria 5613
158 Ga0070704_100011659 3300005549 Bacteria 5398
159 Ga0070704_100079868 3300005549 Bacteria 2404
160 Ga0068855_100016329 3300005563 Bacteria 8928
161 Ga0068855_100220046 3300005563 Bacteria 2130
162 Ga0070664_100006163 3300005564 Bacteria 9694
163 Ga0070664_100022615 3300005564 Bacteria 5184
164 Ga0070664_100110472 3300005564 Bacteria 2399
165 Ga0070664_100117944 3300005564 Bacteria 2321
166 Ga0068857_100053854 3300005577 Bacteria 3569
167 Ga0068857_100128672 3300005577 Bacteria 2283
168 Ga0068854_100003641 3300005578 Bacteria 9642
169 Ga0068856_100114923 3300005614 Bacteria 2690
170 Ga0070702_100001386 3300005615 Bacteria 9902
171 Ga0070702_100004590 3300005615 Bacteria 6325
172 Ga0070702_100005972 3300005615 Bacteria 5728
173 Ga0068852_100010514 3300005616 Bacteria 6921
174 Ga0068859_100004535 3300005617 Bacteria 14163
175 Ga0068859_100012411 3300005617 Bacteria 8572
176 Ga0068859_100048278 3300005617 Bacteria 4276
177 Ga0068859_100127831 3300005617 Bacteria 2612
178 Ga0068859_100194686 3300005617 Bacteria 2111
179 Ga0068864_100038615 3300005618 Bacteria 4079
180 Ga0068864_100053011 3300005618 Bacteria 3498
181 Ga0068864_100057253 3300005618 Bacteria 3367
182 Ga0068864_100067923 3300005618 Bacteria 3096
183 Ga0068866_10001953 3300005718 Bacteria 8594
184 Ga0068866_10023813 3300005718 Bacteria 2853
185 Ga0068866_10031366 3300005718 Bacteria 2559
186 Ga0068861_100007802 3300005719 Bacteria 7355
187 Ga0068861_100048451 3300005719 Bacteria 3212
188 Ga0068861_100094605 3300005719 Bacteria 2364
189 Ga0068851_10029524 3300005834 Bacteria 2715
190 Ga0068870_10006734 3300005840 Bacteria 5087
191 Ga0068863_100000105 3300005841 Bacteria 90388
192 Ga0068863_100001135 3300005841 Bacteria 26616
193 Ga0068863_100004403 3300005841 Bacteria 13889
194 Ga0068863_100009010 3300005841 Bacteria 9743
195 Ga0068863_100054883 3300005841 Bacteria 3774
196 Ga0068863_100064794 3300005841 Bacteria 3456
197 Ga0068858_100009323 3300005842 Bacteria 9371
198 Ga0068858_100010352 3300005842 Bacteria 8832
199 Ga0068858_100010474 3300005842 Bacteria 8783
200 Ga0068858_100033716 3300005842 Bacteria 4749
201 Ga0068858_100056289 3300005842 Bacteria 3635
202 Ga0068860_100000209 3300005843 Bacteria 92811
203 Ga0068860_100000261 3300005843 Bacteria 77163
204 Ga0068860_100001858 3300005843 Bacteria 22473
205 Ga0068860_100002620 3300005843 Bacteria 18701
206 Ga0068860_100024061 3300005843 Bacteria 5888
207 Ga0068860_100036357 3300005843 Bacteria 4720
208 Ga0068862_100000400 3300005844 Bacteria 46788
209 Ga0068862_100005740 3300005844 Bacteria 10354
210 Ga0068862_100008410 3300005844 Bacteria 8538
211 Ga0081455_10000290 3300005937 Bacteria 66541
212 Ga0081455_10002415 3300005937 Bacteria 22283
213 Ga0081455_10004439 3300005937 Bacteria 15744
214 Ga0081455_10009174 3300005937 Bacteria 10195
215 Ga0081455_10020571 3300005937 Bacteria 6210
216 Ga0081455_10023343 3300005937 Bacteria 5757
217 Ga0081455_10024363 3300005937 Bacteria 5606
218 Ga0081455_10043329 3300005937 Bacteria 3937
219 Ga0081455_10070877 3300005937 Bacteria 2892
220 Ga0081455_10090545 3300005937 Bacteria 2480
221 Ga0081538_10000367 3300005981 Bacteria 51530
222 Ga0081540_1010259 3300005983 Bacteria 6361
223 Ga0081540_1010699 3300005983 Bacteria 6183
224 Ga0081540_1056433 3300005983 Bacteria 1906
225 Ga0081539_10000474 3300005985 Bacteria 85045
226 Ga0081539_10001780 3300005985 Bacteria 34234
227 Ga0081539_10002475 3300005985 Bacteria 25990
228 Ga0081539_10006896 3300005985 Bacteria 10595
229 Ga0081539_10008770 3300005985 Bacteria 8675
230 Ga0081539_10011550 3300005985 Bacteria 6964
231 Ga0081539_10015464 3300005985 Bacteria 5544
232 Ga0081539_10032775 3300005985 Bacteria 3176
233 Ga0081539_10035770 3300005985 Bacteria 2980
234 Ga0081539_10080860 3300005985 Bacteria 1708
235 Ga0070717_10009137 3300006028 Bacteria 7446
236 Ga0075365_10000552 3300006038 Bacteria 14463
237 Ga0075365_10005206 3300006038 Bacteria 6995
238 Ga0075365_10045154 3300006038 Bacteria 2889
239 Ga0075365_10058072 3300006038 Bacteria 2575
240 Ga0075365_10062129 3300006038 Bacteria 2497
241 Ga0075365_10083932 3300006038 Bacteria 2161
242 Ga0075363_100003661 3300006048 Bacteria 6600
243 Ga0075363_100007170 3300006048 Bacteria 5104
244 Ga0075363_100008051 3300006048 Bacteria 4887
245 Ga0075363_100008798 3300006048 Bacteria 4721
246 Ga0075363_100022474 3300006048 Bacteria 3188
247 Ga0075363_100032455 3300006048 Bacteria 2712
248 Ga0075364_10000646 3300006051 Bacteria 17975
249 Ga0075364_10000830 3300006051 Bacteria 16299
250 Ga0075364_10004234 3300006051 Bacteria 8237
251 Ga0075364_10012091 3300006051 Bacteria 5267
252 Ga0075364_10014121 3300006051 Bacteria 4929
253 Ga0075364_10071602 3300006051 Bacteria 2284
254 Ga0075364_10078862 3300006051 Bacteria 2176
255 Ga0075432_10006628 3300006058 Bacteria 3940
256 Ga0070716_100006287 3300006173 Bacteria 5795
257 Ga0070712_100003408 3300006175 Bacteria 9782
258 Ga0070712_100003957 3300006175 Bacteria 9111
259 Ga0070712_100061058 3300006175 Bacteria 2661
260 Ga0070712_100062868 3300006175 Bacteria 2626
261 Ga0075367_10015626 3300006178 Bacteria 4131
262 Ga0075367_10027016 3300006178 Bacteria 3261
263 Ga0075367_10033445 3300006178 Bacteria 2963
264 Ga0075367_10037719 3300006178 Bacteria 2809
265 Ga0075369_10000684 3300006186 Bacteria 10833
266 Ga0097621_100009223 3300006237 Bacteria 7156
267 Ga0097621_100075892 3300006237 Bacteria 2787
268 Ga0075370_10008168 3300006353 Bacteria 5372
269 Ga0075370_10026952 3300006353 Bacteria 3186
270 Ga0075428_100000203 3300006844 Bacteria 56882
271 Ga0075428_100047731 3300006844 Bacteria 4702
272 Ga0075428_100142137 3300006844 Bacteria 2609
273 Ga0075428_100165929 3300006844 Bacteria 2395
274 Ga0075430_100004467 3300006846 Bacteria 11799
275 Ga0075430_100069161 3300006846 Bacteria 2962
276 Ga0075431_100023915 3300006847 Bacteria 6254
277 Ga0075431_100144417 3300006847 Bacteria 2452
278 Ga0075433_10001584 3300006852 Bacteria 16851
279 Ga0075433_10004531 3300006852 Bacteria 10836
280 Ga0075433_10012177 3300006852 Bacteria 6936
281 Ga0075433_10149382 3300006852 Bacteria 2078
282 Ga0075434_100001999 3300006871 Bacteria 17701
283 Ga0075434_100010168 3300006871 Bacteria 8814
284 Ga0075434_100032417 3300006871 Bacteria 5152
285 Ga0075434_100033684 3300006871 Bacteria 5057
286 Ga0075429_100070269 3300006880 Bacteria 3048
287 Ga0068865_100002783 3300006881 Bacteria 10391
288 Ga0068865_100057694 3300006881 Bacteria 2709
289 Ga0097620_100004535 3300006931 Bacteria 14163
290 Ga0097620_100012409 3300006931 Bacteria 8572
291 Ga0097620_100048278 3300006931 Bacteria 4276
292 Ga0097620_100127828 3300006931 Bacteria 2612
293 Ga0097620_100194683 3300006931 Bacteria 2111
294 Ga0099826_10058892 3300006948 Bacteria 2515
295 Ga0075435_100004935 3300007076 Bacteria 9254
296 Ga0075435_100015051 3300007076 Bacteria 5805
297 Ga0075435_100018987 3300007076 Bacteria 5239
298 Ga0075435_100188495 3300007076 Bacteria 1745
299 Ga0105251_10014758 3300009011 Bacteria 4302
300 Ga0105240_10190176 3300009093 Bacteria 2414
301 Ga0105240_10248131 3300009093 Bacteria 2060
302 Ga0111539_10022303 3300009094 Bacteria 7782
303 Ga0111539_10053720 3300009094 Bacteria 4795
304 Ga0111539_10109140 3300009094 Bacteria 3247
305 Ga0111539_10268440 3300009094 Bacteria 1986
306 Ga0105245_10006580 3300009098 Bacteria 10200
307 Ga0105245_10009833 3300009098 Bacteria 8333
308 Ga0105245_10022661 3300009098 Bacteria 5513
309 Ga0105245_10084225 3300009098 Bacteria 2912
310 Ga0105245_10094732 3300009098 Bacteria 2753
311 Ga0105245_10102396 3300009098 Bacteria 2652
312 Ga0105245_10122666 3300009098 Bacteria 2429
313 Ga0105247_10000141 3300009101 Bacteria 70210
314 Ga0105247_10003401 3300009101 Bacteria 10399
315 Ga0105247_10041004 3300009101 Bacteria 2831
316 Ga0105247_10044546 3300009101 Bacteria 2721
317 Ga0114129_10006795 3300009147 Bacteria 16241
318 Ga0114129_10010215 3300009147 Bacteria 13386
319 Ga0114129_10077685 3300009147 Bacteria 4617
320 Ga0114129_10093729 3300009147 Bacteria 4159
321 Ga0114129_10457563 3300009147 Bacteria 1673
322 Ga0105243_10003636 3300009148 Bacteria 12410
323 Ga0105243_10004875 3300009148 Bacteria 10531
324 Ga0105243_10005454 3300009148 Bacteria 9925
325 Ga0105243_10027652 3300009148 Bacteria 4348
326 Ga0105243_10090292 3300009148 Bacteria 2521
327 Ga0105242_10004138 3300009176 Bacteria 11293
328 Ga0105242_10006982 3300009176 Bacteria 8716
329 Ga0105242_10019706 3300009176 Bacteria 5287
330 Ga0105242_10028160 3300009176 Bacteria 4469
331 Ga0105242_10168970 3300009176 Bacteria 1920
332 Ga0105242_10235487 3300009176 Bacteria 1643
333 Ga0105248_10001091 3300009177 Bacteria 30053
334 Ga0105248_10013543 3300009177 Bacteria 8977
335 Ga0105248_10014779 3300009177 Bacteria 8596
336 Ga0105248_10029514 3300009177 Bacteria 6118
337 Ga0105248_10101734 3300009177 Bacteria 3238
338 Ga0105248_10102450 3300009177 Bacteria 3226
339 Ga0105248_10138281 3300009177 Bacteria 2748
340 Ga0105248_10190584 3300009177 Bacteria 2310
341 Ga0105237_10001867 3300009545 Bacteria 26871
342 Ga0105237_10003741 3300009545 Bacteria 17926
343 Ga0105237_10227152 3300009545 Bacteria 1867
344 Ga0105238_10060551 3300009551 Bacteria 3790
345 Ga0105249_10000031 3300009553 Bacteria 220006
346 Ga0105249_10016677 3300009553 Bacteria 6520
347 Ga0105249_10090233 3300009553 Bacteria 2865
348 Ga0105249_10196957 3300009553 Bacteria 1969
349 Ga0099796_10014198 3300010159 Bacteria 2295
350 Ga0105239_10009568 3300010375 Bacteria 10904
351 Ga0105239_10045403 3300010375 Bacteria 4815
352 Ga0105239_10074964 3300010375 Bacteria 3720
353 Ga0105239_10078456 3300010375 Bacteria 3634
354 Ga0105239_10098373 3300010375 Bacteria 3234
355 Ga0105246_10001651 3300011119 Bacteria 13303
356 Ga0105246_10019564 3300011119 Bacteria 4328
357 Ga0105246_10040589 3300011119 Bacteria 3141
358 Ga0105246_10055379 3300011119 Bacteria 2737
359 Ga0157370_10139237 3300013104 Bacteria 2261
360 Ga0157369_10011357 3300013105 Bacteria 10115
361 Ga0157369_10012786 3300013105 Bacteria 9517
362 Ga0157369_10039453 3300013105 Bacteria 5160
363 Ga0157369_10315700 3300013105 Bacteria 1625
364 Ga0157374_10039291 3300013296 Bacteria 4355
365 Ga0157378_10006854 3300013297 Bacteria 9936
366 Ga0157378_10008086 3300013297 Bacteria 9179
367 Ga0157378_10035746 3300013297 Bacteria 4396
368 Ga0157378_10043288 3300013297 Bacteria 3997
369 Ga0163162_10016218 3300013306 Bacteria 7286
370 Ga0163162_10111716 3300013306 Bacteria 2831
371 Ga0163162_10127905 3300013306 Bacteria 2648
372 Ga0163162_10211394 3300013306 Bacteria 2070
373 Ga0163162_10392924 3300013306 Bacteria 1519
374 Ga0157372_10000131 3300013307 Bacteria 82235
375 Ga0157372_10006674 3300013307 Bacteria 12276
376 Ga0157372_10012663 3300013307 Bacteria 8985
377 Ga0157372_10365711 3300013307 Bacteria 1681
378 Ga0157375_10001251 3300013308 Bacteria 21991
379 Ga0157375_10004579 3300013308 Bacteria 12013
380 Ga0157375_10028262 3300013308 Bacteria 5254
381 Ga0157375_10053546 3300013308 Bacteria 3971
382 Ga0157375_10258580 3300013308 Bacteria 1902
383 Ga0163163_10044765 3300014325 Bacteria 4342
384 Ga0163163_10081878 3300014325 Bacteria 3231
385 Ga0163163_10232732 3300014325 Bacteria 1892
386 Ga0163163_10250054 3300014325 Bacteria 1823
387 Ga0163163_10357907 3300014325 Bacteria 1516
388 Ga0157380_10009826 3300014326 Bacteria 6868
389 Ga0157380_10035216 3300014326 Bacteria 3866
390 Ga0157380_10054693 3300014326 Bacteria 3168
391 Ga0157380_10058555 3300014326 Bacteria 3071
392 Ga0157380_10111892 3300014326 Bacteria 2296
393 Ga0182008_10000766 3300014497 Bacteria 22531
394 Ga0157377_10005202 3300014745 Bacteria 6090
395 Ga0157379_10006578 3300014968 Bacteria 10030
396 Ga0157379_10008367 3300014968 Bacteria 8990
397 Ga0157379_10042614 3300014968 Bacteria 4053
398 Ga0157379_10056310 3300014968 Bacteria 3513
399 Ga0157379_10137423 3300014968 Bacteria 2202
400 Ga0157376_10014307 3300014969 Bacteria 5950
401 Ga0182007_10001033 3300015262 Bacteria 15217
402 Ga0183367_1008 3300015688 Bacteria 490626
403 Ga0163161_10046285 3300017792 Bacteria 3139
404 Ga0197907_10311176 3300020069 Bacteria 4437
405 Ga0206354_10723847 3300020081 Bacteria 2099
406 Ga0206353_10371772 3300020082 Bacteria 10645
407 Ga0206353_11970105 3300020082 Bacteria 2691
408 Ga0206353_12064141 3300020082 Bacteria 5506
409 Ga0213873_10000084 3300021358 Bacteria 19378
410 Ga0213876_10001902 3300021384 Bacteria 12559
411 Ga0213876_10066972 3300021384 Bacteria 1896
412 Ga0213875_10000723 3300021388 Bacteria 25222
413 Ga0213875_10007311 3300021388 Bacteria 5713
414 Ga0209566_100031 3300025225 Bacteria 341555
415 Ga0209674_100001 3300025226 Bacteria 4013750
416 Ga0209672_100011 3300025228 Bacteria 856297
417 Ga0209147_100619 3300025229 Bacteria 19317
418 Ga0209563_100001 3300025230 Bacteria 4013775
419 Ga0209563_100251 3300025230 Bacteria 25150
420 Ga0207427_100028 3300025231 Bacteria 388949
421 Ga0209437_100581 3300025233 Bacteria 23408
422 Ga0209258_102077 3300025242 Bacteria 5672
423 Ga0209677_100001 3300025253 Bacteria 4013787
424 Ga0209677_101937 3300025253 Bacteria 8274
425 Ga0209148_1000023 3300025254 Bacteria 680511
426 Ga0209233_1000001 3300025261 Bacteria 2992747
427 Ga0209455_1000023 3300025272 Bacteria 680449
428 Ga0207426_1012267 3300025302 Bacteria 3225
429 Ga0207426_1013677 3300025302 Bacteria 2997
430 Ga0209051_1000033 3300025303 Bacteria 380540
431 Ga0209051_1001934 3300025303 Bacteria 15989
432 Ga0209051_1008041 3300025303 Bacteria 5650
433 Ga0207653_10000062 3300025885 Bacteria 82254
434 Ga0207653_10010318 3300025885 Bacteria 2913
435 Ga0207692_10017637 3300025898 Bacteria 3187
436 Ga0207692_10052702 3300025898 Bacteria 2069
437 Ga0207642_10000179 3300025899 Bacteria 18334
438 Ga0207642_10036319 3300025899 Bacteria 2113
439 Ga0207710_10000164 3300025900 Bacteria 70180
440 Ga0207710_10001390 3300025900 Bacteria 12141
441 Ga0207710_10019598 3300025900 Bacteria 2886
442 Ga0207688_10001929 3300025901 Bacteria 11111
443 Ga0207688_10002258 3300025901 Bacteria 10371
444 Ga0207688_10002697 3300025901 Bacteria 9613
445 Ga0207688_10009599 3300025901 Bacteria 5269
446 Ga0207688_10010060 3300025901 Bacteria 5145
447 Ga0207688_10034165 3300025901 Bacteria 2815
448 Ga0207680_10007714 3300025903 Bacteria 5261
449 Ga0207680_10010715 3300025903 Bacteria 4599
450 Ga0207680_10041780 3300025903 Bacteria 2678
451 Ga0207647_10031692 3300025904 Bacteria 3400
452 Ga0207647_10058703 3300025904 Bacteria 2356
453 Ga0207647_10066759 3300025904 Bacteria 2181
454 Ga0207685_10001306 3300025905 Bacteria 5123
455 Ga0207685_10013931 3300025905 Bacteria 2503
456 Ga0207645_10027362 3300025907 Bacteria 3683
457 Ga0207645_10068103 3300025907 Bacteria 2276
458 Ga0207643_10002462 3300025908 Bacteria 9994
459 Ga0207643_10032559 3300025908 Bacteria 2912
460 Ga0207684_10000325 3300025910 Bacteria 67308
461 Ga0207684_10001691 3300025910 Bacteria 23442
462 Ga0207684_10027081 3300025910 Bacteria 4889
463 Ga0207684_10048508 3300025910 Bacteria 3601
464 Ga0207654_10095284 3300025911 Bacteria 1823
465 Ga0207695_10002209 3300025913 Bacteria 29277
466 Ga0207671_10000910 3300025914 Bacteria 37314
467 Ga0207671_10010542 3300025914 Bacteria 7613
468 Ga0207693_10000726 3300025915 Bacteria 29700
469 Ga0207693_10005747 3300025915 Bacteria 10294
470 Ga0207693_10014795 3300025915 Bacteria 6269
471 Ga0207693_10131086 3300025915 Bacteria 1971
472 Ga0207663_10001527 3300025916 Bacteria 10827
473 Ga0207663_10002588 3300025916 Bacteria 8701
474 Ga0207663_10011316 3300025916 Bacteria 4788
475 Ga0207663_10058299 3300025916 Bacteria 2436
476 Ga0207657_10009678 3300025919 Bacteria 9671
477 Ga0207657_10034643 3300025919 Bacteria 4538
478 Ga0207657_10120542 3300025919 Bacteria 2158
479 Ga0207646_10000600 3300025922 Bacteria 46885
480 Ga0207646_10006936 3300025922 Bacteria 11627
481 Ga0207681_10000456 3300025923 Bacteria 28674
482 Ga0207681_10085473 3300025923 Bacteria 2239
483 Ga0207694_10000405 3300025924 Bacteria 40220
484 Ga0207694_10038163 3300025924 Bacteria 3693
485 Ga0207650_10005383 3300025925 Bacteria 8728
486 Ga0207650_10026865 3300025925 Bacteria 4113
487 Ga0207650_10041192 3300025925 Bacteria 3383
488 Ga0207659_10064067 3300025926 Bacteria 2659
489 Ga0207687_10005294 3300025927 Bacteria 8550
490 Ga0207687_10009711 3300025927 Bacteria 6295
491 Ga0207687_10028702 3300025927 Bacteria 3739
492 Ga0207687_10089023 3300025927 Bacteria 2247
493 Ga0207687_10099407 3300025927 Bacteria 2138
494 Ga0207700_10005737 3300025928 Bacteria 7456
495 Ga0207700_10047047 3300025928 Bacteria 3195
496 Ga0207664_10000082 3300025929 Bacteria 95257
497 Ga0207664_10005356 3300025929 Bacteria 8764
498 Ga0207664_10008129 3300025929 Bacteria 7299
499 Ga0207664_10014402 3300025929 Bacteria 5709
500 Ga0207664_10059043 3300025929 Bacteria 3054
501 Ga0207644_10000564 3300025931 Bacteria 23737
502 Ga0207644_10010594 3300025931 Bacteria 6079
503 Ga0207644_10058466 3300025931 Bacteria 2787
504 Ga0207644_10087035 3300025931 Bacteria 2321
505 Ga0207690_10013667 3300025932 Bacteria 4885
506 Ga0207706_10007345 3300025933 Bacteria 10187
507 Ga0207706_10019235 3300025933 Bacteria 6141
508 Ga0207686_10037575 3300025934 Bacteria 2923
509 Ga0207709_10002137 3300025935 Bacteria 12664
510 Ga0207709_10011590 3300025935 Bacteria 4863
511 Ga0207709_10031082 3300025935 Bacteria 3114
512 Ga0207670_10013218 3300025936 Bacteria 4858
513 Ga0207670_10078538 3300025936 Bacteria 2302
514 Ga0207669_10001598 3300025937 Bacteria 9649
515 Ga0207669_10008741 3300025937 Bacteria 4776
516 Ga0207669_10032739 3300025937 Bacteria 2924
517 Ga0207669_10085760 3300025937 Bacteria 2034
518 Ga0207669_10106313 3300025937 Bacteria 1869
519 Ga0207704_10002309 3300025938 Bacteria 8573
520 Ga0207704_10062815 3300025938 Bacteria 2311
521 Ga0207665_10004580 3300025939 Bacteria 9178
522 Ga0207665_10015744 3300025939 Bacteria 4963
523 Ga0207665_10036942 3300025939 Bacteria 3250
524 Ga0207665_10041490 3300025939 Bacteria 3074
525 Ga0207691_10017365 3300025940 Bacteria 6826
526 Ga0207691_10047852 3300025940 Bacteria 3923
527 Ga0207691_10077702 3300025940 Bacteria 2989
528 Ga0207711_10000196 3300025941 Bacteria 64910
529 Ga0207711_10018619 3300025941 Bacteria 5774
530 Ga0207711_10041264 3300025941 Bacteria 3929
531 Ga0207711_10206317 3300025941 Bacteria 1794
532 Ga0207689_10002479 3300025942 Bacteria 17159
533 Ga0207689_10117628 3300025942 Bacteria 2185
534 Ga0207661_10008291 3300025944 Bacteria 7425
535 Ga0207661_10121816 3300025944 Bacteria 2221
536 Ga0207679_10015063 3300025945 Bacteria 5098
537 Ga0207679_10134134 3300025945 Bacteria 1991
538 Ga0207667_10042028 3300025949 Bacteria 4862
539 Ga0207667_10072320 3300025949 Bacteria 3585
540 Ga0207667_10104289 3300025949 Bacteria 2925
541 Ga0207667_10113164 3300025949 Bacteria 2798
542 Ga0207712_10000029 3300025961 Bacteria 220014
543 Ga0207712_10014228 3300025961 Bacteria 5111
544 Ga0207668_10006881 3300025972 Bacteria 6748
545 Ga0207668_10009927 3300025972 Bacteria 5724
546 Ga0207668_10060365 3300025972 Bacteria 2661
547 Ga0207640_10001076 3300025981 Bacteria 15126
548 Ga0207640_10098135 3300025981 Bacteria 2047
549 Ga0207658_10000517 3300025986 Bacteria 35169
550 Ga0207658_10000850 3300025986 Bacteria 25516
551 Ga0207658_10004057 3300025986 Bacteria 10224
552 Ga0207658_10024654 3300025986 Bacteria 4210
553 Ga0207658_10041620 3300025986 Bacteria 3328
554 Ga0207677_10006454 3300026023 Bacteria 6437
555 Ga0207677_10009603 3300026023 Bacteria 5445
556 Ga0207677_10132116 3300026023 Bacteria 1897
557 Ga0207677_10145946 3300026023 Bacteria 1818
558 Ga0207703_10007260 3300026035 Bacteria 8811
559 Ga0207703_10020636 3300026035 Bacteria 5153
560 Ga0207703_10023378 3300026035 Bacteria 4854
561 Ga0207703_10084282 3300026035 Bacteria 2657
562 Ga0207678_10003353 3300026067 Bacteria 14451
563 Ga0207678_10032351 3300026067 Bacteria 4558
564 Ga0207678_10042275 3300026067 Bacteria 3949
565 Ga0207678_10062387 3300026067 Bacteria 3204
566 Ga0207678_10071753 3300026067 Bacteria 2969
567 Ga0207678_10129254 3300026067 Bacteria 2154
568 Ga0207708_10004753 3300026075 Bacteria 9994
569 Ga0207708_10006787 3300026075 Bacteria 8471
570 Ga0207708_10018905 3300026075 Bacteria 5189
571 Ga0207708_10019809 3300026075 Bacteria 5073
572 Ga0207708_10022689 3300026075 Bacteria 4739
573 Ga0207708_10058417 3300026075 Bacteria 2943
574 Ga0207708_10081222 3300026075 Bacteria 2491
575 Ga0207708_10096280 3300026075 Bacteria 2287
576 Ga0207702_10151189 3300026078 Bacteria 2112
577 Ga0207641_10002103 3300026088 Bacteria 18819
578 Ga0207641_10004316 3300026088 Bacteria 12349
579 Ga0207641_10033440 3300026088 Bacteria 4271
580 Ga0207641_10126229 3300026088 Bacteria 2291
581 Ga0207648_10009508 3300026089 Bacteria 9301
582 Ga0207648_10011289 3300026089 Bacteria 8422
583 Ga0207648_10036581 3300026089 Bacteria 4325
584 Ga0207648_10044017 3300026089 Bacteria 3918
585 Ga0207676_10016796 3300026095 Bacteria 5298
586 Ga0207676_10065671 3300026095 Bacteria 2890
587 Ga0207674_10001198 3300026116 Bacteria 33773
588 Ga0207674_10035199 3300026116 Bacteria 5227
589 Ga0207674_10045935 3300026116 Bacteria 4488
590 Ga0207674_10070254 3300026116 Bacteria 3520
591 Ga0207675_100008196 3300026118 Bacteria 9845
592 Ga0207675_100008622 3300026118 Bacteria 9586
593 Ga0207675_100015055 3300026118 Bacteria 7217
594 Ga0207675_100048519 3300026118 Bacteria 3963
595 Ga0207675_100140274 3300026118 Bacteria 2296
596 Ga0207675_100153081 3300026118 Bacteria 2196
597 Ga0207683_10000327 3300026121 Bacteria 43250
598 Ga0207683_10003687 3300026121 Bacteria 13311
599 Ga0207683_10006112 3300026121 Bacteria 10312
600 Ga0207683_10021432 3300026121 Bacteria 5532
601 Ga0207683_10028085 3300026121 Bacteria 4865
602 Ga0207683_10064171 3300026121 Bacteria 3236
603 Ga0207683_10133096 3300026121 Bacteria 2237
604 Ga0207698_10039588 3300026142 Bacteria 3494
605 Ga0207698_10083442 3300026142 Bacteria 2586
606 Ga0207698_10095781 3300026142 Bacteria 2444
607 Ga0209813_10001694 3300027866 Bacteria 4967
608 Ga0207428_10003736 3300027907 Bacteria 14611
609 Ga0207428_10011116 3300027907 Bacteria 7993
610 Ga0207428_10015628 3300027907 Bacteria 6560
611 Ga0207428_10129333 3300027907 Bacteria 1933
612 Ga0268266_10000937 3300028379 Bacteria 37178
613 Ga0268266_10003055 3300028379 Bacteria 17117
614 Ga0268266_10004718 3300028379 Bacteria 12965
615 Ga0268266_10006438 3300028379 Bacteria 10754
616 Ga0268266_10019587 3300028379 Bacteria 5765
617 Ga0268266_10048502 3300028379 Bacteria 3641
618 Ga0268266_10122086 3300028379 Bacteria 2319
619 Ga0268266_10156730 3300028379 Bacteria 2057
620 Ga0268266_10265384 3300028379 Bacteria 1592
621 Ga0268265_10000389 3300028380 Bacteria 46920
622 Ga0268265_10005881 3300028380 Bacteria 8360
623 Ga0268265_10020870 3300028380 Bacteria 4579
624 Ga0268265_10141224 3300028380 Bacteria 2017
625 Ga0268264_10000017 3300028381 Bacteria 498037
626 Ga0268264_10000226 3300028381 Bacteria 109817
627 Ga0268264_10000315 3300028381 Bacteria 77227
628 Ga0268264_10004905 3300028381 Bacteria 11335
629 Ga0268264_10051850 3300028381 Bacteria 3420
630 Ga0268264_10058926 3300028381 Bacteria 3217
631 Ga0268264_10100118 3300028381 Bacteria 2517
632 Ga0265334_10001828 3300028573 Bacteria 10137
633 Ga0265336_10008877 3300028666 Bacteria 3504
634 Ga0307517_10043175 3300028786 Bacteria 4809
635 Ga0307515_10000596 3300028794 Bacteria 84243
636 Ga0307515_10022623 3300028794 Bacteria 11066
637 Ga0307515_10061782 3300028794 Bacteria 5304
638 Ga0307515_10085100 3300028794 Bacteria 4051
639 Ga0307515_10129515 3300028794 Bacteria 2790
640 Ga0265338_10013968 3300028800 Bacteria 9004
641 Ga0307511_10000678 3300030521 Bacteria 36277
642 Ga0314311_1022273 3300030733 Bacteria 1784
643 Ga0314311_1197083 3300030733 Bacteria 2098
644 Ga0316179_1002615 3300030734 Bacteria 2369
645 Ga0265340_10001252 3300031247 Bacteria 14590
646 Ga0265327_10000001 3300031251 Bacteria 894475
647 Ga0265327_10000131 3300031251 Bacteria 164189
648 Ga0265327_10002081 3300031251 Bacteria 22359
649 Ga0307513_10000002 3300031456 Bacteria 842612
650 Ga0307513_10001948 3300031456 Bacteria 29204
651 Ga0307513_10006778 3300031456 Bacteria 14939
652 Ga0307513_10040019 3300031456 Bacteria 5188
653 Ga0307509_10027386 3300031507 Bacteria 6342
654 Ga0307509_10143685 3300031507 Bacteria 2316
655 Ga0307408_100161678 3300031548 Bacteria 1779
656 Ga0307408_100181541 3300031548 Bacteria 1688
657 Ga0307508_10032770 3300031616 Bacteria 4691
658 Ga0307508_10099965 3300031616 Bacteria 2495
659 Ga0307514_10029291 3300031649 Bacteria 4431
660 Ga0307514_10029464 3300031649 Bacteria 4414
661 Ga0307514_10079903 3300031649 Bacteria 2422
662 Ga0316575_10011016 3300031665 Bacteria 3336
663 Ga0316579_10001001 3300031691 Bacteria 9921
664 Ga0316579_10006084 3300031691 Bacteria 4904
665 Ga0316576_10005277 3300031727 Bacteria 7871
666 Ga0316576_10029031 3300031727 Bacteria 3904
667 Ga0316578_10011617 3300031728 Bacteria 4615
668 Ga0307516_10021393 3300031730 Bacteria 6657
669 Ga0307516_10031960 3300031730 Bacteria 5304
670 Ga0307413_10000162 3300031824 Bacteria 18383
671 Ga0307407_10042698 3300031903 Bacteria 2544
672 Ga0307407_10113467 3300031903 Bacteria 1705
673 Ga0307412_10020923 3300031911 Bacteria 3988
674 Ga0307412_10028201 3300031911 Bacteria 3510
675 Ga0307412_10038793 3300031911 Bacteria 3070
676 Ga0307412_10062426 3300031911 Bacteria 2509
677 Ga0307409_100091232 3300031995 Bacteria 2496
678 Ga0307409_100105187 3300031995 Bacteria 2352
679 Ga0307409_100109826 3300031995 Bacteria 2310
680 Ga0307416_100246945 3300032002 Bacteria 1734
681 Ga0307416_100291362 3300032002 Bacteria 1616
682 Ga0307411_10025869 3300032005 Bacteria 3523
683 Ga0307411_10118824 3300032005 Bacteria 1908
684 Ga0307415_100010986 3300032126 Bacteria 5156
685 Ga0307415_100089708 3300032126 Bacteria 2221
686 Ga0316583_10014076 3300032133 Bacteria 2886
687 Ga0307507_10014930 3300033179 Bacteria 9197
688 Ga0307507_10020073 3300033179 Bacteria 7496
689 Ga0307507_10032404 3300033179 Bacteria 5456
690 Ga0307507_10041417 3300033179 Bacteria 4609
691 Ga0307510_10019664 3300033180 Bacteria 7912
692 Ga0373948_0005457 3300034817 Bacteria 2065
693 Ga0373938_0009642 3300034957 Bacteria 1755
694 Ga0373934_0007586 3300035086 Bacteria 4030
695 Ga0373940_0002605 3300035088 Bacteria 3542
696 Ga0373944_0000004 3300035089 Bacteria 49340
697 Ga0373949_0005799 3300035090 Bacteria 2747
698 Ga0373951_0000009 3300035091 Bacteria 77764
699 Ga0373952_0007530 3300035092 Bacteria 2043
700 Ga0373932_0004489 3300035112 Bacteria 3296
701 Ga0373932_0014282 3300035112 Bacteria 1993
702 Ga0373936_0003475 3300035113 Bacteria 5917
703 Ga0373936_0053612 3300035113 Bacteria 1635
704 Ga0373941_0007526 3300035115 Bacteria 2667
705 Ga0373945_0000904 3300035116 Bacteria 8780
706 Ga0373953_0000384 3300035117 Bacteria 11972
707 Ga0373953_0001003 3300035117 Bacteria 7954
708 Ga0373956_0000352 3300035119 Bacteria 18674
709 Ga0373956_0019543 3300035119 Bacteria 2874
710 Ga0373957_0000060 3300035120 Bacteria 26353
711 Ga0373960_0002465 3300035121 Bacteria 4157
712 Ga0373960_0032669 3300035121 Bacteria 1463
713 Ga0373955_0000023 3300035172 Bacteria 61144
714 Ga0373955_0009263 3300035172 Bacteria 4610
715 Ga0373961_0007126 3300035241 Bacteria 2696
716 Ga0373962_0001917 3300035242 Bacteria 4957
717 Ga0316574_0035536 3300035398 Bacteria 3046
718 Ga0373924_0000690 3300035410 Bacteria 10499
719 Ga0373931_0007778 3300035691 Bacteria 5064
720 Ga0373931_0011048 3300035691 Bacteria 4354
721 Ga0373931_0081546 3300035691 Bacteria 1786
722 Ga0373935_0025341 3300035692 Bacteria 3655
723 Ga0373935_0030183 3300035692 Bacteria 3358
724 Ga0373935_0178000 3300035692 Bacteria 1459
725 Ga0373927_0000623 3300035695 Bacteria 26873
726 Ga0373927_0023872 3300035695 Bacteria 4001
727 Ga0373933_0002530 3300035724 Bacteria 10257
728 Ga0373933_0072026 3300035724 Bacteria 2104
729 Ga0373947_0060929 3300035725 Bacteria 2292
730 Ga0373937_0000002 3300036401 Bacteria 304133
731 Ga0373937_0002929 3300036401 Bacteria 14272
732 Ga0373937_0087626 3300036401 Bacteria 2881
733 Ga0316582_0006156 3300036647 Bacteria 6267
734 Ga0316582_0023811 3300036647 Bacteria 3653
735 Ga0316584_0014503 3300036712 Bacteria 5611
736 Ga0316584_0058453 3300036712 Bacteria 2887
737 Ga0316584_0081727 3300036712 Bacteria 2420
738 Ga0373925_0004553 3300037068 Bacteria 10473
739 Ga0395899_0017915 3300037312 Bacteria 5390
740 Ga0395899_0037345 3300037312 Bacteria 3641
741 Ga0395899_0041209 3300037312 Bacteria 3451
742 Ga0395899_0048862 3300037312 Bacteria 3146
743 Ga0395899_0057395 3300037312 Bacteria 2874
744 Ga0395900_0019737 3300037418 Bacteria 6870
745 Ga0395900_0026863 3300037418 Bacteria 5891
746 Ga0395900_0031138 3300037418 Bacteria 5480
747 Ga0395900_0036187 3300037418 Bacteria 5088
748 Ga0395900_0067014 3300037418 Bacteria 3689
749 Ga0395900_0123683 3300037418 Bacteria 2653
750 Ga0395900_0129368 3300037418 Bacteria 2588
751 Ga0395900_0137597 3300037418 Bacteria 2502
752 Ga0395900_0227765 3300037418 Bacteria 1876
753 Ga0395898_0000100 3300037466 Bacteria 226446
754 Ga0395898_0012933 3300037466 Bacteria 8609
755 Ga0395898_0020175 3300037466 Bacteria 6771
756 Ga0395898_0025730 3300037466 Bacteria 5927
757 Ga0395898_0032692 3300037466 Bacteria 5193
758 Ga0395898_0035131 3300037466 Bacteria 4988
759 Ga0395905_0008024 3300037471 Bacteria 10431
760 Ga0395905_0023340 3300037471 Bacteria 5848
761 Ga0395905_0038124 3300037471 Bacteria 4509
762 Ga0395905_0039722 3300037471 Bacteria 4415
763 Ga0395905_0041867 3300037471 Bacteria 4299
764 Ga0436364_0026322 3300037853 Bacteria 25266
765 Ga0436364_0259237 3300037853 Bacteria 7822
766 Ga0436364_0261085 3300037853 Bacteria 4123
767 Ga0436364_0783642 3300037853 Bacteria 30576
768 Ga0436364_1199653 3300037853 Bacteria 9773
769 Ga0395901_0008790 3300038443 Bacteria 10220
770 Ga0395901_0014492 3300038443 Bacteria 8019
771 Ga0395901_0018796 3300038443 Bacteria 7062
772 Ga0395901_0040004 3300038443 Bacteria 4853
773 Ga0395901_0047917 3300038443 Bacteria 4437
774 Ga0395901_0117749 3300038443 Bacteria 2791
775 Ga0395901_0150997 3300038443 Bacteria 2441
776 Ga0395901_0158121 3300038443 Bacteria 2380
777 Ga0395901_0190418 3300038443 Bacteria 2151
778 Ga0395901_0243584 3300038443 Bacteria 1874
779 Ga0395901_0260734 3300038443 Bacteria 1804
780 Ga0395901_0266107 3300038443 Bacteria 1784
781 Ga0395901_0294517 3300038443 Bacteria 1683
782 Ga0436365_0064456 3300039437 Bacteria 6568
783 Ga0436365_0671847 3300039437 Bacteria 34209
784 Ga0436365_1818399 3300039437 Bacteria 33160
785 Ga0436365_1833781 3300039437 Bacteria 32006
786 Ga0436363_1277403 3300039450 Bacteria 1782
787 Ga0436362_0198821 3300039453 Bacteria 18109
788 Ga0439436_0001616 3300041404 Bacteria 6561
789 Ga0439436_0014584 3300041404 Bacteria 2368
790 Ga0439438_011422 3300041405 Bacteria 2767
791 Ga0439439_0001413 3300041406 Bacteria 4767
792 Ga0439461_0000228 3300041410 Bacteria 7920
793 Ga0439465_0007793 3300041413 Bacteria 3395
794 Ga0439465_0012021 3300041413 Bacteria 2710
795 Ga0451793_1845951 3300041452 Bacteria 2587
796 Ga0451797_0041771 3300041453 Bacteria 1996
797 Ga0451833_0032744 3300041491 Bacteria 3703
798 Ga0451837_0514389 3300041494 Bacteria 6887
799 Ga0451839_0137481 3300041496 Bacteria 3620
800 Ga0451853_1798325 3300041512 Bacteria 2313
801 Ga0451853_2403763 3300041512 Bacteria 4652
802 Ga0439445_0000209 3300042004 Bacteria 10750
803 Ga0439445_0015721 3300042004 Bacteria 1856
804 Ga0439448_0002247 3300042005 Bacteria 5219
805 Ga0439449_0000357 3300042007 Bacteria 16784
806 Ga0439449_0026951 3300042007 Bacteria 2145
807 Ga0439457_000476 3300042014 Bacteria 11566
808 Ga0439457_008199 3300042014 Bacteria 2470
809 Ga0439462_0001374 3300042015 Bacteria 5379
810 Ga0450894_000050 3300042131 Bacteria 17933
811 Ga0450898_000106 3300042134 Bacteria 7849
812 Ga0450903_000683 3300042138 Bacteria 6784
813 Ga0450906_001211 3300042145 Bacteria 5708
814 Ga0450907_002846 3300042146 Bacteria 3194
815 Ga0466969_0014647 3300044656 Bacteria 4122
816 Ga0466969_0021118 3300044656 Bacteria 3369
817 Ga0466969_0039214 3300044656 Bacteria 2380
818 Ga0466972_0004069 3300044658 Bacteria 7299
819 Ga0466972_0004237 3300044658 Bacteria 7170
820 Ga0466972_0005148 3300044658 Bacteria 6546
821 Ga0466972_0005236 3300044658 Bacteria 6493
822 Ga0466972_0010726 3300044658 Bacteria 4599
823 Ga0466972_0011660 3300044658 Bacteria 4414
824 Ga0466972_0022424 3300044658 Bacteria 3145
825 Ga0466972_0023719 3300044658 Bacteria 3049
826 Ga0466972_0037778 3300044658 Bacteria 2360
827 Ga0466972_0039065 3300044658 Bacteria 2317
828 Ga0466972_0078250 3300044658 Bacteria 1575
829 Ga0466965_0002025 3300044683 Bacteria 8489
830 Ga0466965_0002597 3300044683 Bacteria 7726
831 Ga0466965_0021752 3300044683 Bacteria 3090
832 Ga0466965_0031149 3300044683 Bacteria 2600
833 Ga0466966_0002442 3300044684 Bacteria 12148
834 Ga0466966_0002752 3300044684 Bacteria 11550
835 Ga0466966_0003595 3300044684 Bacteria 10233
836 Ga0466966_0003942 3300044684 Bacteria 9803
837 Ga0466966_0004948 3300044684 Bacteria 8756
838 Ga0466966_0008977 3300044684 Bacteria 6625
839 Ga0466966_0018090 3300044684 Bacteria 4652
840 Ga0466966_0044570 3300044684 Bacteria 2839
841 Ga0466966_0057069 3300044684 Bacteria 2469
842 Ga0466966_0058042 3300044684 Bacteria 2446
843 Ga0466966_0077943 3300044684 Bacteria 2067
844 Ga0466961_0006450 3300044693 Bacteria 7450
845 Ga0466961_0012392 3300044693 Bacteria 5452
846 Ga0466961_0014592 3300044693 Bacteria 5047
847 Ga0466961_0022060 3300044693 Bacteria 4097
848 Ga0466961_0029038 3300044693 Bacteria 3556
849 Ga0466961_0033106 3300044693 Bacteria 3322
850 Ga0466961_0052076 3300044693 Bacteria 2612
851 Ga0466961_0089131 3300044693 Bacteria 1948
852 Ga0466963_0000277 3300044694 Bacteria 22841
853 Ga0466963_0003366 3300044694 Bacteria 9128
854 Ga0466963_0005946 3300044694 Bacteria 7187
855 Ga0466963_0010205 3300044694 Bacteria 5681
856 Ga0466963_0015792 3300044694 Bacteria 4685
857 Ga0466963_0037685 3300044694 Bacteria 3159
858 Ga0466963_0038588 3300044694 Bacteria 3124
859 Ga0466963_0045188 3300044694 Bacteria 2900
860 Ga0466963_0048494 3300044694 Bacteria 2806
861 Ga0466963_0060153 3300044694 Bacteria 2536
862 Ga0466963_0071200 3300044694 Bacteria 2340
863 Ga0466963_0090605 3300044694 Bacteria 2082
864 Ga0466964_0001054 3300044706 Bacteria 9206
865 Ga0466964_0002951 3300044706 Bacteria 6147
866 Ga0466964_0010248 3300044706 Bacteria 3535
867 Ga0453684_0000719 3300044712 Bacteria 116945
868 Ga0453684_0001079 3300044712 Bacteria 86824
869 Ga0466971_0002024 3300044719 Bacteria 8581
870 Ga0466971_0007929 3300044719 Bacteria 4627
871 Ga0466971_0017094 3300044719 Bacteria 3205
872 Ga0466971_0019147 3300044719 Bacteria 3038
873 Ga0466971_0026675 3300044719 Bacteria 2583
874 Ga0466968_0005739 3300044735 Bacteria 4657
875 Ga0466968_0012560 3300044735 Bacteria 3318
876 Ga0466968_0043542 3300044735 Bacteria 1901
877 Ga0466970_0001383 3300044765 Bacteria 11691
878 Ga0466970_0001467 3300044765 Bacteria 11385
879 Ga0466970_0002516 3300044765 Bacteria 8838
880 Ga0466970_0006080 3300044765 Bacteria 6017
881 Ga0466970_0011760 3300044765 Bacteria 4465
882 Ga0466970_0018686 3300044765 Bacteria 3591
883 Ga0466970_0019119 3300044765 Bacteria 3550
884 Ga0466970_0021255 3300044765 Bacteria 3379
885 Ga0466970_0024087 3300044765 Bacteria 3182
886 Ga0466970_0028270 3300044765 Bacteria 2945
887 Ga0466970_0040679 3300044765 Bacteria 2468
888 Ga0466970_0052778 3300044765 Bacteria 2170
889 Ga0466957_0000471 3300044842 Bacteria 19989
890 Ga0466957_0002105 3300044842 Bacteria 10647
891 Ga0466957_0012124 3300044842 Bacteria 4987
892 Ga0466957_0030972 3300044842 Bacteria 3195
893 Ga0466957_0110635 3300044842 Bacteria 1741
894 Ga0466960_0000683 3300044901 Bacteria 11808
895 Ga0466960_0004914 3300044901 Bacteria 5260
896 Ga0466960_0005920 3300044901 Bacteria 4876
897 Ga0466960_0007257 3300044901 Bacteria 4491
898 Ga0466960_0008436 3300044901 Bacteria 4220
899 Ga0466960_0011368 3300044901 Bacteria 3723
900 Ga0466960_0052912 3300044901 Bacteria 1966
901 Ga0466960_0066334 3300044901 Bacteria 1784
902 Ga0466960_0068193 3300044901 Bacteria 1764
903 Ga0466960_0068435 3300044901 Bacteria 1761
904 Ga0466960_0068807 3300044901 Bacteria 1757
905 Ga0466959_0003472 3300045049 Bacteria 10320
906 Ga0466959_0003956 3300045049 Bacteria 9845
907 Ga0466959_0010256 3300045049 Bacteria 6688
908 Ga0466959_0017352 3300045049 Bacteria 5276
909 Ga0466959_0031087 3300045049 Bacteria 3951
910 Ga0466959_0032390 3300045049 Bacteria 3869
911 Ga0466959_0049923 3300045049 Bacteria 3073
912 Ga0466959_0061768 3300045049 Bacteria 2724
913 Ga0466959_0068249 3300045049 Bacteria 2577
914 Ga0466959_0079611 3300045049 Bacteria 2362
915 Ga0466959_0089206 3300045049 Bacteria 2215
916 Ga0466958_0001073 3300045836 Bacteria 12562
917 Ga0466958_0014838 3300045836 Bacteria 4453
918 Ga0466958_0015631 3300045836 Bacteria 4353
919 Ga0466958_0050742 3300045836 Bacteria 2511
920 Ga0466967_0000302 3300045976 Bacteria 22184
921 Ga0466967_0001526 3300045976 Bacteria 13538
922 Ga0466967_0008914 3300045976 Bacteria 7404
923 Ga0466967_0010313 3300045976 Bacteria 6998
924 Ga0466967_0021383 3300045976 Bacteria 5253
925 Ga0466967_0022734 3300045976 Bacteria 5124
926 Ga0466967_0026462 3300045976 Bacteria 4806
927 Ga0466967_0041240 3300045976 Bacteria 3978
928 Ga0466967_0043325 3300045976 Bacteria 3896
929 Ga0466967_0077492 3300045976 Bacteria 2992
930 Ga0466967_0087802 3300045976 Bacteria 2820
931 Ga0466967_0174189 3300045976 Bacteria 2026
932 Ga0466967_0254873 3300045976 Bacteria 1677
933 Ga0495592_0000003 3300046454 Bacteria 200744
934 Ga0495592_0009084 3300046454 Bacteria 7477
935 Ga0495592_0040124 3300046454 Bacteria 3513
936 Ga0495592_0042690 3300046454 Bacteria 3395
937 Ga0495603_0007070 3300046455 Bacteria 6733
938 Ga0495603_0015069 3300046455 Bacteria 4675
939 Ga0495603_0017507 3300046455 Bacteria 4336
940 Ga0495603_0027400 3300046455 Bacteria 3439
941 Ga0495603_0043891 3300046455 Bacteria 2668
942 Ga0495603_0046681 3300046455 Bacteria 2580
943 Ga0495603_0055917 3300046455 Bacteria 2338
944 Ga0495603_0062597 3300046455 Bacteria 2196
945 Ga0495603_0066075 3300046455 Bacteria 2130
946 Ga0495629_0007553 3300046459 Bacteria 8011
947 Ga0495629_0010908 3300046459 Bacteria 6611
948 Ga0495629_0022040 3300046459 Bacteria 4542
949 Ga0495629_0036411 3300046459 Bacteria 3473
950 Ga0495629_0043733 3300046459 Bacteria 3144
951 Ga0495629_0106228 3300046459 Bacteria 1958
952 Ga0495641_0001496 3300046461 Bacteria 19912
953 Ga0495651_0000031 3300046462 Bacteria 103122
954 Ga0495651_0000760 3300046462 Bacteria 24943
955 Ga0495651_0001189 3300046462 Bacteria 20109
956 Ga0495651_0012598 3300046462 Bacteria 6525
957 Ga0495651_0039002 3300046462 Bacteria 3698
958 Ga0495651_0074795 3300046462 Bacteria 2569
959 Ga0495653_0000906 3300046463 Bacteria 22944
960 Ga0495653_0035517 3300046463 Bacteria 3932
961 Ga0495580_0013508 3300046472 Bacteria 6226
962 Ga0495580_0015227 3300046472 Bacteria 5810
963 Ga0495582_0000196 3300046473 Bacteria 33588
964 Ga0495582_0000400 3300046473 Bacteria 23636
965 Ga0495605_0001970 3300046474 Bacteria 13015
966 Ga0495639_0000497 3300046475 Bacteria 18571
967 Ga0495639_0003060 3300046475 Bacteria 7279
968 Ga0495639_0008853 3300046475 Bacteria 4313
969 Ga0495662_0000427 3300046476 Bacteria 18850
970 Ga0495662_0002136 3300046476 Bacteria 9916
971 Ga0495662_0030356 3300046476 Bacteria 2609
972 Ga0495664_0002595 3300046477 Bacteria 9716
973 Ga0495664_0026825 3300046477 Bacteria 3356
974 Ga0495664_0046621 3300046477 Bacteria 2572
975 Ga0495585_0055572 3300046492 Bacteria 2187
976 Ga0495594_0000230 3300046499 Bacteria 27077
977 Ga0495594_0049423 3300046499 Bacteria 2311
978 Ga0495594_0054321 3300046499 Bacteria 2207
979 Ga0495607_0023399 3300046501 Bacteria 3868
980 Ga0495583_0007209 3300046506 Bacteria 7051
981 Ga0495606_0039733 3300046507 Bacteria 3167
982 Ga0495608_0000018 3300046511 Bacteria 192512
983 Ga0495608_0072806 3300046511 Bacteria 2241
984 Ga0495610_0007745 3300046512 Bacteria 7089
985 Ga0495616_0003636 3300046513 Bacteria 9849
986 Ga0495618_0005624 3300046514 Bacteria 7619
987 Ga0495628_0000020 3300046516 Bacteria 148606
988 Ga0495628_0003309 3300046516 Bacteria 14411
989 Ga0495628_0004113 3300046516 Bacteria 12945
990 Ga0495628_0006282 3300046516 Bacteria 10374
991 Ga0495630_0010924 3300046517 Bacteria 6560
992 Ga0495630_0015558 3300046517 Bacteria 5556
993 Ga0495630_0032538 3300046517 Bacteria 3886
994 Ga0495630_0043531 3300046517 Bacteria 3354
995 Ga0495637_0027517 3300046520 Bacteria 2542
996 Ga0495643_0001354 3300046522 Bacteria 22981
997 Ga0495644_0019174 3300046523 Bacteria 2611
998 Ga0495644_0045775 3300046523 Bacteria 1645
999 Ga0495648_0043149 3300046524 Bacteria 2830
1000 Ga0495663_0003164 3300046525 Bacteria 4799
1001 Ga0495666_0000236 3300046526 Bacteria 23671
1002 Ga0495666_0008597 3300046526 Bacteria 5116
1003 Ga0495666_0019217 3300046526 Bacteria 3393
1004 Ga0495652_0000013 3300046529 Bacteria 238164
1005 Ga0495652_0008621 3300046529 Bacteria 9291
1006 Ga0495652_0019520 3300046529 Bacteria 6033
1007 Ga0495652_0024673 3300046529 Bacteria 5320
1008 Ga0495654_0024623 3300046530 Bacteria 3108
1009 Ga0495665_0000161 3300046531 Bacteria 33493
1010 Ga0495665_0001397 3300046531 Bacteria 12918
1011 Ga0495665_0006330 3300046531 Bacteria 6387
1012 Ga0495665_0006931 3300046531 Bacteria 6115
1013 Ga0495665_0015108 3300046531 Bacteria 4162
1014 Ga0495665_0019098 3300046531 Bacteria 3683
1015 Ga0495640_0009109 3300046533 Bacteria 7748
1016 Ga0495640_0025790 3300046533 Bacteria 4257
1017 Ga0495640_0026924 3300046533 Bacteria 4149
1018 Ga0495640_0084660 3300046533 Bacteria 2102
1019 Ga0495587_0000014 3300046536 Bacteria 192100
1020 Ga0495587_0001459 3300046536 Bacteria 15756
1021 Ga0495587_0003571 3300046536 Bacteria 10363
1022 Ga0495587_0030406 3300046536 Bacteria 3275
1023 Ga0495598_0001568 3300046537 Bacteria 4583
1024 Ga0495598_0009711 3300046537 Bacteria 2284
1025 Ga0495609_0009249 3300046538 Bacteria 4774
1026 Ga0495645_0031676 3300046543 Bacteria 3853
1027 Ga0495645_0038272 3300046543 Bacteria 3498
1028 Ga0495645_0046701 3300046543 Bacteria 3156
1029 Ga0495645_0057476 3300046543 Bacteria 2823
1030 Ga0495622_0062894 3300046557 Bacteria 1717
1031 Ga0495633_0004238 3300046558 Bacteria 9180
1032 Ga0495633_0026689 3300046558 Bacteria 2831
1033 Ga0495667_0000014 3300046559 Bacteria 200767
1034 Ga0495667_0005338 3300046559 Bacteria 8685
1035 Ga0495667_0009690 3300046559 Bacteria 6525
1036 Ga0495667_0026764 3300046559 Bacteria 3885
1037 Ga0495656_0001451 3300046615 Bacteria 7753
1038 Ga0495668_0007084 3300046616 Bacteria 7217
1039 Ga0495668_0054633 3300046616 Bacteria 2207
1040 Ga0495634_0001788 3300046642 Bacteria 18569
1041 Ga0495634_0003800 3300046642 Bacteria 11996
1042 Ga0495634_0007234 3300046642 Bacteria 8369
1043 Ga0495634_0016773 3300046642 Bacteria 5232
1044 Ga0495634_0033627 3300046642 Bacteria 3522
1045 Ga0495611_0014929 3300046648 Bacteria 3318
1046 Ga0495625_0008814 3300046660 Bacteria 8538
1047 Ga0495635_0000747 3300046663 Bacteria 21036
1048 Ga0495635_0004116 3300046663 Bacteria 10081
1049 Ga0495635_0014661 3300046663 Bacteria 5483
1050 Ga0495635_0014977 3300046663 Bacteria 5424
1051 Ga0495635_0016360 3300046663 Bacteria 5178
1052 Ga0495659_0009071 3300046664 Bacteria 3171
1053 Ga0495659_0027791 3300046664 Bacteria 1954
1054 Ga0495661_0015672 3300046665 Bacteria 5052
1055 Ga0495588_0000691 3300046674 Bacteria 15544
1056 Ga0495588_0007271 3300046674 Bacteria 5030
1057 Ga0495588_0019232 3300046674 Bacteria 3344
1058 Ga0495657_0000012 3300046675 Bacteria 197154
1059 Ga0495657_0004444 3300046675 Bacteria 11201
1060 Ga0495657_0008640 3300046675 Bacteria 7772
1061 Ga0495657_0016167 3300046675 Bacteria 5441
1062 Ga0495657_0031774 3300046675 Bacteria 3687
1063 Ga0495599_0000071 3300046678 Bacteria 70833
1064 Ga0495599_0007355 3300046678 Bacteria 6675
1065 Ga0495599_0027668 3300046678 Bacteria 3552
1066 Ga0495599_0078861 3300046678 Bacteria 2056
1067 Ga0495623_0000066 3300046679 Bacteria 64935
1068 Ga0495623_0006079 3300046679 Bacteria 7850
1069 Ga0495623_0010547 3300046679 Bacteria 5978
1070 Ga0495646_0008273 3300046680 Bacteria 6613
1071 Ga0495646_0025526 3300046680 Bacteria 3716
1072 Ga0495647_0001010 3300046681 Bacteria 8564
1073 Ga0495647_0026356 3300046681 Bacteria 2129
1074 Ga0495658_0000958 3300046683 Bacteria 15355
1075 Ga0495658_0004221 3300046683 Bacteria 7071
1076 Ga0495658_0016490 3300046683 Bacteria 3802
1077 Ga0495658_0017175 3300046683 Bacteria 3735
1078 Ga0495658_0060303 3300046683 Bacteria 2175
1079 Ga0495669_0015550 3300046684 Bacteria 3259
1080 Ga0495613_0001355 3300046689 Bacteria 18673
1081 Ga0495613_0001873 3300046689 Bacteria 15975
1082 Ga0495613_0073577 3300046689 Bacteria 2489
1083 Ga0495613_0083708 3300046689 Bacteria 2316
1084 Ga0495624_0001856 3300046690 Bacteria 16123
1085 Ga0495624_0029032 3300046690 Bacteria 3611
1086 Ga0495670_0017326 3300046691 Bacteria 3544
1087 Ga0495670_0045453 3300046691 Bacteria 2192
1088 Ga0495671_0015236 3300046692 Bacteria 4125
1089 Ga0495589_0013451 3300046794 Bacteria 4221
1090 Ga0495589_0052207 3300046794 Bacteria 2020
1091 Ga0495600_0016669 3300046809 Bacteria 4668
1092 Ga0495600_0044267 3300046809 Bacteria 2904
1093 Ga0495600_0058016 3300046809 Bacteria 2528
1094 Ga0495600_0075476 3300046809 Bacteria 2201
1095 Ga0495600_0086567 3300046809 Bacteria 2044
1096 Ga0495660_0027649 3300046810 Bacteria 3208
1097 Ga0495581_0000415 3300047315 Bacteria 21545
1098 Ga0495581_0003525 3300047315 Bacteria 8977
1099 Ga0495581_0003576 3300047315 Bacteria 8930
1100 Ga0495581_0016654 3300047315 Bacteria 4273
1101 Ga0495581_0019055 3300047315 Bacteria 3982
1102 Ga0495581_0028406 3300047315 Bacteria 3242
1103 Ga0495581_0038302 3300047315 Bacteria 2774
1104 Ga0495604_0000054 3300047317 Bacteria 101084
1105 Ga0495604_0003123 3300047317 Bacteria 13240
1106 Ga0495604_0005136 3300047317 Bacteria 10362
1107 Ga0495604_0031714 3300047317 Bacteria 4191
1108 Ga0495604_0072911 3300047317 Bacteria 2593
1109 Ga0495636_0000786 3300047318 Bacteria 11685
1110 Ga0495636_0014627 3300047318 Bacteria 3122
1111 Ga0495674_0025277 3300047319 Bacteria 5447
1112 Ga0495674_0049337 3300047319 Bacteria 3720
1113 Ga0495674_0085720 3300047319 Bacteria 2698
1114 Ga0495674_0139133 3300047319 Bacteria 2041
1115 Ga0495676_0019222 3300047321 Bacteria 6010
1116 Ga0495676_0043922 3300047321 Bacteria 3653
1117 Ga0495676_0101095 3300047321 Bacteria 2134
1118 Ga0495680_0000003 3300047322 Bacteria 172246
1119 Ga0495680_0005012 3300047322 Bacteria 12530
1120 Ga0495680_0057193 3300047322 Bacteria 3017
1121 Ga0495687_002577 3300047443 Bacteria 14293
1122 Ga0495687_004667 3300047443 Bacteria 9140
1123 Ga0495687_015685 3300047443 Bacteria 3842
1124 Ga0495675_0000220 3300047444 Bacteria 41470
1125 Ga0495675_0009187 3300047444 Bacteria 6147
1126 Ga0495675_0010833 3300047444 Bacteria 5714
1127 Ga0495675_0021176 3300047444 Bacteria 4139
1128 Ga0495675_0028220 3300047444 Bacteria 3578
1129 Ga0495685_002361 3300047447 Bacteria 5903
1130 Ga0495685_002450 3300047447 Bacteria 5815
1131 Ga0495685_006206 3300047447 Bacteria 3908
1132 Ga0495685_031524 3300047447 Bacteria 1821
1133 Ga0495673_0000524 3300047469 Bacteria 40257
1134 Ga0495681_0000554 3300047470 Bacteria 28651
1135 Ga0495681_0012672 3300047470 Bacteria 4941
1136 Ga0495681_0015522 3300047470 Bacteria 4304
1137 Ga0495684_0021859 3300047471 Bacteria 4924
1138 Ga0495684_0028076 3300047471 Bacteria 4322
1139 Ga0495684_0041286 3300047471 Bacteria 3535
1140 Ga0495686_0001901 3300047472 Bacteria 20865
1141 Ga0495686_0037599 3300047472 Bacteria 3100
1142 Ga0495686_0073202 3300047472 Bacteria 2105
1143 Ga0495593_0001467 3300047673 Bacteria 13850
1144 Ga0495593_0007108 3300047673 Bacteria 6563
1145 Ga0495593_0019642 3300047673 Bacteria 3787
1146 Ga0495593_0023010 3300047673 Bacteria 3467
1147 Ga0495602_0000014 3300048088 Bacteria 193335
1148 Ga0495602_0069059 3300048088 Bacteria 3031
1149 Ga0495614_0001950 3300048089 Bacteria 9063
1150 Ga0495614_0015275 3300048089 Bacteria 3347
1151 Ga0495626_0006153 3300048091 Bacteria 6873
1152 Ga0496100_0000090 3300048903 Bacteria 51781
1153 Ga0496100_0001709 3300048903 Bacteria 10923
1154 Ga0496100_0004442 3300048903 Bacteria 7436
1155 Ga0496100_0004552 3300048903 Bacteria 7367
1156 Ga0496100_0006094 3300048903 Bacteria 6554
1157 Ga0496100_0006163 3300048903 Bacteria 6521
1158 Ga0496100_0042606 3300048903 Bacteria 2899
1159 Ga0496100_0046280 3300048903 Bacteria 2796
1160 Ga0496100_0053592 3300048903 Bacteria 2627
1161 Ga0496100_0076656 3300048903 Bacteria 2245
1162 Ga0496100_0091651 3300048903 Bacteria 2075
1163 Ga0496101_0000015 3300048904 Bacteria 252368
1164 Ga0496101_0000031 3300048904 Bacteria 195195
1165 Ga0496101_0000462 3300048904 Bacteria 25778
1166 Ga0496101_0004267 3300048904 Bacteria 8963
1167 Ga0496101_0007031 3300048904 Bacteria 7273
1168 Ga0496101_0018263 3300048904 Bacteria 4767
1169 Ga0496101_0022473 3300048904 Bacteria 4342
1170 Ga0496101_0022875 3300048904 Bacteria 4309
1171 Ga0496101_0030349 3300048904 Bacteria 3789
1172 Ga0496101_0032927 3300048904 Bacteria 3652
1173 Ga0496101_0038726 3300048904 Bacteria 3387
1174 Ga0496101_0049579 3300048904 Bacteria 3021
1175 Ga0496101_0067728 3300048904 Bacteria 2608
1176 Ga0496101_0101765 3300048904 Bacteria 2151
1177 Ga0496101_0111108 3300048904 Bacteria 2063
1178 Ga0496102_0000065 3300048905 Bacteria 161370
1179 Ga0496102_0000187 3300048905 Bacteria 84207
1180 Ga0496102_0000387 3300048905 Bacteria 51915
1181 Ga0496102_0000813 3300048905 Bacteria 30380
1182 Ga0496102_0004258 3300048905 Bacteria 12095
1183 Ga0496102_0012669 3300048905 Bacteria 7304
1184 Ga0496102_0023596 3300048905 Bacteria 5465
1185 Ga0496102_0024323 3300048905 Bacteria 5384
1186 Ga0496102_0026240 3300048905 Bacteria 5194
1187 Ga0496102_0036116 3300048905 Bacteria 4451
1188 Ga0496102_0060254 3300048905 Bacteria 3472
1189 Ga0496102_0082166 3300048905 Bacteria 2971
1190 Ga0496102_0082354 3300048905 Bacteria 2967
1191 Ga0496102_0083000 3300048905 Bacteria 2956
1192 Ga0496102_0144725 3300048905 Bacteria 2230
1193 Ga0496103_0000048 3300048906 Bacteria 160911
1194 Ga0496103_0000126 3300048906 Bacteria 82291
1195 Ga0496103_0000292 3300048906 Bacteria 46843
1196 Ga0496103_0000886 3300048906 Bacteria 21631
1197 Ga0496103_0011144 3300048906 Bacteria 5325
1198 Ga0496103_0033374 3300048906 Bacteria 3144
1199 Ga0496103_0058621 3300048906 Bacteria 2392
1200 Ga0496103_0087885 3300048906 Bacteria 1960
1201 Ga0496103_0108781 3300048906 Bacteria 1759
1202 Ga0496104_0005891 3300048907 Bacteria 10734
1203 Ga0496104_0011217 3300048907 Bacteria 8019
1204 Ga0496104_0012856 3300048907 Bacteria 7539
1205 Ga0496104_0013277 3300048907 Bacteria 7425
1206 Ga0496104_0015265 3300048907 Bacteria 6955
1207 Ga0496104_0069683 3300048907 Bacteria 3342
1208 Ga0496104_0077221 3300048907 Bacteria 3173
1209 Ga0496104_0189851 3300048907 Bacteria 1966
1210 Ga0496105_0003893 3300048908 Bacteria 11157
1211 Ga0496105_0004783 3300048908 Bacteria 10224
1212 Ga0496105_0004853 3300048908 Bacteria 10155
1213 Ga0496105_0007560 3300048908 Bacteria 8419
1214 Ga0496105_0036304 3300048908 Bacteria 4060
1215 Ga0496105_0049849 3300048908 Bacteria 3458
1216 Ga0496105_0055343 3300048908 Bacteria 3276
1217 Ga0496105_0073288 3300048908 Bacteria 2829
1218 Ga0496105_0073860 3300048908 Bacteria 2817
1219 Ga0496105_0122837 3300048908 Bacteria 2141
1220 Ga0496105_0127550 3300048908 Bacteria 2097
1221 Ga0496105_0130414 3300048908 Bacteria 2073
1222 Ga0496106_0000390 3300048909 Bacteria 31290
1223 Ga0496106_0004705 3300048909 Bacteria 10110
1224 Ga0496106_0010190 3300048909 Bacteria 6944
1225 Ga0496106_0011482 3300048909 Bacteria 6551
1226 Ga0496106_0052286 3300048909 Bacteria 3081
1227 Ga0496106_0052570 3300048909 Bacteria 3074
1228 Ga0496106_0096005 3300048909 Bacteria 2293
1229 Ga0496107_0000438 3300048910 Bacteria 22612
1230 Ga0496107_0000521 3300048910 Bacteria 21374
1231 Ga0496107_0005833 3300048910 Bacteria 8432
1232 Ga0496107_0009225 3300048910 Bacteria 6836
1233 Ga0496107_0017536 3300048910 Bacteria 5034
1234 Ga0496107_0020054 3300048910 Bacteria 4721
1235 Ga0496107_0030844 3300048910 Bacteria 3823
1236 Ga0496107_0108634 3300048910 Bacteria 2037
1237 Ga0496108_0000812 3300048911 Bacteria 24256
1238 Ga0496108_0001313 3300048911 Bacteria 19543
1239 Ga0496108_0018250 3300048911 Bacteria 5745
1240 Ga0496108_0038094 3300048911 Bacteria 4005
1241 Ga0496108_0075375 3300048911 Bacteria 2850
1242 Ga0496108_0090404 3300048911 Bacteria 2603
1243 Ga0496108_0103119 3300048911 Bacteria 2434
1244 Ga0496108_0108561 3300048911 Bacteria 2371
1245 Ga0496108_0176195 3300048911 Bacteria 1851
1246 Ga0496109_0000134 3300048912 Bacteria 75662
1247 Ga0496109_0003973 3300048912 Bacteria 12346
1248 Ga0496109_0004707 3300048912 Bacteria 11391
1249 Ga0496109_0005225 3300048912 Bacteria 10841
1250 Ga0496109_0006669 3300048912 Bacteria 9720
1251 Ga0496109_0023364 3300048912 Bacteria 5488
1252 Ga0496109_0028903 3300048912 Bacteria 4963
1253 Ga0496109_0045044 3300048912 Bacteria 4003
1254 Ga0496109_0146857 3300048912 Bacteria 2207
1255 Ga0496109_0182559 3300048912 Bacteria 1971
1256 Ga0496110_0005768 3300048913 Bacteria 9728
1257 Ga0496110_0012823 3300048913 Bacteria 6905
1258 Ga0496110_0046606 3300048913 Bacteria 3793
1259 Ga0496110_0048014 3300048913 Bacteria 3740
1260 Ga0496110_0075463 3300048913 Bacteria 2995
1261 Ga0496110_0107403 3300048913 Bacteria 2505
1262 Ga0496110_0182982 3300048913 Bacteria 1903
1263 Ga0496111_0000028 3300048914 Bacteria 58695
1264 Ga0496111_0003079 3300048914 Bacteria 10246
1265 Ga0496111_0046359 3300048914 Bacteria 3130
1266 Ga0496111_0053846 3300048914 Bacteria 2907
1267 Ga0496112_0006907 3300048915 Bacteria 10015
1268 Ga0496112_0080300 3300048915 Bacteria 3225
1269 Ga0496112_0105933 3300048915 Bacteria 2781
1270 Ga0496113_0008778 3300048916 Bacteria 6602
1271 Ga0496113_0021468 3300048916 Bacteria 4555
1272 Ga0496113_0031697 3300048916 Bacteria 3838
1273 Ga0496113_0100381 3300048916 Bacteria 2242
1274 Ga0496114_0001198 3300048917 Bacteria 19604
1275 Ga0496114_0002043 3300048917 Bacteria 15364
1276 Ga0496114_0003634 3300048917 Bacteria 11866
1277 Ga0496114_0004306 3300048917 Bacteria 11016
1278 Ga0496114_0007157 3300048917 Bacteria 8801
1279 Ga0496114_0008776 3300048917 Bacteria 8009
1280 Ga0496114_0039075 3300048917 Bacteria 3927
1281 Ga0496114_0040624 3300048917 Bacteria 3851
1282 Ga0496114_0049896 3300048917 Bacteria 3482
1283 Ga0496114_0074553 3300048917 Bacteria 2856
1284 Ga0496114_0085423 3300048917 Bacteria 2673
1285 Ga0496114_0091760 3300048917 Bacteria 2580
1286 Ga0496115_0001385 3300048918 Bacteria 17323
1287 Ga0496115_0003083 3300048918 Bacteria 11968
1288 Ga0496115_0006246 3300048918 Bacteria 8716
1289 Ga0496115_0024870 3300048918 Bacteria 4657
1290 Ga0496115_0033275 3300048918 Bacteria 4069
1291 Ga0496115_0033898 3300048918 Bacteria 4034
1292 Ga0496116_0000125 3300048919 Bacteria 160885
1293 Ga0496116_0000306 3300048919 Bacteria 82349
1294 Ga0496116_0013915 3300048919 Bacteria 6448
1295 Ga0496116_0036927 3300048919 Bacteria 3413
1296 Ga0496117_0000111 3300048920 Bacteria 184570
1297 Ga0496117_0000343 3300048920 Bacteria 82294
1298 Ga0496117_0001572 3300048920 Bacteria 32413
1299 Ga0496117_0040254 3300048920 Bacteria 3439
1300 Ga0496117_0044935 3300048920 Bacteria 3195
1301 Ga0496118_0000083 3300048921 Bacteria 184570
1302 Ga0496118_0000192 3300048921 Bacteria 107736
1303 Ga0496118_0000272 3300048921 Bacteria 91016
1304 Ga0496118_0001353 3300048921 Bacteria 36982
1305 Ga0496118_0005574 3300048921 Bacteria 14252
1306 Ga0496118_0043314 3300048921 Bacteria 3540
1307 Ga0496118_0057862 3300048921 Bacteria 2902
1308 Ga0496119_0000764 3300048922 Bacteria 43175
1309 Ga0496119_0002640 3300048922 Bacteria 19420
1310 Ga0496119_0005422 3300048922 Bacteria 12237
1311 Ga0496119_0046259 3300048922 Bacteria 2719
1312 Ga0496119_0050948 3300048922 Bacteria 2548
1313 Ga0496119_0076208 3300048922 Bacteria 1946
1314 Ga0496120_0003415 3300048923 Bacteria 14522
1315 Ga0496120_0013212 3300048923 Bacteria 5572
1316 Ga0496121_0000004 3300048924 Bacteria 1139011
1317 Ga0496121_0000728 3300048924 Bacteria 60874
1318 Ga0496121_0002290 3300048924 Bacteria 29745
1319 Ga0496121_0019873 3300048924 Bacteria 6687
1320 Ga0496121_0028149 3300048924 Bacteria 5238
1321 Ga0496121_0146522 3300048924 Bacteria 1744
1322 Ga0496122_0000138 3300048925 Bacteria 169434
1323 Ga0496122_0001030 3300048925 Bacteria 49002
1324 Ga0496123_0007586 3300048926 Bacteria 10166
1325 Ga0496123_0026721 3300048926 Bacteria 4316
1326 Ga0496124_0000012 3300048927 Bacteria 512581
1327 Ga0496124_0010783 3300048927 Bacteria 9211
1328 Ga0496124_0029865 3300048927 Bacteria 4848
1329 Ga0496125_0000003 3300048928 Bacteria 1189767
1330 Ga0496125_0000066 3300048928 Bacteria 249043
1331 Ga0496126_0000001 3300048929 Bacteria 1139011
1332 Ga0496126_0000220 3300048929 Bacteria 124547
1333 Ga0496126_0000433 3300048929 Bacteria 84020
1334 Ga0496126_0001476 3300048929 Bacteria 36542
1335 Ga0496126_0010644 3300048929 Bacteria 9618
1336 Ga0496126_0016431 3300048929 Bacteria 7400
1337 Ga0496126_0043333 3300048929 Bacteria 4152
1338 Ga0495678_008909 3300049459 Bacteria 5017
1339 Ga0501031_0001225 3300049568 Bacteria 15710
1340 Ga0501031_0001837 3300049568 Bacteria 13351
1341 Ga0501031_0027192 3300049568 Bacteria 3730
1342 Ga0501031_0043372 3300049568 Bacteria 2935
1343 Ga0501031_0046276 3300049568 Bacteria 2837
1344 Ga0501031_0106572 3300049568 Bacteria 1829
1345 Ga0501031_0157247 3300049568 Bacteria 1486
1346 Ga0501032_0001562 3300049569 Bacteria 18274
1347 Ga0501032_0004751 3300049569 Bacteria 10189
1348 Ga0501032_0007217 3300049569 Bacteria 8129
1349 Ga0501032_0010112 3300049569 Bacteria 6809
1350 Ga0501032_0029189 3300049569 Bacteria 3787
1351 Ga0501032_0035227 3300049569 Bacteria 3423
1352 Ga0501032_0036228 3300049569 Bacteria 3369
1353 Ga0501032_0048647 3300049569 Bacteria 2862
1354 Ga0501032_0066955 3300049569 Bacteria 2400
1355 Ga0501032_0095270 3300049569 Bacteria 1973
1356 Ga0501033_0000572 3300049570 Bacteria 34349
1357 Ga0501033_0006275 3300049570 Bacteria 9320
1358 Ga0501033_0006403 3300049570 Bacteria 9222
1359 Ga0501033_0010271 3300049570 Bacteria 7186
1360 Ga0501033_0010969 3300049570 Bacteria 6943
1361 Ga0501033_0022188 3300049570 Bacteria 4790
1362 Ga0501033_0132077 3300049570 Bacteria 1808
1363 Ga0501033_0140292 3300049570 Bacteria 1747
1364 Ga0501034_0003044 3300049571 Bacteria 19383
1365 Ga0501034_0004377 3300049571 Bacteria 15734
1366 Ga0501034_0006026 3300049571 Bacteria 13104
1367 Ga0501034_0016112 3300049571 Bacteria 7668
1368 Ga0501034_0019446 3300049571 Bacteria 6947
1369 Ga0501034_0023061 3300049571 Bacteria 6342
1370 Ga0501034_0023927 3300049571 Bacteria 6216
1371 Ga0501034_0032114 3300049571 Bacteria 5334
1372 Ga0501034_0078537 3300049571 Bacteria 3304
1373 Ga0501034_0079746 3300049571 Bacteria 3277
1374 Ga0501034_0083609 3300049571 Bacteria 3194
1375 Ga0501034_0226215 3300049571 Bacteria 1821
1376 Ga0501036_0003307 3300049572 Bacteria 12869
1377 Ga0501036_0003546 3300049572 Bacteria 12481
1378 Ga0501036_0003794 3300049572 Bacteria 12120
1379 Ga0501036_0004601 3300049572 Bacteria 11146
1380 Ga0501036_0092187 3300049572 Bacteria 2559
1381 Ga0501036_0099953 3300049572 Bacteria 2453
1382 Ga0501036_0123903 3300049572 Bacteria 2183
1383 Ga0501037_0000294 3300049573 Bacteria 42178
1384 Ga0501037_0000401 3300049573 Bacteria 36095
1385 Ga0501037_0009368 3300049573 Bacteria 7187
1386 Ga0501037_0012379 3300049573 Bacteria 6281
1387 Ga0501037_0035942 3300049573 Bacteria 3651
1388 Ga0501038_0000303 3300049574 Bacteria 41854
1389 Ga0501038_0003608 3300049574 Bacteria 14413
1390 Ga0501038_0003845 3300049574 Bacteria 13961
1391 Ga0501038_0004045 3300049574 Bacteria 13628
1392 Ga0501038_0005757 3300049574 Bacteria 11484
1393 Ga0501038_0010214 3300049574 Bacteria 8592
1394 Ga0501038_0012474 3300049574 Bacteria 7765
1395 Ga0501038_0016250 3300049574 Bacteria 6749
1396 Ga0501038_0023327 3300049574 Bacteria 5533
1397 Ga0501038_0029580 3300049574 Bacteria 4852
1398 Ga0501039_0001815 3300049575 Bacteria 15779
1399 Ga0501039_0004950 3300049575 Bacteria 10103
1400 Ga0501039_0011640 3300049575 Bacteria 6699
1401 Ga0501039_0011715 3300049575 Bacteria 6680
1402 Ga0501039_0012192 3300049575 Bacteria 6553
1403 Ga0501039_0021966 3300049575 Bacteria 4896
1404 Ga0501039_0023772 3300049575 Bacteria 4703
1405 Ga0501039_0046336 3300049575 Bacteria 3359
1406 Ga0501040_0002552 3300049576 Bacteria 11746
1407 Ga0501040_0020460 3300049576 Bacteria 4409
1408 Ga0501040_0053493 3300049576 Bacteria 2765
1409 Ga0501040_0096384 3300049576 Bacteria 2060
1410 Ga0501040_0104452 3300049576 Bacteria 1978
1411 Ga0501040_0148082 3300049576 Bacteria 1655
1412 Ga0501041_0003443 3300049577 Bacteria 9107
1413 Ga0501041_0166846 3300049577 Bacteria 1377
1414 Ga0501042_0003823 3300049578 Bacteria 9519
1415 Ga0501042_0011058 3300049578 Bacteria 6077
1416 Ga0501042_0019805 3300049578 Bacteria 4677
1417 Ga0501042_0033874 3300049578 Bacteria 3621
1418 Ga0501042_0034233 3300049578 Bacteria 3603
1419 Ga0501042_0069688 3300049578 Bacteria 2515
1420 Ga0501042_0095302 3300049578 Bacteria 2138
1421 Ga0501042_0098897 3300049578 Bacteria 2098
1422 Ga0501043_0001613 3300049579 Bacteria 19644
1423 Ga0501043_0001877 3300049579 Bacteria 18019
1424 Ga0501043_0003544 3300049579 Bacteria 12825
1425 Ga0501043_0004157 3300049579 Bacteria 11830
1426 Ga0501043_0007764 3300049579 Bacteria 8487
1427 Ga0501043_0008555 3300049579 Bacteria 8066
1428 Ga0501043_0015165 3300049579 Bacteria 6033
1429 Ga0501043_0037155 3300049579 Bacteria 3831
1430 Ga0501046_0000236 3300049580 Bacteria 56950
1431 Ga0501046_0000769 3300049580 Bacteria 31025
1432 Ga0501046_0001725 3300049580 Bacteria 20856
1433 Ga0501046_0003797 3300049580 Bacteria 13826
1434 Ga0501046_0005803 3300049580 Bacteria 11015
1435 Ga0501046_0054527 3300049580 Bacteria 3144
1436 Ga0501047_0012990 3300049581 Bacteria 7885
1437 Ga0501047_0014794 3300049581 Bacteria 7427
1438 Ga0501047_0017157 3300049581 Bacteria 6927
1439 Ga0501047_0017158 3300049581 Bacteria 6927
1440 Ga0501047_0021848 3300049581 Bacteria 6145
1441 Ga0501047_0024666 3300049581 Bacteria 5773
1442 Ga0501047_0029588 3300049581 Bacteria 5280
1443 Ga0501047_0032593 3300049581 Bacteria 5030
1444 Ga0501047_0080301 3300049581 Bacteria 3134
1445 Ga0501047_0122576 3300049581 Bacteria 2480
1446 Ga0501047_0160331 3300049581 Bacteria 2121
1447 Ga0501047_0317416 3300049581 Bacteria 1398
1448 Ga0501048_0000093 3300049582 Bacteria 48141
1449 Ga0501048_0004212 3300049582 Bacteria 10963
1450 Ga0501048_0005329 3300049582 Bacteria 9788
1451 Ga0501048_0012861 3300049582 Bacteria 6217
1452 Ga0501048_0023521 3300049582 Bacteria 4501
1453 Ga0501048_0038612 3300049582 Bacteria 3426
1454 Ga0501048_0049259 3300049582 Bacteria 3002
1455 Ga0501048_0106070 3300049582 Bacteria 1983
1456 Ga0501067_0000770 3300049583 Bacteria 17225
1457 Ga0501067_0002255 3300049583 Bacteria 10635
1458 Ga0501067_0002330 3300049583 Bacteria 10499
1459 Ga0501067_0005717 3300049583 Bacteria 6902
1460 Ga0501067_0007863 3300049583 Bacteria 5925
1461 Ga0501067_0030306 3300049583 Bacteria 3000
1462 Ga0501067_0073085 3300049583 Bacteria 1900
1463 Ga0501068_0003180 3300049584 Bacteria 8791
1464 Ga0501068_0018151 3300049584 Bacteria 4072
1465 Ga0501068_0056289 3300049584 Bacteria 2384
1466 Ga0501069_0000897 3300049585 Bacteria 14203
1467 Ga0501069_0001749 3300049585 Bacteria 10831
1468 Ga0501069_0010191 3300049585 Bacteria 4971
1469 Ga0501069_0018837 3300049585 Bacteria 3726
1470 Ga0501069_0073049 3300049585 Bacteria 1923
1471 Ga0501070_0000304 3300049586 Bacteria 45492
1472 Ga0501070_0000985 3300049586 Bacteria 25575
1473 Ga0501070_0001111 3300049586 Bacteria 24148
1474 Ga0501070_0001285 3300049586 Bacteria 22529
1475 Ga0501070_0021783 3300049586 Bacteria 5370
1476 Ga0501070_0025023 3300049586 Bacteria 5006
1477 Ga0501070_0052937 3300049586 Bacteria 3368
1478 Ga0501070_0063145 3300049586 Bacteria 3068
1479 Ga0501070_0099343 3300049586 Bacteria 2408
1480 Ga0501071_0000525 3300049587 Bacteria 19591
1481 Ga0501071_0008335 3300049587 Bacteria 6846
1482 Ga0501071_0019867 3300049587 Bacteria 4664
1483 Ga0501071_0042839 3300049587 Bacteria 3244
1484 Ga0501071_0111312 3300049587 Bacteria 2024
1485 Ga0501072_0011058 3300049588 Bacteria 6887
1486 Ga0501072_0015730 3300049588 Bacteria 5799
1487 Ga0501072_0023669 3300049588 Bacteria 4771
1488 Ga0501072_0070039 3300049588 Bacteria 2769
1489 Ga0501073_0002339 3300049589 Bacteria 14184
1490 Ga0501073_0010335 3300049589 Bacteria 6851
1491 Ga0501073_0026557 3300049589 Bacteria 4146
1492 Ga0501073_0040761 3300049589 Bacteria 3284
1493 Ga0501073_0042885 3300049589 Bacteria 3192
1494 Ga0501073_0084060 3300049589 Bacteria 2215
1495 Ga0501074_0000476 3300049590 Bacteria 24308
1496 Ga0501074_0001111 3300049590 Bacteria 17546
1497 Ga0501074_0003908 3300049590 Bacteria 10613
1498 Ga0501074_0027609 3300049590 Bacteria 4115
1499 Ga0501075_0005120 3300049591 Bacteria 8961
1500 Ga0501075_0005138 3300049591 Bacteria 8950
1501 Ga0501075_0115037 3300049591 Bacteria 2045
1502 Ga0501076_0001890 3300049592 Bacteria 14270
1503 Ga0501076_0008545 3300049592 Bacteria 7508
1504 Ga0501076_0014706 3300049592 Bacteria 5901
1505 Ga0501076_0015983 3300049592 Bacteria 5681
1506 Ga0501076_0079955 3300049592 Bacteria 2623
1507 Ga0501077_0008288 3300049593 Bacteria 6426
1508 Ga0501077_0008984 3300049593 Bacteria 6201
1509 Ga0501077_0019701 3300049593 Bacteria 4268
1510 Ga0501077_0029666 3300049593 Bacteria 3478
1511 Ga0501077_0092327 3300049593 Bacteria 1918
1512 Ga0501079_0014762 3300049741 Bacteria 5955
1513 Ga0501079_0022458 3300049741 Bacteria 4838
1514 Ga0501080_0001133 3300049742 Bacteria 21938
1515 Ga0501080_0013264 3300049742 Bacteria 7571
1516 Ga0501080_0034656 3300049742 Bacteria 4714
1517 Ga0501080_0035065 3300049742 Bacteria 4684
1518 Ga0501080_0044785 3300049742 Bacteria 4118
1519 Ga0501080_0083782 3300049742 Bacteria 2962
1520 Ga0501081_0002611 3300049743 Bacteria 11389
1521 Ga0501081_0030717 3300049743 Bacteria 3638
1522 Ga0501083_0000728 3300049744 Bacteria 21449
1523 Ga0501083_0003749 3300049744 Bacteria 10671
1524 Ga0501083_0005510 3300049744 Bacteria 8969
1525 Ga0501083_0031100 3300049744 Bacteria 3663
1526 Ga0501083_0053364 3300049744 Bacteria 2714
1527 Ga0501083_0063353 3300049744 Bacteria 2466
1528 Ga0501035_0000886 3300049822 Bacteria 31764
1529 Ga0501035_0002028 3300049822 Bacteria 20185
1530 Ga0501035_0005446 3300049822 Bacteria 12038
1531 Ga0501035_0005582 3300049822 Bacteria 11886
1532 Ga0501035_0005745 3300049822 Bacteria 11701
1533 Ga0501035_0006819 3300049822 Bacteria 10671
1534 Ga0501035_0009131 3300049822 Bacteria 9219
1535 Ga0501035_0009171 3300049822 Bacteria 9200
1536 Ga0501035_0011863 3300049822 Bacteria 8068
1537 Ga0501035_0030207 3300049822 Bacteria 4940
1538 Ga0501035_0037091 3300049822 Bacteria 4415
1539 Ga0501035_0060662 3300049822 Bacteria 3367
1540 Ga0501035_0067088 3300049822 Bacteria 3184
1541 Ga0501035_0113287 3300049822 Bacteria 2376
1542 Ga0501035_0138241 3300049822 Bacteria 2119
1543 Ga0501044_0000313 3300049823 Bacteria 61310
1544 Ga0501044_0001800 3300049823 Bacteria 25001
1545 Ga0501044_0002740 3300049823 Bacteria 20041
1546 Ga0501044_0003836 3300049823 Bacteria 16861
1547 Ga0501044_0010059 3300049823 Bacteria 10279
1548 Ga0501044_0010545 3300049823 Bacteria 10024
1549 Ga0501044_0011879 3300049823 Bacteria 9436
1550 Ga0501044_0015546 3300049823 Bacteria 8198
1551 Ga0501044_0015683 3300049823 Bacteria 8159
1552 Ga0501044_0021072 3300049823 Bacteria 6958
1553 Ga0501044_0044148 3300049823 Bacteria 4628
1554 Ga0501044_0073156 3300049823 Bacteria 3484
1555 Ga0501045_0029159 3300049824 Bacteria 3986
1556 Ga0501045_0039918 3300049824 Bacteria 3415
1557 Ga0501045_0041394 3300049824 Bacteria 3352
1558 Ga0501045_0070788 3300049824 Bacteria 2566
1559 Ga0501045_0138280 3300049824 Bacteria 1811
1560 nmdc:mga03n38_1489_c1 3300050490 Bacteria 6754
1561 nmdc:mga03n38_16294_c1 3300050490 Bacteria 2889
1562 nmdc:mga03n38_3379_c1 3300050490 Bacteria 5116
1563 nmdc:mga03n38_4805_c2 3300050490 Bacteria 1960
1564 nmdc:mga03n38_5023_c1 3300050490 Bacteria 4459
1565 nmdc:mga00v17_10338_c1 3300050491 Bacteria 5090
1566 nmdc:mga00v17_14591_c1 3300050491 Bacteria 4389
1567 nmdc:mga00v17_15246_c1 3300050491 Bacteria 4310
1568 nmdc:mga00v17_16663_c1 3300050491 Bacteria 4145
1569 nmdc:mga00v17_18980_c1 3300050491 Bacteria 3916
1570 nmdc:mga00v17_2758_c1 3300050491 Bacteria 9012
1571 nmdc:mga00v17_34200_c1 3300050491 Bacteria 3017
1572 nmdc:mga00v17_3705_c2 3300050491 Bacteria 3444
1573 nmdc:mga00v17_4239_c1 3300050491 Bacteria 7443
1574 nmdc:mga0yw44_1056_c1 3300050492 Bacteria 10593
1575 nmdc:mga0yw44_47032_c1 3300050492 Bacteria 2595
1576 nmdc:mga0yw44_6400_c1 3300050492 Bacteria 5687
1577 nmdc:mga0yw44_88127_c1 3300050492 Bacteria 1957
1578 nmdc:mga06z11_15009_c1 3300050494 Bacteria 3448
1579 nmdc:mga04h51_3331_c1 3300050495 Bacteria 3467
1580 nmdc:mga07m45_12427_c1 3300050496 Bacteria 4501
1581 nmdc:mga07m45_13457_c1 3300050496 Bacteria 4343
1582 nmdc:mga07m45_15847_c1 3300050496 Bacteria 4029
1583 nmdc:mga07m45_21100_c1 3300050496 Bacteria 3543
1584 nmdc:mga07m45_51136_c1 3300050496 Bacteria 2330
1585 nmdc:mga05p37_1749_c1 3300050507 Bacteria 25357
1586 nmdc:mga05p37_17911_c1 3300050507 Bacteria 8550
1587 nmdc:mga05p37_358218_c1 3300050507 Bacteria 1716
1588 nmdc:mga05p37_60787_c1 3300050507 Bacteria 4652
1589 nmdc:mga05p37_67807_c1 3300050507 Bacteria 4389
1590 nmdc:mga05p37_95379_c1 3300050507 Bacteria 3665
1591 nmdc:mga09592_23705_c1 3300050508 Bacteria 5070
1592 nmdc:mga09592_64236_c1 3300050508 Bacteria 3107
1593 nmdc:mga09592_83537_c1 3300050508 Bacteria 2722
1594 nmdc:mga0qj67_12587_c1 3300050509 Bacteria 6377
1595 nmdc:mga0qj67_131927_c1 3300050509 Bacteria 2023
1596 nmdc:mga0qj67_5924_c1 3300050509 Bacteria 8957
1597 nmdc:mga06r32_1952_c2 3300050510 Bacteria 8936
1598 nmdc:mga08y16_138593_c1 3300050511 Bacteria 2529
1599 nmdc:mga08y16_139438_c1 3300050511 Bacteria 2521
1600 nmdc:mga08y16_161465_c1 3300050511 Bacteria 2329
1601 nmdc:mga08y16_82680_c1 3300050511 Bacteria 3347
1602 nmdc:mga0n895_18283_c1 3300050512 Bacteria 6482
1603 nmdc:mga0n895_1840_c1 3300050512 Bacteria 16182
1604 nmdc:mga0n895_214400_c1 3300050512 Bacteria 1955
1605 nmdc:mga0n895_228170_c1 3300050512 Bacteria 1890
1606 nmdc:mga0rr50_129887_c1 3300050513 Bacteria 2016
1607 nmdc:mga0rr50_208809_c1 3300050513 Bacteria 1608
1608 nmdc:mga0rr50_29549_c1 3300050513 Bacteria 3868
1609 nmdc:mga0a205_34549_c1 3300050515 Bacteria 4850
1610 nmdc:mga0a205_41002_c1 3300050515 Bacteria 4458
1611 nmdc:mga0a205_44535_c1 3300050515 Bacteria 4278
1612 nmdc:mga0a205_6663_c1 3300050515 Bacteria 10451
1613 nmdc:mga0sz30_1079_c1 3300050516 Bacteria 9816
1614 nmdc:mga0sz30_4196_c1 3300050516 Bacteria 5190
1615 nmdc:mga0sz30_5141_c1 3300050516 Bacteria 4787
1616 Ga0495601_0009156 3300053077 Bacteria 5848
1617 Ga0495601_0019856 3300053077 Bacteria 4101
1618 Ga0495612_0001552 3300053078 Bacteria 9469
1619 Ga0495612_0051640 3300053078 Bacteria 1690
1620 Ga0500610_0011170 3300053079 Bacteria 4079
1621 Ga0500610_0025768 3300053079 Bacteria 2937
1622 Ga0500635_0000075 3300053080 Bacteria 64005
1623 Ga0495655_0003171 3300053083 Bacteria 2687
1624 Ga0495619_0000287 3300053085 Bacteria 35945
1625 Ga0495619_0005700 3300053085 Bacteria 7897
1626 Ga0495619_0006349 3300053085 Bacteria 7494
1627 Ga0495619_0045475 3300053085 Bacteria 2884
1628 Ga0495619_0047871 3300053085 Bacteria 2817
1629 Ga0500643_003235 3300053087 Bacteria 7931
1630 Ga0500644_0000203 3300053088 Bacteria 35985
1631 Ga0500644_0005211 3300053088 Bacteria 3273
1632 Ga0500654_017380 3300053099 Bacteria 4694
1633 Ga0500660_019742 3300053100 Bacteria 3601
1634 Ga0500556_0000883 3300053104 Bacteria 16859
1635 Ga0500569_017708 3300053109 Bacteria 1826
1636 Ga0500593_001072 3300053117 Bacteria 9891
1637 Ga0500614_011358 3300053123 Bacteria 1926
1638 Ga0500652_001141 3300053131 Bacteria 8524
1639 Ga0500652_025994 3300053131 Bacteria 2249
1640 Ga0500559_0002237 3300053136 Bacteria 10225
1641 Ga0500573_0024525 3300053140 Bacteria 3467
1642 Ga0500600_0008867 3300053149 Bacteria 6064
1643 Ga0500616_0030958 3300053153 Bacteria 2935
1644 Ga0500624_001618 3300053157 Bacteria 3414
1645 Ga0500630_040150 3300053159 Bacteria 2285
1646 Ga0500633_0006523 3300053160 Bacteria 2868
1647 Ga0501084_0002183 3300054114 Bacteria 15695
1648 Ga0501084_0007824 3300054114 Bacteria 8795
1649 Ga0501084_0009070 3300054114 Bacteria 8229
1650 Ga0501084_0027049 3300054114 Bacteria 4792
1651 Ga0501084_0029803 3300054114 Bacteria 4564
1652 Ga0501084_0036552 3300054114 Bacteria 4102
1653 Ga0590074_004035 3300059423 Bacteria 2426
1654 Ga0501082_0007309 3300060353 Bacteria 9530
1655 Ga0501082_0032214 3300060353 Bacteria 4520
1656 Ga0501082_0123092 3300060353 Bacteria 2249
1657 Ga0501082_0197435 3300060353 Bacteria 1750
1658 Ga0466962_0002734 3300061719 Bacteria 8378
1659 Ga0466962_0004115 3300061719 Bacteria 6966
1660 Ga0530510_0009221 3300061734 Bacteria 6917
1661 Ga0530510_0015569 3300061734 Bacteria 5376
1662 Ga0530510_0022754 3300061734 Bacteria 4465
1663 Ga0530510_0105651 3300061734 Bacteria 2061
1664 Ga0530510_0106557 3300061734 Bacteria 2051
1665 Ga0530510_0119442 3300061734 Bacteria 1934

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013306 Ga0163162_10392924 Ga0163162_103929242 404
2 3300026023 Ga0207677_10132116 Ga0207677_101321162 404
3 3300025907 Ga0207645_10027362 Ga0207645_100273622 416
4 3300035121 Ga0373960_0032669 Ga0373960_0032669_176_1450 419
5 3300037418 Ga0395900_0123683 Ga0395900_0123683_1189_2463 419
6 3300038443 Ga0395901_0150997 Ga0395901_0150997_844_2118 419
7 3300049577 Ga0501041_0166846 Ga0501041_0166846_33_1307 419
8 3300050508 nmdc:mga09592_83537_c1 nmdc:mga09592_83537_c1_22_1437 424
9 3300003323 rootH1_10007198 rootH1_100071982 425
10 3300006175 Ga0070712_100061058 Ga0070712_1000610582 430
11 iso_pu_bacteria 2875391855 2875395402 432
12 3300046533 Ga0495640_0026924 Ga0495640_0026924_357_1703 433
13 3300049581 Ga0501047_0317416 Ga0501047_0317416_38_1384 433
14 3300053153 Ga0500616_0030958 Ga0500616_0030958_1550_2899 433
15 3300005543 Ga0070672_100075639 Ga0070672_1000756392 435
16 3300009177 Ga0105248_10101734 Ga0105248_101017342 435
17 3300011119 Ga0105246_10055379 Ga0105246_100553793 435
18 3300026121 Ga0207683_10028085 Ga0207683_100280854 435
19 3300049574 Ga0501038_0029580 Ga0501038_0029580_2234_3799 436
20 3300049576 Ga0501040_0020460 Ga0501040_0020460_2237_3802 436
21 3300049578 Ga0501042_0019805 Ga0501042_0019805_581_2146 436
22 3300049744 Ga0501083_0063353 Ga0501083_0063353_393_1958 436
23 3300054114 Ga0501084_0007824 Ga0501084_0007824_4739_6304 436
24 3300046525 Ga0495663_0003164 Ga0495663_0003164_2809_4221 437
25 3300046537 Ga0495598_0001568 Ga0495598_0001568_1061_2473 437
26 3300046615 Ga0495656_0001451 Ga0495656_0001451_556_1968 437
27 3300046664 Ga0495659_0009071 Ga0495659_0009071_273_1685 437
28 3300046691 Ga0495670_0017326 Ga0495670_0017326_409_1821 437
29 3300046794 Ga0495589_0013451 Ga0495589_0013451_1759_3171 437
30 3300046809 Ga0495600_0086567 Ga0495600_0086567_77_1474 437
31 3300006237 Ga0097621_100075892 Ga0097621_1000758923 438
32 3300009177 Ga0105248_10138281 Ga0105248_101382812 438
33 3300026075 Ga0207708_10058417 Ga0207708_100584173 438
34 3300026088 Ga0207641_10126229 Ga0207641_101262292 438
35 3300026089 Ga0207648_10044017 Ga0207648_100440172 438
36 3300026118 Ga0207675_100140274 Ga0207675_1001402742 438
37 3300005328 Ga0070676_10124627 Ga0070676_101246272 440
38 3300005331 Ga0070670_100068315 Ga0070670_1000683153 440
39 3300005354 Ga0070675_100042140 Ga0070675_1000421402 440
40 3300005365 Ga0070688_100104321 Ga0070688_1001043212 440
41 3300005366 Ga0070659_100208152 Ga0070659_1002081521 440
42 3300005614 Ga0068856_100114923 Ga0068856_1001149232 440
43 3300005617 Ga0068859_100194686 Ga0068859_1001946862 440
44 3300005719 Ga0068861_100094605 Ga0068861_1000946052 440
45 3300005834 Ga0068851_10029524 Ga0068851_100295243 440
46 3300005842 Ga0068858_100056289 Ga0068858_1000562892 440
47 3300006931 Ga0097620_100194683 Ga0097620_1001946833 440
48 3300009094 Ga0111539_10268440 Ga0111539_102684401 440
49 3300009176 Ga0105242_10168970 Ga0105242_101689702 440
50 3300025901 Ga0207688_10034165 Ga0207688_100341652 440
51 3300025908 Ga0207643_10032559 Ga0207643_100325592 440
52 3300025935 Ga0207709_10031082 Ga0207709_100310822 440
53 3300025942 Ga0207689_10117628 Ga0207689_101176281 440
54 3300026067 Ga0207678_10042275 Ga0207678_100422752 440
55 3300026121 Ga0207683_10133096 Ga0207683_101330962 440
56 3300026142 Ga0207698_10095781 Ga0207698_100957813 440
57 3300028379 Ga0268266_10265384 Ga0268266_102653842 440
58 3300028381 Ga0268264_10100118 Ga0268264_101001182 440
59 3300035092 Ga0373952_0007530 Ga0373952_0007530_523_1914 440
60 3300035241 Ga0373961_0007126 Ga0373961_0007126_1157_2548 440
61 3300048908 Ga0496105_0055343 Ga0496105_0055343_1267_2658 440
62 3300050511 nmdc:mga08y16_161465_c1 nmdc:mga08y16_161465_c1_648_2039 440
63 3300031247 Ga0265340_10001252 Ga0265340_1000125213 441
64 3300050507 nmdc:mga05p37_358218_c1 nmdc:mga05p37_358218_c1_59_1408 442
65 3300050515 nmdc:mga0a205_34549_c1 nmdc:mga0a205_34549_c1_3475_4827 443
66 3300005471 Ga0070698_100078423 Ga0070698_1000784232 444
67 3300005440 Ga0070705_100126453 Ga0070705_1001264532 445
68 3300025927 Ga0207687_10089023 Ga0207687_100890232 445
69 3300047321 Ga0495676_0043922 Ga0495676_0043922_818_2167 445
70 3300037418 Ga0395900_0137597 Ga0395900_0137597_412_1770 447
71 3300049576 Ga0501040_0053493 Ga0501040_0053493_241_1611 449
72 3300009098 Ga0105245_10094732 Ga0105245_100947322 450
73 3300046455 Ga0495603_0055917 Ga0495603_0055917_240_1625 450
74 3300046516 Ga0495628_0003309 Ga0495628_0003309_2870_4375 450
75 3300046517 Ga0495630_0015558 Ga0495630_0015558_955_2460 450
76 3300046526 Ga0495666_0008597 Ga0495666_0008597_954_2459 450
77 3300046683 Ga0495658_0004221 Ga0495658_0004221_580_2085 450
78 3300047471 Ga0495684_0028076 Ga0495684_0028076_1489_2994 450
79 3300048904 Ga0496101_0067728 Ga0496101_0067728_444_1829 450
80 3300048907 Ga0496104_0189851 Ga0496104_0189851_29_1414 450
81 3300048908 Ga0496105_0122837 Ga0496105_0122837_631_2016 450
82 3300005544 Ga0070686_100042248 Ga0070686_1000422482 451
83 3300009553 Ga0105249_10196957 Ga0105249_101969572 451
84 3300013105 Ga0157369_10011357 Ga0157369_100113573 451
85 3300025936 Ga0207670_10078538 Ga0207670_100785382 451
86 3300025949 Ga0207667_10104289 Ga0207667_101042892 451
87 3300037068 Ga0373925_0004553 Ga0373925_0004553_3291_4679 451
88 3300044658 Ga0466972_0004237 Ga0466972_0004237_3708_5105 451
89 3300044683 Ga0466965_0002597 Ga0466965_0002597_4597_5994 451
90 3300044694 Ga0466963_0005946 Ga0466963_0005946_4567_5967 451
91 3300044735 Ga0466968_0005739 Ga0466968_0005739_1526_2923 451
92 3300044901 Ga0466960_0004914 Ga0466960_0004914_331_1728 451
93 3300046462 Ga0495651_0000760 Ga0495651_0000760_6363_7769 451
94 3300046511 Ga0495608_0072806 Ga0495608_0072806_167_1573 451
95 3300046517 Ga0495630_0043531 Ga0495630_0043531_1886_3292 451
96 3300046533 Ga0495640_0025790 Ga0495640_0025790_374_1762 451
97 3300046536 Ga0495587_0003571 Ga0495587_0003571_2052_3458 451
98 3300046543 Ga0495645_0057476 Ga0495645_0057476_269_1657 451
99 3300046559 Ga0495667_0026764 Ga0495667_0026764_2256_3662 451
100 3300046642 Ga0495634_0016773 Ga0495634_0016773_1729_3135 451
101 3300046663 Ga0495635_0014661 Ga0495635_0014661_4057_5445 451
102 3300046678 Ga0495599_0007355 Ga0495599_0007355_4471_5877 451
103 3300047319 Ga0495674_0139133 Ga0495674_0139133_161_1567 451
104 3300047471 Ga0495684_0041286 Ga0495684_0041286_1879_3285 451
105 3300048088 Ga0495602_0069059 Ga0495602_0069059_1567_2955 451
106 3300053077 Ga0495601_0009156 Ga0495601_0009156_4132_5538 451
107 3300005536 Ga0070697_100137220 Ga0070697_1001372201 452
108 3300035692 Ga0373935_0178000 Ga0373935_0178000_14_1372 452
109 3300053083 Ga0495655_0003171 Ga0495655_0003171_1290_2654 452
110 3300005338 Ga0068868_100046911 Ga0068868_1000469112 453
111 3300005367 Ga0070667_100006339 Ga0070667_10000633910 453
112 3300005467 Ga0070706_100001603 Ga0070706_10000160315 453
113 3300005471 Ga0070698_100032044 Ga0070698_1000320444 453
114 3300006028 Ga0070717_10009137 Ga0070717_100091374 453
115 3300013105 Ga0157369_10315700 Ga0157369_103157002 453
116 3300013307 Ga0157372_10365711 Ga0157372_103657112 453
117 3300025910 Ga0207684_10001691 Ga0207684_1000169110 453
118 3300025986 Ga0207658_10004057 Ga0207658_100040579 453
119 3300035725 Ga0373947_0060929 Ga0373947_0060929_41_1462 453
120 3300037466 Ga0395898_0032692 Ga0395898_0032692_30_1397 453
121 3300038443 Ga0395901_0040004 Ga0395901_0040004_30_1397 453
122 3300046459 Ga0495629_0007553 Ga0495629_0007553_6097_7518 453
123 3300046473 Ga0495582_0000196 Ga0495582_0000196_18861_20282 453
124 3300046475 Ga0495639_0003060 Ga0495639_0003060_1556_2977 453
125 3300046681 Ga0495647_0026356 Ga0495647_0026356_255_1676 453
126 3300046683 Ga0495658_0000958 Ga0495658_0000958_12952_14373 453
127 3300046689 Ga0495613_0001873 Ga0495613_0001873_9864_11285 453
128 3300047315 Ga0495581_0016654 Ga0495581_0016654_269_1690 453
129 3300049583 Ga0501067_0000770 Ga0501067_0000770_6505_7881 453
130 3300049585 Ga0501069_0010191 Ga0501069_0010191_1799_3175 453
131 3300049586 Ga0501070_0099343 Ga0501070_0099343_221_1597 453
132 3300061734 Ga0530510_0009221 Ga0530510_0009221_1803_3179 453
133 3300005445 Ga0070708_100209049 Ga0070708_1002090493 454
134 3300005467 Ga0070706_100090432 Ga0070706_1000904322 454
135 3300005471 Ga0070698_100086268 Ga0070698_1000862682 454
136 3300009098 Ga0105245_10122666 Ga0105245_101226662 454
137 3300025910 Ga0207684_10048508 Ga0207684_100485084 454
138 3300025915 Ga0207693_10131086 Ga0207693_101310862 454
139 3300025928 Ga0207700_10005737 Ga0207700_100057373 454
140 3300037418 Ga0395900_0019737 Ga0395900_0019737_3203_4645 454
141 3300046678 Ga0495599_0078861 Ga0495599_0078861_633_2030 454
142 3300047317 Ga0495604_0072911 Ga0495604_0072911_1170_2567 454
143 3300005440 Ga0070705_100165590 Ga0070705_1001655901 455
144 3300005549 Ga0070704_100010596 Ga0070704_1000105965 455
145 3300005985 Ga0081539_10002475 Ga0081539_1000247524 455
146 3300009147 Ga0114129_10093729 Ga0114129_100937295 455
147 3300037418 Ga0395900_0026863 Ga0395900_0026863_4460_5839 455
148 3300038443 Ga0395901_0008790 Ga0395901_0008790_159_1538 455
149 3300038443 Ga0395901_0294517 Ga0395901_0294517_160_1539 455
150 3300050507 nmdc:mga05p37_95379_c1 nmdc:mga05p37_95379_c1_833_2212 455
151 3300050512 nmdc:mga0n895_228170_c1 nmdc:mga0n895_228170_c1_394_1773 455
152 3300005440 Ga0070705_100109810 Ga0070705_1001098102 456
153 3300005471 Ga0070698_100129954 Ga0070698_1001299542 456
154 3300005518 Ga0070699_100006304 Ga0070699_1000063042 456
155 3300005719 Ga0068861_100048451 Ga0068861_1000484513 456
156 3300005937 Ga0081455_10020571 Ga0081455_100205712 456
157 3300005937 Ga0081455_10043329 Ga0081455_100433292 456
158 3300005937 Ga0081455_10070877 Ga0081455_100708773 456
159 3300006038 Ga0075365_10062129 Ga0075365_100621292 456
160 3300006844 Ga0075428_100142137 Ga0075428_1001421372 456
161 3300006846 Ga0075430_100069161 Ga0075430_1000691612 456
162 3300006852 Ga0075433_10149382 Ga0075433_101493822 456
163 3300006871 Ga0075434_100033684 Ga0075434_1000336844 456
164 3300006880 Ga0075429_100070269 Ga0075429_1000702692 456
165 3300007076 Ga0075435_100188495 Ga0075435_1001884951 456
166 3300009011 Ga0105251_10014758 Ga0105251_100147581 456
167 3300009094 Ga0111539_10109140 Ga0111539_101091402 456
168 3300009148 Ga0105243_10005454 Ga0105243_100054544 456
169 3300011119 Ga0105246_10019564 Ga0105246_100195642 456
170 3300014326 Ga0157380_10111892 Ga0157380_101118922 456
171 3300026118 Ga0207675_100015055 Ga0207675_1000150554 456
172 3300026121 Ga0207683_10003687 Ga0207683_100036873 456
173 3300027907 Ga0207428_10015628 Ga0207428_100156283 456
174 3300032002 Ga0307416_100291362 Ga0307416_1002913621 456
175 3300035113 Ga0373936_0053612 Ga0373936_0053612_62_1537 456
176 3300035691 Ga0373931_0081546 Ga0373931_0081546_325_1725 456
177 3300037312 Ga0395899_0048862 Ga0395899_0048862_1393_2775 456
178 3300037418 Ga0395900_0031138 Ga0395900_0031138_3143_4525 456
179 3300037466 Ga0395898_0025730 Ga0395898_0025730_3817_5199 456
180 3300037471 Ga0395905_0008024 Ga0395905_0008024_7541_8941 456
181 3300037471 Ga0395905_0039722 Ga0395905_0039722_1052_2434 456
182 3300038443 Ga0395901_0014492 Ga0395901_0014492_88_1488 456
183 3300038443 Ga0395901_0018796 Ga0395901_0018796_2045_3427 456
184 3300046523 Ga0495644_0019174 Ga0495644_0019174_318_1718 456
185 3300046664 Ga0495659_0027791 Ga0495659_0027791_39_1439 456
186 3300047318 Ga0495636_0014627 Ga0495636_0014627_254_1654 456
187 3300048903 Ga0496100_0042606 Ga0496100_0042606_960_2345 456
188 3300048909 Ga0496106_0052286 Ga0496106_0052286_117_1502 456
189 3300048912 Ga0496109_0023364 Ga0496109_0023364_1427_2827 456
190 3300048912 Ga0496109_0146857 Ga0496109_0146857_643_2025 456
191 3300048918 Ga0496115_0024870 Ga0496115_0024870_1693_3078 456
192 3300049576 Ga0501040_0148082 Ga0501040_0148082_211_1611 456
193 3300049578 Ga0501042_0003823 Ga0501042_0003823_6353_7753 456
194 3300049582 Ga0501048_0038612 Ga0501048_0038612_67_1467 456
195 3300049587 Ga0501071_0111312 Ga0501071_0111312_430_1830 456
196 3300049588 Ga0501072_0015730 Ga0501072_0015730_3905_5305 456
197 3300049592 Ga0501076_0014706 Ga0501076_0014706_4418_5818 456
198 3300049824 Ga0501045_0029159 Ga0501045_0029159_2542_3942 456
199 3300050492 nmdc:mga0yw44_6400_c1 nmdc:mga0yw44_6400_c1_610_1992 456
200 3300050508 nmdc:mga09592_23705_c1 nmdc:mga09592_23705_c1_1130_2530 456
201 3300050509 nmdc:mga0qj67_12587_c1 nmdc:mga0qj67_12587_c1_997_2397 456
202 3300050509 nmdc:mga0qj67_131927_c1 nmdc:mga0qj67_131927_c1_581_1981 456
203 3300050511 nmdc:mga08y16_139438_c1 nmdc:mga08y16_139438_c1_701_2101 456
204 3300050512 nmdc:mga0n895_18283_c1 nmdc:mga0n895_18283_c1_4086_5486 456
205 3300050513 nmdc:mga0rr50_208809_c1 nmdc:mga0rr50_208809_c1_180_1565 456
206 3300050515 nmdc:mga0a205_41002_c1 nmdc:mga0a205_41002_c1_225_1625 456
207 3300053077 Ga0495601_0019856 Ga0495601_0019856_2375_3781 456
208 3300061734 Ga0530510_0015569 Ga0530510_0015569_111_1511 456
209 3300002459 JGI24751J29686_10000209 JGI24751J29686_1000020919 457
210 3300005331 Ga0070670_100033934 Ga0070670_1000339342 457
211 3300005331 Ga0070670_100038607 Ga0070670_1000386075 457
212 3300005441 Ga0070700_100033994 Ga0070700_1000339941 457
213 3300005471 Ga0070698_100180339 Ga0070698_1001803391 457
214 3300005549 Ga0070704_100079868 Ga0070704_1000798681 457
215 3300005564 Ga0070664_100006163 Ga0070664_1000061636 457
216 3300005618 Ga0068864_100067923 Ga0068864_1000679233 457
217 3300005840 Ga0068870_10006734 Ga0068870_100067346 457
218 3300005841 Ga0068863_100004403 Ga0068863_1000044034 457
219 3300005844 Ga0068862_100008410 Ga0068862_1000084109 457
220 3300005937 Ga0081455_10090545 Ga0081455_100905452 457
221 3300005985 Ga0081539_10032775 Ga0081539_100327752 457
222 3300006844 Ga0075428_100165929 Ga0075428_1001659292 457
223 3300025885 Ga0207653_10010318 Ga0207653_100103182 457
224 3300025908 Ga0207643_10002462 Ga0207643_100024622 457
225 3300025925 Ga0207650_10005383 Ga0207650_100053836 457
226 3300025925 Ga0207650_10026865 Ga0207650_100268655 457
227 3300025945 Ga0207679_10134134 Ga0207679_101341342 457
228 3300026075 Ga0207708_10004753 Ga0207708_100047534 457
229 3300026095 Ga0207676_10016796 Ga0207676_100167962 457
230 3300026116 Ga0207674_10001198 Ga0207674_1000119811 457
231 3300027907 Ga0207428_10129333 Ga0207428_101293332 457
232 3300028380 Ga0268265_10020870 Ga0268265_100208705 457
233 3300044712 Ga0453684_0000719 Ga0453684_0000719_47414_48850 457
234 3300005435 Ga0070714_100302751 Ga0070714_1003027511 458
235 3300005441 Ga0070700_100009980 Ga0070700_1000099804 458
236 3300005459 Ga0068867_100035193 Ga0068867_1000351932 458
237 3300005471 Ga0070698_100010138 Ga0070698_1000101383 458
238 3300005985 Ga0081539_10006896 Ga0081539_1000689611 458
239 3300005985 Ga0081539_10035770 Ga0081539_100357704 458
240 3300006871 Ga0075434_100010168 Ga0075434_1000101687 458
241 3300009094 Ga0111539_10053720 Ga0111539_100537204 458
242 3300009147 Ga0114129_10010215 Ga0114129_100102156 458
243 3300009147 Ga0114129_10457563 Ga0114129_104575632 458
244 3300014325 Ga0163163_10357907 Ga0163163_103579071 458
245 3300014326 Ga0157380_10058555 Ga0157380_100585552 458
246 3300026075 Ga0207708_10018905 Ga0207708_100189053 458
247 3300027907 Ga0207428_10003736 Ga0207428_100037362 458
248 3300032002 Ga0307416_100246945 Ga0307416_1002469451 458
249 3300046455 Ga0495603_0015069 Ga0495603_0015069_1816_3222 458
250 3300048907 Ga0496104_0013277 Ga0496104_0013277_4415_5890 458
251 3300050507 nmdc:mga05p37_67807_c1 nmdc:mga05p37_67807_c1_1825_3237 458
252 3300050508 nmdc:mga09592_64236_c1 nmdc:mga09592_64236_c1_725_2137 458
253 3300005328 Ga0070676_10032460 Ga0070676_100324602 459
254 3300005330 Ga0070690_100023491 Ga0070690_1000234912 459
255 3300005345 Ga0070692_10044824 Ga0070692_100448242 459
256 3300005406 Ga0070703_10000050 Ga0070703_1000005012 459
257 3300005438 Ga0070701_10007222 Ga0070701_100072222 459
258 3300005439 Ga0070711_100016193 Ga0070711_1000161932 459
259 3300005445 Ga0070708_100001634 Ga0070708_10000163411 459
260 3300005445 Ga0070708_100081920 Ga0070708_1000819204 459
261 3300005456 Ga0070678_100000629 Ga0070678_1000006293 459
262 3300005467 Ga0070706_100002425 Ga0070706_10000242520 459
263 3300005471 Ga0070698_100016904 Ga0070698_1000169041 459
264 3300005544 Ga0070686_100006816 Ga0070686_1000068162 459
265 3300005546 Ga0070696_100008936 Ga0070696_1000089365 459
266 3300005549 Ga0070704_100002771 Ga0070704_1000027719 459
267 3300005615 Ga0070702_100001386 Ga0070702_1000013862 459
268 3300005618 Ga0068864_100038615 Ga0068864_1000386154 459
269 3300005718 Ga0068866_10023813 Ga0068866_100238132 459
270 3300005842 Ga0068858_100033716 Ga0068858_1000337164 459
271 3300005937 Ga0081455_10002415 Ga0081455_1000241521 459
272 3300005937 Ga0081455_10009174 Ga0081455_1000917410 459
273 3300005937 Ga0081455_10024363 Ga0081455_100243634 459
274 3300006058 Ga0075432_10006628 Ga0075432_100066282 459
275 3300006175 Ga0070712_100062868 Ga0070712_1000628683 459
276 3300006237 Ga0097621_100009223 Ga0097621_1000092234 459
277 3300006852 Ga0075433_10001584 Ga0075433_1000158412 459
278 3300006852 Ga0075433_10004531 Ga0075433_100045317 459
279 3300006871 Ga0075434_100001999 Ga0075434_10000199917 459
280 3300007076 Ga0075435_100004935 Ga0075435_1000049358 459
281 3300009094 Ga0111539_10022303 Ga0111539_100223037 459
282 3300009098 Ga0105245_10102396 Ga0105245_101023962 459
283 3300009101 Ga0105247_10044546 Ga0105247_100445462 459
284 3300009147 Ga0114129_10006795 Ga0114129_1000679518 459
285 3300009148 Ga0105243_10003636 Ga0105243_100036367 459
286 3300009148 Ga0105243_10004875 Ga0105243_1000487512 459
287 3300009148 Ga0105243_10027652 Ga0105243_100276525 459
288 3300009176 Ga0105242_10006982 Ga0105242_100069822 459
289 3300009176 Ga0105242_10019706 Ga0105242_100197064 459
290 3300009176 Ga0105242_10028160 Ga0105242_100281606 459
291 3300009177 Ga0105248_10013543 Ga0105248_100135439 459
292 3300009177 Ga0105248_10014779 Ga0105248_100147797 459
293 3300013297 Ga0157378_10006854 Ga0157378_100068542 459
294 3300013297 Ga0157378_10008086 Ga0157378_1000808611 459
295 3300013297 Ga0157378_10043288 Ga0157378_100432883 459
296 3300013306 Ga0163162_10111716 Ga0163162_101117162 459
297 3300013308 Ga0157375_10028262 Ga0157375_100282626 459
298 3300014968 Ga0157379_10006578 Ga0157379_100065788 459
299 3300014968 Ga0157379_10137423 Ga0157379_101374232 459
300 3300014969 Ga0157376_10014307 Ga0157376_100143075 459
301 3300025885 Ga0207653_10000062 Ga0207653_1000006277 459
302 3300025899 Ga0207642_10036319 Ga0207642_100363192 459
303 3300025905 Ga0207685_10001306 Ga0207685_100013062 459
304 3300025910 Ga0207684_10000325 Ga0207684_1000032541 459
305 3300025915 Ga0207693_10000726 Ga0207693_1000072613 459
306 3300025916 Ga0207663_10058299 Ga0207663_100582992 459
307 3300025919 Ga0207657_10120542 Ga0207657_101205422 459
308 3300025922 Ga0207646_10006936 Ga0207646_1000693610 459
309 3300025927 Ga0207687_10009711 Ga0207687_100097115 459
310 3300025927 Ga0207687_10028702 Ga0207687_100287026 459
311 3300025931 Ga0207644_10087035 Ga0207644_100870352 459
312 3300025937 Ga0207669_10085760 Ga0207669_100857602 459
313 3300025938 Ga0207704_10062815 Ga0207704_100628152 459
314 3300025940 Ga0207691_10047852 Ga0207691_100478522 459
315 3300025941 Ga0207711_10206317 Ga0207711_102063172 459
316 3300026023 Ga0207677_10009603 Ga0207677_100096036 459
317 3300026067 Ga0207678_10071753 Ga0207678_100717532 459
318 3300026075 Ga0207708_10019809 Ga0207708_100198094 459
319 3300026089 Ga0207648_10009508 Ga0207648_100095089 459
320 3300026095 Ga0207676_10065671 Ga0207676_100656712 459
321 3300026118 Ga0207675_100048519 Ga0207675_1000485193 459
322 3300026121 Ga0207683_10000327 Ga0207683_100003273 459
323 3300026121 Ga0207683_10021432 Ga0207683_100214322 459
324 3300027907 Ga0207428_10011116 Ga0207428_100111166 459
325 3300035089 Ga0373944_0000004 Ga0373944_0000004_40675_42087 459
326 3300035113 Ga0373936_0003475 Ga0373936_0003475_2573_3985 459
327 3300035116 Ga0373945_0000904 Ga0373945_0000904_4588_6000 459
328 3300035695 Ga0373927_0000623 Ga0373927_0000623_11911_13323 459
329 3300036712 Ga0316584_0081727 Ga0316584_0081727_970_2388 459
330 3300037418 Ga0395900_0129368 Ga0395900_0129368_243_1655 459
331 3300037466 Ga0395898_0035131 Ga0395898_0035131_760_2190 459
332 3300038443 Ga0395901_0190418 Ga0395901_0190418_308_1720 459
333 3300038443 Ga0395901_0243584 Ga0395901_0243584_56_1486 459
334 3300046455 Ga0495603_0017507 Ga0495603_0017507_2319_3731 459
335 3300046455 Ga0495603_0027400 Ga0495603_0027400_1909_3324 459
336 3300046461 Ga0495641_0001496 Ga0495641_0001496_14815_16227 459
337 3300046472 Ga0495580_0013508 Ga0495580_0013508_3719_5131 459
338 3300046473 Ga0495582_0000400 Ga0495582_0000400_9252_10664 459
339 3300046475 Ga0495639_0000497 Ga0495639_0000497_3346_4758 459
340 3300046476 Ga0495662_0002136 Ga0495662_0002136_5881_7293 459
341 3300046517 Ga0495630_0032538 Ga0495630_0032538_1276_2688 459
342 3300046523 Ga0495644_0045775 Ga0495644_0045775_141_1562 459
343 3300046526 Ga0495666_0019217 Ga0495666_0019217_1411_2823 459
344 3300046531 Ga0495665_0000161 Ga0495665_0000161_25496_26908 459
345 3300046531 Ga0495665_0006330 Ga0495665_0006330_4269_5681 459
346 3300046537 Ga0495598_0009711 Ga0495598_0009711_25_1446 459
347 3300046558 Ga0495633_0026689 Ga0495633_0026689_466_1887 459
348 3300046642 Ga0495634_0001788 Ga0495634_0001788_3806_5218 459
349 3300046663 Ga0495635_0004116 Ga0495635_0004116_4082_5494 459
350 3300046674 Ga0495588_0000691 Ga0495588_0000691_13921_15333 459
351 3300046681 Ga0495647_0001010 Ga0495647_0001010_566_1978 459
352 3300046683 Ga0495658_0060303 Ga0495658_0060303_613_2025 459
353 3300046690 Ga0495624_0001856 Ga0495624_0001856_14391_15803 459
354 3300046691 Ga0495670_0045453 Ga0495670_0045453_593_2014 459
355 3300047315 Ga0495581_0000415 Ga0495581_0000415_12518_13930 459
356 3300047319 Ga0495674_0025277 Ga0495674_0025277_2067_3479 459
357 3300047321 Ga0495676_0101095 Ga0495676_0101095_635_2047 459
358 3300047673 Ga0495593_0001467 Ga0495593_0001467_9173_10585 459
359 3300048903 Ga0496100_0004552 Ga0496100_0004552_3420_4832 459
360 3300048903 Ga0496100_0006163 Ga0496100_0006163_725_2116 459
361 3300048903 Ga0496100_0076656 Ga0496100_0076656_457_1872 459
362 3300048904 Ga0496101_0007031 Ga0496101_0007031_1839_3251 459
363 3300048904 Ga0496101_0022473 Ga0496101_0022473_2184_3575 459
364 3300048904 Ga0496101_0101765 Ga0496101_0101765_385_1800 459
365 3300048905 Ga0496102_0023596 Ga0496102_0023596_3295_4686 459
366 3300048905 Ga0496102_0036116 Ga0496102_0036116_1033_2445 459
367 3300048905 Ga0496102_0060254 Ga0496102_0060254_1908_3323 459
368 3300048905 Ga0496102_0083000 Ga0496102_0083000_1384_2796 459
369 3300048906 Ga0496103_0058621 Ga0496103_0058621_722_2134 459
370 3300048907 Ga0496104_0005891 Ga0496104_0005891_566_1957 459
371 3300048908 Ga0496105_0127550 Ga0496105_0127550_581_1972 459
372 3300048909 Ga0496106_0010190 Ga0496106_0010190_3992_5407 459
373 3300048910 Ga0496107_0009225 Ga0496107_0009225_1415_2830 459
374 3300048911 Ga0496108_0090404 Ga0496108_0090404_1056_2468 459
375 3300048911 Ga0496108_0176195 Ga0496108_0176195_23_1444 459
376 3300048912 Ga0496109_0005225 Ga0496109_0005225_5265_6677 459
377 3300048914 Ga0496111_0003079 Ga0496111_0003079_4186_5598 459
378 3300048915 Ga0496112_0080300 Ga0496112_0080300_54_1466 459
379 3300048917 Ga0496114_0001198 Ga0496114_0001198_433_1845 459
380 3300048917 Ga0496114_0049896 Ga0496114_0049896_1334_2725 459
381 3300049568 Ga0501031_0157247 Ga0501031_0157247_60_1451 459
382 3300049576 Ga0501040_0096384 Ga0501040_0096384_474_1865 459
383 3300049592 Ga0501076_0015983 Ga0501076_0015983_3155_4546 459
384 3300049593 Ga0501077_0092327 Ga0501077_0092327_333_1748 459
385 3300050507 nmdc:mga05p37_60787_c1 nmdc:mga05p37_60787_c1_1482_2927 459
386 3300050512 nmdc:mga0n895_1840_c1 nmdc:mga0n895_1840_c1_1449_2864 459
387 3300050513 nmdc:mga0rr50_29549_c1 nmdc:mga0rr50_29549_c1_1942_3357 459
388 3300050515 nmdc:mga0a205_6663_c1 nmdc:mga0a205_6663_c1_5833_7278 459
389 3300053078 Ga0495612_0001552 Ga0495612_0001552_5473_6954 459
390 3300053085 Ga0495619_0000287 Ga0495619_0000287_11021_12433 459
391 3300053085 Ga0495619_0005700 Ga0495619_0005700_2184_3665 459
392 3300060353 Ga0501082_0197435 Ga0501082_0197435_265_1689 459
393 3300003373 JGI25407J50210_10003181 JGI25407J50210_100031812 460
394 3300005981 Ga0081538_10000367 Ga0081538_1000036712 460
395 3300006846 Ga0075430_100004467 Ga0075430_1000044674 460
396 3300009147 Ga0114129_10077685 Ga0114129_100776853 460
397 3300014325 Ga0163163_10232732 Ga0163163_102327322 460
398 3300028380 Ga0268265_10141224 Ga0268265_101412242 460
399 3300032126 Ga0307415_100010986 Ga0307415_1000109862 460
400 3300044712 Ga0453684_0001079 Ga0453684_0001079_77126_78622 460
401 3300049570 Ga0501033_0006275 Ga0501033_0006275_3680_5098 460
402 3300049570 Ga0501033_0132077 Ga0501033_0132077_351_1769 460
403 3300049571 Ga0501034_0023927 Ga0501034_0023927_1013_2431 460
404 3300049573 Ga0501037_0035942 Ga0501037_0035942_1219_2637 460
405 3300049575 Ga0501039_0021966 Ga0501039_0021966_1753_3171 460
406 3300049582 Ga0501048_0049259 Ga0501048_0049259_1496_2914 460
407 3300049585 Ga0501069_0001749 Ga0501069_0001749_810_2228 460
408 3300049586 Ga0501070_0001285 Ga0501070_0001285_14347_15765 460
409 3300049587 Ga0501071_0008335 Ga0501071_0008335_738_2156 460
410 3300049588 Ga0501072_0070039 Ga0501072_0070039_1195_2613 460
411 3300049589 Ga0501073_0040761 Ga0501073_0040761_673_2091 460
412 3300049591 Ga0501075_0005120 Ga0501075_0005120_1975_3393 460
413 3300049591 Ga0501075_0005138 Ga0501075_0005138_2051_3469 460
414 3300049592 Ga0501076_0001890 Ga0501076_0001890_7348_8766 460
415 3300049592 Ga0501076_0079955 Ga0501076_0079955_957_2375 460
416 3300049593 Ga0501077_0008984 Ga0501077_0008984_1003_2421 460
417 3300049741 Ga0501079_0022458 Ga0501079_0022458_2407_3825 460
418 3300049742 Ga0501080_0044785 Ga0501080_0044785_2240_3658 460
419 3300049743 Ga0501081_0002611 Ga0501081_0002611_4849_6267 460
420 3300049744 Ga0501083_0000728 Ga0501083_0000728_8183_9601 460
421 3300049822 Ga0501035_0006819 Ga0501035_0006819_907_2325 460
422 3300049822 Ga0501035_0030207 Ga0501035_0030207_1451_2869 460
423 3300049823 Ga0501044_0003836 Ga0501044_0003836_10881_12299 460
424 3300050507 nmdc:mga05p37_17911_c1 nmdc:mga05p37_17911_c1_85_1563 460
425 3300050509 nmdc:mga0qj67_5924_c1 nmdc:mga0qj67_5924_c1_596_2074 460
426 3300054114 Ga0501084_0009070 Ga0501084_0009070_4067_5485 460
427 3300061734 Ga0530510_0022754 Ga0530510_0022754_1935_3353 460
428 3300005548 Ga0070665_100203863 Ga0070665_1002038632 461
429 3300005563 Ga0068855_100016329 Ga0068855_1000163297 461
430 3300005616 Ga0068852_100010514 Ga0068852_1000105142 461
431 3300009093 Ga0105240_10190176 Ga0105240_101901762 461
432 3300009551 Ga0105238_10060551 Ga0105238_100605513 461
433 3300025911 Ga0207654_10095284 Ga0207654_100952841 461
434 3300025913 Ga0207695_10002209 Ga0207695_1000220921 461
435 3300025914 Ga0207671_10000910 Ga0207671_1000091021 461
436 3300025924 Ga0207694_10000405 Ga0207694_1000040516 461
437 3300025949 Ga0207667_10113164 Ga0207667_101131642 461
438 3300026078 Ga0207702_10151189 Ga0207702_101511892 461
439 3300026142 Ga0207698_10083442 Ga0207698_100834422 461
440 3300028379 Ga0268266_10156730 Ga0268266_101567302 461
441 3300044656 Ga0466969_0039214 Ga0466969_0039214_324_1841 461
442 3300044693 Ga0466961_0029038 Ga0466961_0029038_237_1754 461
443 3300045049 Ga0466959_0079611 Ga0466959_0079611_747_2264 461
444 3300045976 Ga0466967_0041240 Ga0466967_0041240_20_1471 461
445 3300046462 Ga0495651_0001189 Ga0495651_0001189_3572_5089 461
446 3300046516 Ga0495628_0004113 Ga0495628_0004113_3219_4736 461
447 3300046529 Ga0495652_0008621 Ga0495652_0008621_5025_6542 461
448 3300046543 Ga0495645_0038272 Ga0495645_0038272_102_1619 461
449 3300059423 Ga0590074_004035 Ga0590074_004035_198_1640 461
450 3300037471 Ga0395905_0038124 Ga0395905_0038124_990_2453 462
451 3300044765 Ga0466970_0011760 Ga0466970_0011760_1852_3315 462
452 3300005445 Ga0070708_100185454 Ga0070708_1001854542 463
453 3300005467 Ga0070706_100005928 Ga0070706_10000592812 463
454 3300005468 Ga0070707_100000970 Ga0070707_1000009707 463
455 3300009098 Ga0105245_10084225 Ga0105245_100842253 463
456 3300009177 Ga0105248_10102450 Ga0105248_101024503 463
457 3300013104 Ga0157370_10139237 Ga0157370_101392372 463
458 3300014325 Ga0163163_10044765 Ga0163163_100447652 463
459 3300025910 Ga0207684_10027081 Ga0207684_100270812 463
460 3300026116 Ga0207674_10070254 Ga0207674_100702542 463
461 3300031903 Ga0307407_10042698 Ga0307407_100426982 463
462 3300048911 Ga0496108_0103119 Ga0496108_0103119_258_1733 463
463 3300048915 Ga0496112_0105933 Ga0496112_0105933_882_2342 463
464 3300049584 Ga0501068_0003180 Ga0501068_0003180_2184_3623 463
465 3300050512 nmdc:mga0n895_214400_c1 nmdc:mga0n895_214400_c1_386_1867 463
466 3300005335 Ga0070666_10054980 Ga0070666_100549802 465
467 3300014968 Ga0157379_10056310 Ga0157379_100563102 465
468 3300037312 Ga0395899_0057395 Ga0395899_0057395_146_1663 465
469 3300037466 Ga0395898_0000100 Ga0395898_0000100_186803_188320 465
470 3300044765 Ga0466970_0028270 Ga0466970_0028270_748_2166 466
471 3300048917 Ga0496114_0003634 Ga0496114_0003634_7970_9427 466
472 3300005468 Ga0070707_100000324 Ga0070707_10000032453 467
473 3300005471 Ga0070698_100000372 Ga0070698_1000003723 467
474 3300007076 Ga0075435_100018987 Ga0075435_1000189873 467
475 3300025905 Ga0207685_10013931 Ga0207685_100139312 467
476 3300025916 Ga0207663_10011316 Ga0207663_100113161 467
477 3300025922 Ga0207646_10000600 Ga0207646_100006003 467
478 3300025929 Ga0207664_10008129 Ga0207664_100081294 467
479 3300025939 Ga0207665_10036942 Ga0207665_100369423 467
480 3300030733 Ga0314311_1197083 Ga0314311_11970832 467
481 3300034817 Ga0373948_0005457 Ga0373948_0005457_233_1702 467
482 3300034957 Ga0373938_0009642 Ga0373938_0009642_31_1500 467
483 3300035086 Ga0373934_0007586 Ga0373934_0007586_703_2172 467
484 3300035112 Ga0373932_0014282 Ga0373932_0014282_216_1685 467
485 3300035117 Ga0373953_0000384 Ga0373953_0000384_3674_5143 467
486 3300035117 Ga0373953_0001003 Ga0373953_0001003_2277_3746 467
487 3300035119 Ga0373956_0000352 Ga0373956_0000352_5034_6503 467
488 3300035119 Ga0373956_0019543 Ga0373956_0019543_1344_2810 467
489 3300035120 Ga0373957_0000060 Ga0373957_0000060_20497_21966 467
490 3300035172 Ga0373955_0000023 Ga0373955_0000023_33093_34562 467
491 3300035172 Ga0373955_0009263 Ga0373955_0009263_2065_3534 467
492 3300035410 Ga0373924_0000690 Ga0373924_0000690_7321_8790 467
493 3300035692 Ga0373935_0030183 Ga0373935_0030183_1781_3250 467
494 3300035724 Ga0373933_0002530 Ga0373933_0002530_3032_4501 467
495 3300035724 Ga0373933_0072026 Ga0373933_0072026_170_1636 467
496 3300036401 Ga0373937_0000002 Ga0373937_0000002_251053_252522 467
497 3300036401 Ga0373937_0002929 Ga0373937_0002929_1454_2923 467
498 3300036401 Ga0373937_0087626 Ga0373937_0087626_1338_2804 467
499 3300037853 Ga0436364_0783642 Ga0436364_0783642_11705_13126 467
500 3300041404 Ga0439436_0014584 Ga0439436_0014584_560_2077 467
501 3300041406 Ga0439439_0001413 Ga0439439_0001413_1006_2523 467
502 3300042014 Ga0439457_008199 Ga0439457_008199_537_2054 467
503 3300042146 Ga0450907_002846 Ga0450907_002846_1558_3075 467
504 3300046454 Ga0495592_0000003 Ga0495592_0000003_147693_149162 467
505 3300046455 Ga0495603_0043891 Ga0495603_0043891_62_1531 467
506 3300046462 Ga0495651_0000031 Ga0495651_0000031_51609_53078 467
507 3300046462 Ga0495651_0039002 Ga0495651_0039002_233_1699 467
508 3300046463 Ga0495653_0000906 Ga0495653_0000906_15381_16850 467
509 3300046475 Ga0495639_0008853 Ga0495639_0008853_557_2026 467
510 3300046477 Ga0495664_0002595 Ga0495664_0002595_6656_8125 467
511 3300046511 Ga0495608_0000018 Ga0495608_0000018_147689_149158 467
512 3300046516 Ga0495628_0000020 Ga0495628_0000020_112821_114290 467
513 3300046529 Ga0495652_0000013 Ga0495652_0000013_45103_46572 467
514 3300046531 Ga0495665_0019098 Ga0495665_0019098_758_2227 467
515 3300046533 Ga0495640_0084660 Ga0495640_0084660_257_1726 467
516 3300046536 Ga0495587_0000014 Ga0495587_0000014_147677_149146 467
517 3300046536 Ga0495587_0001459 Ga0495587_0001459_1313_2782 467
518 3300046559 Ga0495667_0000014 Ga0495667_0000014_51606_53075 467
519 3300046559 Ga0495667_0005338 Ga0495667_0005338_1563_3029 467
520 3300046642 Ga0495634_0033627 Ga0495634_0033627_1326_2795 467
521 3300046675 Ga0495657_0000012 Ga0495657_0000012_49030_50499 467
522 3300046675 Ga0495657_0016167 Ga0495657_0016167_822_2288 467
523 3300046675 Ga0495657_0031774 Ga0495657_0031774_1314_2783 467
524 3300046678 Ga0495599_0000071 Ga0495599_0000071_24266_25735 467
525 3300046679 Ga0495623_0000066 Ga0495623_0000066_49034_50503 467
526 3300046680 Ga0495646_0008273 Ga0495646_0008273_4939_6408 467
527 3300046809 Ga0495600_0058016 Ga0495600_0058016_807_2276 467
528 3300047315 Ga0495581_0038302 Ga0495581_0038302_937_2406 467
529 3300047317 Ga0495604_0000054 Ga0495604_0000054_54455_55924 467
530 3300047322 Ga0495680_0000003 Ga0495680_0000003_125608_127077 467
531 3300047444 Ga0495675_0000220 Ga0495675_0000220_24530_25999 467
532 3300047444 Ga0495675_0009187 Ga0495675_0009187_3484_4953 467
533 3300047673 Ga0495593_0019642 Ga0495593_0019642_915_2384 467
534 3300048088 Ga0495602_0000014 Ga0495602_0000014_146706_148175 467
535 3300048907 Ga0496104_0069683 Ga0496104_0069683_337_1806 467
536 3300048910 Ga0496107_0030844 Ga0496107_0030844_2063_3532 467
537 3300049581 Ga0501047_0160331 Ga0501047_0160331_372_1808 467
538 3300050513 nmdc:mga0rr50_129887_c1 nmdc:mga0rr50_129887_c1_45_1514 467
539 3300005843 Ga0068860_100001858 Ga0068860_1000018583 468
540 3300028381 Ga0268264_10000226 Ga0268264_1000022693 468
541 3300031456 Ga0307513_10000002 Ga0307513_10000002100 468
542 3300049571 Ga0501034_0016112 Ga0501034_0016112_1880_3487 468
543 3300049574 Ga0501038_0003845 Ga0501038_0003845_2435_3982 468
544 3300049578 Ga0501042_0069688 Ga0501042_0069688_398_1945 468
545 3300049581 Ga0501047_0080301 Ga0501047_0080301_402_1949 468
546 3300049586 Ga0501070_0001111 Ga0501070_0001111_11370_12812 468
547 3300049589 Ga0501073_0084060 Ga0501073_0084060_557_1999 468
548 3300049742 Ga0501080_0035065 Ga0501080_0035065_1248_2690 468
549 3300049822 Ga0501035_0009131 Ga0501035_0009131_3444_4991 468
550 3300049823 Ga0501044_0002740 Ga0501044_0002740_2884_4431 468
551 3300049824 Ga0501045_0070788 Ga0501045_0070788_301_1794 469
552 3300061734 Ga0530510_0105651 Ga0530510_0105651_529_2022 469
553 iso_pu_bacteria 2643221632 2644182084 469
554 3300025924 Ga0207694_10038163 Ga0207694_100381632 470
555 3300028666 Ga0265336_10008877 Ga0265336_100088773 470
556 3300028800 Ga0265338_10013968 Ga0265338_100139684 470
557 3300037853 Ga0436364_0259237 Ga0436364_0259237_736_2319 470
558 iso_pu_bacteria 2643221576 2643890456 470
559 iso_pu_bacteria 2643221590 2643959512 470
560 iso_pu_bacteria 2643221604 2644033020 470
561 iso_pu_bacteria 2643221617 2644099986 470
562 iso_pu_bacteria 2643221620 2644117592 470
563 iso_pu_bacteria 2738541305 2738871869 470
564 iso_pu_bacteria 2811994874 2812331029 470
565 3300006038 Ga0075365_10005206 Ga0075365_100052062 471
566 3300006038 Ga0075365_10083932 Ga0075365_100839321 471
567 3300048908 Ga0496105_0036304 Ga0496105_0036304_17_1450 471
568 3300049572 Ga0501036_0123903 Ga0501036_0123903_471_1922 471
569 3300049583 Ga0501067_0002330 Ga0501067_0002330_1638_3089 471
570 3300049589 Ga0501073_0002339 Ga0501073_0002339_10352_11803 471
571 3300049590 Ga0501074_0001111 Ga0501074_0001111_14807_16258 471
572 3300049742 Ga0501080_0083782 Ga0501080_0083782_138_1589 471
573 3300050491 nmdc:mga00v17_3705_c2 nmdc:mga00v17_3705_c2_666_2120 471
574 3300050492 nmdc:mga0yw44_88127_c1 nmdc:mga0yw44_88127_c1_68_1522 471
575 3300050496 nmdc:mga07m45_12427_c1 nmdc:mga07m45_12427_c1_1883_3337 471
576 3300053088 Ga0500644_0000203 Ga0500644_0000203_18699_20153 471
577 3300054114 Ga0501084_0029803 Ga0501084_0029803_2577_4028 471
578 3300060353 Ga0501082_0007309 Ga0501082_0007309_7185_8636 471
579 3300061734 Ga0530510_0119442 Ga0530510_0119442_139_1608 471
580 iso_pu_bacteria 2554235227 2555228993 471
581 iso_pu_bacteria 2654587600 2655033476 471
582 3300003203 JGI25406J46586_10000769 JGI25406J46586_100007697 472
583 3300041491 Ga0451833_0032744 Ga0451833_0032744_1220_2689 472
584 3300045976 Ga0466967_0010313 Ga0466967_0010313_4030_5481 472
585 3300042007 Ga0439449_0026951 Ga0439449_0026951_552_2048 473
586 3300044658 Ga0466972_0078250 Ga0466972_0078250_72_1529 473
587 3300044765 Ga0466970_0001467 Ga0466970_0001467_6424_7881 473
588 3300044901 Ga0466960_0066334 Ga0466960_0066334_12_1469 473
589 iso_pu_bacteria 2558860112 2558911891 473
590 3300003578 Ga0006562J51391_1043768 Ga0006562J51391_10437682 474
591 3300025904 Ga0207647_10058703 Ga0207647_100587032 474
592 3300031911 Ga0307412_10038793 Ga0307412_100387932 474
593 3300037853 Ga0436364_1199653 Ga0436364_1199653_2498_3982 474
594 3300047319 Ga0495674_0085720 Ga0495674_0085720_535_2064 474
595 3300047322 Ga0495680_0057193 Ga0495680_0057193_223_1752 474
596 3300049568 Ga0501031_0001225 Ga0501031_0001225_3986_5533 474
597 3300049569 Ga0501032_0001562 Ga0501032_0001562_13582_15129 474
598 3300049569 Ga0501032_0004751 Ga0501032_0004751_5798_7339 474
599 3300049570 Ga0501033_0000572 Ga0501033_0000572_10014_11561 474
600 3300049571 Ga0501034_0006026 Ga0501034_0006026_6746_8293 474
601 3300049572 Ga0501036_0003307 Ga0501036_0003307_6788_8335 474
602 3300049572 Ga0501036_0004601 Ga0501036_0004601_2038_3579 474
603 3300049573 Ga0501037_0000294 Ga0501037_0000294_8986_10527 474
604 3300049574 Ga0501038_0003608 Ga0501038_0003608_9721_11268 474
605 3300049574 Ga0501038_0005757 Ga0501038_0005757_8038_9579 474
606 3300049575 Ga0501039_0001815 Ga0501039_0001815_3350_4891 474
607 3300049575 Ga0501039_0004950 Ga0501039_0004950_5412_6959 474
608 3300049578 Ga0501042_0011058 Ga0501042_0011058_1874_3415 474
609 3300049579 Ga0501043_0001877 Ga0501043_0001877_7744_9291 474
610 3300049579 Ga0501043_0004157 Ga0501043_0004157_1691_3232 474
611 3300049580 Ga0501046_0000236 Ga0501046_0000236_23226_24773 474
612 3300049580 Ga0501046_0001725 Ga0501046_0001725_18045_19586 474
613 3300049581 Ga0501047_0017158 Ga0501047_0017158_4812_6359 474
614 3300049581 Ga0501047_0029588 Ga0501047_0029588_2116_3657 474
615 3300049582 Ga0501048_0000093 Ga0501048_0000093_30208_31755 474
616 3300049582 Ga0501048_0005329 Ga0501048_0005329_7792_9333 474
617 3300049583 Ga0501067_0030306 Ga0501067_0030306_919_2466 474
618 3300049585 Ga0501069_0000897 Ga0501069_0000897_4788_6335 474
619 3300049585 Ga0501069_0073049 Ga0501069_0073049_299_1759 474
620 3300049589 Ga0501073_0010335 Ga0501073_0010335_4650_6197 474
621 3300049590 Ga0501074_0000476 Ga0501074_0000476_2533_4080 474
622 3300049742 Ga0501080_0001133 Ga0501080_0001133_16293_17840 474
623 3300049742 Ga0501080_0034656 Ga0501080_0034656_1908_3449 474
624 3300049744 Ga0501083_0053364 Ga0501083_0053364_139_1686 474
625 3300049822 Ga0501035_0005446 Ga0501035_0005446_10179_11726 474
626 3300049822 Ga0501035_0005745 Ga0501035_0005745_1911_3452 474
627 3300049823 Ga0501044_0001800 Ga0501044_0001800_4602_6143 474
628 3300049823 Ga0501044_0010545 Ga0501044_0010545_1732_3279 474
629 3300050491 nmdc:mga00v17_14591_c1 nmdc:mga00v17_14591_c1_696_2156 474
630 3300053085 Ga0495619_0006349 Ga0495619_0006349_1517_3046 474
631 3300054114 Ga0501084_0002183 Ga0501084_0002183_9454_11001 474
632 3300005435 Ga0070714_100002231 Ga0070714_10000223110 475
633 3300021358 Ga0213873_10000084 Ga0213873_1000008410 475
634 3300025923 Ga0207681_10085473 Ga0207681_100854732 475
635 3300025929 Ga0207664_10005356 Ga0207664_100053564 475
636 3300038443 Ga0395901_0266107 Ga0395901_0266107_240_1706 475
637 3300039453 Ga0436362_0198821 Ga0436362_0198821_4448_5953 475
638 3300044694 Ga0466963_0048494 Ga0466963_0048494_726_2240 475
639 3300045976 Ga0466967_0021383 Ga0466967_0021383_644_2158 475
640 3300045976 Ga0466967_0022734 Ga0466967_0022734_194_1732 475
641 3300053085 Ga0495619_0045475 Ga0495619_0045475_86_1591 475
642 iso_pu_bacteria 2870721527 2870727855 475
643 iso_pu_bacteria 8057568493 8057573816 475
644 3300006048 Ga0075363_100008798 Ga0075363_1000087982 476
645 3300006051 Ga0075364_10004234 Ga0075364_100042342 476
646 3300006178 Ga0075367_10037719 Ga0075367_100377192 476
647 3300006353 Ga0075370_10026952 Ga0075370_100269522 476
648 3300009148 Ga0105243_10090292 Ga0105243_100902922 476
649 3300013308 Ga0157375_10258580 Ga0157375_102585801 476
650 3300044683 Ga0466965_0031149 Ga0466965_0031149_670_2214 476
651 3300044694 Ga0466963_0090605 Ga0466963_0090605_42_1583 476
652 3300048927 Ga0496124_0010783 Ga0496124_0010783_1781_3271 476
653 3300049575 Ga0501039_0046336 Ga0501039_0046336_1691_3235 476
654 3300050490 nmdc:mga03n38_3379_c1 nmdc:mga03n38_3379_c1_1498_2997 476
655 3300050491 nmdc:mga00v17_16663_c1 nmdc:mga00v17_16663_c1_1405_2904 476
656 3300050496 nmdc:mga07m45_13457_c1 nmdc:mga07m45_13457_c1_2411_3910 476
657 iso_pu_bacteria 2643221587 2643947749 476
658 iso_pu_bacteria 2643221670 2644390819 476
659 iso_pu_bacteria 2643221677 2644433614 476
660 3300005471 Ga0070698_100000293 Ga0070698_10000029341 477
661 3300009093 Ga0105240_10248131 Ga0105240_102481312 477
662 3300009545 Ga0105237_10227152 Ga0105237_102271522 477
663 3300010375 Ga0105239_10078456 Ga0105239_100784562 477
664 3300025949 Ga0207667_10042028 Ga0207667_100420283 477
665 3300031616 Ga0307508_10099965 Ga0307508_100999652 477
666 3300044684 Ga0466966_0044570 Ga0466966_0044570_1200_2714 477
667 3300044694 Ga0466963_0060153 Ga0466963_0060153_628_2142 477
668 3300044706 Ga0466964_0001054 Ga0466964_0001054_3122_4636 477
669 3300044901 Ga0466960_0068435 Ga0466960_0068435_221_1735 477
670 3300045049 Ga0466959_0068249 Ga0466959_0068249_525_2039 477
671 3300045976 Ga0466967_0000302 Ga0466967_0000302_10696_12213 477
672 3300046679 Ga0495623_0010547 Ga0495623_0010547_1269_2846 477
673 3300048905 Ga0496102_0000813 Ga0496102_0000813_8947_10476 477
674 3300049823 Ga0501044_0010059 Ga0501044_0010059_64_1572 477
675 3300050507 nmdc:mga05p37_1749_c1 nmdc:mga05p37_1749_c1_8006_9529 477
676 iso_pu_bacteria 8056054917 8056055921 477
677 3300002073 JGI24745J21846_1003475 JGI24745J21846_10034752 478
678 3300005327 Ga0070658_10027987 Ga0070658_100279873 478
679 3300005343 Ga0070687_100045972 Ga0070687_1000459722 478
680 3300005347 Ga0070668_100020933 Ga0070668_1000209332 478
681 3300005366 Ga0070659_100172705 Ga0070659_1001727052 478
682 3300005455 Ga0070663_100040375 Ga0070663_1000403752 478
683 3300005466 Ga0070685_10019185 Ga0070685_100191852 478
684 3300005564 Ga0070664_100117944 Ga0070664_1001179442 478
685 3300005577 Ga0068857_100053854 Ga0068857_1000538543 478
686 3300005841 Ga0068863_100064794 Ga0068863_1000647942 478
687 3300009098 Ga0105245_10022661 Ga0105245_100226616 478
688 3300009177 Ga0105248_10190584 Ga0105248_101905842 478
689 3300011119 Ga0105246_10040589 Ga0105246_100405892 478
690 3300013306 Ga0163162_10211394 Ga0163162_102113942 478
691 3300025901 Ga0207688_10002697 Ga0207688_100026976 478
692 3300025904 Ga0207647_10066759 Ga0207647_100667592 478
693 3300025907 Ga0207645_10068103 Ga0207645_100681032 478
694 3300025919 Ga0207657_10034643 Ga0207657_100346432 478
695 3300026023 Ga0207677_10145946 Ga0207677_101459461 478
696 3300026075 Ga0207708_10096280 Ga0207708_100962802 478
697 3300026089 Ga0207648_10036581 Ga0207648_100365812 478
698 3300026116 Ga0207674_10045935 Ga0207674_100459352 478
699 3300048903 Ga0496100_0091651 Ga0496100_0091651_128_1621 478
700 3300049568 Ga0501031_0001837 Ga0501031_0001837_10979_12622 478
701 3300049568 Ga0501031_0027192 Ga0501031_0027192_1929_3452 478
702 3300049569 Ga0501032_0035227 Ga0501032_0035227_1707_3230 478
703 3300049571 Ga0501034_0078537 Ga0501034_0078537_1244_2887 478
704 3300049571 Ga0501034_0226215 Ga0501034_0226215_260_1783 478
705 3300049572 Ga0501036_0003794 Ga0501036_0003794_447_2090 478
706 3300049573 Ga0501037_0012379 Ga0501037_0012379_1327_2970 478
707 3300049574 Ga0501038_0004045 Ga0501038_0004045_9588_11111 478
708 3300049579 Ga0501043_0008555 Ga0501043_0008555_4503_6026 478
709 3300049579 Ga0501043_0015165 Ga0501043_0015165_1553_3064 478
710 3300049580 Ga0501046_0054527 Ga0501046_0054527_729_2372 478
711 3300049581 Ga0501047_0122576 Ga0501047_0122576_384_1907 478
712 3300049582 Ga0501048_0004212 Ga0501048_0004212_5669_7192 478
713 3300049586 Ga0501070_0021783 Ga0501070_0021783_1967_3490 478
714 3300049586 Ga0501070_0052937 Ga0501070_0052937_418_2061 478
715 3300049822 Ga0501035_0009171 Ga0501035_0009171_6272_7795 478
716 3300050511 nmdc:mga08y16_138593_c1 nmdc:mga08y16_138593_c1_752_2245 478
717 iso_pu_bacteria 2537561592 2537899737 478
718 iso_pu_bacteria 2802429296 2804846481 478
719 iso_pu_bacteria 2808606982 2811849314 478
720 iso_pu_bacteria 2899370129 2899376959 478
721 iso_pu_bacteria 2912757875 2912761074 478
722 iso_pu_bacteria 3006321560 3006324677 478
723 iso_pu_bacteria 3006486233 3006493761 478
724 iso_pu_bacteria 8025478263 8025484632 478
725 iso_pu_bacteria 8025530807 8025536353 478
726 iso_pu_bacteria 8056447290 8056451925 478
727 iso_pu_bacteria 8056667051 8056669273 478
728 3300013307 Ga0157372_10000131 Ga0157372_1000013128 479
729 3300021388 Ga0213875_10007311 Ga0213875_100073112 479
730 3300031456 Ga0307513_10001948 Ga0307513_1000194824 479
731 3300044684 Ga0466966_0003942 Ga0466966_0003942_2313_3827 479
732 3300044693 Ga0466961_0006450 Ga0466961_0006450_4267_5781 479
733 3300045049 Ga0466959_0017352 Ga0466959_0017352_1628_3142 479
734 3300048917 Ga0496114_0091760 Ga0496114_0091760_14_1468 479
735 iso_pu_bacteria 2773857762 2774396137 479
736 iso_pu_bacteria 2808606439 2809197775 479
737 iso_pu_bacteria 2811994878 2812347734 479
738 iso_pu_bacteria 2861520306 2861523706 479
739 iso_pu_bacteria 2883821847 2883826584 479
740 iso_pu_bacteria 2891968417 2891968856 479
741 3300005339 Ga0070660_100004498 Ga0070660_1000044985 480
742 3300005356 Ga0070674_100067572 Ga0070674_1000675722 480
743 3300005366 Ga0070659_100003265 Ga0070659_1000032653 480
744 3300005563 Ga0068855_100220046 Ga0068855_1002200461 480
745 3300005985 Ga0081539_10000474 Ga0081539_1000047476 480
746 3300013105 Ga0157369_10039453 Ga0157369_100394532 480
747 3300014326 Ga0157380_10035216 Ga0157380_100352163 480
748 3300025919 Ga0207657_10009678 Ga0207657_100096784 480
749 3300028794 Ga0307515_10129515 Ga0307515_101295152 480
750 3300031507 Ga0307509_10143685 Ga0307509_101436851 480
751 3300041405 Ga0439438_011422 Ga0439438_011422_236_1792 480
752 3300046454 Ga0495592_0040124 Ga0495592_0040124_1796_3313 480
753 3300046459 Ga0495629_0010908 Ga0495629_0010908_2730_4247 480
754 3300046459 Ga0495629_0036411 Ga0495629_0036411_861_2378 480
755 3300046462 Ga0495651_0074795 Ga0495651_0074795_808_2325 480
756 3300046514 Ga0495618_0005624 Ga0495618_0005624_2847_4364 480
757 3300046522 Ga0495643_0001354 Ga0495643_0001354_1317_2837 480
758 3300046529 Ga0495652_0024673 Ga0495652_0024673_3562_5079 480
759 3300046642 Ga0495634_0007234 Ga0495634_0007234_6221_7738 480
760 3300046683 Ga0495658_0017175 Ga0495658_0017175_1964_3484 480
761 3300046690 Ga0495624_0029032 Ga0495624_0029032_135_1652 480
762 3300046794 Ga0495589_0052207 Ga0495589_0052207_96_1616 480
763 3300046809 Ga0495600_0075476 Ga0495600_0075476_329_1846 480
764 3300047317 Ga0495604_0031714 Ga0495604_0031714_2444_3961 480
765 3300047321 Ga0495676_0019222 Ga0495676_0019222_2128_3645 480
766 3300047447 Ga0495685_002361 Ga0495685_002361_1293_2813 480
767 3300047470 Ga0495681_0015522 Ga0495681_0015522_989_2509 480
768 3300048903 Ga0496100_0053592 Ga0496100_0053592_935_2416 480
769 3300048904 Ga0496101_0038726 Ga0496101_0038726_1711_3192 480
770 3300048905 Ga0496102_0024323 Ga0496102_0024323_2097_3623 480
771 3300048905 Ga0496102_0082166 Ga0496102_0082166_1165_2646 480
772 3300048906 Ga0496103_0108781 Ga0496103_0108781_144_1670 480
773 3300048909 Ga0496106_0011482 Ga0496106_0011482_3692_5173 480
774 3300048913 Ga0496110_0107403 Ga0496110_0107403_579_2060 480
775 3300048914 Ga0496111_0053846 Ga0496111_0053846_340_1821 480
776 3300048916 Ga0496113_0100381 Ga0496113_0100381_50_1531 480
777 3300048924 Ga0496121_0028149 Ga0496121_0028149_808_2334 480
778 3300049568 Ga0501031_0043372 Ga0501031_0043372_42_1559 480
779 3300049568 Ga0501031_0106572 Ga0501031_0106572_265_1794 480
780 3300049569 Ga0501032_0007217 Ga0501032_0007217_1403_2920 480
781 3300049569 Ga0501032_0029189 Ga0501032_0029189_1639_3156 480
782 3300049570 Ga0501033_0006403 Ga0501033_0006403_7281_8798 480
783 3300049571 Ga0501034_0019446 Ga0501034_0019446_2388_3905 480
784 3300049571 Ga0501034_0079746 Ga0501034_0079746_1525_3042 480
785 3300049572 Ga0501036_0003546 Ga0501036_0003546_6000_7517 480
786 3300049572 Ga0501036_0099953 Ga0501036_0099953_214_1731 480
787 3300049573 Ga0501037_0009368 Ga0501037_0009368_1282_2799 480
788 3300049574 Ga0501038_0012474 Ga0501038_0012474_1050_2567 480
789 3300049574 Ga0501038_0016250 Ga0501038_0016250_3071_4588 480
790 3300049575 Ga0501039_0011715 Ga0501039_0011715_4600_6129 480
791 3300049575 Ga0501039_0012192 Ga0501039_0012192_4175_5692 480
792 3300049575 Ga0501039_0023772 Ga0501039_0023772_781_2298 480
793 3300049576 Ga0501040_0002552 Ga0501040_0002552_1752_3269 480
794 3300049576 Ga0501040_0104452 Ga0501040_0104452_37_1566 480
795 3300049577 Ga0501041_0003443 Ga0501041_0003443_2587_4104 480
796 3300049578 Ga0501042_0033874 Ga0501042_0033874_170_1699 480
797 3300049579 Ga0501043_0003544 Ga0501043_0003544_1377_2894 480
798 3300049580 Ga0501046_0003797 Ga0501046_0003797_233_1750 480
799 3300049581 Ga0501047_0017157 Ga0501047_0017157_5210_6727 480
800 3300049581 Ga0501047_0032593 Ga0501047_0032593_1975_3492 480
801 3300049582 Ga0501048_0012861 Ga0501048_0012861_1163_2692 480
802 3300049583 Ga0501067_0002255 Ga0501067_0002255_7573_9090 480
803 3300049583 Ga0501067_0007863 Ga0501067_0007863_110_1591 480
804 3300049584 Ga0501068_0018151 Ga0501068_0018151_1409_2926 480
805 3300049584 Ga0501068_0056289 Ga0501068_0056289_501_1982 480
806 3300049585 Ga0501069_0018837 Ga0501069_0018837_146_1663 480
807 3300049586 Ga0501070_0025023 Ga0501070_0025023_2446_3963 480
808 3300049587 Ga0501071_0000525 Ga0501071_0000525_6710_8227 480
809 3300049587 Ga0501071_0019867 Ga0501071_0019867_33_1550 480
810 3300049587 Ga0501071_0042839 Ga0501071_0042839_1553_3082 480
811 3300049588 Ga0501072_0023669 Ga0501072_0023669_268_1785 480
812 3300049590 Ga0501074_0027609 Ga0501074_0027609_535_2052 480
813 3300049591 Ga0501075_0115037 Ga0501075_0115037_445_1974 480
814 3300049592 Ga0501076_0008545 Ga0501076_0008545_4119_5648 480
815 3300049593 Ga0501077_0019701 Ga0501077_0019701_2341_3858 480
816 3300049593 Ga0501077_0029666 Ga0501077_0029666_1534_3063 480
817 3300049741 Ga0501079_0014762 Ga0501079_0014762_922_2439 480
818 3300049743 Ga0501081_0030717 Ga0501081_0030717_440_1969 480
819 3300049744 Ga0501083_0031100 Ga0501083_0031100_395_1912 480
820 3300049822 Ga0501035_0002028 Ga0501035_0002028_12651_14168 480
821 3300049822 Ga0501035_0011863 Ga0501035_0011863_2437_3954 480
822 3300049822 Ga0501035_0037091 Ga0501035_0037091_1503_3020 480
823 3300049822 Ga0501035_0067088 Ga0501035_0067088_880_2409 480
824 3300049823 Ga0501044_0021072 Ga0501044_0021072_233_1750 480
825 3300049824 Ga0501045_0039918 Ga0501045_0039918_162_1679 480
826 3300049824 Ga0501045_0041394 Ga0501045_0041394_1534_3063 480
827 3300049824 Ga0501045_0138280 Ga0501045_0138280_217_1734 480
828 3300053099 Ga0500654_017380 Ga0500654_017380_1173_2693 480
829 3300053100 Ga0500660_019742 Ga0500660_019742_1232_2752 480
830 3300053109 Ga0500569_017708 Ga0500569_017708_252_1772 480
831 3300053123 Ga0500614_011358 Ga0500614_011358_131_1651 480
832 3300053140 Ga0500573_0024525 Ga0500573_0024525_639_2162 480
833 3300053149 Ga0500600_0008867 Ga0500600_0008867_3074_4594 480
834 3300053160 Ga0500633_0006523 Ga0500633_0006523_317_1837 480
835 3300054114 Ga0501084_0027049 Ga0501084_0027049_3043_4560 480
836 3300060353 Ga0501082_0123092 Ga0501082_0123092_118_1647 480
837 3300061734 Ga0530510_0106557 Ga0530510_0106557_440_1969 480
838 iso_pu_bacteria 2844841374 2844843695 480
839 iso_pu_bacteria 2919055335 2919055698 480
840 iso_pu_bacteria 2919523602 2919525789 480
841 iso_pu_bacteria 2928153084 2928153837 480
842 iso_pu_bacteria 2935390628 2935390951 480
843 iso_pu_bacteria 8025413630 8025413662 480
844 3300006844 Ga0075428_100000203 Ga0075428_10000020356 481
845 3300031548 Ga0307408_100181541 Ga0307408_1001815411 481
846 3300031730 Ga0307516_10031960 Ga0307516_100319604 481
847 3300031995 Ga0307409_100091232 Ga0307409_1000912322 481
848 3300038443 Ga0395901_0047917 Ga0395901_0047917_2307_3857 481
849 3300046477 Ga0495664_0046621 Ga0495664_0046621_581_2068 481
850 3300053078 Ga0495612_0051640 Ga0495612_0051640_28_1515 481
851 iso_pu_bacteria 2547132111 2547412484 481
852 iso_pu_bacteria 2554235005 2554257360 481
853 iso_pu_bacteria 2582581313 2585310632 481
854 iso_pu_bacteria 2582581314 2585314398 481
855 iso_pu_bacteria 2616644814 2616700200 481
856 iso_pu_bacteria 2643221548 2643762984 481
857 iso_pu_bacteria 2643221578 2643899929 481
858 iso_pu_bacteria 2643221647 2644263027 481
859 iso_pu_bacteria 2643221673 2644405848 481
860 iso_pu_bacteria 2643221682 2644464158 481
861 iso_pu_bacteria 2784132148 2784588870 481
862 iso_pu_bacteria 2784746763 2785343017 481
863 iso_pu_bacteria 2784746768 2785369811 481
864 iso_pu_bacteria 2786546132 2786670900 481
865 iso_pu_bacteria 2808606375 2808920839 481
866 iso_pu_bacteria 2808606448 2809232483 481
867 iso_pu_bacteria 2811994879 2812357801 481
868 iso_pu_bacteria 2811994917 2812480273 481
869 iso_pu_bacteria 2818991463 2819697155 481
870 iso_pu_bacteria 2852635781 2852637073 481
871 iso_pu_bacteria 2855683550 2855685531 481
872 iso_pu_bacteria 2862178590 2862183397 481
873 iso_pu_bacteria 2862281513 2862285930 481
874 iso_pu_bacteria 2862290372 2862291256 481
875 iso_pu_bacteria 2862382967 2862388325 481
876 iso_pu_bacteria 2862507626 2862507986 481
877 iso_pu_bacteria 2862574272 2862578978 481
878 iso_pu_bacteria 2863404153 2863404281 481
879 iso_pu_bacteria 2867428634 2867436800 481
880 iso_pu_bacteria 2873151551 2873155466 481
881 iso_pu_bacteria 2877676314 2877680828 481
882 iso_pu_bacteria 2912715099 2912719639 481
883 iso_pu_bacteria 2912723979 2912731302 481
884 iso_pu_bacteria 2918501144 2918505310 481
885 iso_pu_bacteria 2919468124 2919472009 481
886 iso_pu_bacteria 2946045630 2946049718 481
887 iso_pu_bacteria 2946064051 2946068065 481
888 iso_pu_bacteria 2947224130 2947228888 481
889 iso_pu_bacteria 2954002825 2954006650 481
890 iso_pu_bacteria 2954380949 2954385927 481
891 iso_pu_bacteria 2954673503 2954677226 481
892 iso_pu_bacteria 2954682443 2954686929 481
893 iso_pu_bacteria 2954691527 2954696579 481
894 iso_pu_bacteria 2954701450 2954705645 481
895 iso_pu_bacteria 2954711539 2954715938 481
896 iso_pu_bacteria 2954721474 2954725877 481
897 iso_pu_bacteria 2954731030 2954735921 481
898 iso_pu_bacteria 2954740390 2954744815 481
899 iso_pu_bacteria 2954749733 2954754784 481
900 iso_pu_bacteria 2954759201 2954763800 481
901 iso_pu_bacteria 2990059506 2990065647 481
902 iso_pu_bacteria 3006493962 3006499262 481
903 iso_pu_bacteria 8008558824 8008566970 481
904 iso_pu_bacteria 8008574985 8008578643 481
905 iso_pu_bacteria 8048406513 8048412635 481
906 iso_pu_bacteria 8056829672 8056833396 481
907 3300005435 Ga0070714_100000126 Ga0070714_10000012621 482
908 3300025929 Ga0207664_10000082 Ga0207664_1000008259 482
909 3300044658 Ga0466972_0039065 Ga0466972_0039065_612_2060 482
910 3300044684 Ga0466966_0018090 Ga0466966_0018090_104_1552 482
911 3300044693 Ga0466961_0012392 Ga0466961_0012392_3227_4675 482
912 3300044765 Ga0466970_0006080 Ga0466970_0006080_3675_5123 482
913 3300044842 Ga0466957_0030972 Ga0466957_0030972_278_1726 482
914 3300045049 Ga0466959_0003472 Ga0466959_0003472_2850_4298 482
915 3300047315 Ga0495581_0003525 Ga0495581_0003525_5992_7563 482
916 3300048904 Ga0496101_0111108 Ga0496101_0111108_36_1505 482
917 3300048909 Ga0496106_0052570 Ga0496106_0052570_460_1929 482
918 3300048917 Ga0496114_0002043 Ga0496114_0002043_13892_15349 482
919 3300048922 Ga0496119_0002640 Ga0496119_0002640_17788_19245 482
920 3300048926 Ga0496123_0026721 Ga0496123_0026721_14_1471 482
921 iso_pu_bacteria 2643221616 2644097867 482
922 iso_pu_bacteria 2884763398 2884766868 482
923 iso_pu_bacteria 8001781756 8001789502 482
924 3300001979 JGI24740J21852_10011444 JGI24740J21852_100114442 483
925 3300001989 JGI24739J22299_10014613 JGI24739J22299_100146132 483
926 3300001989 JGI24739J22299_10018783 JGI24739J22299_100187832 483
927 3300001990 JGI24737J22298_10004741 JGI24737J22298_100047413 483
928 3300001990 JGI24737J22298_10006559 JGI24737J22298_100065593 483
929 3300002067 JGI24735J21928_10017868 JGI24735J21928_100178681 483
930 3300003578 Ga0006562J51391_1058926 Ga0006562J51391_10589265 483
931 3300003578 Ga0006562J51391_1058927 Ga0006562J51391_10589274 483
932 3300003752 Ga0055539_1000019 Ga0055539_1000019320 483
933 3300003756 Ga0055533_1000023 Ga0055533_10000235 483
934 3300003760 Ga0055527_1000025 Ga0055527_100002578 483
935 3300003762 Ga0055542_1000048 Ga0055542_100004878 483
936 3300003763 Ga0055529_1000057 Ga0055529_1000057103 483
937 3300003841 Ga0055541_1003256 Ga0055541_10032562 483
938 3300005539 Ga0068853_100025071 Ga0068853_1000250714 483
939 3300005543 Ga0070672_100154411 Ga0070672_1001544112 483
940 3300005937 Ga0081455_10023343 Ga0081455_100233432 483
941 3300005983 Ga0081540_1010699 Ga0081540_10106994 483
942 3300006038 Ga0075365_10045154 Ga0075365_100451542 483
943 3300006178 Ga0075367_10015626 Ga0075367_100156261 483
944 3300006353 Ga0075370_10008168 Ga0075370_100081682 483
945 3300006948 Ga0099826_10058892 Ga0099826_100588922 483
946 3300009553 Ga0105249_10090233 Ga0105249_100902332 483
947 3300011119 Ga0105246_10001651 Ga0105246_100016514 483
948 3300014497 Ga0182008_10000766 Ga0182008_1000076618 483
949 3300015262 Ga0182007_10001033 Ga0182007_100010332 483
950 3300015688 Ga0183367_1008 Ga0183367_1008421 483
951 3300020069 Ga0197907_10311176 Ga0197907_103111762 483
952 3300020081 Ga0206354_10723847 Ga0206354_107238471 483
953 3300020082 Ga0206353_12064141 Ga0206353_120641415 483
954 3300021388 Ga0213875_10000723 Ga0213875_100007236 483
955 3300025225 Ga0209566_100031 Ga0209566_1000315 483
956 3300025226 Ga0209674_100001 Ga0209674_1000012146 483
957 3300025228 Ga0209672_100011 Ga0209672_100011736 483
958 3300025229 Ga0209147_100619 Ga0209147_1006194 483
959 3300025230 Ga0209563_100001 Ga0209563_1000012146 483
960 3300025230 Ga0209563_100251 Ga0209563_10025114 483
961 3300025242 Ga0209258_102077 Ga0209258_1020774 483
962 3300025253 Ga0209677_100001 Ga0209677_1000012146 483
963 3300025253 Ga0209677_101937 Ga0209677_1019376 483
964 3300025254 Ga0209148_1000023 Ga0209148_1000023574 483
965 3300025272 Ga0209455_1000023 Ga0209455_1000023574 483
966 3300025302 Ga0207426_1013677 Ga0207426_10136772 483
967 3300028786 Ga0307517_10043175 Ga0307517_100431754 483
968 3300028794 Ga0307515_10000596 Ga0307515_100005963 483
969 3300028794 Ga0307515_10022623 Ga0307515_100226239 483
970 3300028794 Ga0307515_10085100 Ga0307515_100851003 483
971 3300030521 Ga0307511_10000678 Ga0307511_1000067814 483
972 3300031456 Ga0307513_10040019 Ga0307513_100400192 483
973 3300031649 Ga0307514_10029291 Ga0307514_100292912 483
974 3300031649 Ga0307514_10079903 Ga0307514_100799032 483
975 3300031995 Ga0307409_100109826 Ga0307409_1001098261 483
976 3300033179 Ga0307507_10032404 Ga0307507_100324043 483
977 3300033179 Ga0307507_10041417 Ga0307507_100414173 483
978 3300037312 Ga0395899_0037345 Ga0395899_0037345_794_2365 483
979 3300037466 Ga0395898_0012933 Ga0395898_0012933_2850_4379 483
980 3300037466 Ga0395898_0020175 Ga0395898_0020175_4268_5797 483
981 3300037471 Ga0395905_0023340 Ga0395905_0023340_114_1676 483
982 3300037853 Ga0436364_0026322 Ga0436364_0026322_18508_20076 483
983 3300038443 Ga0395901_0117749 Ga0395901_0117749_254_1816 483
984 3300038443 Ga0395901_0260734 Ga0395901_0260734_81_1652 483
985 3300039437 Ga0436365_0064456 Ga0436365_0064456_3871_5439 483
986 3300041404 Ga0439436_0001616 Ga0439436_0001616_4643_6169 483
987 3300041512 Ga0451853_1798325 Ga0451853_1798325_332_1861 483
988 3300041512 Ga0451853_2403763 Ga0451853_2403763_237_1766 483
989 3300042005 Ga0439448_0002247 Ga0439448_0002247_2626_4152 483
990 3300042007 Ga0439449_0000357 Ga0439449_0000357_4225_5751 483
991 3300042014 Ga0439457_000476 Ga0439457_000476_5398_6924 483
992 3300042015 Ga0439462_0001374 Ga0439462_0001374_1739_3268 483
993 3300042131 Ga0450894_000050 Ga0450894_000050_10975_12501 483
994 3300042134 Ga0450898_000106 Ga0450898_000106_531_2057 483
995 3300042138 Ga0450903_000683 Ga0450903_000683_2638_4164 483
996 3300042145 Ga0450906_001211 Ga0450906_001211_632_2158 483
997 3300044656 Ga0466969_0021118 Ga0466969_0021118_1434_2960 483
998 3300044658 Ga0466972_0004069 Ga0466972_0004069_5656_7185 483
999 3300044658 Ga0466972_0005148 Ga0466972_0005148_468_1997 483
1000 3300044658 Ga0466972_0022424 Ga0466972_0022424_464_2035 483
1001 3300044658 Ga0466972_0023719 Ga0466972_0023719_240_1766 483
1002 3300044684 Ga0466966_0004948 Ga0466966_0004948_1374_2903 483
1003 3300044684 Ga0466966_0077943 Ga0466966_0077943_23_1549 483
1004 3300044693 Ga0466961_0022060 Ga0466961_0022060_492_2021 483
1005 3300044693 Ga0466961_0033106 Ga0466961_0033106_989_2560 483
1006 3300044694 Ga0466963_0000277 Ga0466963_0000277_492_2021 483
1007 3300044706 Ga0466964_0010248 Ga0466964_0010248_991_2520 483
1008 3300044719 Ga0466971_0002024 Ga0466971_0002024_1281_2810 483
1009 3300044735 Ga0466968_0012560 Ga0466968_0012560_412_1938 483
1010 3300044765 Ga0466970_0001383 Ga0466970_0001383_5817_7346 483
1011 3300044765 Ga0466970_0002516 Ga0466970_0002516_3960_5546 483
1012 3300044765 Ga0466970_0018686 Ga0466970_0018686_1598_3169 483
1013 3300044765 Ga0466970_0040679 Ga0466970_0040679_391_1968 483
1014 3300044842 Ga0466957_0000471 Ga0466957_0000471_16003_17532 483
1015 3300044901 Ga0466960_0008436 Ga0466960_0008436_987_2516 483
1016 3300044901 Ga0466960_0011368 Ga0466960_0011368_747_2318 483
1017 3300044901 Ga0466960_0052912 Ga0466960_0052912_269_1840 483
1018 3300045049 Ga0466959_0003956 Ga0466959_0003956_6368_7897 483
1019 3300045049 Ga0466959_0089206 Ga0466959_0089206_609_2180 483
1020 3300045836 Ga0466958_0014838 Ga0466958_0014838_1949_3478 483
1021 3300045976 Ga0466967_0043325 Ga0466967_0043325_1234_2763 483
1022 3300046454 Ga0495592_0042690 Ga0495592_0042690_1203_2729 483
1023 3300046455 Ga0495603_0007070 Ga0495603_0007070_1610_3136 483
1024 3300046455 Ga0495603_0046681 Ga0495603_0046681_690_2216 483
1025 3300046455 Ga0495603_0066075 Ga0495603_0066075_105_1631 483
1026 3300046459 Ga0495629_0022040 Ga0495629_0022040_1545_3071 483
1027 3300046459 Ga0495629_0043733 Ga0495629_0043733_605_2131 483
1028 3300046459 Ga0495629_0106228 Ga0495629_0106228_172_1698 483
1029 3300046474 Ga0495605_0001970 Ga0495605_0001970_7994_9520 483
1030 3300046477 Ga0495664_0026825 Ga0495664_0026825_198_1724 483
1031 3300046492 Ga0495585_0055572 Ga0495585_0055572_407_1933 483
1032 3300046499 Ga0495594_0000230 Ga0495594_0000230_4798_6324 483
1033 3300046499 Ga0495594_0049423 Ga0495594_0049423_43_1569 483
1034 3300046499 Ga0495594_0054321 Ga0495594_0054321_627_2153 483
1035 3300046501 Ga0495607_0023399 Ga0495607_0023399_224_1750 483
1036 3300046506 Ga0495583_0007209 Ga0495583_0007209_4637_6163 483
1037 3300046512 Ga0495610_0007745 Ga0495610_0007745_1101_2627 483
1038 3300046513 Ga0495616_0003636 Ga0495616_0003636_4837_6363 483
1039 3300046520 Ga0495637_0027517 Ga0495637_0027517_35_1561 483
1040 3300046524 Ga0495648_0043149 Ga0495648_0043149_870_2396 483
1041 3300046530 Ga0495654_0024623 Ga0495654_0024623_426_1952 483
1042 3300046531 Ga0495665_0015108 Ga0495665_0015108_2493_4019 483
1043 3300046538 Ga0495609_0009249 Ga0495609_0009249_2119_3645 483
1044 3300046557 Ga0495622_0062894 Ga0495622_0062894_117_1643 483
1045 3300046558 Ga0495633_0004238 Ga0495633_0004238_561_2087 483
1046 3300046616 Ga0495668_0007084 Ga0495668_0007084_5181_6707 483
1047 3300046642 Ga0495634_0003800 Ga0495634_0003800_328_1854 483
1048 3300046648 Ga0495611_0014929 Ga0495611_0014929_224_1750 483
1049 3300046660 Ga0495625_0008814 Ga0495625_0008814_5545_7071 483
1050 3300046663 Ga0495635_0000747 Ga0495635_0000747_4747_6273 483
1051 3300046663 Ga0495635_0014977 Ga0495635_0014977_1604_3130 483
1052 3300046665 Ga0495661_0015672 Ga0495661_0015672_3441_4967 483
1053 3300046674 Ga0495588_0007271 Ga0495588_0007271_1930_3456 483
1054 3300046675 Ga0495657_0008640 Ga0495657_0008640_1580_3106 483
1055 3300046680 Ga0495646_0025526 Ga0495646_0025526_728_2254 483
1056 3300046683 Ga0495658_0016490 Ga0495658_0016490_1601_3127 483
1057 3300046689 Ga0495613_0001355 Ga0495613_0001355_15065_16591 483
1058 3300046689 Ga0495613_0083708 Ga0495613_0083708_68_1594 483
1059 3300046692 Ga0495671_0015236 Ga0495671_0015236_1158_2684 483
1060 3300046809 Ga0495600_0016669 Ga0495600_0016669_1618_3144 483
1061 3300046810 Ga0495660_0027649 Ga0495660_0027649_1459_2985 483
1062 3300047315 Ga0495581_0019055 Ga0495581_0019055_961_2487 483
1063 3300047317 Ga0495604_0005136 Ga0495604_0005136_4505_6031 483
1064 3300047318 Ga0495636_0000786 Ga0495636_0000786_1600_3126 483
1065 3300047319 Ga0495674_0049337 Ga0495674_0049337_547_2073 483
1066 3300047322 Ga0495680_0005012 Ga0495680_0005012_4621_6147 483
1067 3300047443 Ga0495687_002577 Ga0495687_002577_7301_8827 483
1068 3300047443 Ga0495687_004667 Ga0495687_004667_4436_5965 483
1069 3300047443 Ga0495687_015685 Ga0495687_015685_1428_2954 483
1070 3300047444 Ga0495675_0028220 Ga0495675_0028220_1149_2675 483
1071 3300047447 Ga0495685_002450 Ga0495685_002450_244_1770 483
1072 3300047447 Ga0495685_006206 Ga0495685_006206_1305_2831 483
1073 3300047447 Ga0495685_031524 Ga0495685_031524_51_1577 483
1074 3300047470 Ga0495681_0000554 Ga0495681_0000554_25805_27331 483
1075 3300047470 Ga0495681_0012672 Ga0495681_0012672_2079_3605 483
1076 3300047472 Ga0495686_0037599 Ga0495686_0037599_422_1948 483
1077 3300047673 Ga0495593_0007108 Ga0495593_0007108_1470_2996 483
1078 3300048089 Ga0495614_0001950 Ga0495614_0001950_5443_6969 483
1079 3300048089 Ga0495614_0015275 Ga0495614_0015275_1487_3013 483
1080 3300048091 Ga0495626_0006153 Ga0495626_0006153_511_2037 483
1081 3300048904 Ga0496101_0030349 Ga0496101_0030349_865_2451 483
1082 3300048907 Ga0496104_0077221 Ga0496104_0077221_263_1825 483
1083 3300048908 Ga0496105_0130414 Ga0496105_0130414_521_2047 483
1084 3300048912 Ga0496109_0006669 Ga0496109_0006669_4130_5656 483
1085 3300048917 Ga0496114_0074553 Ga0496114_0074553_1237_2823 483
1086 3300048917 Ga0496114_0085423 Ga0496114_0085423_442_2004 483
1087 3300048921 Ga0496118_0005574 Ga0496118_0005574_11222_12799 483
1088 3300048922 Ga0496119_0076208 Ga0496119_0076208_76_1662 483
1089 3300048924 Ga0496121_0146522 Ga0496121_0146522_76_1662 483
1090 3300049459 Ga0495678_008909 Ga0495678_008909_1126_2631 483
1091 3300049568 Ga0501031_0046276 Ga0501031_0046276_260_1786 483
1092 3300049569 Ga0501032_0036228 Ga0501032_0036228_1584_3110 483
1093 3300049569 Ga0501032_0066955 Ga0501032_0066955_267_1796 483
1094 3300049570 Ga0501033_0010969 Ga0501033_0010969_4390_5919 483
1095 3300049570 Ga0501033_0140292 Ga0501033_0140292_57_1583 483
1096 3300049571 Ga0501034_0023061 Ga0501034_0023061_3687_5216 483
1097 3300049574 Ga0501038_0000303 Ga0501038_0000303_9297_10826 483
1098 3300049574 Ga0501038_0010214 Ga0501038_0010214_4577_6103 483
1099 3300049578 Ga0501042_0034233 Ga0501042_0034233_992_2518 483
1100 3300049579 Ga0501043_0007764 Ga0501043_0007764_1064_2590 483
1101 3300049581 Ga0501047_0014794 Ga0501047_0014794_2120_3649 483
1102 3300049586 Ga0501070_0000304 Ga0501070_0000304_5821_7425 483
1103 3300049822 Ga0501035_0060662 Ga0501035_0060662_336_1922 483
1104 3300049822 Ga0501035_0113287 Ga0501035_0113287_62_1591 483
1105 3300049822 Ga0501035_0138241 Ga0501035_0138241_212_1741 483
1106 3300049823 Ga0501044_0011879 Ga0501044_0011879_3380_4909 483
1107 3300049823 Ga0501044_0044148 Ga0501044_0044148_1577_3106 483
1108 3300050494 nmdc:mga06z11_15009_c1 nmdc:mga06z11_15009_c1_352_1881 483
1109 3300050495 nmdc:mga04h51_3331_c1 nmdc:mga04h51_3331_c1_480_2009 483
1110 3300050496 nmdc:mga07m45_15847_c1 nmdc:mga07m45_15847_c1_356_1909 483
1111 3300053079 Ga0500610_0011170 Ga0500610_0011170_2334_3860 483
1112 3300053157 Ga0500624_001618 Ga0500624_001618_54_1580 483
1113 3300061719 Ga0466962_0004115 Ga0466962_0004115_4297_5826 483
1114 iso_pu_bacteria 2616644941 2616905286 483
1115 iso_pu_bacteria 2643221678 2644443242 483
1116 iso_pu_bacteria 2643221714 2644626946 483
1117 iso_pu_bacteria 2808606359 2808842315 483
1118 iso_pu_bacteria 2858902515 2858904711 483
1119 iso_pu_bacteria 2946072368 2946076168 483
1120 iso_pu_bacteria 8023623736 8023629439 483
1121 3300005937 Ga0081455_10004439 Ga0081455_1000443919 484
1122 3300049583 Ga0501067_0073085 Ga0501067_0073085_47_1564 484
1123 iso_pu_bacteria 2622736626 2623585996 484
1124 iso_pu_bacteria 2643221615 2644092983 484
1125 iso_pu_bacteria 2643221657 2644322596 484
1126 iso_pu_bacteria 2739367898 2740165904 484
1127 iso_pu_bacteria 2772190715 2772646805 484
1128 iso_pu_bacteria 2855386786 2855389582 484
1129 iso_pu_bacteria 2880495981 2880498057 484
1130 iso_pu_bacteria 2929219909 2929220093 484
1131 iso_pu_bacteria 2929226422 2929226620 484
1132 iso_pu_bacteria 8003830390 8003832865 484
1133 iso_pu_bacteria 8003870546 8003870687 484
1134 iso_pu_bacteria 8054609563 8054609710 484
1135 3300002772 JGI25164J39214_1001833 JGI25164J39214_10018333 485
1136 3300003214 JGI25165J46597_1000107 JGI25165J46597_1000107104 485
1137 3300005530 Ga0070679_100003617 Ga0070679_10000361712 485
1138 3300005535 Ga0070684_100022248 Ga0070684_1000222484 485
1139 3300005548 Ga0070665_100001439 Ga0070665_1000014399 485
1140 3300005577 Ga0068857_100128672 Ga0068857_1001286722 485
1141 3300005843 Ga0068860_100036357 Ga0068860_1000363572 485
1142 3300013307 Ga0157372_10006674 Ga0157372_100066749 485
1143 3300013308 Ga0157375_10004579 Ga0157375_100045797 485
1144 3300014968 Ga0157379_10042614 Ga0157379_100426143 485
1145 3300025231 Ga0207427_100028 Ga0207427_100028204 485
1146 3300025233 Ga0209437_100581 Ga0209437_10058117 485
1147 3300025261 Ga0209233_1000001 Ga0209233_1000001702 485
1148 3300025904 Ga0207647_10031692 Ga0207647_100316924 485
1149 3300025941 Ga0207711_10018619 Ga0207711_100186194 485
1150 3300025944 Ga0207661_10121816 Ga0207661_101218162 485
1151 3300028379 Ga0268266_10000937 Ga0268266_1000093724 485
1152 3300028381 Ga0268264_10058926 Ga0268264_100589263 485
1153 3300031691 Ga0316579_10001001 Ga0316579_100010018 485
1154 3300037312 Ga0395899_0041209 Ga0395899_0041209_1326_2909 485
1155 3300037418 Ga0395900_0036187 Ga0395900_0036187_3126_4709 485
1156 3300037471 Ga0395905_0041867 Ga0395905_0041867_907_2490 485
1157 3300038443 Ga0395901_0158121 Ga0395901_0158121_477_1985 485
1158 3300044901 Ga0466960_0005920 Ga0466960_0005920_1088_2650 485
1159 3300045976 Ga0466967_0077492 Ga0466967_0077492_288_1865 485
1160 3300048905 Ga0496102_0012669 Ga0496102_0012669_437_1975 485
1161 3300048912 Ga0496109_0004707 Ga0496109_0004707_8278_9816 485
1162 3300048913 Ga0496110_0005768 Ga0496110_0005768_4447_5985 485
1163 3300049578 Ga0501042_0095302 Ga0501042_0095302_542_2089 485
1164 3300049582 Ga0501048_0106070 Ga0501048_0106070_110_1657 485
1165 iso_pu_bacteria 2515154129 2515722647 485
1166 iso_pu_bacteria 2515154202 2516084724 485
1167 iso_pu_bacteria 2995463766 2995468990 485
1168 3300005985 Ga0081539_10080860 Ga0081539_100808601 486
1169 3300006038 Ga0075365_10000552 Ga0075365_100005524 486
1170 3300006048 Ga0075363_100007170 Ga0075363_1000071705 486
1171 3300006051 Ga0075364_10014121 Ga0075364_100141212 486
1172 3300006178 Ga0075367_10027016 Ga0075367_100270162 486
1173 3300006178 Ga0075367_10033445 Ga0075367_100334452 486
1174 3300014325 Ga0163163_10250054 Ga0163163_102500541 486
1175 3300026118 Ga0207675_100153081 Ga0207675_1001530812 486
1176 3300027866 Ga0209813_10001694 Ga0209813_100016942 486
1177 3300037312 Ga0395899_0017915 Ga0395899_0017915_914_2482 486
1178 3300037418 Ga0395900_0227765 Ga0395900_0227765_36_1604 486
1179 3300041452 Ga0451793_1845951 Ga0451793_1845951_611_2140 486
1180 3300041494 Ga0451837_0514389 Ga0451837_0514389_403_1932 486
1181 3300041496 Ga0451839_0137481 Ga0451839_0137481_1186_2715 486
1182 3300044684 Ga0466966_0003595 Ga0466966_0003595_4681_6231 486
1183 3300044693 Ga0466961_0052076 Ga0466961_0052076_404_1972 486
1184 3300044693 Ga0466961_0089131 Ga0466961_0089131_365_1909 486
1185 3300044694 Ga0466963_0003366 Ga0466963_0003366_4943_6493 486
1186 3300044694 Ga0466963_0045188 Ga0466963_0045188_21_1565 486
1187 3300044706 Ga0466964_0002951 Ga0466964_0002951_2973_4517 486
1188 3300044719 Ga0466971_0017094 Ga0466971_0017094_490_2040 486
1189 3300044735 Ga0466968_0043542 Ga0466968_0043542_295_1839 486
1190 3300044765 Ga0466970_0019119 Ga0466970_0019119_948_2516 486
1191 3300044842 Ga0466957_0002105 Ga0466957_0002105_6657_8207 486
1192 3300044842 Ga0466957_0110635 Ga0466957_0110635_24_1568 486
1193 3300044901 Ga0466960_0007257 Ga0466960_0007257_633_2177 486
1194 3300045049 Ga0466959_0032390 Ga0466959_0032390_1840_3408 486
1195 3300045836 Ga0466958_0001073 Ga0466958_0001073_10660_12210 486
1196 3300045836 Ga0466958_0050742 Ga0466958_0050742_884_2428 486
1197 3300045976 Ga0466967_0087802 Ga0466967_0087802_1226_2806 486
1198 3300048905 Ga0496102_0082354 Ga0496102_0082354_1316_2857 486
1199 3300048906 Ga0496103_0033374 Ga0496103_0033374_582_2123 486
1200 3300048909 Ga0496106_0096005 Ga0496106_0096005_258_1799 486
1201 3300048910 Ga0496107_0108634 Ga0496107_0108634_163_1704 486
1202 3300048912 Ga0496109_0045044 Ga0496109_0045044_1572_3113 486
1203 3300048913 Ga0496110_0182982 Ga0496110_0182982_81_1640 486
1204 3300048917 Ga0496114_0040624 Ga0496114_0040624_1261_2802 486
1205 3300048918 Ga0496115_0033898 Ga0496115_0033898_1354_2895 486
1206 3300048920 Ga0496117_0040254 Ga0496117_0040254_653_2143 486
1207 3300049571 Ga0501034_0032114 Ga0501034_0032114_2495_4036 486
1208 3300049583 Ga0501067_0005717 Ga0501067_0005717_1282_2823 486
1209 3300049588 Ga0501072_0011058 Ga0501072_0011058_4151_5692 486
1210 3300049589 Ga0501073_0026557 Ga0501073_0026557_1133_2674 486
1211 3300049590 Ga0501074_0003908 Ga0501074_0003908_7787_9328 486
1212 3300049593 Ga0501077_0008288 Ga0501077_0008288_1343_2884 486
1213 3300049742 Ga0501080_0013264 Ga0501080_0013264_3512_5053 486
1214 3300049744 Ga0501083_0005510 Ga0501083_0005510_6421_7962 486
1215 3300050492 nmdc:mga0yw44_1056_c1 nmdc:mga0yw44_1056_c1_3311_5014 486
1216 3300053104 Ga0500556_0000883 Ga0500556_0000883_5099_6643 486
1217 3300053117 Ga0500593_001072 Ga0500593_001072_5485_7029 486
1218 3300060353 Ga0501082_0032214 Ga0501082_0032214_1672_3213 486
1219 iso_pu_bacteria 2585428094 2587861606 486
1220 iso_pu_bacteria 2643221613 2644084233 486
1221 iso_pu_bacteria 2643221641 2644228409 486
1222 iso_pu_bacteria 2643221649 2644278161 486
1223 iso_pu_bacteria 2643221721 2644666501 486
1224 iso_pu_bacteria 2791355406 2793983499 486
1225 iso_pu_bacteria 2795385470 2795781104 486
1226 iso_pu_bacteria 2839986021 2839988503 486
1227 iso_pu_bacteria 2862705112 2862709023 486
1228 iso_pu_bacteria 2867475112 2867476096 486
1229 iso_pu_bacteria 2935890801 2935893415 486
1230 iso_pu_bacteria 2990044586 2990048999 486
1231 iso_pu_bacteria 2996221748 2996226068 486
1232 iso_pu_bacteria 3006425503 3006428337 486
1233 iso_pu_bacteria 8008485437 8008487040 486
1234 iso_pu_bacteria 8025524527 8025525199 486
1235 iso_pu_bacteria 8047893842 8047897309 486
1236 iso_pu_bacteria 8048127548 8048128222 486
1237 iso_pu_bacteria 8048356638 8048361634 486
1238 iso_pu_bacteria 8048369669 8048374297 486
1239 iso_pu_bacteria 8048379754 8048383926 486
1240 3300006051 Ga0075364_10078862 Ga0075364_100788622 487
1241 3300028573 Ga0265334_10001828 Ga0265334_100018284 487
1242 3300031649 Ga0307514_10029464 Ga0307514_100294641 487
1243 3300035695 Ga0373927_0023872 Ga0373927_0023872_2292_3806 487
1244 3300044656 Ga0466969_0014647 Ga0466969_0014647_1287_2864 487
1245 3300044684 Ga0466966_0002752 Ga0466966_0002752_3911_5488 487
1246 3300044684 Ga0466966_0058042 Ga0466966_0058042_494_2089 487
1247 3300045049 Ga0466959_0061768 Ga0466959_0061768_1136_2713 487
1248 3300046454 Ga0495592_0009084 Ga0495592_0009084_3716_5299 487
1249 3300046462 Ga0495651_0012598 Ga0495651_0012598_942_2525 487
1250 3300046463 Ga0495653_0035517 Ga0495653_0035517_186_1769 487
1251 3300046472 Ga0495580_0015227 Ga0495580_0015227_2179_3762 487
1252 3300046476 Ga0495662_0000427 Ga0495662_0000427_1773_3356 487
1253 3300046516 Ga0495628_0006282 Ga0495628_0006282_8028_9611 487
1254 3300046517 Ga0495630_0010924 Ga0495630_0010924_2554_4137 487
1255 3300046526 Ga0495666_0000236 Ga0495666_0000236_21019_22602 487
1256 3300046529 Ga0495652_0019520 Ga0495652_0019520_3019_4602 487
1257 3300046531 Ga0495665_0001397 Ga0495665_0001397_2244_3827 487
1258 3300046533 Ga0495640_0009109 Ga0495640_0009109_2322_3905 487
1259 3300046536 Ga0495587_0030406 Ga0495587_0030406_1154_2737 487
1260 3300046543 Ga0495645_0031676 Ga0495645_0031676_1550_3133 487
1261 3300046559 Ga0495667_0009690 Ga0495667_0009690_4001_5584 487
1262 3300046663 Ga0495635_0016360 Ga0495635_0016360_2164_3747 487
1263 3300046675 Ga0495657_0004444 Ga0495657_0004444_2523_4106 487
1264 3300046678 Ga0495599_0027668 Ga0495599_0027668_1377_2960 487
1265 3300046679 Ga0495623_0006079 Ga0495623_0006079_3844_5427 487
1266 3300046689 Ga0495613_0073577 Ga0495613_0073577_186_1769 487
1267 3300046809 Ga0495600_0044267 Ga0495600_0044267_601_2184 487
1268 3300047315 Ga0495581_0003576 Ga0495581_0003576_5294_6877 487
1269 3300047317 Ga0495604_0003123 Ga0495604_0003123_6945_8528 487
1270 3300047444 Ga0495675_0010833 Ga0495675_0010833_2883_4466 487
1271 3300047471 Ga0495684_0021859 Ga0495684_0021859_1910_3493 487
1272 3300047673 Ga0495593_0023010 Ga0495593_0023010_954_2537 487
1273 3300053080 Ga0500635_0000075 Ga0500635_0000075_13507_15090 487
1274 3300061719 Ga0466962_0002734 Ga0466962_0002734_963_2558 487
1275 iso_pu_bacteria 2867507094 2867510178 487
1276 iso_pu_bacteria 2887443736 2887447299 487
1277 3300005548 Ga0070665_100022040 Ga0070665_1000220402 488
1278 3300005618 Ga0068864_100053011 Ga0068864_1000530112 488
1279 3300005841 Ga0068863_100009010 Ga0068863_1000090104 488
1280 3300025302 Ga0207426_1012267 Ga0207426_10122672 488
1281 3300025928 Ga0207700_10047047 Ga0207700_100470473 488
1282 3300026121 Ga0207683_10064171 Ga0207683_100641714 488
1283 3300028379 Ga0268266_10019587 Ga0268266_100195874 488
1284 3300031616 Ga0307508_10032770 Ga0307508_100327704 488
1285 3300031824 Ga0307413_10000162 Ga0307413_1000016220 488
1286 3300044684 Ga0466966_0002442 Ga0466966_0002442_10504_12006 488
1287 3300046543 Ga0495645_0046701 Ga0495645_0046701_1005_2591 488
1288 3300047444 Ga0495675_0021176 Ga0495675_0021176_1562_3148 488
1289 3300048921 Ga0496118_0057862 Ga0496118_0057862_1120_2628 488
1290 3300048929 Ga0496126_0016431 Ga0496126_0016431_3993_5501 488
1291 iso_pu_bacteria 2997600082 2997604404 488
1292 iso_pu_bacteria 8054160619 8054162961 488
1293 3300003911 JGI25405J52794_10008121 JGI25405J52794_100081212 489
1294 3300005356 Ga0070674_100083445 Ga0070674_1000834452 489
1295 3300005438 Ga0070701_10006381 Ga0070701_100063812 489
1296 3300005440 Ga0070705_100002793 Ga0070705_1000027937 489
1297 3300005457 Ga0070662_100014118 Ga0070662_1000141183 489
1298 3300005539 Ga0068853_100005838 Ga0068853_1000058382 489
1299 3300005543 Ga0070672_100100113 Ga0070672_1001001132 489
1300 3300005544 Ga0070686_100037792 Ga0070686_1000377922 489
1301 3300005548 Ga0070665_100108196 Ga0070665_1001081962 489
1302 3300005564 Ga0070664_100110472 Ga0070664_1001104722 489
1303 3300005617 Ga0068859_100127831 Ga0068859_1001278312 489
1304 3300005618 Ga0068864_100057253 Ga0068864_1000572532 489
1305 3300005841 Ga0068863_100054883 Ga0068863_1000548833 489
1306 3300005937 Ga0081455_10000290 Ga0081455_1000029024 489
1307 3300005983 Ga0081540_1056433 Ga0081540_10564332 489
1308 3300005985 Ga0081539_10011550 Ga0081539_100115503 489
1309 3300006852 Ga0075433_10012177 Ga0075433_100121776 489
1310 3300006871 Ga0075434_100032417 Ga0075434_1000324173 489
1311 3300006931 Ga0097620_100127828 Ga0097620_1001278282 489
1312 3300007076 Ga0075435_100015051 Ga0075435_1000150512 489
1313 3300009101 Ga0105247_10041004 Ga0105247_100410042 489
1314 3300009553 Ga0105249_10016677 Ga0105249_100166772 489
1315 3300013105 Ga0157369_10012786 Ga0157369_100127862 489
1316 3300013296 Ga0157374_10039291 Ga0157374_100392914 489
1317 3300013308 Ga0157375_10053546 Ga0157375_100535462 489
1318 3300014326 Ga0157380_10054693 Ga0157380_100546933 489
1319 3300025901 Ga0207688_10009599 Ga0207688_100095992 489
1320 3300025915 Ga0207693_10014795 Ga0207693_100147954 489
1321 3300025916 Ga0207663_10001527 Ga0207663_100015277 489
1322 3300025933 Ga0207706_10007345 Ga0207706_100073458 489
1323 3300025935 Ga0207709_10011590 Ga0207709_100115902 489
1324 3300025940 Ga0207691_10077702 Ga0207691_100777022 489
1325 3300025949 Ga0207667_10072320 Ga0207667_100723204 489
1326 3300026067 Ga0207678_10003353 Ga0207678_100033539 489
1327 3300026075 Ga0207708_10022689 Ga0207708_100226894 489
1328 3300026088 Ga0207641_10004316 Ga0207641_100043166 489
1329 3300028379 Ga0268266_10048502 Ga0268266_100485023 489
1330 3300035088 Ga0373940_0002605 Ga0373940_0002605_721_2241 489
1331 3300035090 Ga0373949_0005799 Ga0373949_0005799_403_1923 489
1332 3300035091 Ga0373951_0000009 Ga0373951_0000009_55708_57294 489
1333 3300035112 Ga0373932_0004489 Ga0373932_0004489_858_2378 489
1334 3300035115 Ga0373941_0007526 Ga0373941_0007526_57_1577 489
1335 3300035121 Ga0373960_0002465 Ga0373960_0002465_2473_3993 489
1336 3300044658 Ga0466972_0011660 Ga0466972_0011660_1338_2930 489
1337 3300044658 Ga0466972_0037778 Ga0466972_0037778_501_2069 489
1338 3300044683 Ga0466965_0002025 Ga0466965_0002025_4659_6251 489
1339 3300044684 Ga0466966_0057069 Ga0466966_0057069_588_2126 489
1340 3300044693 Ga0466961_0014592 Ga0466961_0014592_2238_3806 489
1341 3300044694 Ga0466963_0037685 Ga0466963_0037685_91_1659 489
1342 3300044719 Ga0466971_0019147 Ga0466971_0019147_1184_2752 489
1343 3300044765 Ga0466970_0021255 Ga0466970_0021255_117_1709 489
1344 3300044765 Ga0466970_0024087 Ga0466970_0024087_1212_2780 489
1345 3300045836 Ga0466958_0015631 Ga0466958_0015631_1224_2792 489
1346 3300045976 Ga0466967_0254873 Ga0466967_0254873_90_1643 489
1347 3300048903 Ga0496100_0001709 Ga0496100_0001709_7291_8874 489
1348 3300048904 Ga0496101_0022875 Ga0496101_0022875_2516_4036 489
1349 3300048905 Ga0496102_0000187 Ga0496102_0000187_6275_7870 489
1350 3300048905 Ga0496102_0026240 Ga0496102_0026240_2666_4180 489
1351 3300048905 Ga0496102_0144725 Ga0496102_0144725_42_1541 489
1352 3300048906 Ga0496103_0000126 Ga0496103_0000126_74422_76017 489
1353 3300048906 Ga0496103_0087885 Ga0496103_0087885_315_1829 489
1354 3300048907 Ga0496104_0012856 Ga0496104_0012856_86_1606 489
1355 3300048908 Ga0496105_0003893 Ga0496105_0003893_2352_3866 489
1356 3300048908 Ga0496105_0004853 Ga0496105_0004853_2445_3965 489
1357 3300048908 Ga0496105_0007560 Ga0496105_0007560_2962_4560 489
1358 3300048910 Ga0496107_0005833 Ga0496107_0005833_6527_8047 489
1359 3300048911 Ga0496108_0000812 Ga0496108_0000812_1864_3378 489
1360 3300048911 Ga0496108_0038094 Ga0496108_0038094_1354_2874 489
1361 3300048911 Ga0496108_0108561 Ga0496108_0108561_675_2189 489
1362 3300048912 Ga0496109_0003973 Ga0496109_0003973_796_2310 489
1363 3300048912 Ga0496109_0182559 Ga0496109_0182559_85_1680 489
1364 3300048913 Ga0496110_0046606 Ga0496110_0046606_249_1832 489
1365 3300048913 Ga0496110_0048014 Ga0496110_0048014_1307_2827 489
1366 3300048913 Ga0496110_0075463 Ga0496110_0075463_383_1897 489
1367 3300048914 Ga0496111_0000028 Ga0496111_0000028_39794_41308 489
1368 3300048916 Ga0496113_0008778 Ga0496113_0008778_3835_5355 489
1369 3300048916 Ga0496113_0031697 Ga0496113_0031697_1278_2792 489
1370 3300048917 Ga0496114_0008776 Ga0496114_0008776_2637_4151 489
1371 3300048919 Ga0496116_0000306 Ga0496116_0000306_74480_76075 489
1372 3300048920 Ga0496117_0000343 Ga0496117_0000343_74285_75880 489
1373 3300048921 Ga0496118_0000192 Ga0496118_0000192_31744_33339 489
1374 3300048921 Ga0496118_0000272 Ga0496118_0000272_47890_49389 489
1375 3300048922 Ga0496119_0000764 Ga0496119_0000764_39952_41550 489
1376 3300048923 Ga0496120_0003415 Ga0496120_0003415_1736_3334 489
1377 3300048924 Ga0496121_0002290 Ga0496121_0002290_25534_27117 489
1378 3300048929 Ga0496126_0000433 Ga0496126_0000433_76151_77746 489
1379 3300048929 Ga0496126_0043333 Ga0496126_0043333_857_2362 489
1380 3300050515 nmdc:mga0a205_44535_c1 nmdc:mga0a205_44535_c1_1453_2973 489
1381 3300053088 Ga0500644_0005211 Ga0500644_0005211_1127_2716 489
1382 3300053131 Ga0500652_025994 Ga0500652_025994_556_2145 489
1383 3300053159 Ga0500630_040150 Ga0500630_040150_269_1858 489
1384 3300001991 JGI24743J22301_10001116 JGI24743J22301_100011162 490
1385 3300005329 Ga0070683_100195291 Ga0070683_1001952911 490
1386 3300005355 Ga0070671_100000175 Ga0070671_10000017522 490
1387 3300005355 Ga0070671_100016400 Ga0070671_1000164001 490
1388 3300005356 Ga0070674_100064986 Ga0070674_1000649863 490
1389 3300005367 Ga0070667_100035109 Ga0070667_1000351094 490
1390 3300005548 Ga0070665_100003390 Ga0070665_1000033902 490
1391 3300005548 Ga0070665_100004418 Ga0070665_1000044183 490
1392 3300005841 Ga0068863_100001135 Ga0068863_10000113510 490
1393 3300005843 Ga0068860_100000261 Ga0068860_10000026159 490
1394 3300005843 Ga0068860_100002620 Ga0068860_10000262021 490
1395 3300025903 Ga0207680_10041780 Ga0207680_100417802 490
1396 3300025931 Ga0207644_10000564 Ga0207644_1000056415 490
1397 3300025931 Ga0207644_10058466 Ga0207644_100584662 490
1398 3300025937 Ga0207669_10032739 Ga0207669_100327393 490
1399 3300025972 Ga0207668_10060365 Ga0207668_100603652 490
1400 3300025986 Ga0207658_10024654 Ga0207658_100246542 490
1401 3300026035 Ga0207703_10084282 Ga0207703_100842822 490
1402 3300026088 Ga0207641_10002103 Ga0207641_100021036 490
1403 3300028379 Ga0268266_10003055 Ga0268266_100030552 490
1404 3300028379 Ga0268266_10004718 Ga0268266_1000471811 490
1405 3300028381 Ga0268264_10000315 Ga0268264_1000031560 490
1406 iso_pu_bacteria 2784132109 2784473137 490
1407 iso_pu_bacteria 2791354901 2791917294 490
1408 iso_pu_bacteria 2811994882 2812373105 490
1409 iso_pu_bacteria 2818991318 2819425886 490
1410 iso_pu_bacteria 2818991458 2819664968 490
1411 iso_pu_bacteria 2818991462 2819689376 490
1412 iso_pu_bacteria 2818991469 2819727087 490
1413 iso_pu_bacteria 8054472261 8054479066 490
1414 3300003203 JGI25406J46586_10018706 JGI25406J46586_100187062 491
1415 3300005288 Ga0065714_10072535 Ga0065714_100725352 491
1416 3300005327 Ga0070658_10018256 Ga0070658_100182562 491
1417 3300005347 Ga0070668_100003761 Ga0070668_1000037616 491
1418 3300005985 Ga0081539_10008770 Ga0081539_100087703 491
1419 3300005985 Ga0081539_10015464 Ga0081539_100154642 491
1420 3300009098 Ga0105245_10009833 Ga0105245_100098335 491
1421 3300020082 Ga0206353_10371772 Ga0206353_103717725 491
1422 3300020082 Ga0206353_11970105 Ga0206353_119701053 491
1423 3300025927 Ga0207687_10099407 Ga0207687_100994072 491
1424 3300025972 Ga0207668_10006881 Ga0207668_100068814 491
1425 3300026142 Ga0207698_10039588 Ga0207698_100395883 491
1426 3300031548 Ga0307408_100161678 Ga0307408_1001616782 491
1427 3300031911 Ga0307412_10062426 Ga0307412_100624263 491
1428 3300033179 Ga0307507_10020073 Ga0307507_100200735 491
1429 3300033180 Ga0307510_10019664 Ga0307510_100196647 491
1430 3300045976 Ga0466967_0001526 Ga0466967_0001526_10734_12350 491
1431 3300048908 Ga0496105_0049849 Ga0496105_0049849_729_2339 491
1432 3300048912 Ga0496109_0028903 Ga0496109_0028903_2488_4023 491
1433 3300048918 Ga0496115_0033275 Ga0496115_0033275_1386_2996 491
1434 3300053085 Ga0495619_0047871 Ga0495619_0047871_715_2277 491
1435 iso_pu_bacteria 2582580736 2583152130 491
1436 iso_pu_bacteria 2622736605 2623497905 491
1437 iso_pu_bacteria 2643221690 2644502508 491
1438 iso_pu_bacteria 2643221694 2644524901 491
1439 iso_pu_bacteria 2643221722 2644668987 491
1440 iso_pu_bacteria 2738541272 2738696957 491
1441 iso_pu_bacteria 2738543027 2739324133 491
1442 iso_pu_bacteria 2758568522 2760305120 491
1443 iso_pu_bacteria 2758568621 2760621072 491
1444 iso_pu_bacteria 2808606394 2809025862 491
1445 iso_pu_bacteria 2811994880 2812364030 491
1446 iso_pu_bacteria 2835188231 2835191729 491
1447 iso_pu_bacteria 2866612099 2866616307 491
1448 iso_pu_bacteria 2884994152 2884998179 491
1449 iso_pu_bacteria 2899359706 2899369158 491
1450 iso_pu_bacteria 2932431166 2932431295 491
1451 iso_pu_bacteria 3001889506 3001890225 491
1452 iso_pu_bacteria 8003314358 8003315079 491
1453 iso_pu_bacteria 8056579771 8056580041 491
1454 3300005347 Ga0070668_100004067 Ga0070668_1000040675 492
1455 3300005564 Ga0070664_100022615 Ga0070664_1000226154 492
1456 3300006847 Ga0075431_100023915 Ga0075431_1000239155 492
1457 3300025944 Ga0207661_10008291 Ga0207661_100082915 492
1458 3300025945 Ga0207679_10015063 Ga0207679_100150633 492
1459 3300026116 Ga0207674_10035199 Ga0207674_100351993 492
1460 3300028794 Ga0307515_10061782 Ga0307515_100617823 492
1461 3300031730 Ga0307516_10021393 Ga0307516_100213934 492
1462 3300037418 Ga0395900_0067014 Ga0395900_0067014_1053_2609 492
1463 3300050510 nmdc:mga06r32_1952_c2 nmdc:mga06r32_1952_c2_6181_7713 492
1464 3300053131 Ga0500652_001141 Ga0500652_001141_4606_6105 492
1465 iso_pu_bacteria 2643221561 2643827221 492
1466 iso_pu_bacteria 2643221696 2644533952 492
1467 iso_pu_bacteria 8047710418 8047716275 492
1468 3300010375 Ga0105239_10098373 Ga0105239_100983732 493
1469 3300026067 Ga0207678_10129254 Ga0207678_101292542 493
1470 3300031456 Ga0307513_10006778 Ga0307513_100067783 493
1471 3300031665 Ga0316575_10011016 Ga0316575_100110161 493
1472 3300031691 Ga0316579_10006084 Ga0316579_100060845 493
1473 3300031727 Ga0316576_10005277 Ga0316576_100052777 493
1474 3300031727 Ga0316576_10029031 Ga0316576_100290312 493
1475 3300031728 Ga0316578_10011617 Ga0316578_100116174 493
1476 3300031911 Ga0307412_10020923 Ga0307412_100209232 493
1477 3300032133 Ga0316583_10014076 Ga0316583_100140762 493
1478 3300035242 Ga0373962_0001917 Ga0373962_0001917_1684_3243 493
1479 3300035398 Ga0316574_0035536 Ga0316574_0035536_771_2384 493
1480 3300035692 Ga0373935_0025341 Ga0373935_0025341_1912_3492 493
1481 3300036647 Ga0316582_0006156 Ga0316582_0006156_3922_5535 493
1482 3300036647 Ga0316582_0023811 Ga0316582_0023811_260_1873 493
1483 3300036712 Ga0316584_0014503 Ga0316584_0014503_964_2577 493
1484 3300036712 Ga0316584_0058453 Ga0316584_0058453_623_2236 493
1485 3300046684 Ga0495669_0015550 Ga0495669_0015550_191_1738 493
1486 3300048908 Ga0496105_0073860 Ga0496105_0073860_688_2313 493
1487 3300048917 Ga0496114_0039075 Ga0496114_0039075_1077_2702 493
1488 iso_pu_bacteria 2643221711 2644607897 493
1489 iso_pu_bacteria 2751185782 2753267192 493
1490 3300003285 Ga0007423J48922_100181 Ga0007423J48922_1001815 494
1491 3300005615 Ga0070702_100004590 Ga0070702_1000045906 494
1492 3300006881 Ga0068865_100057694 Ga0068865_1000576942 494
1493 3300025934 Ga0207686_10037575 Ga0207686_100375752 494
1494 3300030733 Ga0314311_1022273 Ga0314311_10222731 494
1495 3300030734 Ga0316179_1002615 Ga0316179_10026152 494
1496 3300044658 Ga0466972_0005236 Ga0466972_0005236_4642_6243 494
1497 3300044719 Ga0466971_0007929 Ga0466971_0007929_1626_3188 494
1498 3300045976 Ga0466967_0008914 Ga0466967_0008914_1177_2766 494
1499 3300048908 Ga0496105_0073288 Ga0496105_0073288_913_2484 494
1500 3300048921 Ga0496118_0043314 Ga0496118_0043314_360_1907 494
1501 3300048922 Ga0496119_0046259 Ga0496119_0046259_979_2526 494
1502 3300048925 Ga0496122_0001030 Ga0496122_0001030_21302_22849 494
1503 3300048928 Ga0496125_0000066 Ga0496125_0000066_87364_88911 494
1504 3300049569 Ga0501032_0010112 Ga0501032_0010112_1129_2679 494
1505 3300049580 Ga0501046_0005803 Ga0501046_0005803_2254_3804 494
1506 3300049581 Ga0501047_0024666 Ga0501047_0024666_1103_2653 494
1507 3300049586 Ga0501070_0063145 Ga0501070_0063145_348_1898 494
1508 3300049744 Ga0501083_0003749 Ga0501083_0003749_5104_6654 494
1509 3300049822 Ga0501035_0005582 Ga0501035_0005582_6341_7891 494
1510 3300049823 Ga0501044_0015546 Ga0501044_0015546_5628_7178 494
1511 3300054114 Ga0501084_0036552 Ga0501084_0036552_2070_3620 494
1512 iso_pu_bacteria 2795385472 2795793955 494
1513 iso_pu_bacteria 2917736166 2917744005 494
1514 iso_pu_bacteria 2956939328 2956942098 494
1515 iso_pu_bacteria 3001119090 3001119448 494
1516 iso_pu_bacteria 8056207758 8056214036 494
1517 3300025937 Ga0207669_10106313 Ga0207669_101063132 495
1518 3300026067 Ga0207678_10062387 Ga0207678_100623872 495
1519 3300041453 Ga0451797_0041771 Ga0451797_0041771_66_1643 495
1520 3300050511 nmdc:mga08y16_82680_c1 nmdc:mga08y16_82680_c1_1085_2629 495
1521 3300005548 Ga0070665_100164564 Ga0070665_1001645642 496
1522 3300005842 Ga0068858_100010474 Ga0068858_1000104744 496
1523 3300005983 Ga0081540_1010259 Ga0081540_10102593 496
1524 3300005985 Ga0081539_10001780 Ga0081539_100017805 496
1525 3300025986 Ga0207658_10041620 Ga0207658_100416203 496
1526 3300026035 Ga0207703_10020636 Ga0207703_100206363 496
1527 3300028381 Ga0268264_10051850 Ga0268264_100518503 496
1528 3300031507 Ga0307509_10027386 Ga0307509_100273864 496
1529 3300031903 Ga0307407_10113467 Ga0307407_101134671 496
1530 3300031911 Ga0307412_10028201 Ga0307412_100282012 496
1531 3300031995 Ga0307409_100105187 Ga0307409_1001051872 496
1532 3300032126 Ga0307415_100089708 Ga0307415_1000897082 496
1533 3300033179 Ga0307507_10014930 Ga0307507_100149306 496
1534 3300049569 Ga0501032_0095270 Ga0501032_0095270_60_1595 496
1535 3300049570 Ga0501033_0010271 Ga0501033_0010271_2926_4461 496
1536 3300049571 Ga0501034_0083609 Ga0501034_0083609_649_2184 496
1537 3300049581 Ga0501047_0021848 Ga0501047_0021848_259_1794 496
1538 3300049822 Ga0501035_0000886 Ga0501035_0000886_17374_18909 496
1539 3300049823 Ga0501044_0000313 Ga0501044_0000313_2752_4287 496
1540 iso_pu_bacteria 2744054611 2744955201 496
1541 iso_pu_bacteria 2866552031 2866555853 496
1542 3300005435 Ga0070714_100013034 Ga0070714_1000130343 497
1543 3300005435 Ga0070714_100071252 Ga0070714_1000712522 497
1544 3300025898 Ga0207692_10052702 Ga0207692_100527022 497
1545 3300025901 Ga0207688_10010060 Ga0207688_100100602 497
1546 3300025929 Ga0207664_10014402 Ga0207664_100144024 497
1547 3300025929 Ga0207664_10059043 Ga0207664_100590433 497
1548 3300039437 Ga0436365_0671847 Ga0436365_0671847_11620_13146 497
1549 3300044694 Ga0466963_0010205 Ga0466963_0010205_405_1958 497
1550 3300044694 Ga0466963_0038588 Ga0466963_0038588_120_1646 497
1551 3300044719 Ga0466971_0026675 Ga0466971_0026675_169_1704 497
1552 3300044901 Ga0466960_0000683 Ga0466960_0000683_9366_10892 497
1553 3300045976 Ga0466967_0026462 Ga0466967_0026462_1008_2534 497
1554 3300048929 Ga0496126_0001476 Ga0496126_0001476_21358_22884 497
1555 3300049570 Ga0501033_0022188 Ga0501033_0022188_2170_3696 497
1556 3300049571 Ga0501034_0004377 Ga0501034_0004377_7855_9381 497
1557 3300049579 Ga0501043_0037155 Ga0501043_0037155_1577_3103 497
1558 3300049580 Ga0501046_0000769 Ga0501046_0000769_21127_22653 497
1559 3300049581 Ga0501047_0012990 Ga0501047_0012990_4053_5579 497
1560 3300049582 Ga0501048_0023521 Ga0501048_0023521_249_1775 497
1561 3300049586 Ga0501070_0000985 Ga0501070_0000985_12706_14232 497
1562 3300021384 Ga0213876_10066972 Ga0213876_100669721 498
1563 3300031251 Ga0265327_10000131 Ga0265327_10000131115 498
1564 3300039437 Ga0436365_1833781 Ga0436365_1833781_28485_30035 498
1565 3300049578 Ga0501042_0098897 Ga0501042_0098897_221_1843 498
1566 3300005355 Ga0070671_100000693 Ga0070671_10000069316 499
1567 3300005367 Ga0070667_100010135 Ga0070667_1000101354 499
1568 3300006048 Ga0075363_100022474 Ga0075363_1000224742 499
1569 3300006051 Ga0075364_10000830 Ga0075364_1000083015 499
1570 3300006186 Ga0075369_10000684 Ga0075369_100006846 499
1571 3300006844 Ga0075428_100047731 Ga0075428_1000477313 499
1572 3300006847 Ga0075431_100144417 Ga0075431_1001444173 499
1573 3300013306 Ga0163162_10127905 Ga0163162_101279052 499
1574 3300014325 Ga0163163_10081878 Ga0163163_100818781 499
1575 3300021384 Ga0213876_10001902 Ga0213876_100019025 499
1576 3300025925 Ga0207650_10041192 Ga0207650_100411923 499
1577 3300025981 Ga0207640_10098135 Ga0207640_100981352 499
1578 3300026088 Ga0207641_10033440 Ga0207641_100334404 499
1579 3300037853 Ga0436364_0261085 Ga0436364_0261085_1148_2686 499
1580 3300039437 Ga0436365_1818399 Ga0436365_1818399_28082_29620 499
1581 3300042004 Ga0439445_0015721 Ga0439445_0015721_104_1627 499
1582 3300044684 Ga0466966_0008977 Ga0466966_0008977_1454_2983 499
1583 3300044694 Ga0466963_0015792 Ga0466963_0015792_2064_3593 499
1584 3300044765 Ga0466970_0052778 Ga0466970_0052778_382_1911 499
1585 3300045049 Ga0466959_0031087 Ga0466959_0031087_1454_2983 499
1586 3300048904 Ga0496101_0032927 Ga0496101_0032927_1616_3142 499
1587 3300048907 Ga0496104_0015265 Ga0496104_0015265_5342_6868 499
1588 3300048911 Ga0496108_0075375 Ga0496108_0075375_1014_2537 499
1589 3300048914 Ga0496111_0046359 Ga0496111_0046359_1070_2596 499
1590 3300048915 Ga0496112_0006907 Ga0496112_0006907_5185_6711 499
1591 3300050490 nmdc:mga03n38_4805_c2 nmdc:mga03n38_4805_c2_190_1713 499
1592 3300050491 nmdc:mga00v17_18980_c1 nmdc:mga00v17_18980_c1_685_2208 499
1593 3300050491 nmdc:mga00v17_2758_c1 nmdc:mga00v17_2758_c1_3914_5440 499
1594 3300050496 nmdc:mga07m45_21100_c1 nmdc:mga07m45_21100_c1_963_2486 499
1595 3300050516 nmdc:mga0sz30_1079_c1 nmdc:mga0sz30_1079_c1_1310_2833 499
1596 3300050516 nmdc:mga0sz30_4196_c1 nmdc:mga0sz30_4196_c1_1620_3146 499
1597 iso_pu_bacteria 2738541264 2738667342 499
1598 iso_pu_bacteria 2738541356 2739146185 499
1599 iso_pu_bacteria 2929212328 2929217885 499
1600 3300053136 Ga0500559_0002237 Ga0500559_0002237_514_2094 500
1601 iso_pu_bacteria 2738541274 2738706335 500
1602 iso_pu_bacteria 2738543028 2739328825 500
1603 iso_pu_bacteria 2902799365 2902804115 500
1604 iso_pu_bacteria 2643221687 2644491253 501
1605 iso_pu_bacteria 2902837492 2902842961 501
1606 iso_pu_bacteria 2939582691 2939585114 501
1607 3300025939 Ga0207665_10041490 Ga0207665_100414902 502
1608 3300046616 Ga0495668_0054633 Ga0495668_0054633_212_1789 502
1609 iso_pu_bacteria 2565956761 2566995802 502
1610 iso_pu_bacteria 2643221692 2644515595 502
1611 iso_pu_bacteria 2738541308 2738888702 502
1612 iso_pu_bacteria 2738543005 2739204594 502
1613 iso_pu_bacteria 2904535858 2904537592 502
1614 iso_pu_bacteria 2904765812 2904766769 502
1615 iso_pu_bacteria 2904770941 2904775219 502
1616 iso_pu_bacteria 2908811453 2908814463 502
1617 iso_pu_bacteria 2919420072 2919420795 502
1618 iso_pu_bacteria 2919432681 2919433447 502
1619 iso_pu_bacteria 2922554459 2922558763 502
1620 iso_pu_bacteria 2928142448 2928145429 502
1621 3300003792 Ga0055540_1000071 Ga0055540_100007164 503
1622 3300005335 Ga0070666_10069481 Ga0070666_100694812 503
1623 3300005367 Ga0070667_100000995 Ga0070667_10000099525 503
1624 3300005456 Ga0070678_100110041 Ga0070678_1001100411 503
1625 3300009545 Ga0105237_10003741 Ga0105237_100037414 503
1626 3300010375 Ga0105239_10009568 Ga0105239_100095689 503
1627 3300025303 Ga0209051_1000033 Ga0209051_1000033296 503
1628 3300025903 Ga0207680_10007714 Ga0207680_100077141 503
1629 3300025914 Ga0207671_10010542 Ga0207671_100105424 503
1630 3300025937 Ga0207669_10008741 Ga0207669_100087414 503
1631 3300025986 Ga0207658_10000850 Ga0207658_1000085025 503
1632 3300031251 Ga0265327_10002081 Ga0265327_1000208115 503
1633 3300046531 Ga0495665_0006931 Ga0495665_0006931_4153_5736 503
1634 3300046674 Ga0495588_0019232 Ga0495588_0019232_383_1966 503
1635 3300047315 Ga0495581_0028406 Ga0495581_0028406_1097_2680 503
1636 3300048903 Ga0496100_0000090 Ga0496100_0000090_41613_43142 503
1637 3300048904 Ga0496101_0000015 Ga0496101_0000015_13835_15364 503
1638 3300048904 Ga0496101_0004267 Ga0496101_0004267_4656_6185 503
1639 3300048906 Ga0496103_0000886 Ga0496103_0000886_6044_7573 503
1640 3300048907 Ga0496104_0011217 Ga0496104_0011217_5830_7359 503
1641 3300048908 Ga0496105_0004783 Ga0496105_0004783_3891_5420 503
1642 3300048909 Ga0496106_0000390 Ga0496106_0000390_12562_14091 503
1643 3300048910 Ga0496107_0000438 Ga0496107_0000438_12943_14472 503
1644 3300048910 Ga0496107_0017536 Ga0496107_0017536_2891_4420 503
1645 3300048911 Ga0496108_0001313 Ga0496108_0001313_15581_17110 503
1646 3300048912 Ga0496109_0000134 Ga0496109_0000134_32495_34024 503
1647 3300048917 Ga0496114_0004306 Ga0496114_0004306_5990_7519 503
1648 3300048918 Ga0496115_0003083 Ga0496115_0003083_8962_10491 503
1649 3300048918 Ga0496115_0006246 Ga0496115_0006246_6859_8388 503
1650 3300048919 Ga0496116_0013915 Ga0496116_0013915_2937_4466 503
1651 3300048920 Ga0496117_0044935 Ga0496117_0044935_288_1817 503
1652 3300048922 Ga0496119_0005422 Ga0496119_0005422_8797_10326 503
1653 3300048924 Ga0496121_0000004 Ga0496121_0000004_548965_550494 503
1654 3300048925 Ga0496122_0000138 Ga0496122_0000138_50948_52477 503
1655 3300048927 Ga0496124_0000012 Ga0496124_0000012_273758_275287 503
1656 3300048928 Ga0496125_0000003 Ga0496125_0000003_639274_640803 503
1657 3300048929 Ga0496126_0000001 Ga0496126_0000001_548965_550494 503
1658 3300050491 nmdc:mga00v17_34200_c1 nmdc:mga00v17_34200_c1_651_2216 503
1659 3300053079 Ga0500610_0025768 Ga0500610_0025768_636_2165 503
1660 iso_pu_bacteria 2643221715 2644636565 503
1661 iso_pu_bacteria 2738543034 2739364534 503
1662 iso_pu_bacteria 2902792274 2902797209 503
1663 iso_pu_bacteria 2902810491 2902814525 503
1664 iso_pu_bacteria 2974315732 2974318750 503
1665 iso_pu_bacteria 2984523437 2984527025 503
1666 3300044683 Ga0466965_0021752 Ga0466965_0021752_807_2330 504
1667 3300044901 Ga0466960_0068193 Ga0466960_0068193_72_1595 504
1668 3300045976 Ga0466967_0174189 Ga0466967_0174189_48_1571 504
1669 3300050516 nmdc:mga0sz30_5141_c1 nmdc:mga0sz30_5141_c1_2945_4471 504
1670 iso_pu_bacteria 2842134933 2842139510 504
1671 3300003792 Ga0055540_1000645 Ga0055540_100064516 505
1672 3300003792 Ga0055540_1005868 Ga0055540_10058682 505
1673 3300006051 Ga0075364_10071602 Ga0075364_100716021 505
1674 3300025303 Ga0209051_1001934 Ga0209051_10019349 505
1675 3300025303 Ga0209051_1008041 Ga0209051_10080412 505
1676 3300044658 Ga0466972_0010726 Ga0466972_0010726_2921_4483 505
1677 3300044694 Ga0466963_0071200 Ga0466963_0071200_51_1595 505
1678 3300044842 Ga0466957_0012124 Ga0466957_0012124_3055_4599 505
1679 3300044901 Ga0466960_0068807 Ga0466960_0068807_55_1617 505
1680 3300047472 Ga0495686_0001901 Ga0495686_0001901_18266_19807 505
1681 3300050491 nmdc:mga00v17_10338_c1 nmdc:mga00v17_10338_c1_101_1639 505
1682 iso_pu_bacteria 2738543011 2739237905 505
1683 iso_pu_bacteria 2751185725 2753039040 505
1684 iso_pu_bacteria 2751185792 2753327401 505
1685 iso_pu_bacteria 2889300758 2889303582 505
1686 iso_pu_bacteria 2939743619 2939747367 505
1687 3300031251 Ga0265327_10000001 Ga0265327_10000001725 506
1688 3300049569 Ga0501032_0048647 Ga0501032_0048647_14_1546 506
1689 3300049571 Ga0501034_0003044 Ga0501034_0003044_9792_11324 506
1690 3300049572 Ga0501036_0092187 Ga0501036_0092187_329_1861 506
1691 3300049573 Ga0501037_0000401 Ga0501037_0000401_29594_31126 506
1692 3300049574 Ga0501038_0023327 Ga0501038_0023327_2717_4249 506
1693 3300049575 Ga0501039_0011640 Ga0501039_0011640_4666_6198 506
1694 3300049579 Ga0501043_0001613 Ga0501043_0001613_15589_17121 506
1695 3300049823 Ga0501044_0015683 Ga0501044_0015683_6121_7680 506
1696 3300049823 Ga0501044_0073156 Ga0501044_0073156_508_2040 506
1697 3300001977 JGI24746J21847_1000708 JGI24746J21847_10007086 507
1698 3300002244 JGI24742J22300_10001558 JGI24742J22300_100015583 507
1699 3300005328 Ga0070676_10017998 Ga0070676_100179982 507
1700 3300005334 Ga0068869_100002932 Ga0068869_1000029328 507
1701 3300005337 Ga0070682_100034083 Ga0070682_1000340832 507
1702 3300005337 Ga0070682_100098095 Ga0070682_1000980951 507
1703 3300005338 Ga0068868_100189404 Ga0068868_1001894041 507
1704 3300005340 Ga0070689_100025015 Ga0070689_1000250152 507
1705 3300005341 Ga0070691_10008186 Ga0070691_100081865 507
1706 3300005347 Ga0070668_100006625 Ga0070668_1000066253 507
1707 3300005354 Ga0070675_100094591 Ga0070675_1000945912 507
1708 3300005356 Ga0070674_100009143 Ga0070674_1000091433 507
1709 3300005366 Ga0070659_100022487 Ga0070659_1000224876 507
1710 3300005366 Ga0070659_100026863 Ga0070659_1000268634 507
1711 3300005367 Ga0070667_100000960 Ga0070667_10000096015 507
1712 3300005367 Ga0070667_100045890 Ga0070667_1000458903 507
1713 3300005434 Ga0070709_10012282 Ga0070709_100122824 507
1714 3300005437 Ga0070710_10001385 Ga0070710_100013857 507
1715 3300005437 Ga0070710_10007135 Ga0070710_100071352 507
1716 3300005438 Ga0070701_10001222 Ga0070701_100012226 507
1717 3300005439 Ga0070711_100002751 Ga0070711_1000027517 507
1718 3300005441 Ga0070700_100002767 Ga0070700_1000027673 507
1719 3300005455 Ga0070663_100021613 Ga0070663_1000216133 507
1720 3300005456 Ga0070678_100002337 Ga0070678_1000023374 507
1721 3300005457 Ga0070662_100004566 Ga0070662_1000045665 507
1722 3300005457 Ga0070662_100010075 Ga0070662_1000100751 507
1723 3300005459 Ga0068867_100005051 Ga0068867_1000050514 507
1724 3300005539 Ga0068853_100061206 Ga0068853_1000612062 507
1725 3300005546 Ga0070696_100006372 Ga0070696_1000063727 507
1726 3300005547 Ga0070693_100012317 Ga0070693_1000123174 507
1727 3300005548 Ga0070665_100022884 Ga0070665_1000228843 507
1728 3300005548 Ga0070665_100037988 Ga0070665_1000379884 507
1729 3300005549 Ga0070704_100011659 Ga0070704_1000116591 507
1730 3300005578 Ga0068854_100003641 Ga0068854_1000036417 507
1731 3300005615 Ga0070702_100005972 Ga0070702_1000059723 507
1732 3300005617 Ga0068859_100004535 Ga0068859_1000045358 507
1733 3300005617 Ga0068859_100012411 Ga0068859_1000124114 507
1734 3300005617 Ga0068859_100048278 Ga0068859_1000482784 507
1735 3300005718 Ga0068866_10001953 Ga0068866_100019533 507
1736 3300005718 Ga0068866_10031366 Ga0068866_100313662 507
1737 3300005719 Ga0068861_100007802 Ga0068861_1000078026 507
1738 3300005841 Ga0068863_100000105 Ga0068863_10000010516 507
1739 3300005842 Ga0068858_100009323 Ga0068858_1000093237 507
1740 3300005842 Ga0068858_100010352 Ga0068858_1000103523 507
1741 3300005843 Ga0068860_100000209 Ga0068860_10000020915 507
1742 3300005843 Ga0068860_100024061 Ga0068860_1000240614 507
1743 3300005844 Ga0068862_100000400 Ga0068862_10000040016 507
1744 3300005844 Ga0068862_100005740 Ga0068862_1000057407 507
1745 3300006038 Ga0075365_10058072 Ga0075365_100580722 507
1746 3300006048 Ga0075363_100003661 Ga0075363_1000036614 507
1747 3300006048 Ga0075363_100008051 Ga0075363_1000080514 507
1748 3300006048 Ga0075363_100032455 Ga0075363_1000324553 507
1749 3300006051 Ga0075364_10000646 Ga0075364_100006466 507
1750 3300006051 Ga0075364_10012091 Ga0075364_100120913 507
1751 3300006173 Ga0070716_100006287 Ga0070716_1000062873 507
1752 3300006175 Ga0070712_100003408 Ga0070712_1000034086 507
1753 3300006175 Ga0070712_100003957 Ga0070712_1000039573 507
1754 3300006881 Ga0068865_100002783 Ga0068865_1000027834 507
1755 3300006931 Ga0097620_100004535 Ga0097620_1000045358 507
1756 3300006931 Ga0097620_100012409 Ga0097620_1000124095 507
1757 3300006931 Ga0097620_100048278 Ga0097620_1000482782 507
1758 3300009098 Ga0105245_10006580 Ga0105245_100065804 507
1759 3300009101 Ga0105247_10000141 Ga0105247_1000014113 507
1760 3300009101 Ga0105247_10003401 Ga0105247_100034017 507
1761 3300009176 Ga0105242_10004138 Ga0105242_100041384 507
1762 3300009176 Ga0105242_10235487 Ga0105242_102354871 507
1763 3300009177 Ga0105248_10001091 Ga0105248_1000109114 507
1764 3300009177 Ga0105248_10029514 Ga0105248_100295141 507
1765 3300009545 Ga0105237_10001867 Ga0105237_1000186710 507
1766 3300009553 Ga0105249_10000031 Ga0105249_10000031216 507
1767 3300010159 Ga0099796_10014198 Ga0099796_100141983 507
1768 3300010375 Ga0105239_10045403 Ga0105239_100454033 507
1769 3300010375 Ga0105239_10074964 Ga0105239_100749643 507
1770 3300013297 Ga0157378_10035746 Ga0157378_100357461 507
1771 3300013306 Ga0163162_10016218 Ga0163162_100162184 507
1772 3300013307 Ga0157372_10012663 Ga0157372_100126636 507
1773 3300013308 Ga0157375_10001251 Ga0157375_100012514 507
1774 3300014326 Ga0157380_10009826 Ga0157380_100098262 507
1775 3300014745 Ga0157377_10005202 Ga0157377_100052023 507
1776 3300014968 Ga0157379_10008367 Ga0157379_100083673 507
1777 3300017792 Ga0163161_10046285 Ga0163161_100462851 507
1778 3300025898 Ga0207692_10017637 Ga0207692_100176371 507
1779 3300025899 Ga0207642_10000179 Ga0207642_1000017920 507
1780 3300025900 Ga0207710_10000164 Ga0207710_1000016413 507
1781 3300025900 Ga0207710_10001390 Ga0207710_100013904 507
1782 3300025900 Ga0207710_10019598 Ga0207710_100195983 507
1783 3300025901 Ga0207688_10001929 Ga0207688_100019297 507
1784 3300025901 Ga0207688_10002258 Ga0207688_100022587 507
1785 3300025903 Ga0207680_10010715 Ga0207680_100107154 507
1786 3300025915 Ga0207693_10005747 Ga0207693_100057477 507
1787 3300025916 Ga0207663_10002588 Ga0207663_100025888 507
1788 3300025923 Ga0207681_10000456 Ga0207681_1000045611 507
1789 3300025926 Ga0207659_10064067 Ga0207659_100640672 507
1790 3300025927 Ga0207687_10005294 Ga0207687_100052944 507
1791 3300025931 Ga0207644_10010594 Ga0207644_100105944 507
1792 3300025932 Ga0207690_10013667 Ga0207690_100136674 507
1793 3300025933 Ga0207706_10019235 Ga0207706_100192354 507
1794 3300025935 Ga0207709_10002137 Ga0207709_100021375 507
1795 3300025936 Ga0207670_10013218 Ga0207670_100132182 507
1796 3300025937 Ga0207669_10001598 Ga0207669_100015983 507
1797 3300025938 Ga0207704_10002309 Ga0207704_100023093 507
1798 3300025939 Ga0207665_10004580 Ga0207665_100045804 507
1799 3300025939 Ga0207665_10015744 Ga0207665_100157442 507
1800 3300025940 Ga0207691_10017365 Ga0207691_100173657 507
1801 3300025941 Ga0207711_10000196 Ga0207711_1000019654 507
1802 3300025941 Ga0207711_10041264 Ga0207711_100412641 507
1803 3300025942 Ga0207689_10002479 Ga0207689_100024797 507
1804 3300025961 Ga0207712_10000029 Ga0207712_10000029216 507
1805 3300025961 Ga0207712_10014228 Ga0207712_100142285 507
1806 3300025972 Ga0207668_10009927 Ga0207668_100099274 507
1807 3300025981 Ga0207640_10001076 Ga0207640_100010764 507
1808 3300025986 Ga0207658_10000517 Ga0207658_1000051725 507
1809 3300026023 Ga0207677_10006454 Ga0207677_100064544 507
1810 3300026035 Ga0207703_10007260 Ga0207703_100072607 507
1811 3300026035 Ga0207703_10023378 Ga0207703_100233782 507
1812 3300026067 Ga0207678_10032351 Ga0207678_100323514 507
1813 3300026075 Ga0207708_10006787 Ga0207708_100067875 507
1814 3300026075 Ga0207708_10081222 Ga0207708_100812221 507
1815 3300026089 Ga0207648_10011289 Ga0207648_100112894 507
1816 3300026118 Ga0207675_100008196 Ga0207675_1000081964 507
1817 3300026118 Ga0207675_100008622 Ga0207675_1000086227 507
1818 3300026121 Ga0207683_10006112 Ga0207683_100061127 507
1819 3300028379 Ga0268266_10006438 Ga0268266_100064383 507
1820 3300028379 Ga0268266_10122086 Ga0268266_101220861 507
1821 3300028380 Ga0268265_10000389 Ga0268265_1000038915 507
1822 3300028380 Ga0268265_10005881 Ga0268265_100058814 507
1823 3300028381 Ga0268264_10000017 Ga0268264_10000017160 507
1824 3300028381 Ga0268264_10004905 Ga0268264_100049054 507
1825 3300032005 Ga0307411_10025869 Ga0307411_100258694 507
1826 3300032005 Ga0307411_10118824 Ga0307411_101188242 507
1827 3300035691 Ga0373931_0007778 Ga0373931_0007778_1488_3011 507
1828 3300035691 Ga0373931_0011048 Ga0373931_0011048_960_2492 507
1829 3300039450 Ga0436363_1277403 Ga0436363_1277403_155_1678 507
1830 3300041410 Ga0439461_0000228 Ga0439461_0000228_4918_6468 507
1831 3300041413 Ga0439465_0007793 Ga0439465_0007793_732_2255 507
1832 3300041413 Ga0439465_0012021 Ga0439465_0012021_701_2251 507
1833 3300042004 Ga0439445_0000209 Ga0439445_0000209_1684_3234 507
1834 3300045049 Ga0466959_0010256 Ga0466959_0010256_1934_3529 507
1835 3300045049 Ga0466959_0049923 Ga0466959_0049923_736_2259 507
1836 3300046455 Ga0495603_0062597 Ga0495603_0062597_428_1951 507
1837 3300046476 Ga0495662_0030356 Ga0495662_0030356_352_1875 507
1838 3300046507 Ga0495606_0039733 Ga0495606_0039733_1405_2955 507
1839 3300047469 Ga0495673_0000524 Ga0495673_0000524_8653_10203 507
1840 3300047472 Ga0495686_0073202 Ga0495686_0073202_24_1574 507
1841 3300048903 Ga0496100_0004442 Ga0496100_0004442_4256_5806 507
1842 3300048903 Ga0496100_0006094 Ga0496100_0006094_225_1772 507
1843 3300048903 Ga0496100_0046280 Ga0496100_0046280_668_2200 507
1844 3300048904 Ga0496101_0000031 Ga0496101_0000031_60807_62357 507
1845 3300048904 Ga0496101_0000462 Ga0496101_0000462_5229_6761 507
1846 3300048904 Ga0496101_0018263 Ga0496101_0018263_2721_4244 507
1847 3300048904 Ga0496101_0049579 Ga0496101_0049579_1389_2936 507
1848 3300048905 Ga0496102_0000065 Ga0496102_0000065_107368_108918 507
1849 3300048905 Ga0496102_0000387 Ga0496102_0000387_38731_40278 507
1850 3300048905 Ga0496102_0004258 Ga0496102_0004258_6812_8344 507
1851 3300048906 Ga0496103_0000048 Ga0496103_0000048_106909_108459 507
1852 3300048906 Ga0496103_0000292 Ga0496103_0000292_33057_34604 507
1853 3300048906 Ga0496103_0011144 Ga0496103_0011144_3707_5239 507
1854 3300048909 Ga0496106_0004705 Ga0496106_0004705_5678_7210 507
1855 3300048910 Ga0496107_0000521 Ga0496107_0000521_14770_16302 507
1856 3300048910 Ga0496107_0020054 Ga0496107_0020054_1393_2940 507
1857 3300048911 Ga0496108_0018250 Ga0496108_0018250_92_1615 507
1858 3300048913 Ga0496110_0012823 Ga0496110_0012823_734_2257 507
1859 3300048916 Ga0496113_0021468 Ga0496113_0021468_336_1871 507
1860 3300048917 Ga0496114_0007157 Ga0496114_0007157_5186_6718 507
1861 3300048918 Ga0496115_0001385 Ga0496115_0001385_13656_15188 507
1862 3300048919 Ga0496116_0000125 Ga0496116_0000125_52453_54003 507
1863 3300048919 Ga0496116_0036927 Ga0496116_0036927_22_1569 507
1864 3300048920 Ga0496117_0000111 Ga0496117_0000111_52453_54003 507
1865 3300048920 Ga0496117_0001572 Ga0496117_0001572_19229_20776 507
1866 3300048921 Ga0496118_0000083 Ga0496118_0000083_52453_54003 507
1867 3300048921 Ga0496118_0001353 Ga0496118_0001353_32938_34485 507
1868 3300048922 Ga0496119_0050948 Ga0496119_0050948_899_2449 507
1869 3300048923 Ga0496120_0013212 Ga0496120_0013212_894_2444 507
1870 3300048924 Ga0496121_0000728 Ga0496121_0000728_37968_39518 507
1871 3300048924 Ga0496121_0019873 Ga0496121_0019873_3627_5174 507
1872 3300048926 Ga0496123_0007586 Ga0496123_0007586_4871_6406 507
1873 3300048927 Ga0496124_0029865 Ga0496124_0029865_3025_4572 507
1874 3300048929 Ga0496126_0000220 Ga0496126_0000220_64843_66393 507
1875 3300048929 Ga0496126_0010644 Ga0496126_0010644_3446_4981 507
1876 3300049589 Ga0501073_0042885 Ga0501073_0042885_449_1981 507
1877 3300050490 nmdc:mga03n38_1489_c1 nmdc:mga03n38_1489_c1_1343_2944 507
1878 3300050490 nmdc:mga03n38_16294_c1 nmdc:mga03n38_16294_c1_78_1616 507
1879 3300050490 nmdc:mga03n38_5023_c1 nmdc:mga03n38_5023_c1_641_2173 507
1880 3300050491 nmdc:mga00v17_15246_c1 nmdc:mga00v17_15246_c1_1204_2736 507
1881 3300050491 nmdc:mga00v17_4239_c1 nmdc:mga00v17_4239_c1_3926_5527 507
1882 3300050492 nmdc:mga0yw44_47032_c1 nmdc:mga0yw44_47032_c1_72_1610 507
1883 3300050496 nmdc:mga07m45_51136_c1 nmdc:mga07m45_51136_c1_157_1689 507
1884 3300053087 Ga0500643_003235 Ga0500643_003235_4328_5878 507
1885 iso_pu_bacteria 2842888712 2842890046 507

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13537

GATase_7

Glutamine amidotransferase domain

153

293

0.83

PF13522

GATase_6

Glutamine amidotransferase domain

137

287

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
6lbp-assembly1.cif.gz_A structure of the glutamine phosphoribosylpyrophosphate amidotransferase from arabidopsis thaliana 0.9401 14 468
1gph-assembly1.cif.gz_1 structure of the allosteric regulatory enzyme of purine biosynthesis 0.932 14 471
1ao0-assembly1.cif.gz_C glutamine phosphoribosylpyrophosphate (prpp) amidotransferase from b. subtilis complexed with adp and gmp 0.9284 14 472
1ao0-assembly1.cif.gz_C glutamine phosphoribosylpyrophosphate (prpp) amidotransferase from b. subtilis complexed with adp and gmp 0.9126 14 472
6lbp-assembly1.cif.gz_A structure of the glutamine phosphoribosylpyrophosphate amidotransferase from arabidopsis thaliana 0.9083 14 468
ID Description Score Start End Superfamily
af_P87171_221_328_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9731 355 392 3.40.50.2020
1ao0B02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9606 280 447 3.40.50.2020
1gph401 Alpha Beta;4-Layer Sandwich;Glutamine Phosphoribosylpyrophosphate, subunit 1, domain 1;Aminohydrolase, N-terminal nucleophile (Ntn) domain 0.9401 14 277 3.60.20.10
af_Q22134_287_448_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9398 281 445 3.40.50.2020
1ao0B02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9393 280 447 3.40.50.2020
ID Description Score Start End GO Terms
AF-A0A7X8ZZX5-F1-model_v4 Amidophosphoribosyltransferase (EC 2.4.2.14) 0.9749 213 471 GO:0004044
AF-A0A368T3L3-F1-model_v4 Amidophosphoribosyltransferase (ATase) (EC 2.4.2.14) (Glutamine phosphoribosylpyrophosphate amidotransferase) (GPATase) 0.9715 5 481 GO:0000287
GO:0004044
GO:0006189
GO:0009113
GO:0051539
AF-X8E076-F1-model_v4 Amidophosphoribosyltransferase (ATase) (EC 2.4.2.14) (Glutamine phosphoribosylpyrophosphate amidotransferase) (GPATase) 0.9706 1 386 GO:0000287
GO:0004044
GO:0006189
GO:0009113
AF-A0A538FGE0-F1-model_v4 Amidophosphoribosyltransferase (EC 2.4.2.14) 0.9705 14 459 GO:0004044
GO:0006189
GO:0009113
GO:0046872
AF-A0A6L6E638-F1-model_v4 Amidophosphoribosyltransferase (EC 2.4.2.14) 0.9676 7 415 GO:0004044
GO:0006189
GO:0009113
GO:0046872

Feature Viewer

pLDDT pTM Quality
86.39 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map