F495907

General Info

Members Datasets Scaffolds Average Seq Length
1859 520 1820 229

Family's Representative Sequence

Representative Sequence 3300053134|Ga0500658_0044679|Ga0500658_0044679_329_1015
Length 222
Sequence MPKLVLIRHGQSAWNLENRFTGWWDVDLTELGVKEAWAAGELMKEKGLDFDLTFTSFQSRAIKTLNLSLEAMGRLWLPTEKSWKLNERHYGGLTGLNKAETAALHGDEQVKIWRRSFDIPGSPWDLAKDLRYHGVPIPQTESLKDTIARVLPYWEERIAPEIRAGKRVLISAHGNSLRALVKHLSGIPDEEIVNLEIPTGQPIVYELDEGLVATDRYYLSER

Samples

Sample ID Description Type Environment
1 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
2 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
3 2599185359 Sphingomonas sp. NFR04 Isolate Rhizoplane
4 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
5 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
6 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
7 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
8 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
9 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
10 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
11 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
12 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
13 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
14 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
15 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
16 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
17 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
18 2818991466 Sphingomonas trueperi 1152a Isolate Unclassified
19 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
20 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
21 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
22 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
23 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
24 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
25 2885427238 Sphingomonas mesophila SYSUP0001 Isolate Stem Tuber
26 2885429604 Sphingomonas sp. WZY 27 Isolate Rhizosphere
27 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
28 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
29 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
30 2928526807 Sphingomonas trueperi 1770 Isolate Rhizosphere
31 2928968154 Sphingomonas trueperi 1075 Isolate Unclassified
32 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
33 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
34 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
35 2990265787 Sphingomonas sp. SORGH_AS802 Isolate Aerial Root
36 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
37 2993693658 Sphingomonas sp. SORGH_AS438 Isolate Aerial Root
38 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere
39 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
40 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
41 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
42 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
43 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
44 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
45 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
46 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
47 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
48 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
49 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
50 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
51 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
52 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
53 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
54 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
55 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
56 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
57 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
58 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
59 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
60 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
61 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
62 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
63 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
64 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
65 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
66 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
67 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
68 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
69 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
70 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
71 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
72 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
73 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
74 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
75 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
76 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
77 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
78 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
79 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
80 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
81 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
82 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
83 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
84 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
85 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
86 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
87 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
88 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
89 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
90 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
91 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
92 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
93 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
94 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
95 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
96 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
97 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
98 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
99 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
100 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
101 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
102 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
103 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
104 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
105 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
106 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
107 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
108 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
109 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
110 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
111 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
112 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
113 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
114 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
115 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
116 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
117 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
118 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
119 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
120 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
121 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
122 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
123 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
124 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
125 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
126 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
127 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
128 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
129 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
130 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
131 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
132 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
133 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
134 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
135 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
136 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
137 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
138 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
139 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
140 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
141 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
142 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
143 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
144 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
145 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
146 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
147 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
148 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
149 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
150 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
151 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
152 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
153 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
154 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
155 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
156 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
157 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
158 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
159 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
160 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
161 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
162 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
163 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
164 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
165 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
166 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
167 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
168 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
169 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
170 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
171 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
172 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
173 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
174 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
175 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
176 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
177 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
178 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
179 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
180 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
181 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
182 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
183 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
184 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
185 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
186 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
187 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
188 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
189 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
190 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
191 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
192 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
193 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
194 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
195 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
196 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
197 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
198 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
199 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
200 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
201 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
202 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
203 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
204 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
205 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
206 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
207 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
208 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
209 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
210 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
211 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
212 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
244 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
245 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
247 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
248 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
250 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
260 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
261 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
264 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
265 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
266 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
268 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
269 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
270 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
271 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
272 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
273 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
274 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
276 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
277 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
278 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
279 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
280 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
281 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
282 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
283 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
284 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
285 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
286 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
287 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
288 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
289 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
290 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
291 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
292 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
293 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
294 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
295 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
296 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
297 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
298 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
299 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
300 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
301 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
302 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
303 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
304 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
305 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
306 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
307 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
308 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
309 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
310 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
311 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
312 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
313 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
314 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
315 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
316 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
317 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
318 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
319 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
320 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
321 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
322 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
323 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
324 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
325 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
326 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
327 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
328 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
329 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
330 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
331 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
332 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
333 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
334 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
335 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
336 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
337 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
338 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
339 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
340 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
341 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
342 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
343 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
344 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
345 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
346 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
347 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
348 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
349 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
350 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
351 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
352 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
353 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
354 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
355 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
356 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
357 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
358 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
359 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
360 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
361 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
362 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
363 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
364 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
365 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
366 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
367 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
368 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
369 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
370 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
371 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
372 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
373 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
374 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
375 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
376 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
377 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
378 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
379 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
380 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
381 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
382 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
383 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
384 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
385 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
386 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
387 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
388 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
389 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
390 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
391 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
392 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
393 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
394 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
395 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
396 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
397 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
398 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
399 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
400 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
401 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
402 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
403 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
404 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
405 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
406 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
407 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
408 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
409 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
410 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
411 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
412 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
413 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
414 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
415 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
416 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
417 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
418 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
419 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
420 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
421 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
422 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
423 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
424 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
425 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
426 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
427 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
428 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
429 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
430 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
431 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
432 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
433 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
434 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
435 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
436 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
437 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
438 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
439 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
440 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
441 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
442 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
443 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
444 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
445 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
446 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
447 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
448 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
449 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
450 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
451 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
452 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
453 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
454 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
455 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
456 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
457 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
458 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
459 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
460 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
461 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
462 3300049774 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_A_5_drought Metagenome Rhizosphere
463 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
464 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
465 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
466 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
467 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
468 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
469 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
470 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
471 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
472 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
473 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
474 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
475 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
476 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
477 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
478 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
479 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
480 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
481 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
482 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
483 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
484 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
485 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
486 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
487 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
488 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
489 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
490 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
491 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
492 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
493 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
494 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
495 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
496 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
497 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
498 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
499 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
500 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
501 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
502 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
503 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
504 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
505 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
506 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
507 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
508 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
509 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
510 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
511 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
512 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
513 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
514 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
515 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
516 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
517 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
518 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
519 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
520 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.79
Metatranscriptomes 0.11
Isolates 2.1

Biome Distribution

Category Percentage (%)
Aerial Root 0.27
Bulb 0
Endosphere 8.71
Nodule 0.05
Rhizoplane 2.04
Rhizosphere 83.49
Stem 0
Stem Tuber 0.05
Unclassified 5.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARcpr5oldR_c000545 3300000041 Bacteria 4683
2 JGI24736J21556_1000055 3300001904 Bacteria 18334
3 JGI24736J21556_1002006 3300001904 Bacteria 3619
4 JGI24736J21556_1007363 3300001904 Bacteria 1850
5 JGI24741J21665_1001039 3300001915 Bacteria 8346
6 JGI24741J21665_1002806 3300001915 Bacteria 4390
7 JGI24746J21847_1001632 3300001977 Bacteria 3588
8 JGI24740J21852_10002783 3300001979 Bacteria 7827
9 JGI24740J21852_10005827 3300001979 Bacteria 5170
10 JGI24740J21852_10021430 3300001979 Bacteria 2241
11 JGI24739J22299_10003678 3300001989 Bacteria 5848
12 JGI24739J22299_10015661 3300001989 Bacteria 2755
13 JGI24739J22299_10015931 3300001989 Bacteria 2727
14 JGI24737J22298_10001549 3300001990 Bacteria 8171
15 JGI24737J22298_10005900 3300001990 Bacteria 4216
16 JGI24737J22298_10012353 3300001990 Bacteria 2785
17 JGI24737J22298_10018048 3300001990 Bacteria 2268
18 JGI24737J22298_10022246 3300001990 Bacteria 2015
19 JGI24737J22298_10074862 3300001990 Bacteria 1010
20 JGI24735J21928_10000941 3300002067 Bacteria 10410
21 JGI24735J21928_10001307 3300002067 Bacteria 8809
22 JGI24735J21928_10002704 3300002067 Bacteria 6125
23 JGI24735J21928_10006631 3300002067 Bacteria 3802
24 JGI24735J21928_10013163 3300002067 Bacteria 2605
25 JGI24735J21928_10017829 3300002067 Bacteria 2193
26 JGI24735J21928_10029465 3300002067 Bacteria 1634
27 JGI24738J21930_10000616 3300002075 Bacteria 10219
28 JGI24738J21930_10000884 3300002075 Bacteria 8576
29 JGI24749J21850_1000042 3300002076 Bacteria 24212
30 JGI24749J21850_1000355 3300002076 Bacteria 6804
31 JGI24744J21845_10012406 3300002077 Bacteria 1730
32 JGI24034J26672_10000011 3300002239 Bacteria 148169
33 JGI24742J22300_10020434 3300002244 Bacteria 1128
34 JGI24751J29686_10000127 3300002459 Bacteria 38458
35 JGI24751J29686_10000252 3300002459 Bacteria 21168
36 JGI24751J29686_10000799 3300002459 Bacteria 7365
37 JGI25150J39212_1003367 3300002774 Bacteria 3753
38 JGI25151J46595_10072970 3300003187 Bacteria 1030
39 JGI25165J46597_1000145 3300003214 Bacteria 116948
40 JGI25153J46596_10000183 3300003215 Bacteria 61802
41 JGI25153J46596_10020315 3300003215 Bacteria 2514
42 Ga0055542_1000226 3300003762 Bacteria 67157
43 Ga0055529_1000243 3300003763 Bacteria 67164
44 Ga0055526_1002892 3300003771 Bacteria 11315
45 Ga0055537_1002641 3300003773 Bacteria 5861
46 Ga0055524_1000601 3300003775 Bacteria 25841
47 Ga0055536_1008296 3300003781 Bacteria 4488
48 Ga0055536_1009289 3300003781 Bacteria 4087
49 Ga0055534_1004204 3300003784 Bacteria 4247
50 Ga0055528_1045401 3300003790 Bacteria 936
51 Ga0055530_10000064 3300003791 Bacteria 94475
52 Ga0055530_10001803 3300003791 Bacteria 14850
53 Ga0055530_10009805 3300003791 Bacteria 3621
54 Ga0055530_10011252 3300003791 Bacteria 3229
55 Ga0055530_10051278 3300003791 Bacteria 958
56 Ga0055540_1003004 3300003792 Bacteria 8437
57 Ga0055531_10000073 3300003794 Bacteria 109510
58 Ga0055531_10002334 3300003794 Bacteria 12796
59 Ga0065165_1018160 3300005262 Bacteria 2559
60 Ga0065165_1021311 3300005262 Bacteria 2255
61 Ga0065165_1033240 3300005262 Bacteria 1607
62 Ga0065714_10021788 3300005288 Bacteria 1298
63 Ga0065704_10002228 3300005289 Bacteria 12287
64 Ga0065704_10006136 3300005289 Bacteria 2919
65 Ga0065704_10100082 3300005289 Bacteria 2287
66 Ga0065712_10086165 3300005290 Bacteria 2651
67 Ga0065715_10000723 3300005293 Bacteria 10453
68 Ga0065715_10140791 3300005293 Bacteria 1857
69 Ga0065707_10022673 3300005295 Bacteria 2030
70 Ga0065707_10081947 3300005295 Bacteria 28071
71 Ga0065707_10084204 3300005295 Bacteria 7528
72 Ga0065707_10092852 3300005295 Bacteria 3708
73 Ga0065707_10149683 3300005295 Bacteria 1673
74 Ga0065707_10155141 3300005295 Bacteria 1616
75 Ga0070658_10000002 3300005327 Bacteria 637290
76 Ga0070658_10001023 3300005327 Bacteria 23933
77 Ga0070658_10001239 3300005327 Bacteria 21882
78 Ga0070658_10001587 3300005327 Bacteria 19216
79 Ga0070658_10005674 3300005327 Bacteria 10120
80 Ga0070658_10011225 3300005327 Bacteria 7179
81 Ga0070658_10041995 3300005327 Bacteria 3690
82 Ga0070658_10059638 3300005327 Bacteria 3107
83 Ga0070658_10168318 3300005327 Bacteria 1840
84 Ga0070658_10357620 3300005327 Bacteria 1250
85 Ga0070658_10389547 3300005327 Bacteria 1196
86 Ga0070658_10562760 3300005327 Bacteria 987
87 Ga0070658_10654532 3300005327 Bacteria 911
88 Ga0070676_10001164 3300005328 Bacteria 13150
89 Ga0070676_10010507 3300005328 Bacteria 5022
90 Ga0070676_10043737 3300005328 Bacteria 2604
91 Ga0070683_100012975 3300005329 Bacteria 7252
92 Ga0070683_100013276 3300005329 Bacteria 7179
93 Ga0070683_100020320 3300005329 Bacteria 5910
94 Ga0070690_100000003 3300005330 Bacteria 144748
95 Ga0070690_100010371 3300005330 Bacteria 5421
96 Ga0070670_100000069 3300005331 Bacteria 104077
97 Ga0070670_100000632 3300005331 Bacteria 27410
98 Ga0070670_100001870 3300005331 Bacteria 17152
99 Ga0070670_100011438 3300005331 Bacteria 7590
100 Ga0070670_100025047 3300005331 Bacteria 5133
101 Ga0070670_100046365 3300005331 Bacteria 3737
102 Ga0070670_100113920 3300005331 Bacteria 2331
103 Ga0070670_100140771 3300005331 Bacteria 2086
104 Ga0070670_100537654 3300005331 Bacteria 1042
105 Ga0070677_10000298 3300005333 Bacteria 17460
106 Ga0070677_10209202 3300005333 Bacteria 946
107 Ga0068869_100000516 3300005334 Bacteria 21591
108 Ga0068869_100155579 3300005334 Bacteria 1776
109 Ga0070666_10000171 3300005335 Bacteria 44565
110 Ga0070666_10000176 3300005335 Bacteria 43811
111 Ga0070666_10080521 3300005335 Bacteria 2226
112 Ga0070680_100002613 3300005336 Bacteria 13336
113 Ga0070680_100004126 3300005336 Bacteria 10883
114 Ga0070680_100006436 3300005336 Bacteria 8923
115 Ga0070680_100045992 3300005336 Bacteria 3550
116 Ga0070680_100051273 3300005336 Bacteria 3366
117 Ga0070680_100108499 3300005336 Bacteria 2309
118 Ga0070680_100623775 3300005336 Bacteria 926
119 Ga0068868_100000051 3300005338 Bacteria 66139
120 Ga0068868_100004352 3300005338 Bacteria 9931
121 Ga0070660_100000535 3300005339 Bacteria 25358
122 Ga0070660_100001009 3300005339 Bacteria 18907
123 Ga0070660_100001090 3300005339 Bacteria 18252
124 Ga0070660_100008568 3300005339 Bacteria 7161
125 Ga0070660_100012573 3300005339 Bacteria 6045
126 Ga0070660_100047956 3300005339 Bacteria 3280
127 Ga0070660_100062453 3300005339 Bacteria 2894
128 Ga0070660_100091528 3300005339 Bacteria 2399
129 Ga0070660_100100434 3300005339 Bacteria 2292
130 Ga0070660_100137844 3300005339 Bacteria 1956
131 Ga0070660_100356156 3300005339 Bacteria 1206
132 Ga0070660_100388522 3300005339 Bacteria 1152
133 Ga0070660_100404246 3300005339 Bacteria 1129
134 Ga0070660_100417308 3300005339 Bacteria 1111
135 Ga0070660_100461292 3300005339 Bacteria 1055
136 Ga0070689_100001889 3300005340 Bacteria 13528
137 Ga0070691_10001812 3300005341 Bacteria 9312
138 Ga0070661_100002722 3300005344 Bacteria 12121
139 Ga0070661_100008171 3300005344 Bacteria 7220
140 Ga0070661_100028218 3300005344 Bacteria 4047
141 Ga0070661_100030971 3300005344 Bacteria 3867
142 Ga0070661_100047855 3300005344 Bacteria 3129
143 Ga0070661_100063449 3300005344 Bacteria 2713
144 Ga0070661_100154403 3300005344 Bacteria 1736
145 Ga0070692_10012663 3300005345 Bacteria 3913
146 Ga0070692_10032690 3300005345 Bacteria 2617
147 Ga0070692_10032895 3300005345 Bacteria 2611
148 Ga0070692_10080755 3300005345 Bacteria 1751
149 Ga0070668_100000001 3300005347 Bacteria 275905
150 Ga0070668_100000172 3300005347 Bacteria 41511
151 Ga0070668_100002241 3300005347 Bacteria 14228
152 Ga0070668_100010271 3300005347 Bacteria 6949
153 Ga0070668_100014364 3300005347 Bacteria 5917
154 Ga0070668_100017822 3300005347 Bacteria 5326
155 Ga0070668_100036952 3300005347 Bacteria 3728
156 Ga0070668_100069881 3300005347 Bacteria 2733
157 Ga0070668_100106024 3300005347 Bacteria 2233
158 Ga0070668_100432204 3300005347 Bacteria 1129
159 Ga0070669_100000001 3300005353 Bacteria 537589
160 Ga0070669_100000014 3300005353 Bacteria 206875
161 Ga0070669_100000105 3300005353 Bacteria 80655
162 Ga0070669_100012372 3300005353 Bacteria 6053
163 Ga0070669_100043276 3300005353 Bacteria 3279
164 Ga0070669_100059287 3300005353 Bacteria 2810
165 Ga0070669_100075906 3300005353 Bacteria 2494
166 Ga0070669_100135383 3300005353 Bacteria 1895
167 Ga0070669_100203592 3300005353 Bacteria 1558
168 Ga0070669_100245917 3300005353 Bacteria 1423
169 Ga0070669_100256532 3300005353 Bacteria 1394
170 Ga0070669_100651298 3300005353 Unclassified 886
171 Ga0070669_100960185 3300005353 Bacteria 732
172 Ga0070675_100001645 3300005354 Bacteria 16513
173 Ga0070675_100005264 3300005354 Bacteria 9880
174 Ga0070675_100021872 3300005354 Bacteria 5109
175 Ga0070675_100209018 3300005354 Bacteria 1696
176 Ga0070671_100000007 3300005355 Bacteria 250397
177 Ga0070671_100000114 3300005355 Bacteria 51983
178 Ga0070671_100000167 3300005355 Bacteria 43269
179 Ga0070671_100001248 3300005355 Bacteria 19067
180 Ga0070671_100005733 3300005355 Bacteria 9888
181 Ga0070671_100006441 3300005355 Bacteria 9383
182 Ga0070671_100011003 3300005355 Bacteria 7260
183 Ga0070671_100031798 3300005355 Bacteria 4362
184 Ga0070671_100106101 3300005355 Bacteria 2358
185 Ga0070671_100107819 3300005355 Bacteria 2339
186 Ga0070671_100108009 3300005355 Bacteria 2337
187 Ga0070671_100120407 3300005355 Bacteria 2208
188 Ga0070671_100256710 3300005355 Bacteria 1485
189 Ga0070674_100000834 3300005356 Bacteria 15941
190 Ga0070674_100007215 3300005356 Bacteria 6543
191 Ga0070674_100349969 3300005356 Bacteria 1193
192 Ga0070673_100000003 3300005364 Bacteria 216759
193 Ga0070673_100004726 3300005364 Bacteria 8649
194 Ga0070673_100093549 3300005364 Bacteria 2462
195 Ga0070688_100000787 3300005365 Bacteria 15717
196 Ga0070659_100003690 3300005366 Bacteria 10918
197 Ga0070659_100007611 3300005366 Bacteria 7873
198 Ga0070659_100019472 3300005366 Bacteria 5144
199 Ga0070659_100028192 3300005366 Bacteria 4334
200 Ga0070659_100035798 3300005366 Bacteria 3867
201 Ga0070659_100046264 3300005366 Bacteria 3410
202 Ga0070659_100059738 3300005366 Bacteria 3010
203 Ga0070659_100068177 3300005366 Bacteria 2822
204 Ga0070659_100087676 3300005366 Bacteria 2492
205 Ga0070659_100110256 3300005366 Bacteria 2221
206 Ga0070659_100223467 3300005366 Bacteria 1555
207 Ga0070659_100290385 3300005366 Bacteria 1362
208 Ga0070659_100337263 3300005366 Bacteria 1262
209 Ga0070659_100396533 3300005366 Bacteria 1164
210 Ga0070659_100546966 3300005366 Bacteria 991
211 Ga0070659_100605436 3300005366 Bacteria 942
212 Ga0070667_100000006 3300005367 Bacteria 336732
213 Ga0070667_100000199 3300005367 Bacteria 71115
214 Ga0070667_100000205 3300005367 Bacteria 69657
215 Ga0070667_100000269 3300005367 Bacteria 59045
216 Ga0070667_100002790 3300005367 Bacteria 15088
217 Ga0070667_100003346 3300005367 Bacteria 13696
218 Ga0070667_100004435 3300005367 Bacteria 11838
219 Ga0070667_100004844 3300005367 Bacteria 11278
220 Ga0070667_100006901 3300005367 Bacteria 9433
221 Ga0070667_100018496 3300005367 Bacteria 5778
222 Ga0070667_100033284 3300005367 Bacteria 4307
223 Ga0070667_100041466 3300005367 Bacteria 3862
224 Ga0070667_100121644 3300005367 Bacteria 2270
225 Ga0070667_100414642 3300005367 Bacteria 1227
226 Ga0070667_100553942 3300005367 Bacteria 1057
227 Ga0070667_100754841 3300005367 Bacteria 902
228 Ga0070714_100018994 3300005435 Bacteria 5593
229 Ga0070714_100148127 3300005435 Bacteria 2113
230 Ga0070714_100324376 3300005435 Bacteria 1441
231 Ga0070713_100002001 3300005436 Bacteria 13155
232 Ga0070713_100046027 3300005436 Bacteria 3578
233 Ga0070701_10090529 3300005438 Bacteria 1675
234 Ga0070705_100200354 3300005440 Bacteria 1368
235 Ga0070700_100087029 3300005441 Bacteria 2030
236 Ga0070663_100008984 3300005455 Bacteria 6170
237 Ga0070663_100016432 3300005455 Bacteria 4807
238 Ga0070663_100018085 3300005455 Bacteria 4613
239 Ga0070663_100039410 3300005455 Bacteria 3300
240 Ga0070663_100039531 3300005455 Bacteria 3296
241 Ga0070663_100073266 3300005455 Bacteria 2498
242 Ga0070663_100146079 3300005455 Bacteria 1810
243 Ga0070663_100255043 3300005455 Bacteria 1389
244 Ga0070663_100270350 3300005455 Bacteria 1351
245 Ga0070678_100071898 3300005456 Bacteria 2591
246 Ga0070678_100077133 3300005456 Bacteria 2513
247 Ga0070678_100100682 3300005456 Bacteria 2239
248 Ga0070678_100124947 3300005456 Bacteria 2035
249 Ga0070662_100000256 3300005457 Bacteria 31436
250 Ga0070662_100002166 3300005457 Bacteria 12033
251 Ga0070662_100004549 3300005457 Bacteria 8783
252 Ga0070662_100007026 3300005457 Bacteria 7282
253 Ga0070662_100029156 3300005457 Bacteria 3850
254 Ga0070662_100053442 3300005457 Bacteria 2924
255 Ga0070662_100106383 3300005457 Bacteria 2131
256 Ga0070662_100118648 3300005457 Bacteria 2025
257 Ga0070662_100244983 3300005457 Bacteria 1439
258 Ga0070662_100294902 3300005457 Bacteria 1316
259 Ga0070681_10189927 3300005458 Bacteria 1974
260 Ga0070681_10864041 3300005458 Bacteria 822
261 Ga0068867_100000001 3300005459 Bacteria 427563
262 Ga0068867_100008403 3300005459 Bacteria 7281
263 Ga0068867_100076754 3300005459 Bacteria 2509
264 Ga0070685_10000034 3300005466 Bacteria 81799
265 Ga0070685_10008389 3300005466 Bacteria 5304
266 Ga0070685_10009198 3300005466 Bacteria 5099
267 Ga0070679_100008946 3300005530 Bacteria 9449
268 Ga0070679_100021647 3300005530 Bacteria 6278
269 Ga0070679_100078668 3300005530 Bacteria 3286
270 Ga0070679_100348636 3300005530 Bacteria 1428
271 Ga0070679_100443054 3300005530 Bacteria 1244
272 Ga0070679_100475045 3300005530 Bacteria 1194
273 Ga0070679_100524899 3300005530 Bacteria 1128
274 Ga0070679_100554973 3300005530 Bacteria 1092
275 Ga0070684_100031151 3300005535 Bacteria 4538
276 Ga0070684_100210818 3300005535 Bacteria 1771
277 Ga0068853_100001824 3300005539 Bacteria 15667
278 Ga0068853_100088133 3300005539 Bacteria 2724
279 Ga0068853_100209240 3300005539 Bacteria 1777
280 Ga0068853_100331927 3300005539 Bacteria 1411
281 Ga0070672_100001894 3300005543 Bacteria 13105
282 Ga0070672_100005990 3300005543 Bacteria 8114
283 Ga0070672_100044638 3300005543 Bacteria 3425
284 Ga0070672_100098283 3300005543 Bacteria 2371
285 Ga0070672_100212193 3300005543 Bacteria 1622
286 Ga0070686_100000023 3300005544 Bacteria 130174
287 Ga0070696_100004335 3300005546 Bacteria 9460
288 Ga0070696_100242508 3300005546 Bacteria 1360
289 Ga0070693_100061864 3300005547 Bacteria 2178
290 Ga0070693_100189670 3300005547 Bacteria 1329
291 Ga0070665_100000019 3300005548 Bacteria 413972
292 Ga0070665_100000101 3300005548 Bacteria 159353
293 Ga0070665_100000564 3300005548 Bacteria 51696
294 Ga0070665_100015602 3300005548 Bacteria 7631
295 Ga0070665_100055102 3300005548 Bacteria 3988
296 Ga0070665_100059573 3300005548 Bacteria 3827
297 Ga0070704_100771805 3300005549 Bacteria 857
298 Ga0068855_100018758 3300005563 Bacteria 8318
299 Ga0068855_100020360 3300005563 Bacteria 7957
300 Ga0068855_100073668 3300005563 Bacteria 3967
301 Ga0068855_100123029 3300005563 Bacteria 2968
302 Ga0068855_100260121 3300005563 Bacteria 1933
303 Ga0068855_100405859 3300005563 Bacteria 1493
304 Ga0068855_100467981 3300005563 Bacteria 1373
305 Ga0068855_100646795 3300005563 Bacteria 1136
306 Ga0070664_100010309 3300005564 Bacteria 7584
307 Ga0070664_100020015 3300005564 Bacteria 5509
308 Ga0070664_100028682 3300005564 Bacteria 4632
309 Ga0070664_100044606 3300005564 Bacteria 3744
310 Ga0070664_100049709 3300005564 Bacteria 3546
311 Ga0070664_100070763 3300005564 Bacteria 2988
312 Ga0070664_100132094 3300005564 Bacteria 2193
313 Ga0070664_100152321 3300005564 Bacteria 2042
314 Ga0070664_100558535 3300005564 Bacteria 1059
315 Ga0070664_100635701 3300005564 Bacteria 991
316 Ga0068857_100008394 3300005577 Bacteria 8926
317 Ga0068857_100017580 3300005577 Bacteria 6270
318 Ga0068857_100044761 3300005577 Bacteria 3927
319 Ga0068857_100068314 3300005577 Bacteria 3163
320 Ga0068857_100111128 3300005577 Bacteria 2463
321 Ga0068857_100334167 3300005577 Bacteria 1401
322 Ga0068857_100364475 3300005577 Bacteria 1340
323 Ga0068857_100376789 3300005577 Bacteria 1317
324 Ga0068857_100406853 3300005577 Bacteria 1267
325 Ga0068857_100624462 3300005577 Bacteria 1020
326 Ga0068854_100011748 3300005578 Bacteria 5715
327 Ga0068854_100036144 3300005578 Bacteria 3461
328 Ga0068854_100044863 3300005578 Bacteria 3141
329 Ga0068854_100270133 3300005578 Bacteria 1365
330 Ga0068854_100384393 3300005578 Bacteria 1157
331 Ga0068856_100012678 3300005614 Bacteria 8162
332 Ga0068856_100021146 3300005614 Bacteria 6323
333 Ga0068856_100031920 3300005614 Bacteria 5153
334 Ga0068856_100033046 3300005614 Bacteria 5066
335 Ga0068856_100072344 3300005614 Bacteria 3414
336 Ga0068856_100087901 3300005614 Bacteria 3090
337 Ga0068856_100126627 3300005614 Bacteria 2557
338 Ga0068852_100078407 3300005616 Bacteria 2922
339 Ga0068852_100105555 3300005616 Bacteria 2553
340 Ga0068852_100148161 3300005616 Bacteria 2179
341 Ga0068852_100218226 3300005616 Bacteria 1813
342 Ga0068852_100459718 3300005616 Bacteria 1262
343 Ga0068852_100789171 3300005616 Bacteria 963
344 Ga0068859_100000787 3300005617 Bacteria 32070
345 Ga0068859_100000965 3300005617 Bacteria 29425
346 Ga0068859_100001280 3300005617 Bacteria 25714
347 Ga0068859_100002392 3300005617 Bacteria 19100
348 Ga0068859_100009260 3300005617 Bacteria 9945
349 Ga0068859_100016862 3300005617 Bacteria 7332
350 Ga0068859_100031931 3300005617 Bacteria 5290
351 Ga0068859_100038356 3300005617 Bacteria 4807
352 Ga0068859_100046234 3300005617 Bacteria 4372
353 Ga0068859_100083931 3300005617 Bacteria 3230
354 Ga0068859_100199811 3300005617 Bacteria 2084
355 Ga0068864_100000079 3300005618 Bacteria 102835
356 Ga0068864_100000080 3300005618 Bacteria 102508
357 Ga0068864_100000809 3300005618 Bacteria 26301
358 Ga0068864_100001110 3300005618 Bacteria 22495
359 Ga0068864_100001128 3300005618 Bacteria 22319
360 Ga0068864_100011580 3300005618 Bacteria 7283
361 Ga0068864_100041232 3300005618 Bacteria 3948
362 Ga0068864_100061135 3300005618 Bacteria 3263
363 Ga0068864_100229254 3300005618 Bacteria 1717
364 Ga0068861_100000094 3300005719 Bacteria 43101
365 Ga0068861_100002455 3300005719 Bacteria 12082
366 Ga0068861_100006944 3300005719 Bacteria 7734
367 Ga0068861_100028619 3300005719 Bacteria 4067
368 Ga0068861_100054275 3300005719 Bacteria 3052
369 Ga0068861_100061239 3300005719 Bacteria 2888
370 Ga0068861_100093703 3300005719 Bacteria 2375
371 Ga0068861_100260690 3300005719 Bacteria 1484
372 Ga0068851_10008753 3300005834 Bacteria 4688
373 Ga0068851_10017808 3300005834 Bacteria 3418
374 Ga0068851_10037256 3300005834 Bacteria 2437
375 Ga0068851_10177300 3300005834 Bacteria 1179
376 Ga0068851_10225904 3300005834 Bacteria 1054
377 Ga0068863_100000029 3300005841 Bacteria 177191
378 Ga0068863_100000043 3300005841 Bacteria 153935
379 Ga0068863_100000081 3300005841 Bacteria 106186
380 Ga0068863_100000087 3300005841 Bacteria 102508
381 Ga0068863_100000806 3300005841 Bacteria 31415
382 Ga0068863_100001056 3300005841 Bacteria 27521
383 Ga0068863_100006288 3300005841 Bacteria 11662
384 Ga0068863_100010291 3300005841 Bacteria 9088
385 Ga0068863_100015687 3300005841 Bacteria 7273
386 Ga0068863_100020622 3300005841 Bacteria 6299
387 Ga0068863_100034213 3300005841 Bacteria 4841
388 Ga0068863_100373768 3300005841 Bacteria 1391
389 Ga0068858_100000412 3300005842 Bacteria 44458
390 Ga0068858_100002232 3300005842 Bacteria 19575
391 Ga0068858_100003145 3300005842 Bacteria 16530
392 Ga0068858_100018265 3300005842 Bacteria 6566
393 Ga0068858_100044921 3300005842 Bacteria 4094
394 Ga0068858_100057213 3300005842 Bacteria 3604
395 Ga0068858_100059014 3300005842 Bacteria 3546
396 Ga0068858_100069155 3300005842 Bacteria 3273
397 Ga0068858_100173226 3300005842 Bacteria 2036
398 Ga0068858_100333151 3300005842 Bacteria 1452
399 Ga0068860_100000120 3300005843 Bacteria 125823
400 Ga0068860_100000376 3300005843 Bacteria 58490
401 Ga0068860_100000426 3300005843 Bacteria 53853
402 Ga0068860_100000601 3300005843 Bacteria 42993
403 Ga0068860_100002768 3300005843 Bacteria 18241
404 Ga0068860_100018705 3300005843 Bacteria 6736
405 Ga0068860_100078472 3300005843 Bacteria 3140
406 Ga0068860_100311623 3300005843 Bacteria 1543
407 Ga0068862_100000033 3300005844 Bacteria 176515
408 Ga0068862_100000101 3300005844 Bacteria 102508
409 Ga0068862_100000195 3300005844 Bacteria 66918
410 Ga0068862_100000365 3300005844 Bacteria 49043
411 Ga0068862_100000468 3300005844 Bacteria 43578
412 Ga0068862_100004220 3300005844 Bacteria 12172
413 Ga0068862_100013492 3300005844 Bacteria 6766
414 Ga0068862_100054616 3300005844 Bacteria 3420
415 Ga0068862_100079978 3300005844 Bacteria 2834
416 Ga0068862_100104619 3300005844 Bacteria 2480
417 Ga0068862_100142707 3300005844 Bacteria 2127
418 Ga0068862_100262608 3300005844 Bacteria 1577
419 Ga0081455_10000220 3300005937 Bacteria 73579
420 Ga0081539_10016356 3300005985 Bacteria 5306
421 Ga0081539_10220621 3300005985 Bacteria 863
422 Ga0070717_10039418 3300006028 Bacteria 3844
423 Ga0075368_10024927 3300006042 Bacteria 2293
424 Ga0075364_10010849 3300006051 Bacteria 5518
425 Ga0075364_10095797 3300006051 Bacteria 1973
426 Ga0070716_100188642 3300006173 Bacteria 1360
427 Ga0075362_10001662 3300006177 Bacteria 7212
428 Ga0075367_10003842 3300006178 Bacteria 7241
429 Ga0075369_10002273 3300006186 Bacteria 6827
430 Ga0075366_10041656 3300006195 Bacteria 2719
431 Ga0075366_10079496 3300006195 Bacteria 1957
432 Ga0075366_10085597 3300006195 Bacteria 1885
433 Ga0097621_100255143 3300006237 Bacteria 1537
434 Ga0075370_10015182 3300006353 Bacteria 4118
435 Ga0075370_10182894 3300006353 Bacteria 1234
436 Ga0068871_100267757 3300006358 Bacteria 1492
437 Ga0075428_100091818 3300006844 Bacteria 3311
438 Ga0075428_100529854 3300006844 Bacteria 1260
439 Ga0075431_100005979 3300006847 Bacteria 12053
440 Ga0075429_100162304 3300006880 Bacteria 1957
441 Ga0068865_100000011 3300006881 Bacteria 154581
442 Ga0068865_100102740 3300006881 Bacteria 2095
443 Ga0097620_100000787 3300006931 Bacteria 32070
444 Ga0097620_100000965 3300006931 Bacteria 29425
445 Ga0097620_100001280 3300006931 Bacteria 25714
446 Ga0097620_100002392 3300006931 Bacteria 19100
447 Ga0097620_100009259 3300006931 Bacteria 9945
448 Ga0097620_100016862 3300006931 Bacteria 7332
449 Ga0097620_100031931 3300006931 Bacteria 5290
450 Ga0097620_100038355 3300006931 Bacteria 4807
451 Ga0097620_100046232 3300006931 Bacteria 4372
452 Ga0097620_100083930 3300006931 Bacteria 3230
453 Ga0097620_100199817 3300006931 Bacteria 2084
454 Ga0079104_1020582 3300006946 Bacteria 1815
455 Ga0105251_10000680 3300009011 Bacteria 31350
456 Ga0105251_10003391 3300009011 Bacteria 11584
457 Ga0105251_10034896 3300009011 Bacteria 2485
458 Ga0105250_10036662 3300009092 Bacteria 1967
459 Ga0105240_10011111 3300009093 Bacteria 12585
460 Ga0105240_10013221 3300009093 Bacteria 11353
461 Ga0105240_10025076 3300009093 Bacteria 7847
462 Ga0105240_10032178 3300009093 Bacteria 6793
463 Ga0105240_10164591 3300009093 Bacteria 2631
464 Ga0105240_10290179 3300009093 Bacteria 1876
465 Ga0105240_10344300 3300009093 Bacteria 1692
466 Ga0111539_10045482 3300009094 Bacteria 5254
467 Ga0111539_10253211 3300009094 Bacteria 2050
468 Ga0105245_10000157 3300009098 Bacteria 64143
469 Ga0105247_10003461 3300009101 Bacteria 10291
470 Ga0105247_10006396 3300009101 Bacteria 7291
471 Ga0105247_10015584 3300009101 Bacteria 4551
472 Ga0105247_10030834 3300009101 Bacteria 3252
473 Ga0105247_10237321 3300009101 Bacteria 1241
474 Ga0105247_10268137 3300009101 Bacteria 1173
475 Ga0105247_10341781 3300009101 Bacteria 1050
476 Ga0114129_10598115 3300009147 Bacteria 1429
477 Ga0105243_10000042 3300009148 Bacteria 159276
478 Ga0105243_10000333 3300009148 Bacteria 51457
479 Ga0105243_10029399 3300009148 Bacteria 4225
480 Ga0105243_10426544 3300009148 Bacteria 1238
481 Ga0105241_10004041 3300009174 Bacteria 10860
482 Ga0105241_10014025 3300009174 Bacteria 5875
483 Ga0105241_10231751 3300009174 Bacteria 1557
484 Ga0105241_10321462 3300009174 Bacteria 1335
485 Ga0105241_10417359 3300009174 Bacteria 1180
486 Ga0105241_10771424 3300009174 Bacteria 883
487 Ga0105242_10133721 3300009176 Bacteria 2144
488 Ga0105242_10348725 3300009176 Bacteria 1367
489 Ga0105248_10000029 3300009177 Bacteria 223366
490 Ga0105248_10000706 3300009177 Bacteria 37722
491 Ga0105248_10001320 3300009177 Bacteria 27621
492 Ga0105248_10003519 3300009177 Bacteria 17372
493 Ga0105248_10003808 3300009177 Bacteria 16728
494 Ga0105248_10004272 3300009177 Bacteria 15809
495 Ga0105248_10010578 3300009177 Bacteria 10166
496 Ga0105248_10010795 3300009177 Bacteria 10084
497 Ga0105248_10016115 3300009177 Bacteria 8225
498 Ga0105248_10110430 3300009177 Bacteria 3100
499 Ga0105248_10457186 3300009177 Bacteria 1439
500 Ga0105248_10489035 3300009177 Bacteria 1387
501 Ga0105248_10800263 3300009177 Bacteria 1064
502 Ga0105248_11363786 3300009177 Bacteria 802
503 Ga0105237_10000737 3300009545 Bacteria 45119
504 Ga0105237_10031651 3300009545 Bacteria 5358
505 Ga0105237_10047884 3300009545 Bacteria 4298
506 Ga0105237_10113085 3300009545 Bacteria 2707
507 Ga0105237_10157976 3300009545 Bacteria 2265
508 Ga0105238_10047663 3300009551 Bacteria 4320
509 Ga0105238_10134943 3300009551 Bacteria 2446
510 Ga0105238_10541302 3300009551 Bacteria 1168
511 Ga0105249_10000024 3300009553 Bacteria 232947
512 Ga0105249_10000390 3300009553 Bacteria 42999
513 Ga0105249_10003685 3300009553 Bacteria 13206
514 Ga0105249_10015597 3300009553 Bacteria 6726
515 Ga0105249_10016320 3300009553 Bacteria 6588
516 Ga0105249_10096685 3300009553 Bacteria 2771
517 Ga0105249_10224955 3300009553 Bacteria 1848
518 Ga0105148_100293 3300009978 Bacteria 6507
519 Ga0105239_10001737 3300010375 Bacteria 28726
520 Ga0105239_10153879 3300010375 Bacteria 2567
521 Ga0105239_10204830 3300010375 Bacteria 2211
522 Ga0105246_10000160 3300011119 Bacteria 32154
523 Ga0105246_10130852 3300011119 Bacteria 1874
524 Ga0105246_10385634 3300011119 Bacteria 1159
525 Ga0157326_1000010 3300012513 Bacteria 16665
526 Ga0157373_10000811 3300013100 Bacteria 24182
527 Ga0157373_10031116 3300013100 Bacteria 3841
528 Ga0157373_10039098 3300013100 Bacteria 3397
529 Ga0157373_10082366 3300013100 Bacteria 2268
530 Ga0157373_10122242 3300013100 Bacteria 1830
531 Ga0157373_10233012 3300013100 Bacteria 1301
532 Ga0157373_10269121 3300013100 Bacteria 1206
533 Ga0157371_10000110 3300013102 Bacteria 124933
534 Ga0157371_10007052 3300013102 Bacteria 9143
535 Ga0157371_10007309 3300013102 Bacteria 8969
536 Ga0157371_10007462 3300013102 Bacteria 8848
537 Ga0157371_10036260 3300013102 Bacteria 3532
538 Ga0157371_10048585 3300013102 Bacteria 3016
539 Ga0157371_10057585 3300013102 Bacteria 2756
540 Ga0157371_10394897 3300013102 Bacteria 1011
541 Ga0157370_10000008 3300013104 Bacteria 240668
542 Ga0157370_10002746 3300013104 Bacteria 21034
543 Ga0157370_10024683 3300013104 Bacteria 5952
544 Ga0157370_10031686 3300013104 Bacteria 5170
545 Ga0157370_10074268 3300013104 Bacteria 3207
546 Ga0157370_10208338 3300013104 Bacteria 1812
547 Ga0157370_10308159 3300013104 Bacteria 1461
548 Ga0157369_10000256 3300013105 Bacteria 73068
549 Ga0157369_10009587 3300013105 Bacteria 11071
550 Ga0157369_10021880 3300013105 Bacteria 7147
551 Ga0157369_10029065 3300013105 Bacteria 6111
552 Ga0157369_10042272 3300013105 Bacteria 4972
553 Ga0157369_10061760 3300013105 Bacteria 4039
554 Ga0157369_10094239 3300013105 Bacteria 3196
555 Ga0157369_10117810 3300013105 Bacteria 2819
556 Ga0157369_10289013 3300013105 Bacteria 1707
557 Ga0157369_10628828 3300013105 Bacteria 1107
558 Ga0157369_10660329 3300013105 Bacteria 1078
559 Ga0157374_10007919 3300013296 Bacteria 9071
560 Ga0157374_10016232 3300013296 Bacteria 6543
561 Ga0157374_10122119 3300013296 Bacteria 2515
562 Ga0157378_10008270 3300013297 Bacteria 9071
563 Ga0163162_10010979 3300013306 Bacteria 8820
564 Ga0163162_10014561 3300013306 Bacteria 7686
565 Ga0163162_10016182 3300013306 Bacteria 7294
566 Ga0163162_10037392 3300013306 Bacteria 4844
567 Ga0163162_10442470 3300013306 Bacteria 1432
568 Ga0157372_10027547 3300013307 Bacteria 6191
569 Ga0157372_10062569 3300013307 Bacteria 4170
570 Ga0157372_10078751 3300013307 Bacteria 3725
571 Ga0157372_10112590 3300013307 Bacteria 3118
572 Ga0157372_10149556 3300013307 Bacteria 2694
573 Ga0157372_10256056 3300013307 Bacteria 2032
574 Ga0157372_10366108 3300013307 Bacteria 1680
575 Ga0157372_10631045 3300013307 Bacteria 1248
576 Ga0157372_10682460 3300013307 Bacteria 1196
577 Ga0157372_11054366 3300013307 Bacteria 941
578 Ga0157372_11470835 3300013307 Bacteria 785
579 Ga0157375_10026310 3300013308 Bacteria 5419
580 Ga0157375_10040781 3300013308 Bacteria 4478
581 Ga0157375_10228437 3300013308 Bacteria 2020
582 Ga0163163_10004062 3300014325 Bacteria 12478
583 Ga0163163_10014763 3300014325 Bacteria 7189
584 Ga0163163_10072582 3300014325 Bacteria 3431
585 Ga0157380_10000670 3300014326 Bacteria 21205
586 Ga0157380_10001286 3300014326 Bacteria 16328
587 Ga0157380_10003250 3300014326 Bacteria 11126
588 Ga0157380_10008503 3300014326 Bacteria 7333
589 Ga0157380_10022069 3300014326 Bacteria 4785
590 Ga0157380_10199859 3300014326 Bacteria 1772
591 Ga0157380_10396143 3300014326 Bacteria 1308
592 Ga0157379_10004515 3300014968 Bacteria 11937
593 Ga0157379_10022295 3300014968 Bacteria 5610
594 Ga0157379_10036954 3300014968 Bacteria 4354
595 Ga0157379_10146843 3300014968 Bacteria 2127
596 Ga0157379_10204468 3300014968 Bacteria 1786
597 Ga0157376_10000072 3300014969 Bacteria 77631
598 Ga0183363_1003 3300015690 Bacteria 421263
599 Ga0163161_10000718 3300017792 Bacteria 26157
600 Ga0163161_10007524 3300017792 Bacteria 7526
601 Ga0163161_10007673 3300017792 Bacteria 7462
602 Ga0163161_10016312 3300017792 Bacteria 5185
603 Ga0163161_10030214 3300017792 Bacteria 3854
604 Ga0163161_10114989 3300017792 Bacteria 2016
605 Ga0163161_10529203 3300017792 Bacteria 963
606 Ga0206353_10636536 3300020082 Bacteria 6502
607 Ga0213873_10000023 3300021358 Bacteria 102573
608 Ga0213872_10030279 3300021361 Bacteria 2481
609 Ga0213872_10042388 3300021361 Bacteria 2075
610 Ga0213872_10123085 3300021361 Bacteria 1146
611 Ga0213876_10000091 3300021384 Bacteria 102527
612 Ga0213876_10001036 3300021384 Bacteria 17961
613 Ga0213875_10006744 3300021388 Bacteria 5998
614 Ga0209147_101685 3300025229 Bacteria 7224
615 Ga0207427_100395 3300025231 Bacteria 25928
616 Ga0209437_104667 3300025233 Bacteria 2388
617 Ga0207425_1000005 3300025245 Bacteria 900502
618 Ga0209646_1009132 3300025246 Bacteria 1578
619 Ga0209677_103019 3300025253 Bacteria 5799
620 Ga0209148_1000008 3300025254 Bacteria 1504371
621 Ga0209148_1002234 3300025254 Bacteria 7064
622 Ga0209129_1003736 3300025258 Bacteria 6430
623 Ga0209233_1000140 3300025261 Bacteria 193274
624 Ga0209233_1000207 3300025261 Bacteria 117152
625 Ga0209233_1050506 3300025261 Bacteria 849
626 Ga0209565_1000007 3300025263 Bacteria 784361
627 Ga0209565_1000044 3300025263 Bacteria 229969
628 Ga0209455_1000002 3300025272 Bacteria 1505459
629 Ga0209455_1000489 3300025272 Bacteria 29111
630 Ga0209673_1006277 3300025273 Bacteria 5784
631 Ga0209673_1010542 3300025273 Bacteria 3887
632 Ga0207673_1004245 3300025290 Bacteria 1705
633 Ga0209675_1000638 3300025291 Bacteria 24903
634 Ga0209676_1000897 3300025292 Bacteria 37715
635 Ga0209676_1001537 3300025292 Bacteria 20872
636 Ga0209676_1002002 3300025292 Bacteria 16097
637 Ga0209676_1027246 3300025292 Bacteria 1801
638 Ga0209025_1000128 3300025294 Bacteria 198859
639 Ga0209025_1014067 3300025294 Bacteria 4965
640 Ga0209564_1003920 3300025295 Bacteria 9523
641 Ga0209758_1000002 3300025297 Bacteria 1400310
642 Ga0209758_1000017 3300025297 Bacteria 754393
643 Ga0209050_1000001 3300025298 Bacteria 3563507
644 Ga0209050_1000010 3300025298 Bacteria 980454
645 Ga0209050_1000267 3300025298 Bacteria 111656
646 Ga0209050_1002180 3300025298 Bacteria 17683
647 Ga0209050_1002751 3300025298 Bacteria 14155
648 Ga0209050_1046375 3300025298 Bacteria 1143
649 Ga0209256_1000008 3300025299 Bacteria 975723
650 Ga0207426_1023247 3300025302 Bacteria 2116
651 Ga0209051_1000357 3300025303 Bacteria 67596
652 Ga0209257_1000027 3300025304 Bacteria 703541
653 Ga0209257_1000083 3300025304 Bacteria 296207
654 Ga0209257_1000500 3300025304 Bacteria 70060
655 Ga0209257_1001441 3300025304 Bacteria 28096
656 Ga0209257_1001755 3300025304 Bacteria 24052
657 Ga0209257_1003004 3300025304 Bacteria 15287
658 Ga0207697_10000442 3300025315 Bacteria 23401
659 Ga0207697_10001404 3300025315 Bacteria 13176
660 Ga0207697_10011771 3300025315 Bacteria 3690
661 Ga0207697_10096545 3300025315 Bacteria 1257
662 Ga0207697_10101138 3300025315 Bacteria 1229
663 Ga0207656_10001793 3300025321 Bacteria 7145
664 Ga0207696_1034473 3300025711 Bacteria 1511
665 Ga0207713_1002683 3300025735 Bacteria 12726
666 Ga0207713_1021992 3300025735 Bacteria 3041
667 Ga0207713_1042755 3300025735 Bacteria 1878
668 Ga0207710_10002492 3300025900 Bacteria 8512
669 Ga0207710_10012540 3300025900 Bacteria 3567
670 Ga0207710_10158165 3300025900 Bacteria 1102
671 Ga0207710_10204994 3300025900 Bacteria 975
672 Ga0207710_10243068 3300025900 Bacteria 898
673 Ga0207688_10006109 3300025901 Bacteria 6553
674 Ga0207688_10037818 3300025901 Bacteria 2678
675 Ga0207680_10000081 3300025903 Bacteria 43007
676 Ga0207680_10000155 3300025903 Bacteria 33334
677 Ga0207680_10001224 3300025903 Bacteria 12130
678 Ga0207680_10018385 3300025903 Bacteria 3715
679 Ga0207680_10037281 3300025903 Bacteria 2806
680 Ga0207680_10177618 3300025903 Bacteria 1438
681 Ga0207680_10248300 3300025903 Bacteria 1228
682 Ga0207680_10354593 3300025903 Bacteria 1031
683 Ga0207647_10000997 3300025904 Bacteria 21946
684 Ga0207647_10001916 3300025904 Bacteria 15929
685 Ga0207647_10004886 3300025904 Bacteria 9896
686 Ga0207647_10006925 3300025904 Bacteria 8219
687 Ga0207647_10009976 3300025904 Bacteria 6726
688 Ga0207647_10014579 3300025904 Bacteria 5415
689 Ga0207647_10014669 3300025904 Bacteria 5397
690 Ga0207647_10016598 3300025904 Bacteria 5022
691 Ga0207647_10081995 3300025904 Bacteria 1932
692 Ga0207647_10235178 3300025904 Bacteria 1053
693 Ga0207645_10007207 3300025907 Bacteria 7880
694 Ga0207645_10011636 3300025907 Bacteria 6001
695 Ga0207645_10016395 3300025907 Bacteria 4904
696 Ga0207645_10016769 3300025907 Bacteria 4844
697 Ga0207705_10000003 3300025909 Bacteria 709270
698 Ga0207705_10000005 3300025909 Bacteria 673478
699 Ga0207705_10000027 3300025909 Bacteria 248863
700 Ga0207705_10000123 3300025909 Bacteria 85382
701 Ga0207705_10000134 3300025909 Bacteria 79513
702 Ga0207705_10000275 3300025909 Bacteria 49216
703 Ga0207705_10002119 3300025909 Bacteria 15407
704 Ga0207705_10002122 3300025909 Bacteria 15392
705 Ga0207705_10002734 3300025909 Bacteria 13521
706 Ga0207705_10006407 3300025909 Bacteria 8721
707 Ga0207705_10022137 3300025909 Bacteria 4534
708 Ga0207705_10044683 3300025909 Bacteria 3183
709 Ga0207705_10057010 3300025909 Bacteria 2818
710 Ga0207705_10117985 3300025909 Bacteria 1966
711 Ga0207705_10250556 3300025909 Bacteria 1351
712 Ga0207654_10004554 3300025911 Bacteria 6998
713 Ga0207654_10004852 3300025911 Bacteria 6804
714 Ga0207654_10536492 3300025911 Bacteria 830
715 Ga0207707_10405463 3300025912 Bacteria 1170
716 Ga0207695_10004104 3300025913 Bacteria 20021
717 Ga0207695_10017623 3300025913 Bacteria 8300
718 Ga0207695_10029125 3300025913 Bacteria 6109
719 Ga0207695_10039402 3300025913 Bacteria 5080
720 Ga0207695_10074574 3300025913 Bacteria 3454
721 Ga0207695_10110032 3300025913 Bacteria 2736
722 Ga0207695_10111271 3300025913 Bacteria 2718
723 Ga0207695_10203963 3300025913 Bacteria 1891
724 Ga0207695_10224249 3300025913 Bacteria 1786
725 Ga0207671_10000206 3300025914 Bacteria 89176
726 Ga0207671_10003091 3300025914 Bacteria 16966
727 Ga0207671_10005230 3300025914 Bacteria 12055
728 Ga0207671_10028696 3300025914 Bacteria 4157
729 Ga0207671_10052354 3300025914 Bacteria 3025
730 Ga0207671_10269071 3300025914 Bacteria 1342
731 Ga0207671_10636870 3300025914 Bacteria 849
732 Ga0207660_10000484 3300025917 Bacteria 26514
733 Ga0207660_10000770 3300025917 Bacteria 21320
734 Ga0207660_10010525 3300025917 Bacteria 6008
735 Ga0207660_10013667 3300025917 Bacteria 5324
736 Ga0207660_10364109 3300025917 Bacteria 1160
737 Ga0207657_10000705 3300025919 Bacteria 35489
738 Ga0207657_10002019 3300025919 Bacteria 21940
739 Ga0207657_10002261 3300025919 Bacteria 20877
740 Ga0207657_10002889 3300025919 Bacteria 18453
741 Ga0207657_10004663 3300025919 Bacteria 14476
742 Ga0207657_10005881 3300025919 Bacteria 12781
743 Ga0207657_10011856 3300025919 Bacteria 8628
744 Ga0207657_10014085 3300025919 Bacteria 7824
745 Ga0207657_10025591 3300025919 Bacteria 5439
746 Ga0207657_10025640 3300025919 Bacteria 5432
747 Ga0207657_10042758 3300025919 Bacteria 3996
748 Ga0207657_10045552 3300025919 Bacteria 3849
749 Ga0207657_10055901 3300025919 Bacteria 3407
750 Ga0207657_10064378 3300025919 Bacteria 3129
751 Ga0207657_10081608 3300025919 Bacteria 2716
752 Ga0207657_10192184 3300025919 Bacteria 1646
753 Ga0207657_10319329 3300025919 Bacteria 1228
754 Ga0207657_10360034 3300025919 Bacteria 1147
755 Ga0207649_10001392 3300025920 Bacteria 14321
756 Ga0207649_10003358 3300025920 Bacteria 8755
757 Ga0207649_10008180 3300025920 Bacteria 5695
758 Ga0207649_10013984 3300025920 Bacteria 4491
759 Ga0207649_10014879 3300025920 Bacteria 4364
760 Ga0207649_10042363 3300025920 Bacteria 2777
761 Ga0207649_10059022 3300025920 Bacteria 2405
762 Ga0207649_10110168 3300025920 Bacteria 1838
763 Ga0207649_10130395 3300025920 Bacteria 1707
764 Ga0207649_10295710 3300025920 Bacteria 1182
765 Ga0207649_10458312 3300025920 Bacteria 963
766 Ga0207652_10000034 3300025921 Bacteria 138571
767 Ga0207652_10001463 3300025921 Bacteria 20896
768 Ga0207652_10283255 3300025921 Bacteria 1495
769 Ga0207652_10346614 3300025921 Bacteria 1341
770 Ga0207652_10652740 3300025921 Bacteria 941
771 Ga0207681_10000002 3300025923 Bacteria 985597
772 Ga0207681_10000014 3300025923 Bacteria 353422
773 Ga0207681_10000045 3300025923 Bacteria 128454
774 Ga0207681_10000186 3300025923 Bacteria 50375
775 Ga0207681_10001451 3300025923 Bacteria 15255
776 Ga0207681_10010858 3300025923 Bacteria 5594
777 Ga0207681_10019383 3300025923 Bacteria 4298
778 Ga0207681_10050735 3300025923 Bacteria 2808
779 Ga0207681_10097329 3300025923 Bacteria 2115
780 Ga0207681_10173298 3300025923 Bacteria 1637
781 Ga0207681_10240837 3300025923 Bacteria 1408
782 Ga0207681_10276935 3300025923 Bacteria 1319
783 Ga0207681_10356945 3300025923 Bacteria 1171
784 Ga0207681_10618577 3300025923 Bacteria 896
785 Ga0207694_10003733 3300025924 Bacteria 12066
786 Ga0207694_10088838 3300025924 Bacteria 2436
787 Ga0207694_10247987 3300025924 Bacteria 1456
788 Ga0207694_10253619 3300025924 Bacteria 1440
789 Ga0207694_10268063 3300025924 Bacteria 1400
790 Ga0207650_10000015 3300025925 Bacteria 369173
791 Ga0207650_10001439 3300025925 Bacteria 17134
792 Ga0207650_10003083 3300025925 Bacteria 11479
793 Ga0207650_10004392 3300025925 Bacteria 9635
794 Ga0207650_10006189 3300025925 Bacteria 8155
795 Ga0207650_10045237 3300025925 Bacteria 3238
796 Ga0207650_10142176 3300025925 Bacteria 1887
797 Ga0207650_10191722 3300025925 Bacteria 1633
798 Ga0207659_10001796 3300025926 Bacteria 12687
799 Ga0207659_10014082 3300025926 Bacteria 5149
800 Ga0207659_10082602 3300025926 Bacteria 2379
801 Ga0207687_10001915 3300025927 Bacteria 14312
802 Ga0207700_10207177 3300025928 Bacteria 1656
803 Ga0207664_10063264 3300025929 Bacteria 2957
804 Ga0207664_10166421 3300025929 Bacteria 1884
805 Ga0207664_10252138 3300025929 Bacteria 1541
806 Ga0207644_10000002 3300025931 Bacteria 942221
807 Ga0207644_10000047 3300025931 Bacteria 103158
808 Ga0207644_10000077 3300025931 Bacteria 72394
809 Ga0207644_10000780 3300025931 Bacteria 20214
810 Ga0207644_10007963 3300025931 Bacteria 6930
811 Ga0207644_10008037 3300025931 Bacteria 6901
812 Ga0207644_10013622 3300025931 Bacteria 5425
813 Ga0207644_10036925 3300025931 Bacteria 3432
814 Ga0207644_10058418 3300025931 Bacteria 2788
815 Ga0207644_10102288 3300025931 Bacteria 2154
816 Ga0207644_10283906 3300025931 Bacteria 1330
817 Ga0207690_10003957 3300025932 Bacteria 8763
818 Ga0207690_10003962 3300025932 Bacteria 8757
819 Ga0207690_10006795 3300025932 Bacteria 6784
820 Ga0207690_10010461 3300025932 Bacteria 5516
821 Ga0207690_10010678 3300025932 Bacteria 5471
822 Ga0207690_10012197 3300025932 Bacteria 5143
823 Ga0207690_10038798 3300025932 Bacteria 3102
824 Ga0207690_10061741 3300025932 Bacteria 2549
825 Ga0207690_10155491 3300025932 Bacteria 1699
826 Ga0207690_10379447 3300025932 Bacteria 1123
827 Ga0207690_10411500 3300025932 Bacteria 1080
828 Ga0207706_10000890 3300025933 Bacteria 30672
829 Ga0207706_10000916 3300025933 Bacteria 30270
830 Ga0207706_10003154 3300025933 Bacteria 15834
831 Ga0207706_10008457 3300025933 Bacteria 9492
832 Ga0207706_10014756 3300025933 Bacteria 7072
833 Ga0207706_10019389 3300025933 Bacteria 6119
834 Ga0207706_10051633 3300025933 Bacteria 3630
835 Ga0207706_10055921 3300025933 Bacteria 3479
836 Ga0207706_10082836 3300025933 Bacteria 2820
837 Ga0207706_10084014 3300025933 Bacteria 2799
838 Ga0207706_10092939 3300025933 Bacteria 2653
839 Ga0207706_10110117 3300025933 Bacteria 2423
840 Ga0207706_10119402 3300025933 Bacteria 2318
841 Ga0207706_10176475 3300025933 Bacteria 1877
842 Ga0207706_10338710 3300025933 Bacteria 1308
843 Ga0207706_10383889 3300025933 Bacteria 1219
844 Ga0207706_10400363 3300025933 Bacteria 1190
845 Ga0207706_10585687 3300025933 Bacteria 959
846 Ga0207686_10000797 3300025934 Bacteria 19358
847 Ga0207709_10000119 3300025935 Bacteria 121452
848 Ga0207709_10000146 3300025935 Bacteria 98521
849 Ga0207709_10039420 3300025935 Bacteria 2821
850 Ga0207670_10001945 3300025936 Bacteria 10823
851 Ga0207669_10000764 3300025937 Bacteria 13811
852 Ga0207669_10009054 3300025937 Bacteria 4716
853 Ga0207669_10310355 3300025937 Bacteria 1203
854 Ga0207704_10000001 3300025938 Bacteria 716296
855 Ga0207665_10244220 3300025939 Bacteria 1324
856 Ga0207691_10000143 3300025940 Bacteria 65645
857 Ga0207691_10003738 3300025940 Bacteria 14760
858 Ga0207691_10247578 3300025940 Bacteria 1539
859 Ga0207691_10255107 3300025940 Bacteria 1513
860 Ga0207691_10473011 3300025940 Bacteria 1065
861 Ga0207691_10477635 3300025940 Bacteria 1059
862 Ga0207691_10669538 3300025940 Bacteria 876
863 Ga0207691_10729947 3300025940 Bacteria 835
864 Ga0207711_10000004 3300025941 Bacteria 870636
865 Ga0207711_10000297 3300025941 Bacteria 53217
866 Ga0207711_10000617 3300025941 Bacteria 35805
867 Ga0207711_10000869 3300025941 Bacteria 29230
868 Ga0207711_10001880 3300025941 Bacteria 19134
869 Ga0207711_10002679 3300025941 Bacteria 15751
870 Ga0207711_10005670 3300025941 Bacteria 10546
871 Ga0207711_10007223 3300025941 Bacteria 9309
872 Ga0207711_10010142 3300025941 Bacteria 7824
873 Ga0207711_10079445 3300025941 Bacteria 2863
874 Ga0207711_10083105 3300025941 Bacteria 2800
875 Ga0207711_10218401 3300025941 Bacteria 1743
876 Ga0207711_10228326 3300025941 Bacteria 1704
877 Ga0207711_10234921 3300025941 Bacteria 1680
878 Ga0207711_10574955 3300025941 Bacteria 1051
879 Ga0207689_10000824 3300025942 Bacteria 29889
880 Ga0207689_10127088 3300025942 Bacteria 2097
881 Ga0207661_10026008 3300025944 Bacteria 4455
882 Ga0207661_10197682 3300025944 Bacteria 1766
883 Ga0207661_10909675 3300025944 Bacteria 810
884 Ga0207679_10011319 3300025945 Bacteria 5771
885 Ga0207679_10055777 3300025945 Bacteria 2914
886 Ga0207679_10113419 3300025945 Bacteria 2144
887 Ga0207679_10144743 3300025945 Bacteria 1926
888 Ga0207679_10157813 3300025945 Bacteria 1854
889 Ga0207679_10485173 3300025945 Bacteria 1101
890 Ga0207679_10635471 3300025945 Bacteria 964
891 Ga0207667_10000001 3300025949 Bacteria 1178522
892 Ga0207667_10003306 3300025949 Bacteria 19886
893 Ga0207667_10006318 3300025949 Bacteria 14368
894 Ga0207667_10009014 3300025949 Bacteria 11801
895 Ga0207667_10014984 3300025949 Bacteria 8818
896 Ga0207667_10035151 3300025949 Bacteria 5376
897 Ga0207667_10085052 3300025949 Bacteria 3274
898 Ga0207667_10132725 3300025949 Bacteria 2565
899 Ga0207667_10174899 3300025949 Bacteria 2206
900 Ga0207667_10279143 3300025949 Bacteria 1707
901 Ga0207667_10340213 3300025949 Bacteria 1531
902 Ga0207667_10666329 3300025949 Bacteria 1045
903 Ga0207651_10000002 3300025960 Bacteria 427663
904 Ga0207651_10066721 3300025960 Bacteria 2530
905 Ga0207651_10092863 3300025960 Bacteria 2214
906 Ga0207651_10093621 3300025960 Bacteria 2207
907 Ga0207712_10000034 3300025961 Bacteria 202320
908 Ga0207712_10000335 3300025961 Bacteria 43007
909 Ga0207712_10005251 3300025961 Bacteria 8192
910 Ga0207712_10016901 3300025961 Bacteria 4731
911 Ga0207712_10018385 3300025961 Bacteria 4551
912 Ga0207712_10029100 3300025961 Bacteria 3702
913 Ga0207712_10044410 3300025961 Bacteria 3071
914 Ga0207712_10085194 3300025961 Bacteria 2311
915 Ga0207712_10095284 3300025961 Bacteria 2200
916 Ga0207668_10000043 3300025972 Bacteria 103738
917 Ga0207668_10000068 3300025972 Bacteria 81202
918 Ga0207668_10000725 3300025972 Bacteria 20192
919 Ga0207668_10001466 3300025972 Bacteria 13831
920 Ga0207668_10004083 3300025972 Bacteria 8580
921 Ga0207668_10004543 3300025972 Bacteria 8164
922 Ga0207668_10008246 3300025972 Bacteria 6208
923 Ga0207668_10021203 3300025972 Bacteria 4141
924 Ga0207668_10024865 3300025972 Bacteria 3870
925 Ga0207668_10031838 3300025972 Bacteria 3479
926 Ga0207668_10060857 3300025972 Bacteria 2652
927 Ga0207668_10127030 3300025972 Bacteria 1941
928 Ga0207640_10001192 3300025981 Bacteria 14205
929 Ga0207640_10007799 3300025981 Bacteria 5913
930 Ga0207640_10019529 3300025981 Bacteria 4006
931 Ga0207640_10029512 3300025981 Bacteria 3368
932 Ga0207640_10034804 3300025981 Bacteria 3147
933 Ga0207640_10225289 3300025981 Bacteria 1438
934 Ga0207640_10343116 3300025981 Bacteria 1197
935 Ga0207658_10000010 3300025986 Bacteria 240224
936 Ga0207658_10000109 3300025986 Bacteria 89979
937 Ga0207658_10000159 3300025986 Bacteria 71280
938 Ga0207658_10000327 3300025986 Bacteria 48072
939 Ga0207658_10002396 3300025986 Bacteria 13746
940 Ga0207658_10005955 3300025986 Bacteria 8328
941 Ga0207658_10006378 3300025986 Bacteria 8052
942 Ga0207658_10009089 3300025986 Bacteria 6738
943 Ga0207658_10012765 3300025986 Bacteria 5735
944 Ga0207658_10012985 3300025986 Bacteria 5688
945 Ga0207658_10019004 3300025986 Bacteria 4753
946 Ga0207658_10040736 3300025986 Bacteria 3360
947 Ga0207658_10046383 3300025986 Bacteria 3173
948 Ga0207658_10148001 3300025986 Bacteria 1909
949 Ga0207658_10372766 3300025986 Bacteria 1248
950 Ga0207658_10398448 3300025986 Bacteria 1209
951 Ga0207677_10000178 3300026023 Bacteria 50577
952 Ga0207703_10000770 3300026035 Bacteria 31525
953 Ga0207703_10000822 3300026035 Bacteria 30583
954 Ga0207703_10002670 3300026035 Bacteria 15330
955 Ga0207703_10004152 3300026035 Bacteria 11945
956 Ga0207703_10031176 3300026035 Bacteria 4214
957 Ga0207703_10057095 3300026035 Bacteria 3182
958 Ga0207703_10104598 3300026035 Bacteria 2405
959 Ga0207703_10146540 3300026035 Bacteria 2054
960 Ga0207703_10174038 3300026035 Bacteria 1895
961 Ga0207639_10000269 3300026041 Bacteria 37143
962 Ga0207639_10001145 3300026041 Bacteria 18035
963 Ga0207639_10001159 3300026041 Bacteria 17877
964 Ga0207639_10001550 3300026041 Bacteria 15427
965 Ga0207639_10014496 3300026041 Bacteria 5546
966 Ga0207639_10016151 3300026041 Bacteria 5274
967 Ga0207639_10023215 3300026041 Bacteria 4477
968 Ga0207639_10067090 3300026041 Bacteria 2791
969 Ga0207639_10114629 3300026041 Bacteria 2203
970 Ga0207639_10149342 3300026041 Bacteria 1956
971 Ga0207639_10158623 3300026041 Bacteria 1904
972 Ga0207639_10308029 3300026041 Bacteria 1402
973 Ga0207639_10539243 3300026041 Bacteria 1070
974 Ga0207639_10567166 3300026041 Bacteria 1044
975 Ga0207678_10000400 3300026067 Bacteria 39732
976 Ga0207678_10009947 3300026067 Bacteria 8343
977 Ga0207678_10017140 3300026067 Bacteria 6360
978 Ga0207678_10033630 3300026067 Bacteria 4465
979 Ga0207678_10048015 3300026067 Bacteria 3691
980 Ga0207678_10048808 3300026067 Bacteria 3658
981 Ga0207678_10060784 3300026067 Bacteria 3249
982 Ga0207678_10077149 3300026067 Bacteria 2854
983 Ga0207678_10122001 3300026067 Bacteria 2224
984 Ga0207678_10136790 3300026067 Bacteria 2090
985 Ga0207678_10157506 3300026067 Bacteria 1939
986 Ga0207678_10276404 3300026067 Bacteria 1441
987 Ga0207678_10340511 3300026067 Bacteria 1292
988 Ga0207678_10876321 3300026067 Bacteria 793
989 Ga0207708_10014964 3300026075 Bacteria 5812
990 Ga0207702_10001123 3300026078 Bacteria 27335
991 Ga0207702_10001961 3300026078 Bacteria 20035
992 Ga0207702_10002063 3300026078 Bacteria 19455
993 Ga0207702_10003523 3300026078 Bacteria 14267
994 Ga0207702_10005983 3300026078 Bacteria 10564
995 Ga0207702_10009744 3300026078 Bacteria 8067
996 Ga0207702_10012745 3300026078 Bacteria 6995
997 Ga0207702_10020227 3300026078 Bacteria 5513
998 Ga0207702_10027516 3300026078 Bacteria 4722
999 Ga0207702_10101713 3300026078 Bacteria 2538
1000 Ga0207702_10181703 3300026078 Bacteria 1938
1001 Ga0207641_10000010 3300026088 Bacteria 402193
1002 Ga0207641_10000031 3300026088 Bacteria 224320
1003 Ga0207641_10000049 3300026088 Bacteria 177222
1004 Ga0207641_10000143 3300026088 Bacteria 102398
1005 Ga0207641_10000182 3300026088 Bacteria 87316
1006 Ga0207641_10000294 3300026088 Bacteria 62469
1007 Ga0207641_10000919 3300026088 Bacteria 30374
1008 Ga0207641_10001513 3300026088 Bacteria 22775
1009 Ga0207641_10003077 3300026088 Bacteria 15031
1010 Ga0207641_10005066 3300026088 Bacteria 11294
1011 Ga0207641_10026236 3300026088 Bacteria 4808
1012 Ga0207641_10053565 3300026088 Bacteria 3420
1013 Ga0207641_10200720 3300026088 Bacteria 1838
1014 Ga0207641_10247732 3300026088 Bacteria 1663
1015 Ga0207648_10000001 3300026089 Bacteria 427499
1016 Ga0207648_10022514 3300026089 Bacteria 5656
1017 Ga0207648_10061674 3300026089 Bacteria 3269
1018 Ga0207676_10000036 3300026095 Bacteria 198447
1019 Ga0207676_10000071 3300026095 Bacteria 104095
1020 Ga0207676_10000383 3300026095 Bacteria 37759
1021 Ga0207676_10002378 3300026095 Bacteria 13429
1022 Ga0207676_10007383 3300026095 Bacteria 7795
1023 Ga0207676_10008557 3300026095 Bacteria 7273
1024 Ga0207676_10013375 3300026095 Bacteria 5894
1025 Ga0207676_10040107 3300026095 Bacteria 3586
1026 Ga0207676_10094217 3300026095 Bacteria 2467
1027 Ga0207676_10203376 3300026095 Bacteria 1751
1028 Ga0207676_10214993 3300026095 Bacteria 1708
1029 Ga0207674_10003084 3300026116 Bacteria 20610
1030 Ga0207674_10005061 3300026116 Bacteria 15735
1031 Ga0207674_10012914 3300026116 Bacteria 9315
1032 Ga0207674_10014614 3300026116 Bacteria 8660
1033 Ga0207674_10018651 3300026116 Bacteria 7536
1034 Ga0207674_10021191 3300026116 Bacteria 7007
1035 Ga0207674_10022185 3300026116 Bacteria 6823
1036 Ga0207674_10035097 3300026116 Bacteria 5235
1037 Ga0207674_10040233 3300026116 Bacteria 4844
1038 Ga0207674_10098851 3300026116 Bacteria 2901
1039 Ga0207674_10138008 3300026116 Bacteria 2399
1040 Ga0207674_10178578 3300026116 Bacteria 2075
1041 Ga0207674_10288757 3300026116 Bacteria 1589
1042 Ga0207674_10384025 3300026116 Bacteria 1358
1043 Ga0207674_10426202 3300026116 Bacteria 1282
1044 Ga0207675_100000041 3300026118 Bacteria 90476
1045 Ga0207675_100001120 3300026118 Bacteria 26559
1046 Ga0207675_100001364 3300026118 Bacteria 24483
1047 Ga0207675_100004161 3300026118 Bacteria 14002
1048 Ga0207675_100014835 3300026118 Bacteria 7272
1049 Ga0207675_100375536 3300026118 Bacteria 1397
1050 Ga0207683_10003626 3300026121 Bacteria 13437
1051 Ga0207683_10076773 3300026121 Bacteria 2958
1052 Ga0207698_10006491 3300026142 Bacteria 7301
1053 Ga0207698_10014515 3300026142 Bacteria 5240
1054 Ga0207698_10020547 3300026142 Bacteria 4547
1055 Ga0207698_10026473 3300026142 Bacteria 4103
1056 Ga0207698_10050594 3300026142 Bacteria 3171
1057 Ga0207698_10053521 3300026142 Bacteria 3099
1058 Ga0207698_10100192 3300026142 Bacteria 2399
1059 Ga0207698_10529778 3300026142 Bacteria 1151
1060 Ga0209983_1007478 3300027665 Bacteria 2239
1061 Ga0209971_1007391 3300027682 Bacteria 2606
1062 Ga0209813_10000052 3300027866 Bacteria 47473
1063 Ga0207428_10053033 3300027907 Bacteria 3235
1064 Ga0268266_10000025 3300028379 Bacteria 477143
1065 Ga0268266_10000036 3300028379 Bacteria 348910
1066 Ga0268266_10000314 3300028379 Bacteria 76554
1067 Ga0268266_10000558 3300028379 Bacteria 51887
1068 Ga0268266_10006140 3300028379 Bacteria 11058
1069 Ga0268266_10031304 3300028379 Bacteria 4517
1070 Ga0268266_10058220 3300028379 Bacteria 3327
1071 Ga0268266_10369809 3300028379 Bacteria 1350
1072 Ga0268265_10000013 3300028380 Bacteria 341536
1073 Ga0268265_10000059 3300028380 Bacteria 152531
1074 Ga0268265_10000143 3300028380 Bacteria 90469
1075 Ga0268265_10001046 3300028380 Bacteria 24878
1076 Ga0268265_10001847 3300028380 Bacteria 16875
1077 Ga0268265_10007222 3300028380 Bacteria 7506
1078 Ga0268265_10008332 3300028380 Bacteria 7001
1079 Ga0268265_10019527 3300028380 Bacteria 4713
1080 Ga0268265_10030191 3300028380 Bacteria 3900
1081 Ga0268265_10098675 3300028380 Bacteria 2353
1082 Ga0268265_10226126 3300028380 Bacteria 1641
1083 Ga0268265_10290707 3300028380 Bacteria 1467
1084 Ga0268265_10354931 3300028380 Bacteria 1340
1085 Ga0268265_10594578 3300028380 Bacteria 1056
1086 Ga0268265_10613457 3300028380 Bacteria 1041
1087 Ga0268264_10000070 3300028381 Bacteria 268524
1088 Ga0268264_10000071 3300028381 Bacteria 267236
1089 Ga0268264_10000126 3300028381 Bacteria 186138
1090 Ga0268264_10000144 3300028381 Bacteria 168841
1091 Ga0268264_10000608 3300028381 Bacteria 43007
1092 Ga0268264_10002628 3300028381 Bacteria 15686
1093 Ga0268264_10020464 3300028381 Bacteria 5406
1094 Ga0268264_10020586 3300028381 Bacteria 5389
1095 Ga0268264_10106716 3300028381 Bacteria 2445
1096 Ga0268264_10967596 3300028381 Bacteria 857
1097 Ga0307517_10034735 3300028786 Bacteria 5731
1098 Ga0307517_10146195 3300028786 Bacteria 1640
1099 Ga0265338_10008130 3300028800 Bacteria 12806
1100 Ga0265338_10092072 3300028800 Bacteria 2502
1101 Ga0265338_10112576 3300028800 Bacteria 2188
1102 Ga0316182_1058570 3300030745 Bacteria 1312
1103 Ga0307408_100013164 3300031548 Bacteria 5490
1104 Ga0307408_100029566 3300031548 Bacteria 3797
1105 Ga0307408_100031935 3300031548 Bacteria 3669
1106 Ga0307408_100032881 3300031548 Bacteria 3619
1107 Ga0307408_100042872 3300031548 Bacteria 3217
1108 Ga0307408_100065686 3300031548 Bacteria 2661
1109 Ga0307408_100099549 3300031548 Bacteria 2212
1110 Ga0307408_100108658 3300031548 Bacteria 2126
1111 Ga0307408_100208004 3300031548 Bacteria 1588
1112 Ga0307408_100299645 3300031548 Bacteria 1346
1113 Ga0307408_100315131 3300031548 Bacteria 1316
1114 Ga0307408_100454043 3300031548 Bacteria 1112
1115 Ga0307408_100492589 3300031548 Bacteria 1071
1116 Ga0307408_100910963 3300031548 Bacteria 805
1117 Ga0307508_10000437 3300031616 Bacteria 49724
1118 Ga0265314_10201127 3300031711 Bacteria 1177
1119 Ga0307405_10009539 3300031731 Bacteria 4980
1120 Ga0307405_10012578 3300031731 Bacteria 4488
1121 Ga0307405_10030704 3300031731 Bacteria 3154
1122 Ga0307405_10031491 3300031731 Bacteria 3123
1123 Ga0307405_10044581 3300031731 Bacteria 2713
1124 Ga0307405_10051724 3300031731 Bacteria 2550
1125 Ga0307405_10071317 3300031731 Bacteria 2235
1126 Ga0307405_10090071 3300031731 Bacteria 2028
1127 Ga0307405_10109503 3300031731 Bacteria 1868
1128 Ga0307405_10203885 3300031731 Bacteria 1438
1129 Ga0307405_10226839 3300031731 Bacteria 1374
1130 Ga0307405_10278584 3300031731 Bacteria 1257
1131 Ga0307405_10444311 3300031731 Bacteria 1026
1132 Ga0307413_10002391 3300031824 Bacteria 7623
1133 Ga0307413_10004714 3300031824 Bacteria 5984
1134 Ga0307413_10040118 3300031824 Bacteria 2729
1135 Ga0307413_10067151 3300031824 Bacteria 2241
1136 Ga0307413_10088567 3300031824 Bacteria 2008
1137 Ga0307413_10243112 3300031824 Bacteria 1330
1138 Ga0307413_10262643 3300031824 Bacteria 1288
1139 Ga0307413_10315693 3300031824 Bacteria 1191
1140 Ga0307413_10470960 3300031824 Bacteria 1002
1141 Ga0307413_10490457 3300031824 Bacteria 984
1142 Ga0307410_10006898 3300031852 Bacteria 6170
1143 Ga0307410_10014043 3300031852 Bacteria 4696
1144 Ga0307410_10019555 3300031852 Bacteria 4123
1145 Ga0307410_10029787 3300031852 Bacteria 3480
1146 Ga0307410_10029941 3300031852 Bacteria 3473
1147 Ga0307410_10031489 3300031852 Bacteria 3404
1148 Ga0307410_10035891 3300031852 Bacteria 3224
1149 Ga0307410_10047117 3300031852 Bacteria 2879
1150 Ga0307410_10048902 3300031852 Bacteria 2836
1151 Ga0307410_10075082 3300031852 Bacteria 2356
1152 Ga0307410_10105965 3300031852 Bacteria 2025
1153 Ga0307410_10107231 3300031852 Bacteria 2014
1154 Ga0307410_10135701 3300031852 Bacteria 1813
1155 Ga0307410_10145465 3300031852 Bacteria 1758
1156 Ga0307410_10173689 3300031852 Bacteria 1626
1157 Ga0307410_10344492 3300031852 Bacteria 1189
1158 Ga0307410_10415298 3300031852 Bacteria 1090
1159 Ga0307406_10013423 3300031901 Bacteria 4692
1160 Ga0307406_10024162 3300031901 Bacteria 3626
1161 Ga0307406_10035673 3300031901 Bacteria 3060
1162 Ga0307406_10039071 3300031901 Bacteria 2942
1163 Ga0307406_10049711 3300031901 Bacteria 2655
1164 Ga0307406_10068324 3300031901 Bacteria 2319
1165 Ga0307406_10109982 3300031901 Bacteria 1895
1166 Ga0307406_10127035 3300031901 Bacteria 1783
1167 Ga0307406_10176223 3300031901 Bacteria 1552
1168 Ga0307406_10224062 3300031901 Bacteria 1400
1169 Ga0307406_10256087 3300031901 Bacteria 1321
1170 Ga0307406_10289834 3300031901 Bacteria 1252
1171 Ga0307406_10350431 3300031901 Bacteria 1153
1172 Ga0307407_10004866 3300031903 Bacteria 5764
1173 Ga0307407_10028047 3300031903 Bacteria 3004
1174 Ga0307407_10044011 3300031903 Bacteria 2513
1175 Ga0307407_10071254 3300031903 Bacteria 2069
1176 Ga0307407_10093311 3300031903 Bacteria 1850
1177 Ga0307407_10110764 3300031903 Bacteria 1722
1178 Ga0307407_10143274 3300031903 Bacteria 1544
1179 Ga0307407_10330336 3300031903 Bacteria 1073
1180 Ga0307407_10358006 3300031903 Bacteria 1035
1181 Ga0307412_10000368 3300031911 Bacteria 28053
1182 Ga0307412_10000425 3300031911 Bacteria 25583
1183 Ga0307412_10005229 3300031911 Bacteria 7277
1184 Ga0307412_10009767 3300031911 Bacteria 5509
1185 Ga0307412_10013360 3300031911 Bacteria 4812
1186 Ga0307412_10017619 3300031911 Bacteria 4277
1187 Ga0307412_10026547 3300031911 Bacteria 3600
1188 Ga0307412_10027328 3300031911 Bacteria 3556
1189 Ga0307412_10047403 3300031911 Bacteria 2822
1190 Ga0307412_10053684 3300031911 Bacteria 2672
1191 Ga0307412_10061699 3300031911 Bacteria 2521
1192 Ga0307412_10086573 3300031911 Bacteria 2181
1193 Ga0307412_10113670 3300031911 Bacteria 1937
1194 Ga0307412_10158778 3300031911 Bacteria 1677
1195 Ga0307412_10246087 3300031911 Bacteria 1386
1196 Ga0307412_10274557 3300031911 Bacteria 1321
1197 Ga0307412_10656692 3300031911 Bacteria 895
1198 Ga0307409_100014448 3300031995 Bacteria 5137
1199 Ga0307409_100029953 3300031995 Bacteria 3903
1200 Ga0307409_100112711 3300031995 Bacteria 2284
1201 Ga0307409_100120558 3300031995 Bacteria 2220
1202 Ga0307409_100129273 3300031995 Bacteria 2155
1203 Ga0307409_100161468 3300031995 Bacteria 1960
1204 Ga0307409_100177803 3300031995 Bacteria 1880
1205 Ga0307409_100181627 3300031995 Bacteria 1863
1206 Ga0307409_100198811 3300031995 Bacteria 1791
1207 Ga0307409_100278970 3300031995 Bacteria 1543
1208 Ga0307409_100293200 3300031995 Bacteria 1509
1209 Ga0307409_100301621 3300031995 Bacteria 1490
1210 Ga0307409_100375606 3300031995 Bacteria 1349
1211 Ga0307416_100020525 3300032002 Bacteria 4717
1212 Ga0307416_100030428 3300032002 Bacteria 4050
1213 Ga0307416_100164925 3300032002 Bacteria 2053
1214 Ga0307416_100253890 3300032002 Bacteria 1713
1215 Ga0307416_100313785 3300032002 Bacteria 1566
1216 Ga0307416_100314962 3300032002 Bacteria 1563
1217 Ga0307416_100526549 3300032002 Bacteria 1251
1218 Ga0307416_100616664 3300032002 Bacteria 1166
1219 Ga0307416_100617655 3300032002 Bacteria 1165
1220 Ga0307416_100654908 3300032002 Bacteria 1135
1221 Ga0307416_100680291 3300032002 Bacteria 1116
1222 Ga0307416_101173185 3300032002 Bacteria 873
1223 Ga0307414_10000996 3300032004 Bacteria 14475
1224 Ga0307414_10004003 3300032004 Bacteria 7955
1225 Ga0307414_10006804 3300032004 Bacteria 6393
1226 Ga0307414_10007563 3300032004 Bacteria 6108
1227 Ga0307414_10007626 3300032004 Bacteria 6088
1228 Ga0307414_10007906 3300032004 Bacteria 6000
1229 Ga0307414_10018838 3300032004 Bacteria 4262
1230 Ga0307414_10027709 3300032004 Bacteria 3665
1231 Ga0307414_10034632 3300032004 Bacteria 3351
1232 Ga0307414_10037145 3300032004 Bacteria 3259
1233 Ga0307414_10051481 3300032004 Bacteria 2859
1234 Ga0307414_10058044 3300032004 Bacteria 2724
1235 Ga0307414_10062291 3300032004 Bacteria 2646
1236 Ga0307414_10075676 3300032004 Bacteria 2444
1237 Ga0307414_10077988 3300032004 Bacteria 2413
1238 Ga0307414_10089713 3300032004 Bacteria 2279
1239 Ga0307414_10096306 3300032004 Bacteria 2214
1240 Ga0307414_10096608 3300032004 Bacteria 2211
1241 Ga0307414_10117214 3300032004 Bacteria 2040
1242 Ga0307414_10131210 3300032004 Bacteria 1945
1243 Ga0307414_10133943 3300032004 Bacteria 1928
1244 Ga0307414_10189023 3300032004 Bacteria 1664
1245 Ga0307414_10226133 3300032004 Bacteria 1539
1246 Ga0307414_10311956 3300032004 Bacteria 1335
1247 Ga0307414_10357083 3300032004 Bacteria 1256
1248 Ga0307411_10009989 3300032005 Bacteria 5029
1249 Ga0307411_10012573 3300032005 Bacteria 4628
1250 Ga0307411_10025582 3300032005 Bacteria 3539
1251 Ga0307411_10029387 3300032005 Bacteria 3355
1252 Ga0307411_10041507 3300032005 Bacteria 2928
1253 Ga0307411_10066130 3300032005 Bacteria 2427
1254 Ga0307411_10074795 3300032005 Bacteria 2310
1255 Ga0307411_10099516 3300032005 Bacteria 2052
1256 Ga0307411_10133978 3300032005 Bacteria 1815
1257 Ga0307411_10210451 3300032005 Bacteria 1501
1258 Ga0307411_10260776 3300032005 Bacteria 1368
1259 Ga0307411_10410124 3300032005 Bacteria 1122
1260 Ga0307411_10510130 3300032005 Bacteria 1018
1261 Ga0307415_100009130 3300032126 Bacteria 5539
1262 Ga0307415_100009983 3300032126 Bacteria 5355
1263 Ga0307415_100050797 3300032126 Bacteria 2811
1264 Ga0307415_100051734 3300032126 Bacteria 2789
1265 Ga0307415_100099985 3300032126 Bacteria 2124
1266 Ga0307415_100267327 3300032126 Bacteria 1399
1267 Ga0307415_100634805 3300032126 Bacteria 955
1268 Ga0307415_100716287 3300032126 Bacteria 905
1269 Ga0307415_100720667 3300032126 Bacteria 902
1270 Ga0316583_10002544 3300032133 Bacteria 6355
1271 Ga0307510_10002654 3300033180 Bacteria 20437
1272 Ga0307510_10020525 3300033180 Bacteria 7720
1273 Ga0307510_10109075 3300033180 Bacteria 2519
1274 Ga0373928_0045767 3300035084 Bacteria 1019
1275 Ga0373923_0235363 3300035111 Bacteria 854
1276 Ga0373937_0699227 3300036401 Bacteria 960
1277 Ga0316584_0015325 3300036712 Bacteria 5481
1278 Ga0316584_0046420 3300036712 Bacteria 3245
1279 Ga0373925_0101272 3300037068 Bacteria 2215
1280 Ga0395899_0007334 3300037312 Bacteria 8530
1281 Ga0395899_0008123 3300037312 Bacteria 8085
1282 Ga0395899_0019612 3300037312 Bacteria 5133
1283 Ga0395899_0021784 3300037312 Bacteria 4860
1284 Ga0395899_0025715 3300037312 Bacteria 4443
1285 Ga0395899_0045698 3300037312 Bacteria 3262
1286 Ga0395899_0093908 3300037312 Bacteria 2171
1287 Ga0395899_0095513 3300037312 Bacteria 2150
1288 Ga0395899_0195738 3300037312 Bacteria 1412
1289 Ga0395900_0000124 3300037418 Bacteria 133210
1290 Ga0395900_0001779 3300037418 Bacteria 24718
1291 Ga0395900_0009084 3300037418 Bacteria 10188
1292 Ga0395900_0030086 3300037418 Bacteria 5573
1293 Ga0395900_0035428 3300037418 Bacteria 5140
1294 Ga0395900_0052744 3300037418 Bacteria 4186
1295 Ga0395900_0072699 3300037418 Bacteria 3535
1296 Ga0395900_0094329 3300037418 Bacteria 3074
1297 Ga0395900_0157752 3300037418 Bacteria 2317
1298 Ga0395900_0197608 3300037418 Bacteria 2036
1299 Ga0395900_0207862 3300037418 Bacteria 1977
1300 Ga0395900_0260175 3300037418 Bacteria 1733
1301 Ga0395900_0330107 3300037418 Bacteria 1503
1302 Ga0395900_0755962 3300037418 Bacteria 902
1303 Ga0395898_0018013 3300037466 Bacteria 7205
1304 Ga0395898_0038108 3300037466 Bacteria 4766
1305 Ga0395898_0046946 3300037466 Bacteria 4240
1306 Ga0395898_0096973 3300037466 Bacteria 2832
1307 Ga0395898_0119516 3300037466 Bacteria 2524
1308 Ga0395898_0140695 3300037466 Bacteria 2310
1309 Ga0395898_0180153 3300037466 Bacteria 2020
1310 Ga0395898_0224392 3300037466 Bacteria 1792
1311 Ga0395898_0469575 3300037466 Bacteria 1197
1312 Ga0395898_0484349 3300037466 Bacteria 1177
1313 Ga0395905_0000083 3300037471 Bacteria 158407
1314 Ga0395905_0003571 3300037471 Bacteria 16557
1315 Ga0395905_0030244 3300037471 Bacteria 5105
1316 Ga0395905_0052768 3300037471 Bacteria 3806
1317 Ga0395905_0122037 3300037471 Bacteria 2450
1318 Ga0395905_0138978 3300037471 Bacteria 2285
1319 Ga0395905_0151984 3300037471 Bacteria 2178
1320 Ga0395905_0171782 3300037471 Bacteria 2036
1321 Ga0395905_0254720 3300037471 Bacteria 1639
1322 Ga0395905_0297269 3300037471 Bacteria 1502
1323 Ga0395905_0336991 3300037471 Bacteria 1399
1324 Ga0395905_0488490 3300037471 Bacteria 1131
1325 Ga0436364_0791346 3300037853 Bacteria 11897
1326 Ga0436364_0852694 3300037853 Bacteria 36694
1327 Ga0395901_0000031 3300038443 Bacteria 241733
1328 Ga0395901_0000369 3300038443 Bacteria 54034
1329 Ga0395901_0032817 3300038443 Bacteria 5356
1330 Ga0395901_0052142 3300038443 Bacteria 4252
1331 Ga0395901_0106626 3300038443 Bacteria 2940
1332 Ga0395901_0141058 3300038443 Bacteria 2532
1333 Ga0395901_0180625 3300038443 Bacteria 2213
1334 Ga0395901_0182907 3300038443 Bacteria 2198
1335 Ga0395901_0261347 3300038443 Bacteria 1802
1336 Ga0395901_0570981 3300038443 Bacteria 1144
1337 Ga0400483_285123 3300039062 Bacteria 1933
1338 Ga0436365_0380590 3300039437 Bacteria 74578
1339 Ga0436365_0564701 3300039437 Bacteria 31631
1340 Ga0436360_1138764 3300039438 Bacteria 9386
1341 Ga0436361_0156897 3300039447 Bacteria 2456
1342 Ga0436361_0290947 3300039447 Bacteria 24175
1343 Ga0436363_0755130 3300039450 Bacteria 1373
1344 Ga0436362_0265247 3300039453 Bacteria 102026
1345 Ga0439436_0040872 3300041404 Bacteria 1328
1346 Ga0439436_0046721 3300041404 Bacteria 1230
1347 Ga0439439_0004034 3300041406 Bacteria 3280
1348 Ga0439461_0001088 3300041410 Bacteria 4097
1349 Ga0439465_0004070 3300041413 Bacteria 4762
1350 Ga0439465_0018585 3300041413 Bacteria 2172
1351 Ga0451797_0647272 3300041453 Bacteria 1628
1352 Ga0451802_1792715 3300041460 Bacteria 2055
1353 Ga0451807_0363003 3300041486 Bacteria 727
1354 Ga0451807_1555181 3300041486 Bacteria 1691
1355 Ga0451853_0010956 3300041512 Bacteria 2259
1356 Ga0439431_0000614 3300041997 Bacteria 7572
1357 Ga0439448_0000189 3300042005 Bacteria 12696
1358 Ga0439448_0001949 3300042005 Bacteria 5504
1359 Ga0439448_0010633 3300042005 Bacteria 2731
1360 Ga0439448_0034292 3300042005 Bacteria 1621
1361 Ga0439432_007906 3300042006 Bacteria 3749
1362 Ga0439432_023371 3300042006 Bacteria 2037
1363 Ga0439432_044335 3300042006 Bacteria 1401
1364 Ga0439449_0057706 3300042007 Bacteria 1433
1365 Ga0439455_0016585 3300042012 Bacteria 1706
1366 Ga0439455_0054506 3300042012 Bacteria 1050
1367 Ga0439462_0000063 3300042015 Bacteria 15632
1368 Ga0439462_0018387 3300042015 Bacteria 1815
1369 Ga0450914_002942 3300042118 Bacteria 1267
1370 Ga0450920_016026 3300042122 Bacteria 1427
1371 Ga0450898_010808 3300042134 Bacteria 1485
1372 Ga0450889_000938 3300042144 Bacteria 3101
1373 Ga0439446_0033685 3300042156 Bacteria 1489
1374 Ga0439458_0000020 3300042157 Bacteria 25235
1375 Ga0439458_0003976 3300042157 Bacteria 3415
1376 Ga0439458_0048364 3300042157 Bacteria 1045
1377 Ga0439434_0000837 3300042435 Bacteria 8865
1378 Ga0466969_0024531 3300044656 Bacteria 3102
1379 Ga0466969_0044256 3300044656 Bacteria 2216
1380 Ga0466972_0007627 3300044658 Bacteria 5430
1381 Ga0466972_0060546 3300044658 Bacteria 1816
1382 Ga0466966_0000010 3300044684 Bacteria 150868
1383 Ga0466966_0009572 3300044684 Bacteria 6412
1384 Ga0466961_0021726 3300044693 Bacteria 4128
1385 Ga0466961_0026020 3300044693 Bacteria 3761
1386 Ga0466961_0365663 3300044693 Bacteria 877
1387 Ga0466963_0015932 3300044694 Bacteria 4667
1388 Ga0466963_0074979 3300044694 Bacteria 2282
1389 Ga0466963_0414577 3300044694 Bacteria 950
1390 Ga0466964_0014857 3300044706 Bacteria 2964
1391 Ga0466971_0014375 3300044719 Bacteria 3482
1392 Ga0466971_0070500 3300044719 Bacteria 1587
1393 Ga0466971_0259421 3300044719 Bacteria 829
1394 Ga0466968_0008602 3300044735 Bacteria 3912
1395 Ga0466968_0036142 3300044735 Bacteria 2069
1396 Ga0466968_0096417 3300044735 Bacteria 1316
1397 Ga0466970_0006134 3300044765 Bacteria 5987
1398 Ga0466970_0023186 3300044765 Bacteria 3240
1399 Ga0466970_0146826 3300044765 Bacteria 1301
1400 Ga0466957_0049324 3300044842 Bacteria 2560
1401 Ga0466957_0326025 3300044842 Bacteria 1037
1402 Ga0466960_0016605 3300044901 Bacteria 3197
1403 Ga0466959_0050551 3300045049 Bacteria 3051
1404 Ga0466959_0091176 3300045049 Bacteria 2188
1405 Ga0466959_0093983 3300045049 Bacteria 2151
1406 Ga0466959_0406087 3300045049 Bacteria 925
1407 Ga0451576_0000024 3300045051 Bacteria 470499
1408 Ga0466958_0029194 3300045836 Bacteria 3272
1409 Ga0466958_0036661 3300045836 Bacteria 2936
1410 Ga0466958_0082311 3300045836 Bacteria 1982
1411 Ga0466967_0048844 3300045976 Bacteria 3698
1412 Ga0466967_0059045 3300045976 Bacteria 3393
1413 Ga0466967_0161910 3300045976 Bacteria 2101
1414 Ga0495627_000089 3300046453 Bacteria 110113
1415 Ga0495627_000108 3300046453 Bacteria 102455
1416 Ga0495627_000430 3300046453 Bacteria 36446
1417 Ga0495629_0016572 3300046459 Bacteria 5290
1418 Ga0495638_0000012 3300046460 Bacteria 435577
1419 Ga0495638_0067020 3300046460 Bacteria 2205
1420 Ga0495650_0000355 3300046471 Bacteria 81062
1421 Ga0495650_0000366 3300046471 Bacteria 79144
1422 Ga0495650_0018649 3300046471 Bacteria 3442
1423 Ga0495584_0135657 3300046491 Bacteria 1249
1424 Ga0495585_0002254 3300046492 Bacteria 13943
1425 Ga0495585_0039541 3300046492 Bacteria 2651
1426 Ga0495585_0138670 3300046492 Bacteria 1275
1427 Ga0495596_0000789 3300046500 Bacteria 19241
1428 Ga0495607_0014490 3300046501 Bacteria 5126
1429 Ga0495607_0056599 3300046501 Bacteria 2251
1430 Ga0495583_0000447 3300046506 Bacteria 61780
1431 Ga0495583_0000949 3300046506 Bacteria 33737
1432 Ga0495583_0001229 3300046506 Bacteria 27263
1433 Ga0495583_0011684 3300046506 Bacteria 5028
1434 Ga0495583_0018285 3300046506 Bacteria 3692
1435 Ga0495583_0074564 3300046506 Bacteria 1485
1436 Ga0495606_0000534 3300046507 Bacteria 61311
1437 Ga0495606_0023959 3300046507 Bacteria 4411
1438 Ga0495606_0041901 3300046507 Bacteria 3067
1439 Ga0495606_0192292 3300046507 Bacteria 1169
1440 Ga0495610_0000050 3300046512 Bacteria 143781
1441 Ga0495610_0000662 3300046512 Bacteria 33529
1442 Ga0495610_0003729 3300046512 Bacteria 11663
1443 Ga0495616_0000030 3300046513 Bacteria 132950
1444 Ga0495618_0148847 3300046514 Bacteria 1496
1445 Ga0495620_0054461 3300046515 Bacteria 1689
1446 Ga0495628_0015737 3300046516 Bacteria 6314
1447 Ga0495631_0014327 3300046518 Bacteria 3831
1448 Ga0495631_0044275 3300046518 Bacteria 1962
1449 Ga0495632_0000001 3300046519 Bacteria 873295
1450 Ga0495632_0001187 3300046519 Bacteria 22143
1451 Ga0495632_0002709 3300046519 Bacteria 13186
1452 Ga0495632_0010006 3300046519 Bacteria 5655
1453 Ga0495637_0001922 3300046520 Bacteria 11806
1454 Ga0495637_0011653 3300046520 Bacteria 4219
1455 Ga0495637_0012808 3300046520 Bacteria 4001
1456 Ga0495643_0000020 3300046522 Bacteria 294973
1457 Ga0495643_0000754 3300046522 Bacteria 36639
1458 Ga0495643_0003791 3300046522 Bacteria 10933
1459 Ga0495643_0012831 3300046522 Bacteria 5040
1460 Ga0495643_0016735 3300046522 Bacteria 4304
1461 Ga0495643_0019971 3300046522 Bacteria 3870
1462 Ga0495643_0086352 3300046522 Bacteria 1625
1463 Ga0495648_0000295 3300046524 Bacteria 55574
1464 Ga0495648_0001562 3300046524 Bacteria 22358
1465 Ga0495648_0020560 3300046524 Bacteria 4599
1466 Ga0495663_0000002 3300046525 Bacteria 495384
1467 Ga0495663_0001876 3300046525 Bacteria 6466
1468 Ga0495663_0005518 3300046525 Bacteria 3509
1469 Ga0495663_0024157 3300046525 Bacteria 1765
1470 Ga0495663_0046785 3300046525 Bacteria 1330
1471 Ga0495654_0000535 3300046530 Bacteria 30674
1472 Ga0495654_0051664 3300046530 Bacteria 2005
1473 Ga0495598_0025743 3300046537 Bacteria 1607
1474 Ga0495598_0106145 3300046537 Bacteria 935
1475 Ga0495609_0007581 3300046538 Bacteria 5396
1476 Ga0495609_0096628 3300046538 Bacteria 1282
1477 Ga0495621_0000099 3300046539 Bacteria 17912
1478 Ga0495621_0000360 3300046539 Bacteria 11102
1479 Ga0495621_0000399 3300046539 Bacteria 10696
1480 Ga0495621_0007914 3300046539 Bacteria 3164
1481 Ga0495597_0007914 3300046542 Bacteria 5357
1482 Ga0495597_0072695 3300046542 Bacteria 1479
1483 Ga0495622_0049190 3300046557 Bacteria 1957
1484 Ga0495633_0000213 3300046558 Bacteria 72710
1485 Ga0495633_0000544 3300046558 Bacteria 37513
1486 Ga0495633_0002550 3300046558 Bacteria 12776
1487 Ga0495633_0028562 3300046558 Bacteria 2717
1488 Ga0495633_0044994 3300046558 Bacteria 2091
1489 Ga0495668_0000234 3300046616 Bacteria 79147
1490 Ga0495668_0000431 3300046616 Bacteria 54273
1491 Ga0495668_0001515 3300046616 Bacteria 22093
1492 Ga0495668_0012462 3300046616 Bacteria 5041
1493 Ga0495668_0015339 3300046616 Bacteria 4477
1494 Ga0495668_0032777 3300046616 Bacteria 2921
1495 Ga0495668_0054098 3300046616 Bacteria 2219
1496 Ga0495668_0076149 3300046616 Bacteria 1842
1497 Ga0495611_0009356 3300046648 Bacteria 4141
1498 Ga0495611_0087078 3300046648 Bacteria 1441
1499 Ga0495625_0000584 3300046660 Bacteria 52916
1500 Ga0495625_0005142 3300046660 Bacteria 12072
1501 Ga0495625_0006071 3300046660 Bacteria 10844
1502 Ga0495625_0027285 3300046660 Bacteria 4302
1503 Ga0495625_0030477 3300046660 Bacteria 4024
1504 Ga0495625_0041164 3300046660 Bacteria 3364
1505 Ga0495625_0325965 3300046660 Bacteria 977
1506 Ga0495659_0001833 3300046664 Bacteria 7042
1507 Ga0495659_0052951 3300046664 Bacteria 1482
1508 Ga0495661_0081908 3300046665 Bacteria 1859
1509 Ga0495669_0000465 3300046684 Bacteria 18940
1510 Ga0495669_0003625 3300046684 Bacteria 6359
1511 Ga0495669_0006919 3300046684 Bacteria 4751
1512 Ga0495669_0112441 3300046684 Bacteria 1272
1513 Ga0495669_0113336 3300046684 Bacteria 1267
1514 Ga0495669_0140647 3300046684 Bacteria 1139
1515 Ga0495670_0000017 3300046691 Bacteria 120427
1516 Ga0495670_0041912 3300046691 Bacteria 2284
1517 Ga0495670_0049079 3300046691 Bacteria 2111
1518 Ga0495671_0000016 3300046692 Bacteria 294821
1519 Ga0495671_0000111 3300046692 Bacteria 72744
1520 Ga0495671_0100862 3300046692 Bacteria 1411
1521 Ga0495649_0031941 3300046694 Bacteria 2902
1522 Ga0495649_0159937 3300046694 Bacteria 1181
1523 Ga0495589_0044317 3300046794 Bacteria 2213
1524 Ga0495600_0023893 3300046809 Bacteria 3933
1525 Ga0495683_0026175 3300047323 Bacteria 2985
1526 Ga0495687_000745 3300047443 Bacteria 35355
1527 Ga0495687_001214 3300047443 Bacteria 24651
1528 Ga0495677_0014759 3300047445 Bacteria 2842
1529 Ga0495677_0017332 3300047445 Bacteria 2612
1530 Ga0495677_0018633 3300047445 Bacteria 2516
1531 Ga0495677_0051981 3300047445 Bacteria 1510
1532 Ga0495685_011488 3300047447 Bacteria 2989
1533 Ga0495673_0000013 3300047469 Bacteria 612902
1534 Ga0495681_0000089 3300047470 Bacteria 79789
1535 Ga0495681_0000129 3300047470 Bacteria 66033
1536 Ga0495681_0011686 3300047470 Bacteria 5210
1537 Ga0495681_0109971 3300047470 Bacteria 1195
1538 Ga0495686_0000074 3300047472 Bacteria 208094
1539 Ga0495686_0000956 3300047472 Bacteria 35653
1540 Ga0495686_0002793 3300047472 Bacteria 15859
1541 Ga0495686_0004696 3300047472 Bacteria 11081
1542 Ga0495686_0016160 3300047472 Bacteria 5071
1543 Ga0495686_0035402 3300047472 Bacteria 3210
1544 Ga0495686_0073077 3300047472 Bacteria 2107
1545 Ga0495686_0106550 3300047472 Bacteria 1685
1546 Ga0495593_0038412 3300047673 Bacteria 2586
1547 Ga0495602_0227585 3300048088 Bacteria 1403
1548 Ga0495626_0000255 3300048091 Bacteria 61151
1549 Ga0496101_0103177 3300048904 Bacteria 2137
1550 Ga0496102_0004440 3300048905 Bacteria 11845
1551 Ga0496102_0016971 3300048905 Bacteria 6371
1552 Ga0496102_0513833 3300048905 Bacteria 1120
1553 Ga0496103_0004338 3300048906 Bacteria 8611
1554 Ga0496103_0006060 3300048906 Bacteria 7224
1555 Ga0496103_0018322 3300048906 Bacteria 4199
1556 Ga0496103_0032728 3300048906 Bacteria 3174
1557 Ga0496104_0561261 3300048907 Bacteria 1052
1558 Ga0496105_0012633 3300048908 Bacteria 6687
1559 Ga0496105_0356795 3300048908 Bacteria 1167
1560 Ga0496105_0388436 3300048908 Bacteria 1110
1561 Ga0496106_0033166 3300048909 Bacteria 3852
1562 Ga0496107_0015627 3300048910 Bacteria 5321
1563 Ga0496108_0000566 3300048911 Bacteria 28953
1564 Ga0496108_0007701 3300048911 Bacteria 8724
1565 Ga0496109_0030373 3300048912 Bacteria 4843
1566 Ga0496109_0077299 3300048912 Bacteria 3063
1567 Ga0496109_0238513 3300048912 Bacteria 1711
1568 Ga0496110_0006992 3300048913 Bacteria 8976
1569 Ga0496110_0008059 3300048913 Bacteria 8454
1570 Ga0496110_0019948 3300048913 Bacteria 5651
1571 Ga0496110_0364109 3300048913 Bacteria 1317
1572 Ga0496111_0000383 3300048914 Bacteria 22109
1573 Ga0496111_0006695 3300048914 Bacteria 7498
1574 Ga0496111_0182872 3300048914 Bacteria 1558
1575 Ga0496112_0004861 3300048915 Bacteria 11482
1576 Ga0496113_0009618 3300048916 Bacteria 6347
1577 Ga0496113_0445258 3300048916 Bacteria 1041
1578 Ga0496114_0043188 3300048917 Bacteria 3738
1579 Ga0496114_0473619 3300048917 Bacteria 1108
1580 Ga0496115_0001780 3300048918 Bacteria 15418
1581 Ga0496115_0506708 3300048918 Bacteria 969
1582 Ga0496116_0000045 3300048919 Bacteria 324307
1583 Ga0496116_0014181 3300048919 Bacteria 6378
1584 Ga0496117_0008020 3300048920 Bacteria 10125
1585 Ga0496117_0023280 3300048920 Bacteria 4942
1586 Ga0496117_0030787 3300048920 Bacteria 4109
1587 Ga0496117_0073459 3300048920 Bacteria 2281
1588 Ga0496117_0105086 3300048920 Bacteria 1776
1589 Ga0496117_0143937 3300048920 Bacteria 1423
1590 Ga0496117_0218587 3300048920 Bacteria 1062
1591 Ga0496118_0000797 3300048921 Bacteria 50370
1592 Ga0496118_0001340 3300048921 Bacteria 37345
1593 Ga0496118_0020552 3300048921 Bacteria 5850
1594 Ga0496118_0022886 3300048921 Bacteria 5446
1595 Ga0496118_0025316 3300048921 Bacteria 5093
1596 Ga0496118_0055561 3300048921 Bacteria 2986
1597 Ga0496118_0057617 3300048921 Bacteria 2910
1598 Ga0496119_0014928 3300048922 Bacteria 6036
1599 Ga0496119_0026083 3300048922 Bacteria 4062
1600 Ga0496119_0030582 3300048922 Bacteria 3626
1601 Ga0496120_0145919 3300048923 Bacteria 1195
1602 Ga0496120_0239661 3300048923 Bacteria 857
1603 Ga0496121_0000024 3300048924 Bacteria 462959
1604 Ga0496121_0000123 3300048924 Bacteria 172448
1605 Ga0496121_0000192 3300048924 Bacteria 136529
1606 Ga0496121_0000723 3300048924 Bacteria 61128
1607 Ga0496121_0001342 3300048924 Bacteria 42142
1608 Ga0496121_0003762 3300048924 Bacteria 21233
1609 Ga0496121_0007935 3300048924 Bacteria 12686
1610 Ga0496121_0042102 3300048924 Bacteria 3980
1611 Ga0496121_0256596 3300048924 Bacteria 1209
1612 Ga0496122_0000768 3300048925 Bacteria 61953
1613 Ga0496122_0000989 3300048925 Bacteria 50786
1614 Ga0496122_0004681 3300048925 Bacteria 16797
1615 Ga0496122_0016352 3300048925 Bacteria 7027
1616 Ga0496122_0018871 3300048925 Bacteria 6339
1617 Ga0496122_0096901 3300048925 Bacteria 1987
1618 Ga0496122_0167190 3300048925 Bacteria 1332
1619 Ga0496123_0000335 3300048926 Bacteria 89251
1620 Ga0496123_0002151 3300048926 Bacteria 25170
1621 Ga0496123_0014434 3300048926 Bacteria 6550
1622 Ga0496123_0025449 3300048926 Bacteria 4461
1623 Ga0496123_0036342 3300048926 Bacteria 3495
1624 Ga0496123_0132702 3300048926 Bacteria 1376
1625 Ga0496124_0002634 3300048927 Bacteria 23074
1626 Ga0496124_0004095 3300048927 Bacteria 17241
1627 Ga0496124_0007495 3300048927 Bacteria 11585
1628 Ga0496124_0013848 3300048927 Bacteria 7844
1629 Ga0496124_0055489 3300048927 Bacteria 3348
1630 Ga0496124_0069946 3300048927 Bacteria 2912
1631 Ga0496124_0099075 3300048927 Bacteria 2364
1632 Ga0496124_0114970 3300048927 Bacteria 2160
1633 Ga0496124_0143093 3300048927 Bacteria 1884
1634 Ga0496124_0165871 3300048927 Bacteria 1716
1635 Ga0496125_0001515 3300048928 Bacteria 33290
1636 Ga0496125_0003252 3300048928 Bacteria 20009
1637 Ga0496125_0008331 3300048928 Bacteria 10876
1638 Ga0496125_0025437 3300048928 Bacteria 5419
1639 Ga0496125_0032413 3300048928 Bacteria 4642
1640 Ga0496125_0046577 3300048928 Bacteria 3637
1641 Ga0496125_0053957 3300048928 Bacteria 3290
1642 Ga0496125_0065865 3300048928 Bacteria 2866
1643 Ga0496125_0068194 3300048928 Bacteria 2799
1644 Ga0496126_0000641 3300048929 Bacteria 65115
1645 Ga0496126_0032755 3300048929 Bacteria 4893
1646 Ga0496126_0066897 3300048929 Bacteria 3212
1647 Ga0496126_0066969 3300048929 Bacteria 3210
1648 Ga0496126_0314963 3300048929 Bacteria 1288
1649 Ga0496126_0570053 3300048929 Bacteria 896
1650 Ga0495678_010008 3300049459 Bacteria 4639
1651 Ga0495678_069965 3300049459 Bacteria 1289
1652 Ga0495682_0106270 3300049460 Bacteria 1006
1653 Ga0501290_000032 3300049513 Bacteria 18418
1654 Ga0501292_000022 3300049515 Bacteria 47432
1655 Ga0501294_000025 3300049517 Bacteria 15053
1656 Ga0501298_005905 3300049521 Bacteria 1985
1657 Ga0501300_002150 3300049523 Bacteria 2932
1658 Ga0501335_004600 3300049551 Bacteria 1209
1659 Ga0501032_0001211 3300049569 Bacteria 20636
1660 Ga0501032_0090233 3300049569 Bacteria 2034
1661 Ga0501032_0307807 3300049569 Bacteria 1024
1662 Ga0501033_0087415 3300049570 Bacteria 2281
1663 Ga0501034_0003520 3300049571 Bacteria 17777
1664 Ga0501034_0268817 3300049571 Bacteria 1646
1665 Ga0501034_0318887 3300049571 Bacteria 1487
1666 Ga0501036_0219346 3300049572 Bacteria 1597
1667 Ga0501037_0004760 3300049573 Bacteria 9871
1668 Ga0501037_0045901 3300049573 Bacteria 3206
1669 Ga0501037_0053311 3300049573 Bacteria 2958
1670 Ga0501038_0019542 3300049574 Bacteria 6105
1671 Ga0501038_0282191 3300049574 Bacteria 1307
1672 Ga0501043_0014727 3300049579 Bacteria 6123
1673 Ga0501047_0008184 3300049581 Bacteria 9877
1674 Ga0501047_0019483 3300049581 Bacteria 6508
1675 Ga0501067_0000028 3300049583 Bacteria 88712
1676 Ga0501068_0001146 3300049584 Bacteria 14035
1677 Ga0501068_0047349 3300049584 Bacteria 2594
1678 Ga0501072_0084891 3300049588 Bacteria 2511
1679 Ga0501073_0000002 3300049589 Bacteria 323865
1680 Ga0501073_0006010 3300049589 Bacteria 9056
1681 Ga0501077_0000002 3300049593 Bacteria 159855
1682 Ga0501201_013483 3300049651 Bacteria 821
1683 Ga0501211_003056 3300049658 Bacteria 1740
1684 Ga0501222_000400 3300049662 Bacteria 6556
1685 Ga0501223_000022 3300049663 Bacteria 65110
1686 Ga0501223_000034 3300049663 Bacteria 49055
1687 Ga0501223_029285 3300049663 Bacteria 1071
1688 Ga0501224_000004 3300049664 Bacteria 169090
1689 Ga0501224_002903 3300049664 Bacteria 2367
1690 Ga0501233_000678 3300049668 Bacteria 5605
1691 Ga0501233_017526 3300049668 Bacteria 1496
1692 Ga0501235_002727 3300049669 Bacteria 3796
1693 Ga0501235_004878 3300049669 Bacteria 2907
1694 Ga0501235_009248 3300049669 Bacteria 2154
1695 Ga0501235_013806 3300049669 Bacteria 1779
1696 Ga0501249_016416 3300049679 Bacteria 1590
1697 Ga0501249_032561 3300049679 Bacteria 1166
1698 Ga0501257_000052 3300049686 Bacteria 32874
1699 Ga0501258_026691 3300049687 Bacteria 709
1700 Ga0501261_000127 3300049690 Bacteria 11409
1701 Ga0501225_0000048 3300049705 Bacteria 40596
1702 Ga0501225_0000061 3300049705 Bacteria 35280
1703 Ga0501225_0000236 3300049705 Bacteria 17239
1704 Ga0501225_0023793 3300049705 Bacteria 1687
1705 Ga0501080_0025413 3300049742 Bacteria 5496
1706 Ga0501080_0177414 3300049742 Unclassified 1962
1707 Ga0501083_0038171 3300049744 Bacteria 3266
1708 Ga0501262_010509 3300049759 Bacteria 1159
1709 Ga0501270_041363 3300049767 Bacteria 804
1710 Ga0501273_019975 3300049770 Bacteria 901
1711 Ga0501278_003561 3300049774 Bacteria 1109
1712 Ga0501279_000012 3300049775 Bacteria 80359
1713 Ga0501280_000005 3300049776 Bacteria 85174
1714 Ga0501280_000363 3300049776 Bacteria 11209
1715 Ga0501281_00448 3300049777 Bacteria 3982
1716 Ga0501282_001176 3300049778 Bacteria 2929
1717 Ga0501283_002129 3300049779 Bacteria 2569
1718 Ga0501035_0128611 3300049822 Bacteria 2209
1719 Ga0501035_0368634 3300049822 Bacteria 1199
1720 Ga0501035_0438833 3300049822 Bacteria 1082
1721 Ga0501044_0000250 3300049823 Bacteria 68405
1722 Ga0501044_0003057 3300049823 Bacteria 18932
1723 Ga0501044_0003301 3300049823 Bacteria 18176
1724 Ga0501044_0148961 3300049823 Bacteria 2323
1725 Ga0501044_0464736 3300049823 Bacteria 1170
1726 Ga0501226_000018 3300049853 Bacteria 147268
1727 nmdc:mga03683_69770_c1 3300050489 Bacteria 1500
1728 nmdc:mga03683_82244_c1 3300050489 Bacteria 1392
1729 nmdc:mga00v17_10860_c1 3300050491 Bacteria 4989
1730 nmdc:mga0k408_19120_c1 3300050493 Bacteria 3826
1731 nmdc:mga06z11_4_c1 3300050494 Bacteria 131352
1732 nmdc:mga04h51_7_c1 3300050495 Bacteria 109425
1733 nmdc:mga07m45_182425_c1 3300050496 Bacteria 1220
1734 nmdc:mga07m45_348_c1 3300050496 Bacteria 18873
1735 nmdc:mga07m45_50042_c1 3300050496 Bacteria 2354
1736 nmdc:mga06r32_2867_c1 3300050510 Bacteria 15468
1737 nmdc:mga08y16_147622_c1 3300050511 Bacteria 2444
1738 nmdc:mga08y16_24694_c1 3300050511 Bacteria 6342
1739 nmdc:mga08y16_26255_c1 3300050511 Bacteria 5253
1740 nmdc:mga0sz30_2296_c1 3300050516 Bacteria 6828
1741 Ga0495601_0106572 3300053077 Bacteria 1813
1742 Ga0500610_0000035 3300053079 Bacteria 47656
1743 Ga0500643_000201 3300053087 Bacteria 56872
1744 Ga0500643_000995 3300053087 Bacteria 17396
1745 Ga0500643_001246 3300053087 Bacteria 15078
1746 Ga0500643_001650 3300053087 Bacteria 12459
1747 Ga0500643_004016 3300053087 Bacteria 6797
1748 Ga0500643_004082 3300053087 Bacteria 6730
1749 Ga0500643_006065 3300053087 Bacteria 5107
1750 Ga0500643_006136 3300053087 Bacteria 5071
1751 Ga0500643_006920 3300053087 Bacteria 4662
1752 Ga0500647_0038833 3300053091 Bacteria 2280
1753 Ga0500651_0002188 3300053093 Bacteria 10235
1754 Ga0500641_0001729 3300053096 Bacteria 7766
1755 Ga0500641_0017266 3300053096 Bacteria 2697
1756 Ga0500556_0000013 3300053104 Bacteria 243797
1757 Ga0500569_011420 3300053109 Bacteria 2121
1758 Ga0500592_000062 3300053116 Bacteria 29528
1759 Ga0500592_000132 3300053116 Bacteria 16036
1760 Ga0500592_000967 3300053116 Bacteria 4683
1761 Ga0500592_005470 3300053116 Bacteria 2024
1762 Ga0500594_0075181 3300053118 Bacteria 1000
1763 Ga0500595_001117 3300053119 Bacteria 14878
1764 Ga0500595_003623 3300053119 Bacteria 7158
1765 Ga0500595_003862 3300053119 Bacteria 6881
1766 Ga0500595_013305 3300053119 Bacteria 3155
1767 Ga0500597_074084 3300053120 Bacteria 1473
1768 Ga0500608_001083 3300053122 Bacteria 9703
1769 Ga0500614_004554 3300053123 Bacteria 2924
1770 Ga0500614_005012 3300053123 Bacteria 2782
1771 Ga0500618_006224 3300053125 Bacteria 3525
1772 Ga0500618_015064 3300053125 Bacteria 1961
1773 Ga0500642_0000002 3300053130 Bacteria 795093
1774 Ga0500642_0001441 3300053130 Bacteria 6825
1775 Ga0500642_0003961 3300053130 Bacteria 4566
1776 Ga0500652_074493 3300053131 Bacteria 1410
1777 Ga0500655_000061 3300053133 Bacteria 29562
1778 Ga0500658_0000191 3300053134 Bacteria 29300
1779 Ga0500658_0044679 3300053134 Bacteria 1788
1780 Ga0500559_0000956 3300053136 Bacteria 18146
1781 Ga0500559_0005749 3300053136 Bacteria 5661
1782 Ga0500559_0013564 3300053136 Bacteria 3449
1783 Ga0500559_0046855 3300053136 Bacteria 1897
1784 Ga0500568_0001218 3300053139 Bacteria 17161
1785 Ga0500573_0000065 3300053140 Bacteria 64628
1786 Ga0500573_0070211 3300053140 Bacteria 1999
1787 Ga0500577_0086412 3300053142 Bacteria 1260
1788 Ga0500590_006067 3300053148 Bacteria 5859
1789 Ga0500590_020683 3300053148 Bacteria 3416
1790 Ga0500604_0002001 3300053151 Bacteria 5640
1791 Ga0500604_0006133 3300053151 Bacteria 3175
1792 Ga0500604_0075798 3300053151 Bacteria 1080
1793 Ga0500604_0157384 3300053151 Bacteria 773
1794 Ga0500616_0048284 3300053153 Bacteria 2257
1795 Ga0500619_005015 3300053154 Bacteria 2909
1796 Ga0500619_120861 3300053154 Bacteria 892
1797 Ga0500620_064666 3300053155 Bacteria 1250
1798 Ga0500622_0003437 3300053156 Bacteria 10591
1799 Ga0500624_000004 3300053157 Bacteria 196921
1800 Ga0500624_000068 3300053157 Bacteria 61139
1801 Ga0500624_000087 3300053157 Bacteria 47425
1802 Ga0500627_0000070 3300053158 Bacteria 41863
1803 Ga0500627_0000967 3300053158 Bacteria 7788
1804 Ga0500627_0001794 3300053158 Bacteria 6105
1805 Ga0500636_0003180 3300053177 Bacteria 9193
1806 Ga0500636_0015792 3300053177 Bacteria 4449
1807 Ga0500636_0087072 3300053177 Bacteria 1793
1808 Ga0500637_0000241 3300053178 Bacteria 20387
1809 Ga0500570_000268 3300053724 Bacteria 17871
1810 Ga0500576_017884 3300053725 Bacteria 3225
1811 Ga0500645_000162 3300053730 Bacteria 51937
1812 Ga0500645_000575 3300053730 Bacteria 23790
1813 Ga0500645_013077 3300053730 Bacteria 2672
1814 Ga0501084_0483141 3300054114 Unclassified 1047
1815 Ga0500661_000395 3300055283 Bacteria 8073
1816 Ga0501082_0152162 3300060353 Bacteria 2010
1817 Ga0466962_0001374 3300061719 Bacteria 11272
1818 Ga0466962_0024390 3300061719 Bacteria 2905
1819 Ga0466962_0094076 3300061719 Bacteria 1437
1820 Ga0466962_0224840 3300061719 Bacteria 919

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003791 Ga0055530_10011252 Ga0055530_100112523 203
2 3300026067 Ga0207678_10048808 Ga0207678_100488084 218
3 3300009101 Ga0105247_10268137 Ga0105247_102681372 222
4 3300053134 Ga0500658_0044679 Ga0500658_0044679_329_1015 222
5 3300037471 Ga0395905_0336991 Ga0395905_0336991_308_982 224
6 3300038443 Ga0395901_0180625 Ga0395901_0180625_1182_1856 224
7 3300044765 Ga0466970_0146826 Ga0466970_0146826_311_985 224
8 iso_pu_bacteria 2512564014 2512642729 224
9 iso_pu_bacteria 2582581305 2585263900 224
10 iso_pu_bacteria 2599185359 2600227509 224
11 iso_pu_bacteria 2643221541 2643726900 224
12 iso_pu_bacteria 2643221563 2643835070 224
13 iso_pu_bacteria 2643221588 2643951005 224
14 iso_pu_bacteria 2643221605 2644039057 224
15 iso_pu_bacteria 2643221606 2644046058 224
16 iso_pu_bacteria 2643221608 2644055997 224
17 iso_pu_bacteria 2643221622 2644125628 224
18 iso_pu_bacteria 2643221671 2644393131 224
19 iso_pu_bacteria 2751185897 2753766878 224
20 iso_pu_bacteria 2775507255 2778124454 224
21 iso_pu_bacteria 2808606401 2809061811 224
22 iso_pu_bacteria 2808606404 2809077775 224
23 iso_pu_bacteria 2808606405 2809082517 224
24 iso_pu_bacteria 2818991438 2819551149 224
25 iso_pu_bacteria 2818991466 2819716093 224
26 iso_pu_bacteria 2848297114 2848298120 224
27 iso_pu_bacteria 2852653556 2852655884 224
28 iso_pu_bacteria 2852680915 2852683062 224
29 iso_pu_bacteria 2879163058 2879165759 224
30 iso_pu_bacteria 2880518877 2880520006 224
31 iso_pu_bacteria 2882806704 2882809379 224
32 iso_pu_bacteria 2885427238 2885428996 224
33 iso_pu_bacteria 2885429604 2885432112 224
34 iso_pu_bacteria 2895880812 2895881168 224
35 iso_pu_bacteria 2896429255 2896431991 224
36 iso_pu_bacteria 2928027323 2928030821 224
37 iso_pu_bacteria 2928526807 2928528152 224
38 iso_pu_bacteria 2928968154 2928971340 224
39 iso_pu_bacteria 2946787523 2946789986 224
40 iso_pu_bacteria 2984555340 2984556313 224
41 iso_pu_bacteria 2984564862 2984565496 224
42 iso_pu_bacteria 2990265787 2990268398 224
43 iso_pu_bacteria 2993356040 2993356590 224
44 iso_pu_bacteria 2993693658 2993696570 224
45 iso_pu_bacteria 3000865235 3000868166 224
46 iso_pu_bacteria 8057101203 8057102022 224
47 3300011119 Ga0105246_10000160 Ga0105246_100001602 225
48 3300013307 Ga0157372_10366108 Ga0157372_103661083 225
49 3300037312 Ga0395899_0195738 Ga0395899_0195738_567_1244 225
50 3300037466 Ga0395898_0224392 Ga0395898_0224392_516_1193 225
51 3300048908 Ga0496105_0356795 Ga0496105_0356795_20_697 225
52 3300048917 Ga0496114_0473619 Ga0496114_0473619_330_1007 225
53 3300049823 Ga0501044_0464736 Ga0501044_0464736_137_814 225
54 3300005339 Ga0070660_100461292 Ga0070660_1004612921 226
55 3300005353 Ga0070669_100256532 Ga0070669_1002565322 226
56 3300005367 Ga0070667_100018496 Ga0070667_1000184966 226
57 3300005367 Ga0070667_100033284 Ga0070667_1000332844 226
58 3300005543 Ga0070672_100212193 Ga0070672_1002121932 226
59 3300005617 Ga0068859_100002392 Ga0068859_10000239216 226
60 3300005618 Ga0068864_100001110 Ga0068864_10000111010 226
61 3300005841 Ga0068863_100001056 Ga0068863_10000105616 226
62 3300005842 Ga0068858_100003145 Ga0068858_1000031457 226
63 3300005843 Ga0068860_100002768 Ga0068860_10000276816 226
64 3300006931 Ga0097620_100002392 Ga0097620_10000239216 226
65 3300009092 Ga0105250_10036662 Ga0105250_100366622 226
66 3300009148 Ga0105243_10000333 Ga0105243_100003337 226
67 3300009177 Ga0105248_10001320 Ga0105248_1000132019 226
68 3300009177 Ga0105248_10003519 Ga0105248_1000351915 226
69 3300011119 Ga0105246_10385634 Ga0105246_103856342 226
70 3300013102 Ga0157371_10000110 Ga0157371_1000011014 226
71 3300013104 Ga0157370_10002746 Ga0157370_1000274615 226
72 3300013306 Ga0163162_10037392 Ga0163162_100373923 226
73 3300014325 Ga0163163_10004062 Ga0163163_100040622 226
74 3300014968 Ga0157379_10036954 Ga0157379_100369544 226
75 3300014968 Ga0157379_10146843 Ga0157379_101468432 226
76 3300025711 Ga0207696_1034473 Ga0207696_10344732 226
77 3300025923 Ga0207681_10276935 Ga0207681_102769352 226
78 3300025940 Ga0207691_10729947 Ga0207691_107299472 226
79 3300025941 Ga0207711_10000617 Ga0207711_1000061713 226
80 3300025941 Ga0207711_10000869 Ga0207711_1000086916 226
81 3300025960 Ga0207651_10092863 Ga0207651_100928631 226
82 3300025961 Ga0207712_10018385 Ga0207712_100183854 226
83 3300025986 Ga0207658_10002396 Ga0207658_1000239612 226
84 3300025986 Ga0207658_10009089 Ga0207658_100090894 226
85 3300026035 Ga0207703_10004152 Ga0207703_100041522 226
86 3300026088 Ga0207641_10001513 Ga0207641_1000151316 226
87 3300026095 Ga0207676_10040107 Ga0207676_100401072 226
88 3300028381 Ga0268264_10020464 Ga0268264_100204647 226
89 3300031901 Ga0307406_10049711 Ga0307406_100497113 226
90 3300046491 Ga0495584_0135657 Ga0495584_0135657_126_806 226
91 3300046492 Ga0495585_0138670 Ga0495585_0138670_398_1078 226
92 3300046501 Ga0495607_0056599 Ga0495607_0056599_759_1439 226
93 3300046506 Ga0495583_0000447 Ga0495583_0000447_8167_8847 226
94 3300046506 Ga0495583_0011684 Ga0495583_0011684_45_725 226
95 3300046506 Ga0495583_0018285 Ga0495583_0018285_2728_3408 226
96 3300046506 Ga0495583_0074564 Ga0495583_0074564_780_1460 226
97 3300046507 Ga0495606_0000534 Ga0495606_0000534_18481_19161 226
98 3300046518 Ga0495631_0014327 Ga0495631_0014327_545_1225 226
99 3300046522 Ga0495643_0000754 Ga0495643_0000754_33013_33693 226
100 3300046522 Ga0495643_0003791 Ga0495643_0003791_7584_8264 226
101 3300046522 Ga0495643_0086352 Ga0495643_0086352_774_1454 226
102 3300046524 Ga0495648_0001562 Ga0495648_0001562_18980_19660 226
103 3300046525 Ga0495663_0001876 Ga0495663_0001876_2704_3384 226
104 3300046542 Ga0495597_0072695 Ga0495597_0072695_529_1209 226
105 3300046558 Ga0495633_0002550 Ga0495633_0002550_11396_12076 226
106 3300046616 Ga0495668_0000431 Ga0495668_0000431_15660_16340 226
107 3300046648 Ga0495611_0009356 Ga0495611_0009356_2507_3187 226
108 3300046648 Ga0495611_0087078 Ga0495611_0087078_468_1148 226
109 3300046660 Ga0495625_0006071 Ga0495625_0006071_9439_10119 226
110 3300046660 Ga0495625_0041164 Ga0495625_0041164_1390_2070 226
111 3300046684 Ga0495669_0000465 Ga0495669_0000465_15521_16201 226
112 3300046691 Ga0495670_0000017 Ga0495670_0000017_57211_57891 226
113 3300046691 Ga0495670_0049079 Ga0495670_0049079_1390_2070 226
114 3300046694 Ga0495649_0031941 Ga0495649_0031941_1412_2092 226
115 3300047323 Ga0495683_0026175 Ga0495683_0026175_1707_2387 226
116 3300047443 Ga0495687_000745 Ga0495687_000745_18507_19187 226
117 3300047443 Ga0495687_001214 Ga0495687_001214_2691_3371 226
118 3300047445 Ga0495677_0017332 Ga0495677_0017332_1890_2570 226
119 3300047470 Ga0495681_0011686 Ga0495681_0011686_3236_3916 226
120 3300047470 Ga0495681_0109971 Ga0495681_0109971_475_1155 226
121 3300048913 Ga0496110_0364109 Ga0496110_0364109_358_1038 226
122 3300048918 Ga0496115_0506708 Ga0496115_0506708_248_955 226
123 3300053079 Ga0500610_0000035 Ga0500610_0000035_2754_3434 226
124 3300053130 Ga0500642_0003961 Ga0500642_0003961_2615_3295 226
125 3300053730 Ga0500645_000162 Ga0500645_000162_48463_49143 226
126 3300005336 Ga0070680_100004126 Ga0070680_1000041267 227
127 3300005577 Ga0068857_100376789 Ga0068857_1003767893 227
128 3300005844 Ga0068862_100262608 Ga0068862_1002626083 227
129 3300013105 Ga0157369_10660329 Ga0157369_106603291 227
130 3300025917 Ga0207660_10000484 Ga0207660_1000048439 227
131 3300028380 Ga0268265_10007222 Ga0268265_100072223 227
132 3300046514 Ga0495618_0148847 Ga0495618_0148847_448_1131 227
133 3300046516 Ga0495628_0015737 Ga0495628_0015737_5457_6140 227
134 3300000041 ARcpr5oldR_c000545 ARcpr5oldR_0005452 228
135 3300001904 JGI24736J21556_1000055 JGI24736J21556_10000557 228
136 3300001904 JGI24736J21556_1002006 JGI24736J21556_10020062 228
137 3300001904 JGI24736J21556_1007363 JGI24736J21556_10073632 228
138 3300001915 JGI24741J21665_1001039 JGI24741J21665_10010396 228
139 3300001915 JGI24741J21665_1002806 JGI24741J21665_10028064 228
140 3300001977 JGI24746J21847_1001632 JGI24746J21847_10016322 228
141 3300001979 JGI24740J21852_10002783 JGI24740J21852_100027833 228
142 3300001979 JGI24740J21852_10005827 JGI24740J21852_100058275 228
143 3300001979 JGI24740J21852_10021430 JGI24740J21852_100214302 228
144 3300001989 JGI24739J22299_10003678 JGI24739J22299_100036784 228
145 3300001989 JGI24739J22299_10015661 JGI24739J22299_100156613 228
146 3300001989 JGI24739J22299_10015931 JGI24739J22299_100159312 228
147 3300001990 JGI24737J22298_10001549 JGI24737J22298_100015492 228
148 3300001990 JGI24737J22298_10005900 JGI24737J22298_100059002 228
149 3300001990 JGI24737J22298_10012353 JGI24737J22298_100123534 228
150 3300001990 JGI24737J22298_10018048 JGI24737J22298_100180483 228
151 3300001990 JGI24737J22298_10022246 JGI24737J22298_100222462 228
152 3300001990 JGI24737J22298_10074862 JGI24737J22298_100748621 228
153 3300002067 JGI24735J21928_10000941 JGI24735J21928_100009412 228
154 3300002067 JGI24735J21928_10001307 JGI24735J21928_100013077 228
155 3300002067 JGI24735J21928_10002704 JGI24735J21928_100027044 228
156 3300002067 JGI24735J21928_10006631 JGI24735J21928_100066313 228
157 3300002067 JGI24735J21928_10013163 JGI24735J21928_100131634 228
158 3300002067 JGI24735J21928_10017829 JGI24735J21928_100178292 228
159 3300002067 JGI24735J21928_10029465 JGI24735J21928_100294652 228
160 3300002075 JGI24738J21930_10000616 JGI24738J21930_100006162 228
161 3300002075 JGI24738J21930_10000884 JGI24738J21930_100008843 228
162 3300002076 JGI24749J21850_1000042 JGI24749J21850_100004228 228
163 3300002076 JGI24749J21850_1000355 JGI24749J21850_10003555 228
164 3300002077 JGI24744J21845_10012406 JGI24744J21845_100124062 228
165 3300002239 JGI24034J26672_10000011 JGI24034J26672_10000011104 228
166 3300002244 JGI24742J22300_10020434 JGI24742J22300_100204342 228
167 3300002459 JGI24751J29686_10000127 JGI24751J29686_1000012742 228
168 3300002459 JGI24751J29686_10000252 JGI24751J29686_100002528 228
169 3300002459 JGI24751J29686_10000799 JGI24751J29686_100007996 228
170 3300002774 JGI25150J39212_1003367 JGI25150J39212_10033672 228
171 3300003187 JGI25151J46595_10072970 JGI25151J46595_100729702 228
172 3300003214 JGI25165J46597_1000145 JGI25165J46597_1000145127 228
173 3300003215 JGI25153J46596_10000183 JGI25153J46596_1000018351 228
174 3300003215 JGI25153J46596_10020315 JGI25153J46596_100203153 228
175 3300003762 Ga0055542_1000226 Ga0055542_100022651 228
176 3300003763 Ga0055529_1000243 Ga0055529_100024351 228
177 3300003771 Ga0055526_1002892 Ga0055526_100289210 228
178 3300003773 Ga0055537_1002641 Ga0055537_10026415 228
179 3300003775 Ga0055524_1000601 Ga0055524_10006015 228
180 3300003781 Ga0055536_1008296 Ga0055536_10082964 228
181 3300003781 Ga0055536_1009289 Ga0055536_10092892 228
182 3300003784 Ga0055534_1004204 Ga0055534_10042042 228
183 3300003790 Ga0055528_1045401 Ga0055528_10454011 228
184 3300003791 Ga0055530_10000064 Ga0055530_1000006489 228
185 3300003791 Ga0055530_10001803 Ga0055530_100018038 228
186 3300003791 Ga0055530_10009805 Ga0055530_100098053 228
187 3300003791 Ga0055530_10051278 Ga0055530_100512781 228
188 3300003792 Ga0055540_1003004 Ga0055540_10030044 228
189 3300003794 Ga0055531_10000073 Ga0055531_1000007389 228
190 3300003794 Ga0055531_10002334 Ga0055531_100023347 228
191 3300005262 Ga0065165_1018160 Ga0065165_10181604 228
192 3300005262 Ga0065165_1021311 Ga0065165_10213113 228
193 3300005262 Ga0065165_1033240 Ga0065165_10332402 228
194 3300005288 Ga0065714_10021788 Ga0065714_100217882 228
195 3300005289 Ga0065704_10002228 Ga0065704_100022284 228
196 3300005289 Ga0065704_10006136 Ga0065704_100061362 228
197 3300005289 Ga0065704_10100082 Ga0065704_101000823 228
198 3300005290 Ga0065712_10086165 Ga0065712_100861653 228
199 3300005293 Ga0065715_10000723 Ga0065715_1000072310 228
200 3300005293 Ga0065715_10140791 Ga0065715_101407912 228
201 3300005295 Ga0065707_10022673 Ga0065707_100226733 228
202 3300005295 Ga0065707_10081947 Ga0065707_1008194717 228
203 3300005295 Ga0065707_10084204 Ga0065707_100842042 228
204 3300005295 Ga0065707_10092852 Ga0065707_100928523 228
205 3300005295 Ga0065707_10149683 Ga0065707_101496832 228
206 3300005295 Ga0065707_10155141 Ga0065707_101551411 228
207 3300005327 Ga0070658_10000002 Ga0070658_1000000215 228
208 3300005327 Ga0070658_10001023 Ga0070658_1000102315 228
209 3300005327 Ga0070658_10001239 Ga0070658_100012398 228
210 3300005327 Ga0070658_10001587 Ga0070658_100015871 228
211 3300005327 Ga0070658_10005674 Ga0070658_100056744 228
212 3300005327 Ga0070658_10011225 Ga0070658_100112253 228
213 3300005327 Ga0070658_10041995 Ga0070658_100419954 228
214 3300005327 Ga0070658_10059638 Ga0070658_100596383 228
215 3300005327 Ga0070658_10168318 Ga0070658_101683182 228
216 3300005327 Ga0070658_10357620 Ga0070658_103576202 228
217 3300005327 Ga0070658_10389547 Ga0070658_103895471 228
218 3300005327 Ga0070658_10562760 Ga0070658_105627601 228
219 3300005327 Ga0070658_10654532 Ga0070658_106545321 228
220 3300005328 Ga0070676_10001164 Ga0070676_100011644 228
221 3300005328 Ga0070676_10010507 Ga0070676_100105073 228
222 3300005328 Ga0070676_10043737 Ga0070676_100437373 228
223 3300005329 Ga0070683_100012975 Ga0070683_1000129756 228
224 3300005329 Ga0070683_100013276 Ga0070683_1000132763 228
225 3300005329 Ga0070683_100020320 Ga0070683_1000203206 228
226 3300005330 Ga0070690_100000003 Ga0070690_10000000318 228
227 3300005330 Ga0070690_100010371 Ga0070690_1000103712 228
228 3300005331 Ga0070670_100000069 Ga0070670_1000000698 228
229 3300005331 Ga0070670_100000632 Ga0070670_10000063214 228
230 3300005331 Ga0070670_100001870 Ga0070670_10000187014 228
231 3300005331 Ga0070670_100011438 Ga0070670_1000114386 228
232 3300005331 Ga0070670_100025047 Ga0070670_1000250473 228
233 3300005331 Ga0070670_100046365 Ga0070670_1000463654 228
234 3300005331 Ga0070670_100113920 Ga0070670_1001139202 228
235 3300005331 Ga0070670_100140771 Ga0070670_1001407711 228
236 3300005331 Ga0070670_100537654 Ga0070670_1005376541 228
237 3300005333 Ga0070677_10000298 Ga0070677_100002986 228
238 3300005333 Ga0070677_10209202 Ga0070677_102092021 228
239 3300005334 Ga0068869_100000516 Ga0068869_1000005164 228
240 3300005334 Ga0068869_100155579 Ga0068869_1001555792 228
241 3300005335 Ga0070666_10000171 Ga0070666_100001718 228
242 3300005335 Ga0070666_10000176 Ga0070666_1000017619 228
243 3300005335 Ga0070666_10080521 Ga0070666_100805213 228
244 3300005336 Ga0070680_100002613 Ga0070680_1000026135 228
245 3300005336 Ga0070680_100006436 Ga0070680_1000064369 228
246 3300005336 Ga0070680_100045992 Ga0070680_1000459921 228
247 3300005336 Ga0070680_100051273 Ga0070680_1000512732 228
248 3300005336 Ga0070680_100108499 Ga0070680_1001084994 228
249 3300005336 Ga0070680_100623775 Ga0070680_1006237751 228
250 3300005338 Ga0068868_100000051 Ga0068868_10000005120 228
251 3300005338 Ga0068868_100004352 Ga0068868_10000435210 228
252 3300005339 Ga0070660_100000535 Ga0070660_1000005357 228
253 3300005339 Ga0070660_100001009 Ga0070660_10000100919 228
254 3300005339 Ga0070660_100001090 Ga0070660_10000109013 228
255 3300005339 Ga0070660_100008568 Ga0070660_1000085682 228
256 3300005339 Ga0070660_100012573 Ga0070660_1000125735 228
257 3300005339 Ga0070660_100047956 Ga0070660_1000479563 228
258 3300005339 Ga0070660_100062453 Ga0070660_1000624534 228
259 3300005339 Ga0070660_100091528 Ga0070660_1000915281 228
260 3300005339 Ga0070660_100100434 Ga0070660_1001004342 228
261 3300005339 Ga0070660_100137844 Ga0070660_1001378442 228
262 3300005339 Ga0070660_100356156 Ga0070660_1003561562 228
263 3300005339 Ga0070660_100388522 Ga0070660_1003885221 228
264 3300005339 Ga0070660_100404246 Ga0070660_1004042462 228
265 3300005339 Ga0070660_100417308 Ga0070660_1004173082 228
266 3300005340 Ga0070689_100001889 Ga0070689_10000188910 228
267 3300005341 Ga0070691_10001812 Ga0070691_100018122 228
268 3300005344 Ga0070661_100002722 Ga0070661_1000027225 228
269 3300005344 Ga0070661_100008171 Ga0070661_1000081717 228
270 3300005344 Ga0070661_100028218 Ga0070661_1000282183 228
271 3300005344 Ga0070661_100030971 Ga0070661_1000309712 228
272 3300005344 Ga0070661_100047855 Ga0070661_1000478554 228
273 3300005344 Ga0070661_100063449 Ga0070661_1000634493 228
274 3300005344 Ga0070661_100154403 Ga0070661_1001544032 228
275 3300005345 Ga0070692_10012663 Ga0070692_100126634 228
276 3300005345 Ga0070692_10032690 Ga0070692_100326902 228
277 3300005345 Ga0070692_10032895 Ga0070692_100328953 228
278 3300005345 Ga0070692_10080755 Ga0070692_100807553 228
279 3300005347 Ga0070668_100000001 Ga0070668_100000001174 228
280 3300005347 Ga0070668_100000172 Ga0070668_10000017237 228
281 3300005347 Ga0070668_100002241 Ga0070668_1000022416 228
282 3300005347 Ga0070668_100010271 Ga0070668_1000102716 228
283 3300005347 Ga0070668_100014364 Ga0070668_1000143642 228
284 3300005347 Ga0070668_100017822 Ga0070668_1000178225 228
285 3300005347 Ga0070668_100036952 Ga0070668_1000369522 228
286 3300005347 Ga0070668_100069881 Ga0070668_1000698812 228
287 3300005347 Ga0070668_100106024 Ga0070668_1001060243 228
288 3300005347 Ga0070668_100432204 Ga0070668_1004322042 228
289 3300005353 Ga0070669_100000001 Ga0070669_10000000151 228
290 3300005353 Ga0070669_100000014 Ga0070669_100000014101 228
291 3300005353 Ga0070669_100000105 Ga0070669_1000001057 228
292 3300005353 Ga0070669_100012372 Ga0070669_1000123724 228
293 3300005353 Ga0070669_100043276 Ga0070669_1000432762 228
294 3300005353 Ga0070669_100059287 Ga0070669_1000592874 228
295 3300005353 Ga0070669_100075906 Ga0070669_1000759064 228
296 3300005353 Ga0070669_100135383 Ga0070669_1001353834 228
297 3300005353 Ga0070669_100203592 Ga0070669_1002035922 228
298 3300005353 Ga0070669_100245917 Ga0070669_1002459172 228
299 3300005353 Ga0070669_100651298 Ga0070669_1006512982 228
300 3300005353 Ga0070669_100960185 Ga0070669_1009601851 228
301 3300005354 Ga0070675_100001645 Ga0070675_10000164511 228
302 3300005354 Ga0070675_100005264 Ga0070675_10000526410 228
303 3300005354 Ga0070675_100021872 Ga0070675_1000218722 228
304 3300005354 Ga0070675_100209018 Ga0070675_1002090182 228
305 3300005355 Ga0070671_100000007 Ga0070671_100000007216 228
306 3300005355 Ga0070671_100000114 Ga0070671_10000011413 228
307 3300005355 Ga0070671_100000167 Ga0070671_10000016718 228
308 3300005355 Ga0070671_100001248 Ga0070671_10000124826 228
309 3300005355 Ga0070671_100005733 Ga0070671_1000057339 228
310 3300005355 Ga0070671_100006441 Ga0070671_1000064416 228
311 3300005355 Ga0070671_100011003 Ga0070671_1000110036 228
312 3300005355 Ga0070671_100031798 Ga0070671_1000317982 228
313 3300005355 Ga0070671_100106101 Ga0070671_1001061012 228
314 3300005355 Ga0070671_100107819 Ga0070671_1001078192 228
315 3300005355 Ga0070671_100108009 Ga0070671_1001080093 228
316 3300005355 Ga0070671_100120407 Ga0070671_1001204072 228
317 3300005355 Ga0070671_100256710 Ga0070671_1002567102 228
318 3300005356 Ga0070674_100000834 Ga0070674_1000008344 228
319 3300005356 Ga0070674_100007215 Ga0070674_1000072158 228
320 3300005356 Ga0070674_100349969 Ga0070674_1003499691 228
321 3300005364 Ga0070673_100000003 Ga0070673_10000000394 228
322 3300005364 Ga0070673_100004726 Ga0070673_10000472610 228
323 3300005364 Ga0070673_100093549 Ga0070673_1000935491 228
324 3300005365 Ga0070688_100000787 Ga0070688_10000078714 228
325 3300005366 Ga0070659_100003690 Ga0070659_10000369011 228
326 3300005366 Ga0070659_100007611 Ga0070659_1000076112 228
327 3300005366 Ga0070659_100019472 Ga0070659_1000194727 228
328 3300005366 Ga0070659_100028192 Ga0070659_1000281925 228
329 3300005366 Ga0070659_100035798 Ga0070659_1000357982 228
330 3300005366 Ga0070659_100046264 Ga0070659_1000462642 228
331 3300005366 Ga0070659_100059738 Ga0070659_1000597382 228
332 3300005366 Ga0070659_100068177 Ga0070659_1000681772 228
333 3300005366 Ga0070659_100087676 Ga0070659_1000876762 228
334 3300005366 Ga0070659_100110256 Ga0070659_1001102564 228
335 3300005366 Ga0070659_100223467 Ga0070659_1002234671 228
336 3300005366 Ga0070659_100290385 Ga0070659_1002903851 228
337 3300005366 Ga0070659_100337263 Ga0070659_1003372633 228
338 3300005366 Ga0070659_100396533 Ga0070659_1003965331 228
339 3300005366 Ga0070659_100546966 Ga0070659_1005469661 228
340 3300005366 Ga0070659_100605436 Ga0070659_1006054361 228
341 3300005367 Ga0070667_100000006 Ga0070667_100000006119 228
342 3300005367 Ga0070667_100000199 Ga0070667_1000001996 228
343 3300005367 Ga0070667_100000205 Ga0070667_10000020542 228
344 3300005367 Ga0070667_100000269 Ga0070667_10000026949 228
345 3300005367 Ga0070667_100002790 Ga0070667_1000027907 228
346 3300005367 Ga0070667_100003346 Ga0070667_1000033467 228
347 3300005367 Ga0070667_100004435 Ga0070667_1000044357 228
348 3300005367 Ga0070667_100004844 Ga0070667_10000484412 228
349 3300005367 Ga0070667_100006901 Ga0070667_1000069013 228
350 3300005367 Ga0070667_100041466 Ga0070667_1000414661 228
351 3300005367 Ga0070667_100121644 Ga0070667_1001216444 228
352 3300005367 Ga0070667_100414642 Ga0070667_1004146422 228
353 3300005367 Ga0070667_100553942 Ga0070667_1005539422 228
354 3300005367 Ga0070667_100754841 Ga0070667_1007548411 228
355 3300005435 Ga0070714_100018994 Ga0070714_1000189943 228
356 3300005435 Ga0070714_100148127 Ga0070714_1001481272 228
357 3300005435 Ga0070714_100324376 Ga0070714_1003243762 228
358 3300005436 Ga0070713_100002001 Ga0070713_1000020014 228
359 3300005436 Ga0070713_100046027 Ga0070713_1000460273 228
360 3300005438 Ga0070701_10090529 Ga0070701_100905292 228
361 3300005440 Ga0070705_100200354 Ga0070705_1002003541 228
362 3300005441 Ga0070700_100087029 Ga0070700_1000870292 228
363 3300005455 Ga0070663_100008984 Ga0070663_1000089846 228
364 3300005455 Ga0070663_100016432 Ga0070663_1000164324 228
365 3300005455 Ga0070663_100018085 Ga0070663_1000180854 228
366 3300005455 Ga0070663_100039410 Ga0070663_1000394104 228
367 3300005455 Ga0070663_100039531 Ga0070663_1000395314 228
368 3300005455 Ga0070663_100073266 Ga0070663_1000732662 228
369 3300005455 Ga0070663_100146079 Ga0070663_1001460792 228
370 3300005455 Ga0070663_100255043 Ga0070663_1002550432 228
371 3300005455 Ga0070663_100270350 Ga0070663_1002703502 228
372 3300005456 Ga0070678_100071898 Ga0070678_1000718985 228
373 3300005456 Ga0070678_100077133 Ga0070678_1000771334 228
374 3300005456 Ga0070678_100100682 Ga0070678_1001006822 228
375 3300005456 Ga0070678_100124947 Ga0070678_1001249472 228
376 3300005457 Ga0070662_100000256 Ga0070662_1000002566 228
377 3300005457 Ga0070662_100002166 Ga0070662_10000216611 228
378 3300005457 Ga0070662_100004549 Ga0070662_1000045495 228
379 3300005457 Ga0070662_100007026 Ga0070662_1000070266 228
380 3300005457 Ga0070662_100029156 Ga0070662_1000291565 228
381 3300005457 Ga0070662_100053442 Ga0070662_1000534422 228
382 3300005457 Ga0070662_100106383 Ga0070662_1001063832 228
383 3300005457 Ga0070662_100118648 Ga0070662_1001186482 228
384 3300005457 Ga0070662_100244983 Ga0070662_1002449832 228
385 3300005457 Ga0070662_100294902 Ga0070662_1002949022 228
386 3300005458 Ga0070681_10189927 Ga0070681_101899272 228
387 3300005458 Ga0070681_10864041 Ga0070681_108640411 228
388 3300005459 Ga0068867_100000001 Ga0068867_100000001120 228
389 3300005459 Ga0068867_100008403 Ga0068867_1000084034 228
390 3300005459 Ga0068867_100076754 Ga0068867_1000767542 228
391 3300005466 Ga0070685_10000034 Ga0070685_1000003434 228
392 3300005466 Ga0070685_10008389 Ga0070685_100083898 228
393 3300005466 Ga0070685_10009198 Ga0070685_100091985 228
394 3300005530 Ga0070679_100008946 Ga0070679_1000089463 228
395 3300005530 Ga0070679_100021647 Ga0070679_1000216472 228
396 3300005530 Ga0070679_100078668 Ga0070679_1000786684 228
397 3300005530 Ga0070679_100348636 Ga0070679_1003486361 228
398 3300005530 Ga0070679_100443054 Ga0070679_1004430542 228
399 3300005530 Ga0070679_100475045 Ga0070679_1004750452 228
400 3300005530 Ga0070679_100524899 Ga0070679_1005248992 228
401 3300005530 Ga0070679_100554973 Ga0070679_1005549731 228
402 3300005535 Ga0070684_100031151 Ga0070684_1000311517 228
403 3300005535 Ga0070684_100210818 Ga0070684_1002108182 228
404 3300005539 Ga0068853_100001824 Ga0068853_1000018245 228
405 3300005539 Ga0068853_100088133 Ga0068853_1000881334 228
406 3300005539 Ga0068853_100209240 Ga0068853_1002092402 228
407 3300005539 Ga0068853_100331927 Ga0068853_1003319272 228
408 3300005543 Ga0070672_100001894 Ga0070672_10000189411 228
409 3300005543 Ga0070672_100005990 Ga0070672_1000059902 228
410 3300005543 Ga0070672_100044638 Ga0070672_1000446382 228
411 3300005543 Ga0070672_100098283 Ga0070672_1000982834 228
412 3300005544 Ga0070686_100000023 Ga0070686_10000002318 228
413 3300005546 Ga0070696_100004335 Ga0070696_1000043353 228
414 3300005546 Ga0070696_100242508 Ga0070696_1002425082 228
415 3300005547 Ga0070693_100061864 Ga0070693_1000618644 228
416 3300005547 Ga0070693_100189670 Ga0070693_1001896702 228
417 3300005548 Ga0070665_100000019 Ga0070665_100000019404 228
418 3300005548 Ga0070665_100000101 Ga0070665_10000010129 228
419 3300005548 Ga0070665_100000564 Ga0070665_10000056416 228
420 3300005548 Ga0070665_100015602 Ga0070665_1000156022 228
421 3300005548 Ga0070665_100055102 Ga0070665_1000551025 228
422 3300005548 Ga0070665_100059573 Ga0070665_1000595732 228
423 3300005549 Ga0070704_100771805 Ga0070704_1007718051 228
424 3300005563 Ga0068855_100018758 Ga0068855_1000187589 228
425 3300005563 Ga0068855_100020360 Ga0068855_1000203601 228
426 3300005563 Ga0068855_100073668 Ga0068855_1000736684 228
427 3300005563 Ga0068855_100123029 Ga0068855_1001230292 228
428 3300005563 Ga0068855_100260121 Ga0068855_1002601213 228
429 3300005563 Ga0068855_100405859 Ga0068855_1004058592 228
430 3300005563 Ga0068855_100467981 Ga0068855_1004679812 228
431 3300005563 Ga0068855_100646795 Ga0068855_1006467952 228
432 3300005564 Ga0070664_100010309 Ga0070664_1000103095 228
433 3300005564 Ga0070664_100020015 Ga0070664_1000200156 228
434 3300005564 Ga0070664_100028682 Ga0070664_1000286823 228
435 3300005564 Ga0070664_100044606 Ga0070664_1000446065 228
436 3300005564 Ga0070664_100049709 Ga0070664_1000497093 228
437 3300005564 Ga0070664_100070763 Ga0070664_1000707632 228
438 3300005564 Ga0070664_100132094 Ga0070664_1001320945 228
439 3300005564 Ga0070664_100152321 Ga0070664_1001523212 228
440 3300005564 Ga0070664_100558535 Ga0070664_1005585352 228
441 3300005564 Ga0070664_100635701 Ga0070664_1006357012 228
442 3300005577 Ga0068857_100008394 Ga0068857_1000083946 228
443 3300005577 Ga0068857_100017580 Ga0068857_1000175804 228
444 3300005577 Ga0068857_100044761 Ga0068857_1000447613 228
445 3300005577 Ga0068857_100068314 Ga0068857_1000683144 228
446 3300005577 Ga0068857_100111128 Ga0068857_1001111283 228
447 3300005577 Ga0068857_100334167 Ga0068857_1003341672 228
448 3300005577 Ga0068857_100364475 Ga0068857_1003644752 228
449 3300005577 Ga0068857_100406853 Ga0068857_1004068532 228
450 3300005577 Ga0068857_100624462 Ga0068857_1006244622 228
451 3300005578 Ga0068854_100011748 Ga0068854_1000117483 228
452 3300005578 Ga0068854_100036144 Ga0068854_1000361442 228
453 3300005578 Ga0068854_100044863 Ga0068854_1000448632 228
454 3300005578 Ga0068854_100270133 Ga0068854_1002701332 228
455 3300005578 Ga0068854_100384393 Ga0068854_1003843932 228
456 3300005614 Ga0068856_100012678 Ga0068856_1000126789 228
457 3300005614 Ga0068856_100021146 Ga0068856_1000211466 228
458 3300005614 Ga0068856_100031920 Ga0068856_1000319203 228
459 3300005614 Ga0068856_100033046 Ga0068856_1000330462 228
460 3300005614 Ga0068856_100072344 Ga0068856_1000723445 228
461 3300005614 Ga0068856_100087901 Ga0068856_1000879012 228
462 3300005614 Ga0068856_100126627 Ga0068856_1001266272 228
463 3300005616 Ga0068852_100078407 Ga0068852_1000784073 228
464 3300005616 Ga0068852_100105555 Ga0068852_1001055552 228
465 3300005616 Ga0068852_100148161 Ga0068852_1001481613 228
466 3300005616 Ga0068852_100218226 Ga0068852_1002182262 228
467 3300005616 Ga0068852_100459718 Ga0068852_1004597182 228
468 3300005616 Ga0068852_100789171 Ga0068852_1007891712 228
469 3300005617 Ga0068859_100000787 Ga0068859_1000007872 228
470 3300005617 Ga0068859_100000965 Ga0068859_10000096529 228
471 3300005617 Ga0068859_100001280 Ga0068859_1000012805 228
472 3300005617 Ga0068859_100009260 Ga0068859_1000092601 228
473 3300005617 Ga0068859_100016862 Ga0068859_1000168626 228
474 3300005617 Ga0068859_100031931 Ga0068859_1000319314 228
475 3300005617 Ga0068859_100038356 Ga0068859_1000383565 228
476 3300005617 Ga0068859_100046234 Ga0068859_1000462343 228
477 3300005617 Ga0068859_100083931 Ga0068859_1000839313 228
478 3300005617 Ga0068859_100199811 Ga0068859_1001998113 228
479 3300005618 Ga0068864_100000079 Ga0068864_1000000798 228
480 3300005618 Ga0068864_100000080 Ga0068864_10000008015 228
481 3300005618 Ga0068864_100000809 Ga0068864_10000080913 228
482 3300005618 Ga0068864_100001128 Ga0068864_1000011282 228
483 3300005618 Ga0068864_100011580 Ga0068864_1000115804 228
484 3300005618 Ga0068864_100041232 Ga0068864_1000412321 228
485 3300005618 Ga0068864_100061135 Ga0068864_1000611353 228
486 3300005618 Ga0068864_100229254 Ga0068864_1002292542 228
487 3300005719 Ga0068861_100000094 Ga0068861_10000009414 228
488 3300005719 Ga0068861_100002455 Ga0068861_1000024555 228
489 3300005719 Ga0068861_100006944 Ga0068861_1000069446 228
490 3300005719 Ga0068861_100028619 Ga0068861_1000286195 228
491 3300005719 Ga0068861_100054275 Ga0068861_1000542754 228
492 3300005719 Ga0068861_100061239 Ga0068861_1000612393 228
493 3300005719 Ga0068861_100093703 Ga0068861_1000937032 228
494 3300005719 Ga0068861_100260690 Ga0068861_1002606902 228
495 3300005834 Ga0068851_10008753 Ga0068851_100087535 228
496 3300005834 Ga0068851_10017808 Ga0068851_100178083 228
497 3300005834 Ga0068851_10037256 Ga0068851_100372563 228
498 3300005834 Ga0068851_10177300 Ga0068851_101773002 228
499 3300005834 Ga0068851_10225904 Ga0068851_102259042 228
500 3300005841 Ga0068863_100000029 Ga0068863_10000002964 228
501 3300005841 Ga0068863_100000043 Ga0068863_10000004348 228
502 3300005841 Ga0068863_100000081 Ga0068863_10000008192 228
503 3300005841 Ga0068863_100000087 Ga0068863_10000008715 228
504 3300005841 Ga0068863_100000806 Ga0068863_10000080612 228
505 3300005841 Ga0068863_100006288 Ga0068863_1000062886 228
506 3300005841 Ga0068863_100010291 Ga0068863_1000102914 228
507 3300005841 Ga0068863_100015687 Ga0068863_1000156874 228
508 3300005841 Ga0068863_100020622 Ga0068863_1000206225 228
509 3300005841 Ga0068863_100034213 Ga0068863_1000342133 228
510 3300005841 Ga0068863_100373768 Ga0068863_1003737682 228
511 3300005842 Ga0068858_100000412 Ga0068858_10000041226 228
512 3300005842 Ga0068858_100002232 Ga0068858_1000022329 228
513 3300005842 Ga0068858_100018265 Ga0068858_1000182656 228
514 3300005842 Ga0068858_100044921 Ga0068858_1000449214 228
515 3300005842 Ga0068858_100057213 Ga0068858_1000572132 228
516 3300005842 Ga0068858_100059014 Ga0068858_1000590143 228
517 3300005842 Ga0068858_100069155 Ga0068858_1000691555 228
518 3300005842 Ga0068858_100173226 Ga0068858_1001732262 228
519 3300005842 Ga0068858_100333151 Ga0068858_1003331512 228
520 3300005843 Ga0068860_100000120 Ga0068860_10000012088 228
521 3300005843 Ga0068860_100000376 Ga0068860_10000037643 228
522 3300005843 Ga0068860_100000426 Ga0068860_10000042613 228
523 3300005843 Ga0068860_100000601 Ga0068860_10000060119 228
524 3300005843 Ga0068860_100018705 Ga0068860_1000187054 228
525 3300005843 Ga0068860_100078472 Ga0068860_1000784724 228
526 3300005843 Ga0068860_100311623 Ga0068860_1003116231 228
527 3300005844 Ga0068862_100000033 Ga0068862_100000033109 228
528 3300005844 Ga0068862_100000101 Ga0068862_10000010115 228
529 3300005844 Ga0068862_100000195 Ga0068862_10000019555 228
530 3300005844 Ga0068862_100000365 Ga0068862_10000036532 228
531 3300005844 Ga0068862_100000468 Ga0068862_10000046851 228
532 3300005844 Ga0068862_100004220 Ga0068862_1000042207 228
533 3300005844 Ga0068862_100013492 Ga0068862_1000134927 228
534 3300005844 Ga0068862_100054616 Ga0068862_1000546162 228
535 3300005844 Ga0068862_100079978 Ga0068862_1000799783 228
536 3300005844 Ga0068862_100104619 Ga0068862_1001046192 228
537 3300005844 Ga0068862_100142707 Ga0068862_1001427073 228
538 3300005937 Ga0081455_10000220 Ga0081455_1000022059 228
539 3300005985 Ga0081539_10016356 Ga0081539_100163562 228
540 3300005985 Ga0081539_10220621 Ga0081539_102206211 228
541 3300006028 Ga0070717_10039418 Ga0070717_100394183 228
542 3300006042 Ga0075368_10024927 Ga0075368_100249272 228
543 3300006051 Ga0075364_10010849 Ga0075364_100108494 228
544 3300006051 Ga0075364_10095797 Ga0075364_100957972 228
545 3300006173 Ga0070716_100188642 Ga0070716_1001886422 228
546 3300006177 Ga0075362_10001662 Ga0075362_100016623 228
547 3300006178 Ga0075367_10003842 Ga0075367_100038423 228
548 3300006186 Ga0075369_10002273 Ga0075369_100022734 228
549 3300006195 Ga0075366_10041656 Ga0075366_100416564 228
550 3300006195 Ga0075366_10079496 Ga0075366_100794962 228
551 3300006195 Ga0075366_10085597 Ga0075366_100855972 228
552 3300006237 Ga0097621_100255143 Ga0097621_1002551432 228
553 3300006353 Ga0075370_10015182 Ga0075370_100151824 228
554 3300006353 Ga0075370_10182894 Ga0075370_101828942 228
555 3300006358 Ga0068871_100267757 Ga0068871_1002677572 228
556 3300006844 Ga0075428_100091818 Ga0075428_1000918183 228
557 3300006844 Ga0075428_100529854 Ga0075428_1005298542 228
558 3300006847 Ga0075431_100005979 Ga0075431_1000059797 228
559 3300006880 Ga0075429_100162304 Ga0075429_1001623043 228
560 3300006881 Ga0068865_100000011 Ga0068865_100000011129 228
561 3300006881 Ga0068865_100102740 Ga0068865_1001027403 228
562 3300006931 Ga0097620_100000787 Ga0097620_1000007872 228
563 3300006931 Ga0097620_100000965 Ga0097620_10000096529 228
564 3300006931 Ga0097620_100001280 Ga0097620_1000012805 228
565 3300006931 Ga0097620_100009259 Ga0097620_1000092591 228
566 3300006931 Ga0097620_100016862 Ga0097620_1000168626 228
567 3300006931 Ga0097620_100031931 Ga0097620_1000319312 228
568 3300006931 Ga0097620_100038355 Ga0097620_1000383555 228
569 3300006931 Ga0097620_100046232 Ga0097620_1000462323 228
570 3300006931 Ga0097620_100083930 Ga0097620_1000839303 228
571 3300006931 Ga0097620_100199817 Ga0097620_1001998173 228
572 3300006946 Ga0079104_1020582 Ga0079104_10205821 228
573 3300009011 Ga0105251_10000680 Ga0105251_100006808 228
574 3300009011 Ga0105251_10003391 Ga0105251_100033919 228
575 3300009011 Ga0105251_10034896 Ga0105251_100348962 228
576 3300009093 Ga0105240_10011111 Ga0105240_1001111110 228
577 3300009093 Ga0105240_10013221 Ga0105240_1001322115 228
578 3300009093 Ga0105240_10025076 Ga0105240_100250764 228
579 3300009093 Ga0105240_10032178 Ga0105240_100321789 228
580 3300009093 Ga0105240_10164591 Ga0105240_101645912 228
581 3300009093 Ga0105240_10290179 Ga0105240_102901793 228
582 3300009093 Ga0105240_10344300 Ga0105240_103443002 228
583 3300009094 Ga0111539_10045482 Ga0111539_100454824 228
584 3300009094 Ga0111539_10253211 Ga0111539_102532112 228
585 3300009098 Ga0105245_10000157 Ga0105245_100001574 228
586 3300009101 Ga0105247_10003461 Ga0105247_100034613 228
587 3300009101 Ga0105247_10006396 Ga0105247_1000639610 228
588 3300009101 Ga0105247_10015584 Ga0105247_100155844 228
589 3300009101 Ga0105247_10030834 Ga0105247_100308343 228
590 3300009101 Ga0105247_10237321 Ga0105247_102373212 228
591 3300009101 Ga0105247_10341781 Ga0105247_103417812 228
592 3300009147 Ga0114129_10598115 Ga0114129_105981152 228
593 3300009148 Ga0105243_10000042 Ga0105243_10000042123 228
594 3300009148 Ga0105243_10029399 Ga0105243_100293992 228
595 3300009148 Ga0105243_10426544 Ga0105243_104265442 228
596 3300009174 Ga0105241_10004041 Ga0105241_100040415 228
597 3300009174 Ga0105241_10014025 Ga0105241_100140254 228
598 3300009174 Ga0105241_10231751 Ga0105241_102317512 228
599 3300009174 Ga0105241_10321462 Ga0105241_103214622 228
600 3300009174 Ga0105241_10417359 Ga0105241_104173591 228
601 3300009174 Ga0105241_10771424 Ga0105241_107714242 228
602 3300009176 Ga0105242_10133721 Ga0105242_101337214 228
603 3300009176 Ga0105242_10348725 Ga0105242_103487252 228
604 3300009177 Ga0105248_10000029 Ga0105248_1000002964 228
605 3300009177 Ga0105248_10000706 Ga0105248_1000070634 228
606 3300009177 Ga0105248_10003808 Ga0105248_100038082 228
607 3300009177 Ga0105248_10004272 Ga0105248_100042722 228
608 3300009177 Ga0105248_10010578 Ga0105248_100105788 228
609 3300009177 Ga0105248_10010795 Ga0105248_100107955 228
610 3300009177 Ga0105248_10016115 Ga0105248_100161152 228
611 3300009177 Ga0105248_10110430 Ga0105248_101104303 228
612 3300009177 Ga0105248_10457186 Ga0105248_104571862 228
613 3300009177 Ga0105248_10489035 Ga0105248_104890351 228
614 3300009177 Ga0105248_10800263 Ga0105248_108002632 228
615 3300009177 Ga0105248_11363786 Ga0105248_113637861 228
616 3300009545 Ga0105237_10000737 Ga0105237_1000073744 228
617 3300009545 Ga0105237_10031651 Ga0105237_100316515 228
618 3300009545 Ga0105237_10047884 Ga0105237_100478846 228
619 3300009545 Ga0105237_10113085 Ga0105237_101130852 228
620 3300009545 Ga0105237_10157976 Ga0105237_101579763 228
621 3300009551 Ga0105238_10047663 Ga0105238_100476634 228
622 3300009551 Ga0105238_10134943 Ga0105238_101349432 228
623 3300009551 Ga0105238_10541302 Ga0105238_105413022 228
624 3300009553 Ga0105249_10000024 Ga0105249_1000002455 228
625 3300009553 Ga0105249_10000390 Ga0105249_1000039019 228
626 3300009553 Ga0105249_10003685 Ga0105249_1000368510 228
627 3300009553 Ga0105249_10015597 Ga0105249_100155973 228
628 3300009553 Ga0105249_10016320 Ga0105249_100163203 228
629 3300009553 Ga0105249_10096685 Ga0105249_100966852 228
630 3300009553 Ga0105249_10224955 Ga0105249_102249552 228
631 3300009978 Ga0105148_100293 Ga0105148_1002936 228
632 3300010375 Ga0105239_10001737 Ga0105239_1000173717 228
633 3300010375 Ga0105239_10153879 Ga0105239_101538794 228
634 3300010375 Ga0105239_10204830 Ga0105239_102048304 228
635 3300011119 Ga0105246_10130852 Ga0105246_101308522 228
636 3300012513 Ga0157326_1000010 Ga0157326_100001013 228
637 3300013100 Ga0157373_10000811 Ga0157373_100008119 228
638 3300013100 Ga0157373_10031116 Ga0157373_100311162 228
639 3300013100 Ga0157373_10039098 Ga0157373_100390982 228
640 3300013100 Ga0157373_10082366 Ga0157373_100823662 228
641 3300013100 Ga0157373_10122242 Ga0157373_101222423 228
642 3300013100 Ga0157373_10233012 Ga0157373_102330122 228
643 3300013100 Ga0157373_10269121 Ga0157373_102691212 228
644 3300013102 Ga0157371_10007052 Ga0157371_100070526 228
645 3300013102 Ga0157371_10007309 Ga0157371_1000730910 228
646 3300013102 Ga0157371_10007462 Ga0157371_100074628 228
647 3300013102 Ga0157371_10036260 Ga0157371_100362603 228
648 3300013102 Ga0157371_10048585 Ga0157371_100485852 228
649 3300013102 Ga0157371_10057585 Ga0157371_100575854 228
650 3300013102 Ga0157371_10394897 Ga0157371_103948972 228
651 3300013104 Ga0157370_10000008 Ga0157370_10000008158 228
652 3300013104 Ga0157370_10024683 Ga0157370_100246835 228
653 3300013104 Ga0157370_10031686 Ga0157370_100316863 228
654 3300013104 Ga0157370_10074268 Ga0157370_100742683 228
655 3300013104 Ga0157370_10208338 Ga0157370_102083382 228
656 3300013104 Ga0157370_10308159 Ga0157370_103081592 228
657 3300013105 Ga0157369_10000256 Ga0157369_1000025626 228
658 3300013105 Ga0157369_10009587 Ga0157369_100095875 228
659 3300013105 Ga0157369_10021880 Ga0157369_100218805 228
660 3300013105 Ga0157369_10029065 Ga0157369_100290654 228
661 3300013105 Ga0157369_10042272 Ga0157369_100422722 228
662 3300013105 Ga0157369_10061760 Ga0157369_100617605 228
663 3300013105 Ga0157369_10094239 Ga0157369_100942392 228
664 3300013105 Ga0157369_10117810 Ga0157369_101178102 228
665 3300013105 Ga0157369_10289013 Ga0157369_102890132 228
666 3300013105 Ga0157369_10628828 Ga0157369_106288282 228
667 3300013296 Ga0157374_10007919 Ga0157374_100079197 228
668 3300013296 Ga0157374_10016232 Ga0157374_100162323 228
669 3300013296 Ga0157374_10122119 Ga0157374_101221194 228
670 3300013297 Ga0157378_10008270 Ga0157378_100082707 228
671 3300013306 Ga0163162_10010979 Ga0163162_1001097914 228
672 3300013306 Ga0163162_10014561 Ga0163162_100145617 228
673 3300013306 Ga0163162_10016182 Ga0163162_100161826 228
674 3300013306 Ga0163162_10442470 Ga0163162_104424702 228
675 3300013307 Ga0157372_10027547 Ga0157372_100275474 228
676 3300013307 Ga0157372_10062569 Ga0157372_100625694 228
677 3300013307 Ga0157372_10078751 Ga0157372_100787513 228
678 3300013307 Ga0157372_10112590 Ga0157372_101125902 228
679 3300013307 Ga0157372_10149556 Ga0157372_101495563 228
680 3300013307 Ga0157372_10256056 Ga0157372_102560561 228
681 3300013307 Ga0157372_10631045 Ga0157372_106310452 228
682 3300013307 Ga0157372_10682460 Ga0157372_106824602 228
683 3300013307 Ga0157372_11054366 Ga0157372_110543661 228
684 3300013307 Ga0157372_11470835 Ga0157372_114708351 228
685 3300013308 Ga0157375_10026310 Ga0157375_100263102 228
686 3300013308 Ga0157375_10040781 Ga0157375_100407813 228
687 3300013308 Ga0157375_10228437 Ga0157375_102284372 228
688 3300014325 Ga0163163_10014763 Ga0163163_100147632 228
689 3300014325 Ga0163163_10072582 Ga0163163_100725824 228
690 3300014326 Ga0157380_10000670 Ga0157380_1000067016 228
691 3300014326 Ga0157380_10001286 Ga0157380_1000128613 228
692 3300014326 Ga0157380_10003250 Ga0157380_100032505 228
693 3300014326 Ga0157380_10008503 Ga0157380_100085037 228
694 3300014326 Ga0157380_10022069 Ga0157380_100220696 228
695 3300014326 Ga0157380_10199859 Ga0157380_101998592 228
696 3300014326 Ga0157380_10396143 Ga0157380_103961432 228
697 3300014968 Ga0157379_10004515 Ga0157379_100045156 228
698 3300014968 Ga0157379_10022295 Ga0157379_100222952 228
699 3300014968 Ga0157379_10204468 Ga0157379_102044682 228
700 3300014969 Ga0157376_10000072 Ga0157376_1000007260 228
701 3300015690 Ga0183363_1003 Ga0183363_1003266 228
702 3300017792 Ga0163161_10000718 Ga0163161_1000071818 228
703 3300017792 Ga0163161_10007524 Ga0163161_100075244 228
704 3300017792 Ga0163161_10007673 Ga0163161_100076732 228
705 3300017792 Ga0163161_10016312 Ga0163161_100163125 228
706 3300017792 Ga0163161_10030214 Ga0163161_100302144 228
707 3300017792 Ga0163161_10114989 Ga0163161_101149892 228
708 3300017792 Ga0163161_10529203 Ga0163161_105292031 228
709 3300020082 Ga0206353_10636536 Ga0206353_106365365 228
710 3300021358 Ga0213873_10000023 Ga0213873_1000002345 228
711 3300021361 Ga0213872_10030279 Ga0213872_100302793 228
712 3300021361 Ga0213872_10042388 Ga0213872_100423882 228
713 3300021361 Ga0213872_10123085 Ga0213872_101230851 228
714 3300021384 Ga0213876_10000091 Ga0213876_1000009155 228
715 3300021384 Ga0213876_10001036 Ga0213876_100010362 228
716 3300021388 Ga0213875_10006744 Ga0213875_100067442 228
717 3300025229 Ga0209147_101685 Ga0209147_1016855 228
718 3300025231 Ga0207427_100395 Ga0207427_1003952 228
719 3300025233 Ga0209437_104667 Ga0209437_1046672 228
720 3300025245 Ga0207425_1000005 Ga0207425_1000005433 228
721 3300025246 Ga0209646_1009132 Ga0209646_10091322 228
722 3300025253 Ga0209677_103019 Ga0209677_1030196 228
723 3300025254 Ga0209148_1000008 Ga0209148_10000081246 228
724 3300025254 Ga0209148_1002234 Ga0209148_10022342 228
725 3300025258 Ga0209129_1003736 Ga0209129_10037362 228
726 3300025261 Ga0209233_1000140 Ga0209233_100014067 228
727 3300025261 Ga0209233_1000207 Ga0209233_10002078 228
728 3300025261 Ga0209233_1050506 Ga0209233_10505061 228
729 3300025263 Ga0209565_1000007 Ga0209565_1000007272 228
730 3300025263 Ga0209565_1000044 Ga0209565_100004413 228
731 3300025272 Ga0209455_1000002 Ga0209455_1000002180 228
732 3300025272 Ga0209455_1000489 Ga0209455_100048910 228
733 3300025273 Ga0209673_1006277 Ga0209673_10062773 228
734 3300025273 Ga0209673_1010542 Ga0209673_10105425 228
735 3300025290 Ga0207673_1004245 Ga0207673_10042452 228
736 3300025291 Ga0209675_1000638 Ga0209675_10006385 228
737 3300025292 Ga0209676_1000897 Ga0209676_10008978 228
738 3300025292 Ga0209676_1001537 Ga0209676_10015378 228
739 3300025292 Ga0209676_1002002 Ga0209676_10020029 228
740 3300025292 Ga0209676_1027246 Ga0209676_10272462 228
741 3300025294 Ga0209025_1000128 Ga0209025_1000128149 228
742 3300025294 Ga0209025_1014067 Ga0209025_10140672 228
743 3300025295 Ga0209564_1003920 Ga0209564_10039208 228
744 3300025297 Ga0209758_1000002 Ga0209758_1000002911 228
745 3300025297 Ga0209758_1000017 Ga0209758_1000017435 228
746 3300025298 Ga0209050_1000001 Ga0209050_1000001904 228
747 3300025298 Ga0209050_1000010 Ga0209050_1000010908 228
748 3300025298 Ga0209050_1000267 Ga0209050_100026774 228
749 3300025298 Ga0209050_1002180 Ga0209050_10021809 228
750 3300025298 Ga0209050_1002751 Ga0209050_10027517 228
751 3300025298 Ga0209050_1046375 Ga0209050_10463752 228
752 3300025299 Ga0209256_1000008 Ga0209256_1000008114 228
753 3300025302 Ga0207426_1023247 Ga0207426_10232473 228
754 3300025303 Ga0209051_1000357 Ga0209051_100035769 228
755 3300025304 Ga0209257_1000027 Ga0209257_1000027550 228
756 3300025304 Ga0209257_1000083 Ga0209257_10000832 228
757 3300025304 Ga0209257_1000500 Ga0209257_100050031 228
758 3300025304 Ga0209257_1001441 Ga0209257_100144116 228
759 3300025304 Ga0209257_1001755 Ga0209257_100175515 228
760 3300025304 Ga0209257_1003004 Ga0209257_10030048 228
761 3300025315 Ga0207697_10000442 Ga0207697_1000044220 228
762 3300025315 Ga0207697_10001404 Ga0207697_100014048 228
763 3300025315 Ga0207697_10011771 Ga0207697_100117713 228
764 3300025315 Ga0207697_10096545 Ga0207697_100965452 228
765 3300025315 Ga0207697_10101138 Ga0207697_101011381 228
766 3300025321 Ga0207656_10001793 Ga0207656_100017934 228
767 3300025735 Ga0207713_1002683 Ga0207713_10026839 228
768 3300025735 Ga0207713_1021992 Ga0207713_10219922 228
769 3300025735 Ga0207713_1042755 Ga0207713_10427552 228
770 3300025900 Ga0207710_10002492 Ga0207710_100024924 228
771 3300025900 Ga0207710_10012540 Ga0207710_100125403 228
772 3300025900 Ga0207710_10158165 Ga0207710_101581652 228
773 3300025900 Ga0207710_10204994 Ga0207710_102049942 228
774 3300025900 Ga0207710_10243068 Ga0207710_102430682 228
775 3300025901 Ga0207688_10006109 Ga0207688_100061098 228
776 3300025901 Ga0207688_10037818 Ga0207688_100378183 228
777 3300025903 Ga0207680_10000081 Ga0207680_1000008119 228
778 3300025903 Ga0207680_10000155 Ga0207680_1000015513 228
779 3300025903 Ga0207680_10001224 Ga0207680_1000122410 228
780 3300025903 Ga0207680_10018385 Ga0207680_100183852 228
781 3300025903 Ga0207680_10037281 Ga0207680_100372813 228
782 3300025903 Ga0207680_10177618 Ga0207680_101776182 228
783 3300025903 Ga0207680_10248300 Ga0207680_102483002 228
784 3300025903 Ga0207680_10354593 Ga0207680_103545931 228
785 3300025904 Ga0207647_10000997 Ga0207647_100009975 228
786 3300025904 Ga0207647_10001916 Ga0207647_1000191614 228
787 3300025904 Ga0207647_10004886 Ga0207647_100048862 228
788 3300025904 Ga0207647_10006925 Ga0207647_100069255 228
789 3300025904 Ga0207647_10009976 Ga0207647_100099765 228
790 3300025904 Ga0207647_10014579 Ga0207647_100145795 228
791 3300025904 Ga0207647_10014669 Ga0207647_100146693 228
792 3300025904 Ga0207647_10016598 Ga0207647_100165985 228
793 3300025904 Ga0207647_10081995 Ga0207647_100819953 228
794 3300025904 Ga0207647_10235178 Ga0207647_102351782 228
795 3300025907 Ga0207645_10007207 Ga0207645_100072075 228
796 3300025907 Ga0207645_10011636 Ga0207645_100116366 228
797 3300025907 Ga0207645_10016395 Ga0207645_100163952 228
798 3300025907 Ga0207645_10016769 Ga0207645_100167693 228
799 3300025909 Ga0207705_10000003 Ga0207705_10000003145 228
800 3300025909 Ga0207705_10000005 Ga0207705_10000005462 228
801 3300025909 Ga0207705_10000027 Ga0207705_1000002721 228
802 3300025909 Ga0207705_10000123 Ga0207705_100001233 228
803 3300025909 Ga0207705_10000134 Ga0207705_1000013448 228
804 3300025909 Ga0207705_10000275 Ga0207705_1000027528 228
805 3300025909 Ga0207705_10002119 Ga0207705_100021195 228
806 3300025909 Ga0207705_10002122 Ga0207705_1000212218 228
807 3300025909 Ga0207705_10002734 Ga0207705_1000273410 228
808 3300025909 Ga0207705_10006407 Ga0207705_100064076 228
809 3300025909 Ga0207705_10022137 Ga0207705_100221372 228
810 3300025909 Ga0207705_10044683 Ga0207705_100446833 228
811 3300025909 Ga0207705_10057010 Ga0207705_100570101 228
812 3300025909 Ga0207705_10117985 Ga0207705_101179852 228
813 3300025909 Ga0207705_10250556 Ga0207705_102505562 228
814 3300025911 Ga0207654_10004554 Ga0207654_100045545 228
815 3300025911 Ga0207654_10004852 Ga0207654_100048522 228
816 3300025911 Ga0207654_10536492 Ga0207654_105364922 228
817 3300025912 Ga0207707_10405463 Ga0207707_104054632 228
818 3300025913 Ga0207695_10004104 Ga0207695_100041043 228
819 3300025913 Ga0207695_10017623 Ga0207695_100176234 228
820 3300025913 Ga0207695_10029125 Ga0207695_100291254 228
821 3300025913 Ga0207695_10039402 Ga0207695_100394022 228
822 3300025913 Ga0207695_10074574 Ga0207695_100745743 228
823 3300025913 Ga0207695_10110032 Ga0207695_101100323 228
824 3300025913 Ga0207695_10111271 Ga0207695_101112713 228
825 3300025913 Ga0207695_10203963 Ga0207695_102039632 228
826 3300025913 Ga0207695_10224249 Ga0207695_102242492 228
827 3300025914 Ga0207671_10000206 Ga0207671_100002066 228
828 3300025914 Ga0207671_10003091 Ga0207671_1000309118 228
829 3300025914 Ga0207671_10005230 Ga0207671_1000523015 228
830 3300025914 Ga0207671_10028696 Ga0207671_100286963 228
831 3300025914 Ga0207671_10052354 Ga0207671_100523542 228
832 3300025914 Ga0207671_10269071 Ga0207671_102690712 228
833 3300025914 Ga0207671_10636870 Ga0207671_106368702 228
834 3300025917 Ga0207660_10000770 Ga0207660_1000077017 228
835 3300025917 Ga0207660_10010525 Ga0207660_100105256 228
836 3300025917 Ga0207660_10013667 Ga0207660_100136672 228
837 3300025917 Ga0207660_10364109 Ga0207660_103641092 228
838 3300025919 Ga0207657_10000705 Ga0207657_100007056 228
839 3300025919 Ga0207657_10002019 Ga0207657_1000201918 228
840 3300025919 Ga0207657_10002261 Ga0207657_1000226119 228
841 3300025919 Ga0207657_10002889 Ga0207657_1000288923 228
842 3300025919 Ga0207657_10004663 Ga0207657_1000466317 228
843 3300025919 Ga0207657_10005881 Ga0207657_100058818 228
844 3300025919 Ga0207657_10011856 Ga0207657_100118567 228
845 3300025919 Ga0207657_10014085 Ga0207657_100140855 228
846 3300025919 Ga0207657_10025591 Ga0207657_100255912 228
847 3300025919 Ga0207657_10025640 Ga0207657_100256403 228
848 3300025919 Ga0207657_10042758 Ga0207657_100427584 228
849 3300025919 Ga0207657_10045552 Ga0207657_100455525 228
850 3300025919 Ga0207657_10055901 Ga0207657_100559013 228
851 3300025919 Ga0207657_10064378 Ga0207657_100643784 228
852 3300025919 Ga0207657_10081608 Ga0207657_100816083 228
853 3300025919 Ga0207657_10192184 Ga0207657_101921842 228
854 3300025919 Ga0207657_10319329 Ga0207657_103193292 228
855 3300025919 Ga0207657_10360034 Ga0207657_103600342 228
856 3300025920 Ga0207649_10001392 Ga0207649_100013925 228
857 3300025920 Ga0207649_10003358 Ga0207649_1000335810 228
858 3300025920 Ga0207649_10008180 Ga0207649_100081803 228
859 3300025920 Ga0207649_10013984 Ga0207649_100139845 228
860 3300025920 Ga0207649_10014879 Ga0207649_100148793 228
861 3300025920 Ga0207649_10042363 Ga0207649_100423634 228
862 3300025920 Ga0207649_10059022 Ga0207649_100590223 228
863 3300025920 Ga0207649_10110168 Ga0207649_101101682 228
864 3300025920 Ga0207649_10130395 Ga0207649_101303952 228
865 3300025920 Ga0207649_10295710 Ga0207649_102957102 228
866 3300025920 Ga0207649_10458312 Ga0207649_104583122 228
867 3300025921 Ga0207652_10000034 Ga0207652_10000034111 228
868 3300025921 Ga0207652_10001463 Ga0207652_1000146317 228
869 3300025921 Ga0207652_10283255 Ga0207652_102832552 228
870 3300025921 Ga0207652_10346614 Ga0207652_103466142 228
871 3300025921 Ga0207652_10652740 Ga0207652_106527402 228
872 3300025923 Ga0207681_10000002 Ga0207681_10000002952 228
873 3300025923 Ga0207681_10000014 Ga0207681_1000001478 228
874 3300025923 Ga0207681_10000045 Ga0207681_100000457 228
875 3300025923 Ga0207681_10000186 Ga0207681_1000018628 228
876 3300025923 Ga0207681_10001451 Ga0207681_100014516 228
877 3300025923 Ga0207681_10010858 Ga0207681_100108583 228
878 3300025923 Ga0207681_10019383 Ga0207681_100193834 228
879 3300025923 Ga0207681_10050735 Ga0207681_100507353 228
880 3300025923 Ga0207681_10097329 Ga0207681_100973292 228
881 3300025923 Ga0207681_10173298 Ga0207681_101732982 228
882 3300025923 Ga0207681_10240837 Ga0207681_102408372 228
883 3300025923 Ga0207681_10356945 Ga0207681_103569452 228
884 3300025923 Ga0207681_10618577 Ga0207681_106185772 228
885 3300025924 Ga0207694_10003733 Ga0207694_100037332 228
886 3300025924 Ga0207694_10088838 Ga0207694_100888382 228
887 3300025924 Ga0207694_10247987 Ga0207694_102479871 228
888 3300025924 Ga0207694_10253619 Ga0207694_102536191 228
889 3300025924 Ga0207694_10268063 Ga0207694_102680632 228
890 3300025925 Ga0207650_10000015 Ga0207650_1000001595 228
891 3300025925 Ga0207650_10001439 Ga0207650_100014398 228
892 3300025925 Ga0207650_10003083 Ga0207650_1000308311 228
893 3300025925 Ga0207650_10004392 Ga0207650_1000439210 228
894 3300025925 Ga0207650_10006189 Ga0207650_100061895 228
895 3300025925 Ga0207650_10045237 Ga0207650_100452372 228
896 3300025925 Ga0207650_10142176 Ga0207650_101421762 228
897 3300025925 Ga0207650_10191722 Ga0207650_101917222 228
898 3300025926 Ga0207659_10001796 Ga0207659_100017969 228
899 3300025926 Ga0207659_10014082 Ga0207659_100140825 228
900 3300025926 Ga0207659_10082602 Ga0207659_100826021 228
901 3300025927 Ga0207687_10001915 Ga0207687_100019154 228
902 3300025928 Ga0207700_10207177 Ga0207700_102071772 228
903 3300025929 Ga0207664_10063264 Ga0207664_100632644 228
904 3300025929 Ga0207664_10166421 Ga0207664_101664213 228
905 3300025929 Ga0207664_10252138 Ga0207664_102521382 228
906 3300025931 Ga0207644_10000002 Ga0207644_10000002891 228
907 3300025931 Ga0207644_10000047 Ga0207644_1000004727 228
908 3300025931 Ga0207644_10000077 Ga0207644_1000007746 228
909 3300025931 Ga0207644_10000780 Ga0207644_100007802 228
910 3300025931 Ga0207644_10007963 Ga0207644_100079635 228
911 3300025931 Ga0207644_10008037 Ga0207644_100080374 228
912 3300025931 Ga0207644_10013622 Ga0207644_100136223 228
913 3300025931 Ga0207644_10036925 Ga0207644_100369252 228
914 3300025931 Ga0207644_10058418 Ga0207644_100584182 228
915 3300025931 Ga0207644_10102288 Ga0207644_101022883 228
916 3300025931 Ga0207644_10283906 Ga0207644_102839062 228
917 3300025932 Ga0207690_10003957 Ga0207690_100039578 228
918 3300025932 Ga0207690_10003962 Ga0207690_100039621 228
919 3300025932 Ga0207690_10006795 Ga0207690_100067955 228
920 3300025932 Ga0207690_10010461 Ga0207690_100104617 228
921 3300025932 Ga0207690_10010678 Ga0207690_100106782 228
922 3300025932 Ga0207690_10012197 Ga0207690_100121975 228
923 3300025932 Ga0207690_10038798 Ga0207690_100387984 228
924 3300025932 Ga0207690_10061741 Ga0207690_100617413 228
925 3300025932 Ga0207690_10155491 Ga0207690_101554912 228
926 3300025932 Ga0207690_10379447 Ga0207690_103794472 228
927 3300025932 Ga0207690_10411500 Ga0207690_104115002 228
928 3300025933 Ga0207706_10000890 Ga0207706_100008907 228
929 3300025933 Ga0207706_10000916 Ga0207706_100009166 228
930 3300025933 Ga0207706_10003154 Ga0207706_1000315417 228
931 3300025933 Ga0207706_10008457 Ga0207706_1000845710 228
932 3300025933 Ga0207706_10014756 Ga0207706_100147565 228
933 3300025933 Ga0207706_10019389 Ga0207706_100193895 228
934 3300025933 Ga0207706_10051633 Ga0207706_100516335 228
935 3300025933 Ga0207706_10055921 Ga0207706_100559212 228
936 3300025933 Ga0207706_10082836 Ga0207706_100828364 228
937 3300025933 Ga0207706_10084014 Ga0207706_100840143 228
938 3300025933 Ga0207706_10092939 Ga0207706_100929393 228
939 3300025933 Ga0207706_10110117 Ga0207706_101101172 228
940 3300025933 Ga0207706_10119402 Ga0207706_101194023 228
941 3300025933 Ga0207706_10176475 Ga0207706_101764751 228
942 3300025933 Ga0207706_10338710 Ga0207706_103387102 228
943 3300025933 Ga0207706_10383889 Ga0207706_103838892 228
944 3300025933 Ga0207706_10400363 Ga0207706_104003632 228
945 3300025933 Ga0207706_10585687 Ga0207706_105856871 228
946 3300025934 Ga0207686_10000797 Ga0207686_1000079718 228
947 3300025935 Ga0207709_10000119 Ga0207709_100001194 228
948 3300025935 Ga0207709_10000146 Ga0207709_100001465 228
949 3300025935 Ga0207709_10039420 Ga0207709_100394202 228
950 3300025936 Ga0207670_10001945 Ga0207670_100019454 228
951 3300025937 Ga0207669_10000764 Ga0207669_100007644 228
952 3300025937 Ga0207669_10009054 Ga0207669_100090541 228
953 3300025937 Ga0207669_10310355 Ga0207669_103103552 228
954 3300025938 Ga0207704_10000001 Ga0207704_10000001661 228
955 3300025939 Ga0207665_10244220 Ga0207665_102442202 228
956 3300025940 Ga0207691_10000143 Ga0207691_1000014350 228
957 3300025940 Ga0207691_10003738 Ga0207691_100037389 228
958 3300025940 Ga0207691_10247578 Ga0207691_102475782 228
959 3300025940 Ga0207691_10255107 Ga0207691_102551073 228
960 3300025940 Ga0207691_10473011 Ga0207691_104730112 228
961 3300025940 Ga0207691_10477635 Ga0207691_104776352 228
962 3300025940 Ga0207691_10669538 Ga0207691_106695382 228
963 3300025941 Ga0207711_10000004 Ga0207711_10000004443 228
964 3300025941 Ga0207711_10000297 Ga0207711_100002976 228
965 3300025941 Ga0207711_10001880 Ga0207711_1000188022 228
966 3300025941 Ga0207711_10002679 Ga0207711_1000267911 228
967 3300025941 Ga0207711_10005670 Ga0207711_100056707 228
968 3300025941 Ga0207711_10007223 Ga0207711_1000722313 228
969 3300025941 Ga0207711_10010142 Ga0207711_100101426 228
970 3300025941 Ga0207711_10079445 Ga0207711_100794452 228
971 3300025941 Ga0207711_10083105 Ga0207711_100831054 228
972 3300025941 Ga0207711_10218401 Ga0207711_102184012 228
973 3300025941 Ga0207711_10228326 Ga0207711_102283262 228
974 3300025941 Ga0207711_10234921 Ga0207711_102349211 228
975 3300025941 Ga0207711_10574955 Ga0207711_105749551 228
976 3300025942 Ga0207689_10000824 Ga0207689_1000082413 228
977 3300025942 Ga0207689_10127088 Ga0207689_101270882 228
978 3300025944 Ga0207661_10026008 Ga0207661_100260084 228
979 3300025944 Ga0207661_10197682 Ga0207661_101976822 228
980 3300025944 Ga0207661_10909675 Ga0207661_109096751 228
981 3300025945 Ga0207679_10011319 Ga0207679_100113197 228
982 3300025945 Ga0207679_10055777 Ga0207679_100557773 228
983 3300025945 Ga0207679_10113419 Ga0207679_101134192 228
984 3300025945 Ga0207679_10144743 Ga0207679_101447433 228
985 3300025945 Ga0207679_10157813 Ga0207679_101578133 228
986 3300025945 Ga0207679_10485173 Ga0207679_104851732 228
987 3300025945 Ga0207679_10635471 Ga0207679_106354712 228
988 3300025949 Ga0207667_10000001 Ga0207667_10000001311 228
989 3300025949 Ga0207667_10003306 Ga0207667_1000330620 228
990 3300025949 Ga0207667_10006318 Ga0207667_100063188 228
991 3300025949 Ga0207667_10009014 Ga0207667_100090146 228
992 3300025949 Ga0207667_10014984 Ga0207667_100149849 228
993 3300025949 Ga0207667_10035151 Ga0207667_100351517 228
994 3300025949 Ga0207667_10085052 Ga0207667_100850522 228
995 3300025949 Ga0207667_10132725 Ga0207667_101327255 228
996 3300025949 Ga0207667_10174899 Ga0207667_101748993 228
997 3300025949 Ga0207667_10279143 Ga0207667_102791432 228
998 3300025949 Ga0207667_10340213 Ga0207667_103402132 228
999 3300025949 Ga0207667_10666329 Ga0207667_106663292 228
1000 3300025960 Ga0207651_10000002 Ga0207651_10000002330 228
1001 3300025960 Ga0207651_10066721 Ga0207651_100667214 228
1002 3300025960 Ga0207651_10093621 Ga0207651_100936212 228
1003 3300025961 Ga0207712_10000034 Ga0207712_1000003456 228
1004 3300025961 Ga0207712_10000335 Ga0207712_1000033519 228
1005 3300025961 Ga0207712_10005251 Ga0207712_100052517 228
1006 3300025961 Ga0207712_10016901 Ga0207712_100169014 228
1007 3300025961 Ga0207712_10029100 Ga0207712_100291003 228
1008 3300025961 Ga0207712_10044410 Ga0207712_100444103 228
1009 3300025961 Ga0207712_10085194 Ga0207712_100851943 228
1010 3300025961 Ga0207712_10095284 Ga0207712_100952842 228
1011 3300025972 Ga0207668_10000043 Ga0207668_1000004316 228
1012 3300025972 Ga0207668_10000068 Ga0207668_1000006847 228
1013 3300025972 Ga0207668_10000725 Ga0207668_1000072520 228
1014 3300025972 Ga0207668_10001466 Ga0207668_1000146617 228
1015 3300025972 Ga0207668_10004083 Ga0207668_100040837 228
1016 3300025972 Ga0207668_10004543 Ga0207668_100045436 228
1017 3300025972 Ga0207668_10008246 Ga0207668_100082465 228
1018 3300025972 Ga0207668_10021203 Ga0207668_100212034 228
1019 3300025972 Ga0207668_10024865 Ga0207668_100248655 228
1020 3300025972 Ga0207668_10031838 Ga0207668_100318385 228
1021 3300025972 Ga0207668_10060857 Ga0207668_100608573 228
1022 3300025972 Ga0207668_10127030 Ga0207668_101270302 228
1023 3300025981 Ga0207640_10001192 Ga0207640_100011925 228
1024 3300025981 Ga0207640_10007799 Ga0207640_100077992 228
1025 3300025981 Ga0207640_10019529 Ga0207640_100195291 228
1026 3300025981 Ga0207640_10029512 Ga0207640_100295123 228
1027 3300025981 Ga0207640_10034804 Ga0207640_100348042 228
1028 3300025981 Ga0207640_10225289 Ga0207640_102252892 228
1029 3300025981 Ga0207640_10343116 Ga0207640_103431162 228
1030 3300025986 Ga0207658_10000010 Ga0207658_10000010118 228
1031 3300025986 Ga0207658_10000109 Ga0207658_1000010943 228
1032 3300025986 Ga0207658_10000159 Ga0207658_100001597 228
1033 3300025986 Ga0207658_10000327 Ga0207658_1000032714 228
1034 3300025986 Ga0207658_10005955 Ga0207658_100059557 228
1035 3300025986 Ga0207658_10006378 Ga0207658_100063787 228
1036 3300025986 Ga0207658_10012765 Ga0207658_100127655 228
1037 3300025986 Ga0207658_10012985 Ga0207658_100129854 228
1038 3300025986 Ga0207658_10019004 Ga0207658_100190045 228
1039 3300025986 Ga0207658_10040736 Ga0207658_100407363 228
1040 3300025986 Ga0207658_10046383 Ga0207658_100463832 228
1041 3300025986 Ga0207658_10148001 Ga0207658_101480013 228
1042 3300025986 Ga0207658_10372766 Ga0207658_103727661 228
1043 3300025986 Ga0207658_10398448 Ga0207658_103984482 228
1044 3300026023 Ga0207677_10000178 Ga0207677_100001789 228
1045 3300026035 Ga0207703_10000770 Ga0207703_1000077026 228
1046 3300026035 Ga0207703_10000822 Ga0207703_1000082218 228
1047 3300026035 Ga0207703_10002670 Ga0207703_1000267014 228
1048 3300026035 Ga0207703_10031176 Ga0207703_100311764 228
1049 3300026035 Ga0207703_10057095 Ga0207703_100570952 228
1050 3300026035 Ga0207703_10104598 Ga0207703_101045983 228
1051 3300026035 Ga0207703_10146540 Ga0207703_101465402 228
1052 3300026035 Ga0207703_10174038 Ga0207703_101740384 228
1053 3300026041 Ga0207639_10000269 Ga0207639_1000026925 228
1054 3300026041 Ga0207639_10001145 Ga0207639_1000114516 228
1055 3300026041 Ga0207639_10001159 Ga0207639_100011592 228
1056 3300026041 Ga0207639_10001550 Ga0207639_100015507 228
1057 3300026041 Ga0207639_10014496 Ga0207639_100144963 228
1058 3300026041 Ga0207639_10016151 Ga0207639_100161515 228
1059 3300026041 Ga0207639_10023215 Ga0207639_100232153 228
1060 3300026041 Ga0207639_10067090 Ga0207639_100670902 228
1061 3300026041 Ga0207639_10114629 Ga0207639_101146292 228
1062 3300026041 Ga0207639_10149342 Ga0207639_101493423 228
1063 3300026041 Ga0207639_10158623 Ga0207639_101586233 228
1064 3300026041 Ga0207639_10308029 Ga0207639_103080293 228
1065 3300026041 Ga0207639_10539243 Ga0207639_105392432 228
1066 3300026041 Ga0207639_10567166 Ga0207639_105671662 228
1067 3300026067 Ga0207678_10000400 Ga0207678_100004002 228
1068 3300026067 Ga0207678_10009947 Ga0207678_100099478 228
1069 3300026067 Ga0207678_10017140 Ga0207678_100171403 228
1070 3300026067 Ga0207678_10033630 Ga0207678_100336304 228
1071 3300026067 Ga0207678_10048015 Ga0207678_100480154 228
1072 3300026067 Ga0207678_10060784 Ga0207678_100607842 228
1073 3300026067 Ga0207678_10077149 Ga0207678_100771493 228
1074 3300026067 Ga0207678_10122001 Ga0207678_101220012 228
1075 3300026067 Ga0207678_10136790 Ga0207678_101367903 228
1076 3300026067 Ga0207678_10157506 Ga0207678_101575062 228
1077 3300026067 Ga0207678_10276404 Ga0207678_102764042 228
1078 3300026067 Ga0207678_10340511 Ga0207678_103405112 228
1079 3300026067 Ga0207678_10876321 Ga0207678_108763211 228
1080 3300026075 Ga0207708_10014964 Ga0207708_100149647 228
1081 3300026078 Ga0207702_10001123 Ga0207702_100011237 228
1082 3300026078 Ga0207702_10001961 Ga0207702_100019617 228
1083 3300026078 Ga0207702_10002063 Ga0207702_100020634 228
1084 3300026078 Ga0207702_10003523 Ga0207702_100035238 228
1085 3300026078 Ga0207702_10005983 Ga0207702_100059836 228
1086 3300026078 Ga0207702_10009744 Ga0207702_1000974411 228
1087 3300026078 Ga0207702_10012745 Ga0207702_100127453 228
1088 3300026078 Ga0207702_10020227 Ga0207702_100202272 228
1089 3300026078 Ga0207702_10027516 Ga0207702_100275162 228
1090 3300026078 Ga0207702_10101713 Ga0207702_101017132 228
1091 3300026078 Ga0207702_10181703 Ga0207702_101817031 228
1092 3300026088 Ga0207641_10000010 Ga0207641_1000001086 228
1093 3300026088 Ga0207641_10000031 Ga0207641_1000003151 228
1094 3300026088 Ga0207641_10000049 Ga0207641_1000004964 228
1095 3300026088 Ga0207641_10000143 Ga0207641_100001434 228
1096 3300026088 Ga0207641_10000182 Ga0207641_1000018222 228
1097 3300026088 Ga0207641_10000294 Ga0207641_1000029442 228
1098 3300026088 Ga0207641_10000919 Ga0207641_100009198 228
1099 3300026088 Ga0207641_10003077 Ga0207641_1000307712 228
1100 3300026088 Ga0207641_10005066 Ga0207641_100050666 228
1101 3300026088 Ga0207641_10026236 Ga0207641_100262362 228
1102 3300026088 Ga0207641_10053565 Ga0207641_100535654 228
1103 3300026088 Ga0207641_10200720 Ga0207641_102007203 228
1104 3300026088 Ga0207641_10247732 Ga0207641_102477322 228
1105 3300026089 Ga0207648_10000001 Ga0207648_10000001330 228
1106 3300026089 Ga0207648_10022514 Ga0207648_100225143 228
1107 3300026089 Ga0207648_10061674 Ga0207648_100616742 228
1108 3300026095 Ga0207676_10000036 Ga0207676_10000036129 228
1109 3300026095 Ga0207676_10000071 Ga0207676_100000718 228
1110 3300026095 Ga0207676_10000383 Ga0207676_1000038320 228
1111 3300026095 Ga0207676_10002378 Ga0207676_100023786 228
1112 3300026095 Ga0207676_10007383 Ga0207676_100073832 228
1113 3300026095 Ga0207676_10008557 Ga0207676_100085576 228
1114 3300026095 Ga0207676_10013375 Ga0207676_100133753 228
1115 3300026095 Ga0207676_10094217 Ga0207676_100942173 228
1116 3300026095 Ga0207676_10203376 Ga0207676_102033762 228
1117 3300026095 Ga0207676_10214993 Ga0207676_102149932 228
1118 3300026116 Ga0207674_10003084 Ga0207674_100030846 228
1119 3300026116 Ga0207674_10005061 Ga0207674_1000506111 228
1120 3300026116 Ga0207674_10012914 Ga0207674_100129148 228
1121 3300026116 Ga0207674_10014614 Ga0207674_100146146 228
1122 3300026116 Ga0207674_10018651 Ga0207674_100186514 228
1123 3300026116 Ga0207674_10021191 Ga0207674_100211918 228
1124 3300026116 Ga0207674_10022185 Ga0207674_100221855 228
1125 3300026116 Ga0207674_10035097 Ga0207674_100350975 228
1126 3300026116 Ga0207674_10040233 Ga0207674_100402333 228
1127 3300026116 Ga0207674_10098851 Ga0207674_100988513 228
1128 3300026116 Ga0207674_10138008 Ga0207674_101380082 228
1129 3300026116 Ga0207674_10178578 Ga0207674_101785782 228
1130 3300026116 Ga0207674_10288757 Ga0207674_102887572 228
1131 3300026116 Ga0207674_10384025 Ga0207674_103840252 228
1132 3300026116 Ga0207674_10426202 Ga0207674_104262022 228
1133 3300026118 Ga0207675_100000041 Ga0207675_10000004188 228
1134 3300026118 Ga0207675_100001120 Ga0207675_1000011208 228
1135 3300026118 Ga0207675_100001364 Ga0207675_1000013647 228
1136 3300026118 Ga0207675_100004161 Ga0207675_10000416115 228
1137 3300026118 Ga0207675_100014835 Ga0207675_1000148356 228
1138 3300026118 Ga0207675_100375536 Ga0207675_1003755362 228
1139 3300026121 Ga0207683_10003626 Ga0207683_1000362613 228
1140 3300026121 Ga0207683_10076773 Ga0207683_100767732 228
1141 3300026142 Ga0207698_10006491 Ga0207698_100064913 228
1142 3300026142 Ga0207698_10014515 Ga0207698_100145155 228
1143 3300026142 Ga0207698_10020547 Ga0207698_100205475 228
1144 3300026142 Ga0207698_10026473 Ga0207698_100264732 228
1145 3300026142 Ga0207698_10050594 Ga0207698_100505942 228
1146 3300026142 Ga0207698_10053521 Ga0207698_100535213 228
1147 3300026142 Ga0207698_10100192 Ga0207698_101001923 228
1148 3300026142 Ga0207698_10529778 Ga0207698_105297782 228
1149 3300027665 Ga0209983_1007478 Ga0209983_10074782 228
1150 3300027682 Ga0209971_1007391 Ga0209971_10073912 228
1151 3300027866 Ga0209813_10000052 Ga0209813_1000005217 228
1152 3300027907 Ga0207428_10053033 Ga0207428_100530332 228
1153 3300028379 Ga0268266_10000025 Ga0268266_10000025101 228
1154 3300028379 Ga0268266_10000036 Ga0268266_10000036256 228
1155 3300028379 Ga0268266_10000314 Ga0268266_1000031445 228
1156 3300028379 Ga0268266_10000558 Ga0268266_100005587 228
1157 3300028379 Ga0268266_10006140 Ga0268266_1000614013 228
1158 3300028379 Ga0268266_10031304 Ga0268266_100313044 228
1159 3300028379 Ga0268266_10058220 Ga0268266_100582205 228
1160 3300028379 Ga0268266_10369809 Ga0268266_103698092 228
1161 3300028380 Ga0268265_10000013 Ga0268265_10000013279 228
1162 3300028380 Ga0268265_10000059 Ga0268265_1000005982 228
1163 3300028380 Ga0268265_10000143 Ga0268265_1000014332 228
1164 3300028380 Ga0268265_10001046 Ga0268265_1000104610 228
1165 3300028380 Ga0268265_10001847 Ga0268265_1000184717 228
1166 3300028380 Ga0268265_10008332 Ga0268265_100083323 228
1167 3300028380 Ga0268265_10019527 Ga0268265_100195273 228
1168 3300028380 Ga0268265_10030191 Ga0268265_100301912 228
1169 3300028380 Ga0268265_10098675 Ga0268265_100986752 228
1170 3300028380 Ga0268265_10226126 Ga0268265_102261263 228
1171 3300028380 Ga0268265_10290707 Ga0268265_102907072 228
1172 3300028380 Ga0268265_10354931 Ga0268265_103549311 228
1173 3300028380 Ga0268265_10594578 Ga0268265_105945782 228
1174 3300028380 Ga0268265_10613457 Ga0268265_106134572 228
1175 3300028381 Ga0268264_10000070 Ga0268264_1000007058 228
1176 3300028381 Ga0268264_10000071 Ga0268264_1000007131 228
1177 3300028381 Ga0268264_10000126 Ga0268264_10000126145 228
1178 3300028381 Ga0268264_10000144 Ga0268264_1000014453 228
1179 3300028381 Ga0268264_10000608 Ga0268264_1000060819 228
1180 3300028381 Ga0268264_10002628 Ga0268264_1000262813 228
1181 3300028381 Ga0268264_10020586 Ga0268264_100205862 228
1182 3300028381 Ga0268264_10106716 Ga0268264_101067162 228
1183 3300028381 Ga0268264_10967596 Ga0268264_109675962 228
1184 3300028786 Ga0307517_10034735 Ga0307517_100347358 228
1185 3300028786 Ga0307517_10146195 Ga0307517_101461951 228
1186 3300028800 Ga0265338_10008130 Ga0265338_1000813011 228
1187 3300028800 Ga0265338_10092072 Ga0265338_100920723 228
1188 3300028800 Ga0265338_10112576 Ga0265338_101125763 228
1189 3300030745 Ga0316182_1058570 Ga0316182_10585702 228
1190 3300031548 Ga0307408_100013164 Ga0307408_1000131643 228
1191 3300031548 Ga0307408_100029566 Ga0307408_1000295665 228
1192 3300031548 Ga0307408_100031935 Ga0307408_1000319351 228
1193 3300031548 Ga0307408_100032881 Ga0307408_1000328812 228
1194 3300031548 Ga0307408_100042872 Ga0307408_1000428723 228
1195 3300031548 Ga0307408_100065686 Ga0307408_1000656864 228
1196 3300031548 Ga0307408_100099549 Ga0307408_1000995492 228
1197 3300031548 Ga0307408_100108658 Ga0307408_1001086582 228
1198 3300031548 Ga0307408_100208004 Ga0307408_1002080042 228
1199 3300031548 Ga0307408_100299645 Ga0307408_1002996452 228
1200 3300031548 Ga0307408_100315131 Ga0307408_1003151312 228
1201 3300031548 Ga0307408_100454043 Ga0307408_1004540432 228
1202 3300031548 Ga0307408_100492589 Ga0307408_1004925891 228
1203 3300031548 Ga0307408_100910963 Ga0307408_1009109631 228
1204 3300031616 Ga0307508_10000437 Ga0307508_1000043713 228
1205 3300031711 Ga0265314_10201127 Ga0265314_102011271 228
1206 3300031731 Ga0307405_10009539 Ga0307405_100095392 228
1207 3300031731 Ga0307405_10012578 Ga0307405_100125786 228
1208 3300031731 Ga0307405_10030704 Ga0307405_100307043 228
1209 3300031731 Ga0307405_10031491 Ga0307405_100314914 228
1210 3300031731 Ga0307405_10044581 Ga0307405_100445813 228
1211 3300031731 Ga0307405_10051724 Ga0307405_100517244 228
1212 3300031731 Ga0307405_10071317 Ga0307405_100713173 228
1213 3300031731 Ga0307405_10090071 Ga0307405_100900712 228
1214 3300031731 Ga0307405_10109503 Ga0307405_101095032 228
1215 3300031731 Ga0307405_10203885 Ga0307405_102038852 228
1216 3300031731 Ga0307405_10226839 Ga0307405_102268392 228
1217 3300031731 Ga0307405_10278584 Ga0307405_102785841 228
1218 3300031731 Ga0307405_10444311 Ga0307405_104443111 228
1219 3300031824 Ga0307413_10002391 Ga0307413_100023912 228
1220 3300031824 Ga0307413_10004714 Ga0307413_100047143 228
1221 3300031824 Ga0307413_10040118 Ga0307413_100401182 228
1222 3300031824 Ga0307413_10067151 Ga0307413_100671512 228
1223 3300031824 Ga0307413_10088567 Ga0307413_100885672 228
1224 3300031824 Ga0307413_10243112 Ga0307413_102431122 228
1225 3300031824 Ga0307413_10262643 Ga0307413_102626432 228
1226 3300031824 Ga0307413_10315693 Ga0307413_103156932 228
1227 3300031824 Ga0307413_10470960 Ga0307413_104709602 228
1228 3300031824 Ga0307413_10490457 Ga0307413_104904571 228
1229 3300031852 Ga0307410_10006898 Ga0307410_100068988 228
1230 3300031852 Ga0307410_10014043 Ga0307410_100140436 228
1231 3300031852 Ga0307410_10019555 Ga0307410_100195552 228
1232 3300031852 Ga0307410_10029787 Ga0307410_100297873 228
1233 3300031852 Ga0307410_10029941 Ga0307410_100299414 228
1234 3300031852 Ga0307410_10031489 Ga0307410_100314894 228
1235 3300031852 Ga0307410_10035891 Ga0307410_100358912 228
1236 3300031852 Ga0307410_10047117 Ga0307410_100471173 228
1237 3300031852 Ga0307410_10048902 Ga0307410_100489022 228
1238 3300031852 Ga0307410_10075082 Ga0307410_100750822 228
1239 3300031852 Ga0307410_10105965 Ga0307410_101059652 228
1240 3300031852 Ga0307410_10107231 Ga0307410_101072312 228
1241 3300031852 Ga0307410_10135701 Ga0307410_101357012 228
1242 3300031852 Ga0307410_10145465 Ga0307410_101454652 228
1243 3300031852 Ga0307410_10173689 Ga0307410_101736892 228
1244 3300031852 Ga0307410_10344492 Ga0307410_103444922 228
1245 3300031852 Ga0307410_10415298 Ga0307410_104152982 228
1246 3300031901 Ga0307406_10013423 Ga0307406_100134233 228
1247 3300031901 Ga0307406_10024162 Ga0307406_100241625 228
1248 3300031901 Ga0307406_10035673 Ga0307406_100356734 228
1249 3300031901 Ga0307406_10039071 Ga0307406_100390712 228
1250 3300031901 Ga0307406_10068324 Ga0307406_100683242 228
1251 3300031901 Ga0307406_10109982 Ga0307406_101099822 228
1252 3300031901 Ga0307406_10127035 Ga0307406_101270352 228
1253 3300031901 Ga0307406_10176223 Ga0307406_101762232 228
1254 3300031901 Ga0307406_10224062 Ga0307406_102240622 228
1255 3300031901 Ga0307406_10256087 Ga0307406_102560872 228
1256 3300031901 Ga0307406_10289834 Ga0307406_102898342 228
1257 3300031901 Ga0307406_10350431 Ga0307406_103504312 228
1258 3300031903 Ga0307407_10004866 Ga0307407_100048666 228
1259 3300031903 Ga0307407_10028047 Ga0307407_100280472 228
1260 3300031903 Ga0307407_10044011 Ga0307407_100440112 228
1261 3300031903 Ga0307407_10071254 Ga0307407_100712542 228
1262 3300031903 Ga0307407_10093311 Ga0307407_100933112 228
1263 3300031903 Ga0307407_10110764 Ga0307407_101107642 228
1264 3300031903 Ga0307407_10143274 Ga0307407_101432742 228
1265 3300031903 Ga0307407_10330336 Ga0307407_103303362 228
1266 3300031903 Ga0307407_10358006 Ga0307407_103580061 228
1267 3300031911 Ga0307412_10000368 Ga0307412_100003682 228
1268 3300031911 Ga0307412_10000425 Ga0307412_1000042511 228
1269 3300031911 Ga0307412_10005229 Ga0307412_100052295 228
1270 3300031911 Ga0307412_10009767 Ga0307412_100097673 228
1271 3300031911 Ga0307412_10013360 Ga0307412_100133603 228
1272 3300031911 Ga0307412_10017619 Ga0307412_100176195 228
1273 3300031911 Ga0307412_10026547 Ga0307412_100265472 228
1274 3300031911 Ga0307412_10027328 Ga0307412_100273283 228
1275 3300031911 Ga0307412_10047403 Ga0307412_100474031 228
1276 3300031911 Ga0307412_10053684 Ga0307412_100536842 228
1277 3300031911 Ga0307412_10061699 Ga0307412_100616992 228
1278 3300031911 Ga0307412_10086573 Ga0307412_100865733 228
1279 3300031911 Ga0307412_10113670 Ga0307412_101136702 228
1280 3300031911 Ga0307412_10158778 Ga0307412_101587781 228
1281 3300031911 Ga0307412_10246087 Ga0307412_102460872 228
1282 3300031911 Ga0307412_10274557 Ga0307412_102745571 228
1283 3300031911 Ga0307412_10656692 Ga0307412_106566921 228
1284 3300031995 Ga0307409_100014448 Ga0307409_1000144483 228
1285 3300031995 Ga0307409_100029953 Ga0307409_1000299532 228
1286 3300031995 Ga0307409_100112711 Ga0307409_1001127113 228
1287 3300031995 Ga0307409_100120558 Ga0307409_1001205583 228
1288 3300031995 Ga0307409_100129273 Ga0307409_1001292733 228
1289 3300031995 Ga0307409_100161468 Ga0307409_1001614682 228
1290 3300031995 Ga0307409_100177803 Ga0307409_1001778031 228
1291 3300031995 Ga0307409_100181627 Ga0307409_1001816273 228
1292 3300031995 Ga0307409_100198811 Ga0307409_1001988112 228
1293 3300031995 Ga0307409_100278970 Ga0307409_1002789702 228
1294 3300031995 Ga0307409_100293200 Ga0307409_1002932002 228
1295 3300031995 Ga0307409_100301621 Ga0307409_1003016212 228
1296 3300031995 Ga0307409_100375606 Ga0307409_1003756062 228
1297 3300032002 Ga0307416_100020525 Ga0307416_1000205255 228
1298 3300032002 Ga0307416_100030428 Ga0307416_1000304284 228
1299 3300032002 Ga0307416_100164925 Ga0307416_1001649252 228
1300 3300032002 Ga0307416_100253890 Ga0307416_1002538902 228
1301 3300032002 Ga0307416_100313785 Ga0307416_1003137852 228
1302 3300032002 Ga0307416_100314962 Ga0307416_1003149622 228
1303 3300032002 Ga0307416_100526549 Ga0307416_1005265492 228
1304 3300032002 Ga0307416_100616664 Ga0307416_1006166641 228
1305 3300032002 Ga0307416_100617655 Ga0307416_1006176552 228
1306 3300032002 Ga0307416_100654908 Ga0307416_1006549081 228
1307 3300032002 Ga0307416_100680291 Ga0307416_1006802912 228
1308 3300032002 Ga0307416_101173185 Ga0307416_1011731851 228
1309 3300032004 Ga0307414_10000996 Ga0307414_1000099617 228
1310 3300032004 Ga0307414_10004003 Ga0307414_100040032 228
1311 3300032004 Ga0307414_10006804 Ga0307414_100068045 228
1312 3300032004 Ga0307414_10007563 Ga0307414_100075631 228
1313 3300032004 Ga0307414_10007626 Ga0307414_100076267 228
1314 3300032004 Ga0307414_10007906 Ga0307414_100079066 228
1315 3300032004 Ga0307414_10018838 Ga0307414_100188382 228
1316 3300032004 Ga0307414_10027709 Ga0307414_100277092 228
1317 3300032004 Ga0307414_10034632 Ga0307414_100346324 228
1318 3300032004 Ga0307414_10037145 Ga0307414_100371454 228
1319 3300032004 Ga0307414_10051481 Ga0307414_100514812 228
1320 3300032004 Ga0307414_10058044 Ga0307414_100580442 228
1321 3300032004 Ga0307414_10062291 Ga0307414_100622912 228
1322 3300032004 Ga0307414_10075676 Ga0307414_100756763 228
1323 3300032004 Ga0307414_10077988 Ga0307414_100779882 228
1324 3300032004 Ga0307414_10089713 Ga0307414_100897133 228
1325 3300032004 Ga0307414_10096306 Ga0307414_100963062 228
1326 3300032004 Ga0307414_10096608 Ga0307414_100966081 228
1327 3300032004 Ga0307414_10117214 Ga0307414_101172142 228
1328 3300032004 Ga0307414_10131210 Ga0307414_101312102 228
1329 3300032004 Ga0307414_10133943 Ga0307414_101339432 228
1330 3300032004 Ga0307414_10189023 Ga0307414_101890233 228
1331 3300032004 Ga0307414_10226133 Ga0307414_102261332 228
1332 3300032004 Ga0307414_10311956 Ga0307414_103119562 228
1333 3300032004 Ga0307414_10357083 Ga0307414_103570832 228
1334 3300032005 Ga0307411_10009989 Ga0307411_100099892 228
1335 3300032005 Ga0307411_10012573 Ga0307411_100125735 228
1336 3300032005 Ga0307411_10025582 Ga0307411_100255824 228
1337 3300032005 Ga0307411_10029387 Ga0307411_100293873 228
1338 3300032005 Ga0307411_10041507 Ga0307411_100415072 228
1339 3300032005 Ga0307411_10066130 Ga0307411_100661304 228
1340 3300032005 Ga0307411_10074795 Ga0307411_100747952 228
1341 3300032005 Ga0307411_10099516 Ga0307411_100995163 228
1342 3300032005 Ga0307411_10133978 Ga0307411_101339782 228
1343 3300032005 Ga0307411_10210451 Ga0307411_102104512 228
1344 3300032005 Ga0307411_10260776 Ga0307411_102607762 228
1345 3300032005 Ga0307411_10410124 Ga0307411_104101241 228
1346 3300032005 Ga0307411_10510130 Ga0307411_105101302 228
1347 3300032126 Ga0307415_100009130 Ga0307415_1000091302 228
1348 3300032126 Ga0307415_100009983 Ga0307415_1000099832 228
1349 3300032126 Ga0307415_100050797 Ga0307415_1000507973 228
1350 3300032126 Ga0307415_100051734 Ga0307415_1000517342 228
1351 3300032126 Ga0307415_100099985 Ga0307415_1000999852 228
1352 3300032126 Ga0307415_100267327 Ga0307415_1002673272 228
1353 3300032126 Ga0307415_100634805 Ga0307415_1006348052 228
1354 3300032126 Ga0307415_100716287 Ga0307415_1007162871 228
1355 3300032126 Ga0307415_100720667 Ga0307415_1007206672 228
1356 3300032133 Ga0316583_10002544 Ga0316583_100025448 228
1357 3300033180 Ga0307510_10002654 Ga0307510_1000265421 228
1358 3300033180 Ga0307510_10020525 Ga0307510_100205253 228
1359 3300033180 Ga0307510_10109075 Ga0307510_101090753 228
1360 3300035084 Ga0373928_0045767 Ga0373928_0045767_183_869 228
1361 3300035111 Ga0373923_0235363 Ga0373923_0235363_156_842 228
1362 3300036401 Ga0373937_0699227 Ga0373937_0699227_133_819 228
1363 3300036712 Ga0316584_0015325 Ga0316584_0015325_2354_3040 228
1364 3300036712 Ga0316584_0046420 Ga0316584_0046420_11_697 228
1365 3300037068 Ga0373925_0101272 Ga0373925_0101272_19_705 228
1366 3300037312 Ga0395899_0007334 Ga0395899_0007334_5937_6623 228
1367 3300037312 Ga0395899_0008123 Ga0395899_0008123_1764_2450 228
1368 3300037312 Ga0395899_0019612 Ga0395899_0019612_63_749 228
1369 3300037312 Ga0395899_0021784 Ga0395899_0021784_63_749 228
1370 3300037312 Ga0395899_0025715 Ga0395899_0025715_2482_3168 228
1371 3300037312 Ga0395899_0045698 Ga0395899_0045698_1009_1695 228
1372 3300037312 Ga0395899_0093908 Ga0395899_0093908_680_1366 228
1373 3300037312 Ga0395899_0095513 Ga0395899_0095513_595_1281 228
1374 3300037418 Ga0395900_0000124 Ga0395900_0000124_128772_129458 228
1375 3300037418 Ga0395900_0001779 Ga0395900_0001779_21136_21822 228
1376 3300037418 Ga0395900_0009084 Ga0395900_0009084_668_1354 228
1377 3300037418 Ga0395900_0030086 Ga0395900_0030086_1567_2253 228
1378 3300037418 Ga0395900_0035428 Ga0395900_0035428_4392_5078 228
1379 3300037418 Ga0395900_0052744 Ga0395900_0052744_785_1471 228
1380 3300037418 Ga0395900_0072699 Ga0395900_0072699_1529_2215 228
1381 3300037418 Ga0395900_0094329 Ga0395900_0094329_1216_1902 228
1382 3300037418 Ga0395900_0157752 Ga0395900_0157752_668_1354 228
1383 3300037418 Ga0395900_0197608 Ga0395900_0197608_32_718 228
1384 3300037418 Ga0395900_0207862 Ga0395900_0207862_1229_1915 228
1385 3300037418 Ga0395900_0260175 Ga0395900_0260175_293_979 228
1386 3300037418 Ga0395900_0330107 Ga0395900_0330107_737_1423 228
1387 3300037418 Ga0395900_0755962 Ga0395900_0755962_201_887 228
1388 3300037466 Ga0395898_0018013 Ga0395898_0018013_2006_2692 228
1389 3300037466 Ga0395898_0038108 Ga0395898_0038108_3902_4588 228
1390 3300037466 Ga0395898_0046946 Ga0395898_0046946_126_812 228
1391 3300037466 Ga0395898_0096973 Ga0395898_0096973_897_1583 228
1392 3300037466 Ga0395898_0119516 Ga0395898_0119516_770_1456 228
1393 3300037466 Ga0395898_0140695 Ga0395898_0140695_162_848 228
1394 3300037466 Ga0395898_0180153 Ga0395898_0180153_679_1365 228
1395 3300037466 Ga0395898_0469575 Ga0395898_0469575_245_931 228
1396 3300037466 Ga0395898_0484349 Ga0395898_0484349_137_823 228
1397 3300037471 Ga0395905_0000083 Ga0395905_0000083_25291_25977 228
1398 3300037471 Ga0395905_0003571 Ga0395905_0003571_5413_6099 228
1399 3300037471 Ga0395905_0030244 Ga0395905_0030244_3881_4567 228
1400 3300037471 Ga0395905_0052768 Ga0395905_0052768_1371_2057 228
1401 3300037471 Ga0395905_0122037 Ga0395905_0122037_1397_2083 228
1402 3300037471 Ga0395905_0138978 Ga0395905_0138978_125_811 228
1403 3300037471 Ga0395905_0151984 Ga0395905_0151984_552_1238 228
1404 3300037471 Ga0395905_0171782 Ga0395905_0171782_1069_1755 228
1405 3300037471 Ga0395905_0254720 Ga0395905_0254720_755_1441 228
1406 3300037471 Ga0395905_0297269 Ga0395905_0297269_409_1095 228
1407 3300037471 Ga0395905_0488490 Ga0395905_0488490_396_1082 228
1408 3300037853 Ga0436364_0791346 Ga0436364_0791346_8735_9421 228
1409 3300037853 Ga0436364_0852694 Ga0436364_0852694_22418_23122 228
1410 3300038443 Ga0395901_0000031 Ga0395901_0000031_129215_129901 228
1411 3300038443 Ga0395901_0000369 Ga0395901_0000369_17171_17857 228
1412 3300038443 Ga0395901_0032817 Ga0395901_0032817_794_1480 228
1413 3300038443 Ga0395901_0052142 Ga0395901_0052142_2216_2902 228
1414 3300038443 Ga0395901_0106626 Ga0395901_0106626_606_1292 228
1415 3300038443 Ga0395901_0141058 Ga0395901_0141058_1121_1807 228
1416 3300038443 Ga0395901_0182907 Ga0395901_0182907_1319_2005 228
1417 3300038443 Ga0395901_0261347 Ga0395901_0261347_425_1138 228
1418 3300038443 Ga0395901_0570981 Ga0395901_0570981_433_1119 228
1419 3300039062 Ga0400483_285123 Ga0400483_285123_737_1447 228
1420 3300039437 Ga0436365_0380590 Ga0436365_0380590_56759_57445 228
1421 3300039437 Ga0436365_0564701 Ga0436365_0564701_23863_24570 228
1422 3300039438 Ga0436360_1138764 Ga0436360_1138764_3775_4488 228
1423 3300039447 Ga0436361_0156897 Ga0436361_0156897_249_962 228
1424 3300039447 Ga0436361_0290947 Ga0436361_0290947_2552_3280 228
1425 3300039450 Ga0436363_0755130 Ga0436363_0755130_254_940 228
1426 3300039453 Ga0436362_0265247 Ga0436362_0265247_59372_60079 228
1427 3300041404 Ga0439436_0040872 Ga0439436_0040872_617_1303 228
1428 3300041404 Ga0439436_0046721 Ga0439436_0046721_414_1100 228
1429 3300041406 Ga0439439_0004034 Ga0439439_0004034_1401_2093 228
1430 3300041410 Ga0439461_0001088 Ga0439461_0001088_502_1188 228
1431 3300041413 Ga0439465_0004070 Ga0439465_0004070_1561_2247 228
1432 3300041413 Ga0439465_0018585 Ga0439465_0018585_233_922 228
1433 3300041453 Ga0451797_0647272 Ga0451797_0647272_925_1611 228
1434 3300041460 Ga0451802_1792715 Ga0451802_1792715_791_1477 228
1435 3300041486 Ga0451807_0363003 Ga0451807_0363003_21_707 228
1436 3300041486 Ga0451807_1555181 Ga0451807_1555181_342_1028 228
1437 3300041512 Ga0451853_0010956 Ga0451853_0010956_1240_1926 228
1438 3300041997 Ga0439431_0000614 Ga0439431_0000614_6686_7372 228
1439 3300042005 Ga0439448_0000189 Ga0439448_0000189_668_1354 228
1440 3300042005 Ga0439448_0001949 Ga0439448_0001949_3171_3857 228
1441 3300042005 Ga0439448_0010633 Ga0439448_0010633_2024_2710 228
1442 3300042005 Ga0439448_0034292 Ga0439448_0034292_59_745 228
1443 3300042006 Ga0439432_007906 Ga0439432_007906_1138_1827 228
1444 3300042006 Ga0439432_023371 Ga0439432_023371_1264_1950 228
1445 3300042006 Ga0439432_044335 Ga0439432_044335_17_703 228
1446 3300042007 Ga0439449_0057706 Ga0439449_0057706_664_1356 228
1447 3300042012 Ga0439455_0016585 Ga0439455_0016585_975_1661 228
1448 3300042012 Ga0439455_0054506 Ga0439455_0054506_265_951 228
1449 3300042015 Ga0439462_0000063 Ga0439462_0000063_3517_4203 228
1450 3300042015 Ga0439462_0018387 Ga0439462_0018387_473_1159 228
1451 3300042118 Ga0450914_002942 Ga0450914_002942_549_1235 228
1452 3300042122 Ga0450920_016026 Ga0450920_016026_259_951 228
1453 3300042134 Ga0450898_010808 Ga0450898_010808_432_1118 228
1454 3300042144 Ga0450889_000938 Ga0450889_000938_1410_2096 228
1455 3300042156 Ga0439446_0033685 Ga0439446_0033685_225_911 228
1456 3300042157 Ga0439458_0000020 Ga0439458_0000020_2226_2912 228
1457 3300042157 Ga0439458_0003976 Ga0439458_0003976_1845_2531 228
1458 3300042157 Ga0439458_0048364 Ga0439458_0048364_347_1033 228
1459 3300042435 Ga0439434_0000837 Ga0439434_0000837_290_976 228
1460 3300044656 Ga0466969_0024531 Ga0466969_0024531_1755_2441 228
1461 3300044656 Ga0466969_0044256 Ga0466969_0044256_156_842 228
1462 3300044658 Ga0466972_0007627 Ga0466972_0007627_1263_1949 228
1463 3300044658 Ga0466972_0060546 Ga0466972_0060546_310_996 228
1464 3300044684 Ga0466966_0000010 Ga0466966_0000010_25442_26128 228
1465 3300044684 Ga0466966_0009572 Ga0466966_0009572_692_1378 228
1466 3300044693 Ga0466961_0021726 Ga0466961_0021726_2736_3422 228
1467 3300044693 Ga0466961_0026020 Ga0466961_0026020_2299_2985 228
1468 3300044693 Ga0466961_0365663 Ga0466961_0365663_95_781 228
1469 3300044694 Ga0466963_0015932 Ga0466963_0015932_1945_2631 228
1470 3300044694 Ga0466963_0074979 Ga0466963_0074979_1352_2038 228
1471 3300044694 Ga0466963_0414577 Ga0466963_0414577_202_888 228
1472 3300044706 Ga0466964_0014857 Ga0466964_0014857_349_1035 228
1473 3300044719 Ga0466971_0014375 Ga0466971_0014375_1314_2000 228
1474 3300044719 Ga0466971_0070500 Ga0466971_0070500_119_805 228
1475 3300044719 Ga0466971_0259421 Ga0466971_0259421_48_734 228
1476 3300044735 Ga0466968_0008602 Ga0466968_0008602_2647_3333 228
1477 3300044735 Ga0466968_0036142 Ga0466968_0036142_860_1546 228
1478 3300044735 Ga0466968_0096417 Ga0466968_0096417_147_833 228
1479 3300044765 Ga0466970_0006134 Ga0466970_0006134_3081_3767 228
1480 3300044765 Ga0466970_0023186 Ga0466970_0023186_1915_2601 228
1481 3300044842 Ga0466957_0049324 Ga0466957_0049324_1211_1897 228
1482 3300044842 Ga0466957_0326025 Ga0466957_0326025_238_924 228
1483 3300044901 Ga0466960_0016605 Ga0466960_0016605_566_1252 228
1484 3300045049 Ga0466959_0050551 Ga0466959_0050551_649_1335 228
1485 3300045049 Ga0466959_0091176 Ga0466959_0091176_660_1346 228
1486 3300045049 Ga0466959_0093983 Ga0466959_0093983_692_1378 228
1487 3300045049 Ga0466959_0406087 Ga0466959_0406087_90_776 228
1488 3300045051 Ga0451576_0000024 Ga0451576_0000024_189102_189788 228
1489 3300045836 Ga0466958_0029194 Ga0466958_0029194_1075_1761 228
1490 3300045836 Ga0466958_0036661 Ga0466958_0036661_1474_2160 228
1491 3300045836 Ga0466958_0082311 Ga0466958_0082311_520_1206 228
1492 3300045976 Ga0466967_0048844 Ga0466967_0048844_2236_2922 228
1493 3300045976 Ga0466967_0059045 Ga0466967_0059045_901_1587 228
1494 3300045976 Ga0466967_0161910 Ga0466967_0161910_539_1225 228
1495 3300046453 Ga0495627_000089 Ga0495627_000089_70742_71473 228
1496 3300046453 Ga0495627_000108 Ga0495627_000108_53932_54618 228
1497 3300046453 Ga0495627_000430 Ga0495627_000430_5511_6200 228
1498 3300046459 Ga0495629_0016572 Ga0495629_0016572_3174_3884 228
1499 3300046460 Ga0495638_0000012 Ga0495638_0000012_246194_246940 228
1500 3300046460 Ga0495638_0067020 Ga0495638_0067020_1393_2079 228
1501 3300046471 Ga0495650_0000355 Ga0495650_0000355_68952_69638 228
1502 3300046471 Ga0495650_0000366 Ga0495650_0000366_73562_74251 228
1503 3300046471 Ga0495650_0018649 Ga0495650_0018649_51_737 228
1504 3300046492 Ga0495585_0002254 Ga0495585_0002254_930_1724 228
1505 3300046492 Ga0495585_0039541 Ga0495585_0039541_1193_1879 228
1506 3300046500 Ga0495596_0000789 Ga0495596_0000789_1252_1938 228
1507 3300046501 Ga0495607_0014490 Ga0495607_0014490_1262_1975 228
1508 3300046506 Ga0495583_0000949 Ga0495583_0000949_6027_6713 228
1509 3300046506 Ga0495583_0001229 Ga0495583_0001229_9191_9937 228
1510 3300046507 Ga0495606_0023959 Ga0495606_0023959_3330_4043 228
1511 3300046507 Ga0495606_0041901 Ga0495606_0041901_946_1632 228
1512 3300046507 Ga0495606_0192292 Ga0495606_0192292_372_1058 228
1513 3300046512 Ga0495610_0000050 Ga0495610_0000050_79732_80421 228
1514 3300046512 Ga0495610_0000662 Ga0495610_0000662_1835_2521 228
1515 3300046512 Ga0495610_0003729 Ga0495610_0003729_9238_9924 228
1516 3300046513 Ga0495616_0000030 Ga0495616_0000030_10777_11463 228
1517 3300046515 Ga0495620_0054461 Ga0495620_0054461_48_737 228
1518 3300046518 Ga0495631_0044275 Ga0495631_0044275_899_1588 228
1519 3300046519 Ga0495632_0000001 Ga0495632_0000001_174524_175210 228
1520 3300046519 Ga0495632_0001187 Ga0495632_0001187_5253_5999 228
1521 3300046519 Ga0495632_0002709 Ga0495632_0002709_582_1271 228
1522 3300046519 Ga0495632_0010006 Ga0495632_0010006_3315_4049 228
1523 3300046520 Ga0495637_0001922 Ga0495637_0001922_125_811 228
1524 3300046520 Ga0495637_0011653 Ga0495637_0011653_1945_2631 228
1525 3300046520 Ga0495637_0012808 Ga0495637_0012808_486_1172 228
1526 3300046522 Ga0495643_0000020 Ga0495643_0000020_159275_159961 228
1527 3300046522 Ga0495643_0012831 Ga0495643_0012831_2626_3312 228
1528 3300046522 Ga0495643_0016735 Ga0495643_0016735_212_898 228
1529 3300046522 Ga0495643_0019971 Ga0495643_0019971_2587_3300 228
1530 3300046524 Ga0495648_0000295 Ga0495648_0000295_37960_38706 228
1531 3300046524 Ga0495648_0020560 Ga0495648_0020560_2473_3204 228
1532 3300046525 Ga0495663_0000002 Ga0495663_0000002_172854_173540 228
1533 3300046525 Ga0495663_0005518 Ga0495663_0005518_1458_2144 228
1534 3300046525 Ga0495663_0024157 Ga0495663_0024157_940_1626 228
1535 3300046525 Ga0495663_0046785 Ga0495663_0046785_387_1073 228
1536 3300046530 Ga0495654_0000535 Ga0495654_0000535_18519_19208 228
1537 3300046530 Ga0495654_0051664 Ga0495654_0051664_737_1423 228
1538 3300046537 Ga0495598_0025743 Ga0495598_0025743_150_836 228
1539 3300046537 Ga0495598_0106145 Ga0495598_0106145_75_761 228
1540 3300046538 Ga0495609_0007581 Ga0495609_0007581_3173_3859 228
1541 3300046538 Ga0495609_0096628 Ga0495609_0096628_48_782 228
1542 3300046539 Ga0495621_0000099 Ga0495621_0000099_3731_4417 228
1543 3300046539 Ga0495621_0000360 Ga0495621_0000360_20_706 228
1544 3300046539 Ga0495621_0000399 Ga0495621_0000399_3119_3805 228
1545 3300046539 Ga0495621_0007914 Ga0495621_0007914_2107_2793 228
1546 3300046542 Ga0495597_0007914 Ga0495597_0007914_1914_2624 228
1547 3300046557 Ga0495622_0049190 Ga0495622_0049190_68_754 228
1548 3300046558 Ga0495633_0000213 Ga0495633_0000213_6834_7520 228
1549 3300046558 Ga0495633_0000544 Ga0495633_0000544_24285_24971 228
1550 3300046558 Ga0495633_0028562 Ga0495633_0028562_972_1658 228
1551 3300046558 Ga0495633_0044994 Ga0495633_0044994_43_729 228
1552 3300046616 Ga0495668_0000234 Ga0495668_0000234_4735_5421 228
1553 3300046616 Ga0495668_0001515 Ga0495668_0001515_9880_10569 228
1554 3300046616 Ga0495668_0012462 Ga0495668_0012462_340_1026 228
1555 3300046616 Ga0495668_0015339 Ga0495668_0015339_190_879 228
1556 3300046616 Ga0495668_0032777 Ga0495668_0032777_1276_1962 228
1557 3300046616 Ga0495668_0054098 Ga0495668_0054098_389_1099 228
1558 3300046616 Ga0495668_0076149 Ga0495668_0076149_747_1433 228
1559 3300046660 Ga0495625_0000584 Ga0495625_0000584_10675_11469 228
1560 3300046660 Ga0495625_0005142 Ga0495625_0005142_10424_11110 228
1561 3300046660 Ga0495625_0027285 Ga0495625_0027285_2535_3221 228
1562 3300046660 Ga0495625_0030477 Ga0495625_0030477_1856_2542 228
1563 3300046660 Ga0495625_0325965 Ga0495625_0325965_241_927 228
1564 3300046664 Ga0495659_0001833 Ga0495659_0001833_1901_2587 228
1565 3300046664 Ga0495659_0052951 Ga0495659_0052951_419_1105 228
1566 3300046665 Ga0495661_0081908 Ga0495661_0081908_324_1010 228
1567 3300046684 Ga0495669_0003625 Ga0495669_0003625_140_826 228
1568 3300046684 Ga0495669_0006919 Ga0495669_0006919_694_1380 228
1569 3300046684 Ga0495669_0112441 Ga0495669_0112441_252_938 228
1570 3300046684 Ga0495669_0113336 Ga0495669_0113336_167_853 228
1571 3300046684 Ga0495669_0140647 Ga0495669_0140647_313_1005 228
1572 3300046691 Ga0495670_0041912 Ga0495670_0041912_823_1509 228
1573 3300046692 Ga0495671_0000016 Ga0495671_0000016_159275_159961 228
1574 3300046692 Ga0495671_0000111 Ga0495671_0000111_54478_55224 228
1575 3300046692 Ga0495671_0100862 Ga0495671_0100862_476_1210 228
1576 3300046694 Ga0495649_0159937 Ga0495649_0159937_400_1086 228
1577 3300046794 Ga0495589_0044317 Ga0495589_0044317_1271_1960 228
1578 3300046809 Ga0495600_0023893 Ga0495600_0023893_18_704 228
1579 3300047445 Ga0495677_0014759 Ga0495677_0014759_1330_2016 228
1580 3300047445 Ga0495677_0018633 Ga0495677_0018633_1585_2271 228
1581 3300047445 Ga0495677_0051981 Ga0495677_0051981_622_1314 228
1582 3300047447 Ga0495685_011488 Ga0495685_011488_1794_2483 228
1583 3300047469 Ga0495673_0000013 Ga0495673_0000013_17512_18258 228
1584 3300047470 Ga0495681_0000089 Ga0495681_0000089_5560_6249 228
1585 3300047470 Ga0495681_0000129 Ga0495681_0000129_2956_3642 228
1586 3300047472 Ga0495686_0000074 Ga0495686_0000074_146035_146751 228
1587 3300047472 Ga0495686_0000956 Ga0495686_0000956_5245_5931 228
1588 3300047472 Ga0495686_0002793 Ga0495686_0002793_10607_11293 228
1589 3300047472 Ga0495686_0004696 Ga0495686_0004696_3488_4174 228
1590 3300047472 Ga0495686_0016160 Ga0495686_0016160_1457_2143 228
1591 3300047472 Ga0495686_0035402 Ga0495686_0035402_276_962 228
1592 3300047472 Ga0495686_0073077 Ga0495686_0073077_677_1363 228
1593 3300047472 Ga0495686_0106550 Ga0495686_0106550_220_930 228
1594 3300047673 Ga0495593_0038412 Ga0495593_0038412_1489_2199 228
1595 3300048088 Ga0495602_0227585 Ga0495602_0227585_180_890 228
1596 3300048091 Ga0495626_0000255 Ga0495626_0000255_19911_20597 228
1597 3300048904 Ga0496101_0103177 Ga0496101_0103177_931_1623 228
1598 3300048905 Ga0496102_0004440 Ga0496102_0004440_2306_2998 228
1599 3300048905 Ga0496102_0016971 Ga0496102_0016971_1985_2671 228
1600 3300048905 Ga0496102_0513833 Ga0496102_0513833_23_709 228
1601 3300048906 Ga0496103_0004338 Ga0496103_0004338_7681_8370 228
1602 3300048906 Ga0496103_0006060 Ga0496103_0006060_2638_3324 228
1603 3300048906 Ga0496103_0018322 Ga0496103_0018322_2666_3358 228
1604 3300048906 Ga0496103_0032728 Ga0496103_0032728_2443_3129 228
1605 3300048907 Ga0496104_0561261 Ga0496104_0561261_135_821 228
1606 3300048908 Ga0496105_0012633 Ga0496105_0012633_2047_2733 228
1607 3300048908 Ga0496105_0388436 Ga0496105_0388436_336_1022 228
1608 3300048909 Ga0496106_0033166 Ga0496106_0033166_77_763 228
1609 3300048910 Ga0496107_0015627 Ga0496107_0015627_1576_2262 228
1610 3300048911 Ga0496108_0000566 Ga0496108_0000566_23209_23895 228
1611 3300048911 Ga0496108_0007701 Ga0496108_0007701_1760_2446 228
1612 3300048912 Ga0496109_0030373 Ga0496109_0030373_2717_3403 228
1613 3300048912 Ga0496109_0077299 Ga0496109_0077299_1653_2345 228
1614 3300048912 Ga0496109_0238513 Ga0496109_0238513_661_1353 228
1615 3300048913 Ga0496110_0006992 Ga0496110_0006992_170_862 228
1616 3300048913 Ga0496110_0008059 Ga0496110_0008059_3959_4645 228
1617 3300048913 Ga0496110_0019948 Ga0496110_0019948_1601_2287 228
1618 3300048914 Ga0496111_0000383 Ga0496111_0000383_4922_5608 228
1619 3300048914 Ga0496111_0006695 Ga0496111_0006695_178_870 228
1620 3300048914 Ga0496111_0182872 Ga0496111_0182872_295_981 228
1621 3300048915 Ga0496112_0004861 Ga0496112_0004861_6920_7606 228
1622 3300048916 Ga0496113_0009618 Ga0496113_0009618_5036_5722 228
1623 3300048916 Ga0496113_0445258 Ga0496113_0445258_112_804 228
1624 3300048917 Ga0496114_0043188 Ga0496114_0043188_626_1318 228
1625 3300048918 Ga0496115_0001780 Ga0496115_0001780_13194_13880 228
1626 3300048919 Ga0496116_0000045 Ga0496116_0000045_19787_20473 228
1627 3300048919 Ga0496116_0014181 Ga0496116_0014181_4057_4749 228
1628 3300048920 Ga0496117_0008020 Ga0496117_0008020_8865_9551 228
1629 3300048920 Ga0496117_0023280 Ga0496117_0023280_3706_4395 228
1630 3300048920 Ga0496117_0030787 Ga0496117_0030787_2020_2706 228
1631 3300048920 Ga0496117_0073459 Ga0496117_0073459_18_710 228
1632 3300048920 Ga0496117_0105086 Ga0496117_0105086_24_710 228
1633 3300048920 Ga0496117_0143937 Ga0496117_0143937_660_1346 228
1634 3300048920 Ga0496117_0218587 Ga0496117_0218587_348_1034 228
1635 3300048921 Ga0496118_0000797 Ga0496118_0000797_29706_30395 228
1636 3300048921 Ga0496118_0001340 Ga0496118_0001340_26097_26783 228
1637 3300048921 Ga0496118_0020552 Ga0496118_0020552_5141_5833 228
1638 3300048921 Ga0496118_0022886 Ga0496118_0022886_2209_2895 228
1639 3300048921 Ga0496118_0025316 Ga0496118_0025316_4165_4851 228
1640 3300048921 Ga0496118_0055561 Ga0496118_0055561_693_1379 228
1641 3300048921 Ga0496118_0057617 Ga0496118_0057617_315_1001 228
1642 3300048922 Ga0496119_0014928 Ga0496119_0014928_1226_1912 228
1643 3300048922 Ga0496119_0026083 Ga0496119_0026083_2798_3484 228
1644 3300048922 Ga0496119_0030582 Ga0496119_0030582_441_1127 228
1645 3300048923 Ga0496120_0145919 Ga0496120_0145919_109_795 228
1646 3300048923 Ga0496120_0239661 Ga0496120_0239661_38_727 228
1647 3300048924 Ga0496121_0000024 Ga0496121_0000024_251647_252333 228
1648 3300048924 Ga0496121_0000123 Ga0496121_0000123_69502_70188 228
1649 3300048924 Ga0496121_0000192 Ga0496121_0000192_70911_71597 228
1650 3300048924 Ga0496121_0000723 Ga0496121_0000723_19395_20081 228
1651 3300048924 Ga0496121_0001342 Ga0496121_0001342_34834_35520 228
1652 3300048924 Ga0496121_0003762 Ga0496121_0003762_19345_20031 228
1653 3300048924 Ga0496121_0007935 Ga0496121_0007935_6065_6751 228
1654 3300048924 Ga0496121_0042102 Ga0496121_0042102_2406_3098 228
1655 3300048924 Ga0496121_0256596 Ga0496121_0256596_86_772 228
1656 3300048925 Ga0496122_0000768 Ga0496122_0000768_21535_22221 228
1657 3300048925 Ga0496122_0000989 Ga0496122_0000989_21256_21942 228
1658 3300048925 Ga0496122_0004681 Ga0496122_0004681_12699_13385 228
1659 3300048925 Ga0496122_0016352 Ga0496122_0016352_3896_4582 228
1660 3300048925 Ga0496122_0018871 Ga0496122_0018871_3519_4205 228
1661 3300048925 Ga0496122_0096901 Ga0496122_0096901_1180_1866 228
1662 3300048925 Ga0496122_0167190 Ga0496122_0167190_592_1296 228
1663 3300048926 Ga0496123_0000335 Ga0496123_0000335_29777_30463 228
1664 3300048926 Ga0496123_0002151 Ga0496123_0002151_21308_21994 228
1665 3300048926 Ga0496123_0014434 Ga0496123_0014434_3580_4266 228
1666 3300048926 Ga0496123_0025449 Ga0496123_0025449_3483_4169 228
1667 3300048926 Ga0496123_0036342 Ga0496123_0036342_833_1519 228
1668 3300048926 Ga0496123_0132702 Ga0496123_0132702_225_911 228
1669 3300048927 Ga0496124_0002634 Ga0496124_0002634_7574_8260 228
1670 3300048927 Ga0496124_0004095 Ga0496124_0004095_10803_11489 228
1671 3300048927 Ga0496124_0007495 Ga0496124_0007495_4217_4903 228
1672 3300048927 Ga0496124_0013848 Ga0496124_0013848_3778_4464 228
1673 3300048927 Ga0496124_0055489 Ga0496124_0055489_584_1270 228
1674 3300048927 Ga0496124_0069946 Ga0496124_0069946_814_1500 228
1675 3300048927 Ga0496124_0099075 Ga0496124_0099075_1253_1939 228
1676 3300048927 Ga0496124_0114970 Ga0496124_0114970_55_741 228
1677 3300048927 Ga0496124_0143093 Ga0496124_0143093_771_1457 228
1678 3300048927 Ga0496124_0165871 Ga0496124_0165871_125_811 228
1679 3300048928 Ga0496125_0001515 Ga0496125_0001515_30262_30948 228
1680 3300048928 Ga0496125_0003252 Ga0496125_0003252_15430_16116 228
1681 3300048928 Ga0496125_0008331 Ga0496125_0008331_7962_8648 228
1682 3300048928 Ga0496125_0025437 Ga0496125_0025437_4433_5119 228
1683 3300048928 Ga0496125_0032413 Ga0496125_0032413_3946_4632 228
1684 3300048928 Ga0496125_0046577 Ga0496125_0046577_2665_3351 228
1685 3300048928 Ga0496125_0053957 Ga0496125_0053957_1551_2237 228
1686 3300048928 Ga0496125_0065865 Ga0496125_0065865_2085_2771 228
1687 3300048928 Ga0496125_0068194 Ga0496125_0068194_266_952 228
1688 3300048929 Ga0496126_0000641 Ga0496126_0000641_49259_49945 228
1689 3300048929 Ga0496126_0032755 Ga0496126_0032755_2862_3548 228
1690 3300048929 Ga0496126_0066897 Ga0496126_0066897_582_1268 228
1691 3300048929 Ga0496126_0066969 Ga0496126_0066969_628_1314 228
1692 3300048929 Ga0496126_0314963 Ga0496126_0314963_395_1081 228
1693 3300048929 Ga0496126_0570053 Ga0496126_0570053_45_731 228
1694 3300049459 Ga0495678_010008 Ga0495678_010008_1209_1895 228
1695 3300049459 Ga0495678_069965 Ga0495678_069965_110_799 228
1696 3300049460 Ga0495682_0106270 Ga0495682_0106270_74_760 228
1697 3300049513 Ga0501290_000032 Ga0501290_000032_4312_4998 228
1698 3300049515 Ga0501292_000022 Ga0501292_000022_36324_37010 228
1699 3300049517 Ga0501294_000025 Ga0501294_000025_8559_9245 228
1700 3300049521 Ga0501298_005905 Ga0501298_005905_1056_1745 228
1701 3300049523 Ga0501300_002150 Ga0501300_002150_700_1386 228
1702 3300049551 Ga0501335_004600 Ga0501335_004600_274_1017 228
1703 3300049569 Ga0501032_0001211 Ga0501032_0001211_12170_12880 228
1704 3300049569 Ga0501032_0090233 Ga0501032_0090233_615_1325 228
1705 3300049569 Ga0501032_0307807 Ga0501032_0307807_41_727 228
1706 3300049570 Ga0501033_0087415 Ga0501033_0087415_1337_2050 228
1707 3300049571 Ga0501034_0003520 Ga0501034_0003520_14208_14894 228
1708 3300049571 Ga0501034_0268817 Ga0501034_0268817_127_837 228
1709 3300049571 Ga0501034_0318887 Ga0501034_0318887_714_1424 228
1710 3300049572 Ga0501036_0219346 Ga0501036_0219346_867_1577 228
1711 3300049573 Ga0501037_0004760 Ga0501037_0004760_8276_8986 228
1712 3300049573 Ga0501037_0045901 Ga0501037_0045901_773_1486 228
1713 3300049573 Ga0501037_0053311 Ga0501037_0053311_1130_1840 228
1714 3300049574 Ga0501038_0019542 Ga0501038_0019542_2092_2802 228
1715 3300049574 Ga0501038_0282191 Ga0501038_0282191_543_1253 228
1716 3300049579 Ga0501043_0014727 Ga0501043_0014727_1117_1827 228
1717 3300049581 Ga0501047_0008184 Ga0501047_0008184_657_1367 228
1718 3300049581 Ga0501047_0019483 Ga0501047_0019483_1331_2017 228
1719 3300049583 Ga0501067_0000028 Ga0501067_0000028_54206_54916 228
1720 3300049584 Ga0501068_0001146 Ga0501068_0001146_10466_11176 228
1721 3300049584 Ga0501068_0047349 Ga0501068_0047349_1152_1862 228
1722 3300049588 Ga0501072_0084891 Ga0501072_0084891_536_1246 228
1723 3300049589 Ga0501073_0000002 Ga0501073_0000002_237064_237774 228
1724 3300049589 Ga0501073_0006010 Ga0501073_0006010_2357_3067 228
1725 3300049593 Ga0501077_0000002 Ga0501077_0000002_19064_19774 228
1726 3300049651 Ga0501201_013483 Ga0501201_013483_24_710 228
1727 3300049658 Ga0501211_003056 Ga0501211_003056_165_935 228
1728 3300049662 Ga0501222_000400 Ga0501222_000400_3259_3945 228
1729 3300049663 Ga0501223_000022 Ga0501223_000022_51623_52405 228
1730 3300049663 Ga0501223_000034 Ga0501223_000034_5722_6420 228
1731 3300049663 Ga0501223_029285 Ga0501223_029285_245_934 228
1732 3300049664 Ga0501224_000004 Ga0501224_000004_125380_126078 228
1733 3300049664 Ga0501224_002903 Ga0501224_002903_1176_1862 228
1734 3300049668 Ga0501233_000678 Ga0501233_000678_926_1624 228
1735 3300049668 Ga0501233_017526 Ga0501233_017526_395_1081 228
1736 3300049669 Ga0501235_002727 Ga0501235_002727_2164_2934 228
1737 3300049669 Ga0501235_004878 Ga0501235_004878_903_1589 228
1738 3300049669 Ga0501235_009248 Ga0501235_009248_1167_1853 228
1739 3300049669 Ga0501235_013806 Ga0501235_013806_76_774 228
1740 3300049679 Ga0501249_016416 Ga0501249_016416_281_967 228
1741 3300049679 Ga0501249_032561 Ga0501249_032561_423_1109 228
1742 3300049686 Ga0501257_000052 Ga0501257_000052_5898_6587 228
1743 3300049687 Ga0501258_026691 Ga0501258_026691_12_698 228
1744 3300049690 Ga0501261_000127 Ga0501261_000127_7839_8525 228
1745 3300049705 Ga0501225_0000048 Ga0501225_0000048_13472_14170 228
1746 3300049705 Ga0501225_0000061 Ga0501225_0000061_12689_13471 228
1747 3300049705 Ga0501225_0000236 Ga0501225_0000236_8667_9353 228
1748 3300049705 Ga0501225_0023793 Ga0501225_0023793_125_868 228
1749 3300049742 Ga0501080_0025413 Ga0501080_0025413_4195_4905 228
1750 3300049742 Ga0501080_0177414 Ga0501080_0177414_797_1507 228
1751 3300049744 Ga0501083_0038171 Ga0501083_0038171_23_733 228
1752 3300049759 Ga0501262_010509 Ga0501262_010509_375_1061 228
1753 3300049767 Ga0501270_041363 Ga0501270_041363_71_757 228
1754 3300049770 Ga0501273_019975 Ga0501273_019975_194_880 228
1755 3300049774 Ga0501278_003561 Ga0501278_003561_239_925 228
1756 3300049775 Ga0501279_000012 Ga0501279_000012_33069_33755 228
1757 3300049776 Ga0501280_000005 Ga0501280_000005_36089_36775 228
1758 3300049776 Ga0501280_000363 Ga0501280_000363_9369_10058 228
1759 3300049777 Ga0501281_00448 Ga0501281_00448_2505_3191 228
1760 3300049778 Ga0501282_001176 Ga0501282_001176_1955_2641 228
1761 3300049779 Ga0501283_002129 Ga0501283_002129_1429_2115 228
1762 3300049822 Ga0501035_0128611 Ga0501035_0128611_628_1335 228
1763 3300049822 Ga0501035_0368634 Ga0501035_0368634_27_713 228
1764 3300049822 Ga0501035_0438833 Ga0501035_0438833_343_1053 228
1765 3300049823 Ga0501044_0000250 Ga0501044_0000250_49516_50202 228
1766 3300049823 Ga0501044_0003057 Ga0501044_0003057_4333_5043 228
1767 3300049823 Ga0501044_0003301 Ga0501044_0003301_12058_12771 228
1768 3300049823 Ga0501044_0148961 Ga0501044_0148961_799_1509 228
1769 3300049853 Ga0501226_000018 Ga0501226_000018_42992_43690 228
1770 3300050489 nmdc:mga03683_69770_c1 nmdc:mga03683_69770_c1_252_938 228
1771 3300050489 nmdc:mga03683_82244_c1 nmdc:mga03683_82244_c1_629_1339 228
1772 3300050491 nmdc:mga00v17_10860_c1 nmdc:mga00v17_10860_c1_1121_1807 228
1773 3300050493 nmdc:mga0k408_19120_c1 nmdc:mga0k408_19120_c1_513_1205 228
1774 3300050494 nmdc:mga06z11_4_c1 nmdc:mga06z11_4_c1_84664_85350 228
1775 3300050495 nmdc:mga04h51_7_c1 nmdc:mga04h51_7_c1_22644_23330 228
1776 3300050496 nmdc:mga07m45_182425_c1 nmdc:mga07m45_182425_c1_186_872 228
1777 3300050496 nmdc:mga07m45_348_c1 nmdc:mga07m45_348_c1_15653_16339 228
1778 3300050496 nmdc:mga07m45_50042_c1 nmdc:mga07m45_50042_c1_1419_2105 228
1779 3300050510 nmdc:mga06r32_2867_c1 nmdc:mga06r32_2867_c1_9265_9951 228
1780 3300050511 nmdc:mga08y16_147622_c1 nmdc:mga08y16_147622_c1_1640_2332 228
1781 3300050511 nmdc:mga08y16_24694_c1 nmdc:mga08y16_24694_c1_1017_1703 228
1782 3300050511 nmdc:mga08y16_26255_c1 nmdc:mga08y16_26255_c1_2476_3162 228
1783 3300050516 nmdc:mga0sz30_2296_c1 nmdc:mga0sz30_2296_c1_4090_4776 228
1784 3300053077 Ga0495601_0106572 Ga0495601_0106572_79_765 228
1785 3300053087 Ga0500643_000201 Ga0500643_000201_47843_48529 228
1786 3300053087 Ga0500643_000995 Ga0500643_000995_4446_5141 228
1787 3300053087 Ga0500643_001246 Ga0500643_001246_8774_9463 228
1788 3300053087 Ga0500643_001650 Ga0500643_001650_3513_4199 228
1789 3300053087 Ga0500643_004016 Ga0500643_004016_3199_3885 228
1790 3300053087 Ga0500643_004082 Ga0500643_004082_1745_2431 228
1791 3300053087 Ga0500643_006065 Ga0500643_006065_3334_4167 228
1792 3300053087 Ga0500643_006136 Ga0500643_006136_12_698 228
1793 3300053087 Ga0500643_006920 Ga0500643_006920_2677_3363 228
1794 3300053091 Ga0500647_0038833 Ga0500647_0038833_403_1089 228
1795 3300053093 Ga0500651_0002188 Ga0500651_0002188_6203_6889 228
1796 3300053096 Ga0500641_0001729 Ga0500641_0001729_2969_3676 228
1797 3300053096 Ga0500641_0017266 Ga0500641_0017266_1564_2250 228
1798 3300053104 Ga0500556_0000013 Ga0500556_0000013_208946_209632 228
1799 3300053109 Ga0500569_011420 Ga0500569_011420_257_967 228
1800 3300053116 Ga0500592_000062 Ga0500592_000062_11108_11797 228
1801 3300053116 Ga0500592_000132 Ga0500592_000132_4420_5109 228
1802 3300053116 Ga0500592_000967 Ga0500592_000967_2712_3398 228
1803 3300053116 Ga0500592_005470 Ga0500592_005470_1213_1899 228
1804 3300053118 Ga0500594_0075181 Ga0500594_0075181_146_922 228
1805 3300053119 Ga0500595_001117 Ga0500595_001117_3400_4086 228
1806 3300053119 Ga0500595_003623 Ga0500595_003623_4557_5267 228
1807 3300053119 Ga0500595_003862 Ga0500595_003862_5042_5728 228
1808 3300053119 Ga0500595_013305 Ga0500595_013305_51_761 228
1809 3300053120 Ga0500597_074084 Ga0500597_074084_50_736 228
1810 3300053122 Ga0500608_001083 Ga0500608_001083_4426_5136 228
1811 3300053123 Ga0500614_004554 Ga0500614_004554_1317_2003 228
1812 3300053123 Ga0500614_005012 Ga0500614_005012_1738_2448 228
1813 3300053125 Ga0500618_006224 Ga0500618_006224_2406_3092 228
1814 3300053125 Ga0500618_015064 Ga0500618_015064_905_1591 228
1815 3300053130 Ga0500642_0000002 Ga0500642_0000002_443698_444384 228
1816 3300053130 Ga0500642_0001441 Ga0500642_0001441_573_1259 228
1817 3300053131 Ga0500652_074493 Ga0500652_074493_631_1317 228
1818 3300053133 Ga0500655_000061 Ga0500655_000061_10096_10782 228
1819 3300053134 Ga0500658_0000191 Ga0500658_0000191_314_1000 228
1820 3300053136 Ga0500559_0000956 Ga0500559_0000956_7575_8261 228
1821 3300053136 Ga0500559_0005749 Ga0500559_0005749_3931_4641 228
1822 3300053136 Ga0500559_0013564 Ga0500559_0013564_1400_2086 228
1823 3300053136 Ga0500559_0046855 Ga0500559_0046855_849_1535 228
1824 3300053139 Ga0500568_0001218 Ga0500568_0001218_12109_12795 228
1825 3300053140 Ga0500573_0000065 Ga0500573_0000065_12766_13452 228
1826 3300053140 Ga0500573_0070211 Ga0500573_0070211_527_1213 228
1827 3300053142 Ga0500577_0086412 Ga0500577_0086412_291_977 228
1828 3300053148 Ga0500590_006067 Ga0500590_006067_750_1436 228
1829 3300053148 Ga0500590_020683 Ga0500590_020683_1885_2595 228
1830 3300053151 Ga0500604_0002001 Ga0500604_0002001_1504_2190 228
1831 3300053151 Ga0500604_0006133 Ga0500604_0006133_2450_3136 228
1832 3300053151 Ga0500604_0075798 Ga0500604_0075798_112_801 228
1833 3300053151 Ga0500604_0157384 Ga0500604_0157384_20_706 228
1834 3300053153 Ga0500616_0048284 Ga0500616_0048284_1107_1793 228
1835 3300053154 Ga0500619_005015 Ga0500619_005015_192_878 228
1836 3300053154 Ga0500619_120861 Ga0500619_120861_162_872 228
1837 3300053155 Ga0500620_064666 Ga0500620_064666_151_861 228
1838 3300053156 Ga0500622_0003437 Ga0500622_0003437_840_1526 228
1839 3300053157 Ga0500624_000004 Ga0500624_000004_27152_27838 228
1840 3300053157 Ga0500624_000068 Ga0500624_000068_45994_46680 228
1841 3300053157 Ga0500624_000087 Ga0500624_000087_3194_4027 228
1842 3300053158 Ga0500627_0000070 Ga0500627_0000070_2567_3253 228
1843 3300053158 Ga0500627_0000967 Ga0500627_0000967_5290_5979 228
1844 3300053158 Ga0500627_0001794 Ga0500627_0001794_1850_2536 228
1845 3300053177 Ga0500636_0003180 Ga0500636_0003180_5419_6105 228
1846 3300053177 Ga0500636_0015792 Ga0500636_0015792_3736_4422 228
1847 3300053177 Ga0500636_0087072 Ga0500636_0087072_403_1089 228
1848 3300053178 Ga0500637_0000241 Ga0500637_0000241_18_704 228
1849 3300053724 Ga0500570_000268 Ga0500570_000268_9358_10044 228
1850 3300053725 Ga0500576_017884 Ga0500576_017884_2229_2939 228
1851 3300053730 Ga0500645_000575 Ga0500645_000575_12600_13286 228
1852 3300053730 Ga0500645_013077 Ga0500645_013077_1413_2099 228
1853 3300054114 Ga0501084_0483141 Ga0501084_0483141_207_917 228
1854 3300055283 Ga0500661_000395 Ga0500661_000395_22_708 228
1855 3300060353 Ga0501082_0152162 Ga0501082_0152162_704_1414 228
1856 3300061719 Ga0466962_0001374 Ga0466962_0001374_1711_2397 228
1857 3300061719 Ga0466962_0024390 Ga0466962_0024390_1024_1710 228
1858 3300061719 Ga0466962_0094076 Ga0466962_0094076_21_707 228
1859 3300061719 Ga0466962_0224840 Ga0466962_0224840_61_747 228

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00300

His_Phos_1

Histidine phosphatase superfamily (branch 1)

4

219

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1bq4-assembly1.cif.gz_A saccharomyces cerevisiae phosphoglycerate mutase in complex with benzene hexacarboxylate 0.9826 2 226
5um0-assembly1.cif.gz_D crystal structure of 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase from neisseria gonorrhoeae 0.9809 1 224
3ezn-assembly1.cif.gz_A crystal structure of phosphoglyceromutase from burkholderia pseudomallei 1710b 0.9807 1 224
5vve-assembly1.cif.gz_A crystal structure of phosphoglycerate mutase from naegleria fowleri 0.9802 3 224
1yjx-assembly1.cif.gz_A crystal structure of human b type phosphoglycerate mutase 0.9765 3 224
ID Description Score Start End Superfamily
af_P36623_9_210_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.9869 4 225 3.40.50.1240
af_P36623_9_210_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.9724 4 225 3.40.50.1240
1riiA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.9682 3 228 3.40.50.1240
1riiA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.9558 3 228 3.40.50.1240
af_Q8T8W6_17_267_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.9534 3 224 3.40.50.1240
ID Description Score Start End GO Terms
AF-A0A496KN39-F1-model_v4 deleted 1.002 7 91
AF-A0A7R9WT59-F1-model_v4 phosphoglycerate mutase (2,3-diphosphoglycerate-dependent) (EC 5.4.2.11) 0.9991 7 95 GO:0006096
GO:0016868
AF-A0A379FUA8-F1-model_v4 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase (EC 5.4.2.11) 0.9991 7 83 GO:0006094
GO:0006096
GO:0046538
AF-A0A519PBT1-F1-model_v4 deleted 0.999 7 122
AF-A0A4V1TKA2-F1-model_v4 deleted 0.9987 7 83

Feature Viewer

pLDDT pTM Quality
95.45 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map